3JTTA

Cystal structure of rhesus macaque mhc class i:mamu-a*02
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTSMSRPGRWEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWVEQEGPEYWDRETRNMKAETQNAPVNLRNLRGYYNQSEAGSHTIQRMYGCDLGPDGRLLRGYHQSAYDGKDYIALNEDLRSWTAADMAAQNTQRKWEAAGEAEQHRTYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDQEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCHVQHEGLREPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I Mamu-A*02
publication title Crystal structure of Rhesus macaque MHC class I:Mamu-A*02
rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 68
structure length 276
sequence length 276
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jttA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3jttA01
2P48B 3ARBC 2ADGA 5HVHC 3EDEA 3GI9H 4NRYA 2YXMA 3OJVC 1DJSA 1YA5A 4JZNB 1Q9OB 1U58B 4XNXH 3SHSA 5B4MD 4MS8C 4QRSA 4NJ9L 4X5WA 5CUSL 4XVJL 3D1MC 3MO1A 3FQWB 3MFGB 4Q9BA 4POYA 2KQMA 1AR1D 2DQFA 2G75A 1Q94B 3UJJH 3B9KA 1Q0XH 2BXYA 5C0CE 3ARGA 4CJ0A 3O3EA 5C2UB 2FLBT 1IC7H 4MJIE 1MFDH 5GS0C 4PJ5E 3PHQB 1QPPA 4NQSA 4HS3A 3SN6N 2W9EH 3RVUD 1PG7X 1KJ2H 2DIJA 3I6GA 4P23D 3RL2B 4PJGF 1KT2B 1HSAB 3FO2B 1NC4A 1JNNL 5HHPA 1XF3A 3L3KB 3PQYB 4MX7B 2Z31D 2E27L 4EN3B 4P2QD 5I1CH 4JM2A 3S4SG 1BIIB 4XCYB 1KFAL 3JV4A 3P9WB 5D2LE 3RNKA 1R3KB 4LSQH 3L3IA 3MJ8A 5CMAA 3T0WA 3DYPA 1XGTA 3W0WA 5SWSB 1MCKA 2WIIA 3RTQA 2VLME 2BNQB 2YC1A 1F4WL 2ZCHH 5EU4B 1RZ8A 4M4PA 4NYLB 4O9HL 1FJ1A 2WBJB 4UOJA 3E6HB 3DVNA 3MXWH 3VD4A 1A7NH 3S9DB 3QFJA 3U0WL 4RGOL 1WZ1H 3PWVA 3V6ZA 2C1PA 3EHBC 4YDLB 3CSPA 3TV3L 4KHTL 2B0SL 4RMRA 4ZUVA 4GKNA 1TJIL 3IDNA 1MJ8H 2NY2D 2WZPD 4N8VG 1H8SA 1DBML 3HNTL 1OP3H 4RMTA 2W91A 3UTSD 1MUJB 4NZDA 4PRPA 3SDDC 1UGNA 3VXRA 4Z7WB 3W5MA 3PP4H 5ESQB 1MFEL 3LKOB 5MENB 2YD9A 4P2OB 2DWEB 3O8XC 2ZSVB 4C4KO 5E1AB 1S5HB 3RWGB 2I9TB 1MCPH 4YEEA 5ELIA 2GHWB 3MLXL 1E4JA 4S1DD 4P46A 4LMQI 3JUZA 2CRIA 2VXTH 2EDWA 5I76B 1DLFL 1RU9L 3HC0A 4XC1L 3EDKA 4UV4H 4LHUB 2XWBB 4M5YL 2J5LC 5ADOH 3D3VE 4IM8A 1AQKL 5HVGB 3K0WA 1EX0A 5EC1B 4A6YL 4NFCA 3GHEH 4H8WL 1IC4L 1U8OB 4YHNB 5L6YL 1INDH 4GBXA 3T77B 1KIPA 1A7RL 4HLZH 3TNNB 3U4EB 5BZDB 5T3ZD 3B5TA 1I9IL 4JFOB 5EU3B 2APXA 4GJTB 4NHCH 1VA9A 4CJ1A 3D25A 4X8XA 2F58H 2BNRA 3HZVA 2GCYB 5D2NA 4Z8FL 4NN7C 3AAZA 4LCWE 2CIIA 5T3ZL 2ZZUT 2AJZB 2RQ8A 1JZ2A 2IANE 1K85A 5EUKB 5I74C 4PRHE 5C0BA 3BKJL 43CAA 5CCKL 3BWAA 2BVPA 2GFBB 5GIRB 3AXLB 5TE6L 5AWNH 1TCMA 1QSFA 3VXPA 4RWHA 2FATH 2YD4A 4PJFF 1FFRA 3WJJC 3B9KD 4DVBA 3HPJB 1IAIM 5DMIL 1VFUA 3ARGD 1QEWB 2LAAA 1PZ5B 4EJ1C 4PY8I 2X09A 5D1QA 3FB5A 3G6JB 1KB5H 3QUZB 3MSPA 2M1KA 3WNOA 4Z78B 4NFDA 5GSRB 4YR6B 2D0HA 4QY8A 4ZNCD 1NC4D 3LPGA 3LHPH 4RBPK 8FABB 4GMSH 2Y36H 4JVPA 4LVNB 3GMLA 3SE9L 4V1DA 4MA8H 4JM2D 3V8CA 3GO1H 1NC2B 1FFOA 5L7XL 4JR9L 4R4FL 5DVOA 3NIFE 3PWPB 5HHOA 4G6JH 2IQ9L 2YWZA 3GSWA 3W0WD 3RTQD 3W81A 2OI9C 5HYEA 5C1MB 5IEKB 3IJYB 1RUQL 3FFDB 5ADPH 4HWZA 1J1PH 1WFTA 3UTPE 3IAPA 4X6EA 3LRHA 3QFJD 1S9YA 2GSGB 3G08B 4XB8A 1A6ZB 3D2UD 5IW1A 3DIFB 1OLZA 1T7YA 1JPFA 2QTEA 4WFFD 3IJSA 5DJZB 5BZWB 5JTWA 4JDZB 1CG9B 5B39G 5HJ3A 4ODHH 3QUXC 1IEBA 4PJBF 4N68A 1BJ8A 1U6AL 1JUFA 4PRPD 1YN6B 3TYGL 3BKMH 2AGJH 5TQ0L 1BFSA 4L4VA 4U7KA 3KPNA 1KEGH 1E27A 5IHUH 5L0QC 1PDKA 4WNQB 5GRVK 4PJ8A 5EB9A 4K9EL 3R8QA 3L9RA 4WUKL 4UT9H 1MJJB 4LVOC 5IB4A 1SHMA 2JIXB 1DP0A 2RFXA 4U0RC 5MI0C 4OI8A 5I17B 2X2YA 1AHWA 5FM5O 5I1LA 1J0IA 5E4EB 3P73B 2DQCH 2VIRB 3S37L 1T1YA 3BH9B 3HE7C 4GBXD 4Z0XB 4NRXA 4M8QB 3GBNL 1RZJH 5EIVA 3MBEA 3DUHA 5ACMA 3RY6C 5LJYH 4Y88A 4KTDL 2AXJA 4KC3B 4R26L 4KI1A 3UP1A 5I1GH 4NN6C 2PXYB 1IGTB 1GL4B 3QIWB 4M6ML 4MNHB 4NFBA 5DD0H 5IVZA 1RVFL 1SVCP 1Z5LA 3BPNB 3VFPB 4BH8A 4NNPL 1QSFD 4IOFD 5E99H 2YK1H 1MEXH 1XCTB 5CEXB 1XGPB 5KANI 3KPLB 4DOHE 4HKZA 1UWXK 2WUBL 1A02N 4PLOB 5INCB 1CT8A 5HGHB 1WICA 4KJPC 3WDIA 2P46B 1FO0A 4WFGD 1PX3A 5FA3B 5D1QD 1JYNA 2J12B 2PN5A 4WI4A 5C86A 4PJEA 1WLHA 1LO2L 2RCSL 3PWLA 3VXUB 2NY6C 1WC7B 1P2CA 4POZC 4HV8A 1BQHA 3RWHA 4OJFL 2JB6B 3DUSA 4V1DD 4FQXC 5DJYB 2VDOH 3QEHA 4D0CB 2P44B 1B6UA 3LEXB 5C70A 3Q0HA 1NCBH 1SEBA 1QYGH 5HHOD 1FVDB 1TQBB 1G7LA 3CDGA 4JFYA 1WTGT 5SX4H 4FFYL 4MJ5A 2HTLC 2ZCKL 3H0TB 1JK8A 3O4LA 1JMXA 5D5MF 5IQ7L 3BW9A 4UB0L 3FB8A 3QIUA 1TITA 5E2WH 2DTMH 4LVHC 4WTXA 2V7HB 3RX8A 4OF3A 4YE4L 3QBTB 2V5RA 3B8YA 1DQML 4IRJC 2ENYA 3QDMB 1YN7A 1A7QL 1NFDF 4K3DH 1PFCA 4NZRH 4OD1L 2AAVA 2DLGA 4G3YL 3KPMA 5HD8D 3MQIA 3VI3E 5FIEA 2MPAL 4M43L 3RWCA 5FKPB 2VDPL 4U1HA 1HYSD 1O0VA 4YDJA 1AGCB 1HILA 3MOAH 4Y8AA 4BFBD 4PJ8D 5HYQB 4LCYB 4YQXH 1OB1A 4FZ8L 4Z7OF 5I73C 3BGAA 3R06B 4AQOA 1I85C 1UT9A 1IM3A 4QXGH 3NCCB 2XTJD 4JCLA 3DYMA 4YC2C 4CN4A 5JDSB 2W65B 4LGSB 1UKQA 3UXFA 1MVUB 1LP9E 1MLCA 3U30C 2AEQH 1J1OL 4L4TE 4C56A 4NKMA 2HFFB 2VL5A 5T1KA 3HS0A 3CFEA 4XCNA 2A77L 1EJOL 3MBED 4YHOH 2I07A 1YPZE 5EOTB 2HT2D 2XN9B 1S7VB 5FUZL 3ARSA 3VFUA 1UYWL 5EU6B 1F3JB 4WEBH 2EE9A 5IHBA 1V7NH 3RWIB 2VN7A 2ITDA 1ZGLM 3GUTA 1A2YB 5L9DH 2ESVE 5HGAB 3FAXA 4C4KT 4IMKC 2EKSB 4AK1A 5ICZA 1YECL 1CDGA 1AP2A 5DRZB 3HHRB 4MMXC 3D18B 4DTGL 4M7JH 1OTUC 5JOFB 1OWRM 1F58L 5DFWH 4L9LA 3SE4C 5DRXB 4DW2H 1KV3A 1IZKA 4J1UA 4LOUD 3EW3B 1RSFA 2YR3A 3SDCC 3RVTD 2G5BB 3QUYC 4MJ2A 3OAZK 5EC2B 5EIQA 1FO0L 1V7ML 5E9DB 2Z8VC 3WXWH 5D72L 1I8KA 1MNUL 4Y1AB 4IMLB 2VJXA 3QDHA 3V4VL 1DTUA 1MF2L 1WZMA 5KVEH 3GSVA 3AU1B 3IB4A 5BV7C 5DC0A 1ZHNB 1JFQL 4XRCA 4PGEB 3TH4T 5IF0A 5FGSA 2XNAB 2WQRA 1UZ8A 2EE6A 2GK0A 5GSVB 1GRWA 4JKMA 1AY1L 3O4LD 1MCHA 3C5JB 3KJ4C 1AQDB 5E2TL 1RK0B 1FIGL 2Y6SD 1ZLSL 5FV1L 3QQ9C 3P11L 3QIUD 5K33A 3BUYB 4AEHL 1IGJA 3U36A 5HHME 5EZIL 3GK8H 2GJ6E 4ORGA 1EFXB 5KVFH 1JNLH 5EOQH 4RFNC 2J6EH 3TPUB 1FNAA 3TH3T 3B5GA 5IB1A 3REWA 5IVXF 2DMCA 4ONHA 3BXNA 1YEFH 3C5ZC 4ALAH 4OT1L 2X4QA 3OKMA 2XV6B 4YXHH 5IESH 3WV0A 1RZKL 4KI5F 5ID1B 5ALBH 5I1EH 1YUHA 5LCVL 4L29A 1I1AB 5GGRA 1I9JH 4PJIF 3NPSB 2X41A 3MLRH 3MV8E 3RVXC 1KJ3L 4OF5A 1X9QA 3WUWA 4GW1B 3W2DL 5K9QI 1IM9B 5C0GB 1CLZL 3U0PA 1MCLA 1U8HA 3P3YA 1L0XA 4L1HA 3ROOA 4OF8A 2VLLA 4H26B 2E9IA 5KSUB 4LVEA 4QGYA 4EIGB 5T1KD 4JO2L 4IBLT 3JV6B 4EQ3A 5IEHA 4GW5B 2VISB 2YSSA 2Z4QA 3ILPB 1L7IH 2XQYK 3Q6FB 1IKFH 4HIHA 2DBLL 3CFJA 1T1XA 1P7KA 3MRKA 4KROB 4YK4B 4PJHB 4XMPH 2H32B 2NPLX 3GFUA 5JMOC 4KV5E 2IEPA 4AT6A 1JRHL 1JF6A 4E42B 4KJQD 3MRIA 1RV6X 2AJUH 5EFIA 3HAEH 3PV7A 5F96H 1CDJA 1FE8H 1UB6A 3P0VL 1CE6A 5B3NA 3UAJD 5DQDL 2OTWB 4KK8D 4KMTL 3WEXB 1IAOA 4GW4B 1G6VK 4XPFL 3BVNA 3MXVL 3QQ3B 1MHHA 4PLKC 1T83A 5E5RB 4NO2A 4M1GH 4I0PC 3SGKA 2VXVH 2BK8A 3SDXA 4M62L 2AJSH 4JRYE 5EU5A 2FYYB 5D7JB 1G1CA 3HCVB 4PRIB 4HCRH 5C0CA 1JHKL 1OD7A 1A4KB 5DWUL 2PYEE 3MJ9H 2VLKB 5FKAA 4K8RH 4MJIA 4B41A 2W1NA 2FX8L 4PJ5A 2EXYC 1LDPL 1FZOA 1L4IA 2E5EA 4N0YH 4OLVL 2YRPA 1GGBH 1KJ2A 3TZVC 2Q20A 1HDMA 3QT2A 4NP4L 3O3AA 2DQHL 4IOIA 4EDWH 3CFDB 1CVSC 1UB5A 3MJ7A 4X6FA 4QHKI 3HUJE 3MFFB 2IBGA 4O4YL 5FYKH 3ES6A 4XVTL 3LKRA 6FABL 4X80L 1OAZL 3L3JB 1E4KC 2X4RB 3HZYA 5LAXB 4HT1L 4XPTL 3ZTJG 2HFTA 4ONFL 4KJYB 3C6LB 5DJ6B 1MFNA 4HBCH 4TVPH 2PO6D 4HLJA 3NH7L 5LWYL 5FCUL 5BVPH 4JPIA 5EO9B 4MA7H 5LXGH 2ZUXA 1HN1A 5DMKA 2NY3C 3EYOA 1YMME 2R2HA 4KRPB 3BQUA 5BOZG 1CDHA 3ECBA 5IVOA 1A47A 4PG2A 3RZCC 3BP5A 2FCBA 5EZLB 4KMLB 4ZFGL 3UBXI 1BGXH 4U6HB 2X4NB 3UBXA 3OJMB 4O02L 4BSVB 2RB8A 1GYAA 2DJUA 5GZOD 2DQGH 3OHXA 1R5VB 4HX1A 5ESVB 5T5FL 4CVZA 1WT5A 4UNVA 3UMTA 4S0TD 1KCUL 1HH9B 1DANT 4NBXB 3U0TB 5FF6B 4G8EA 3LCYA 1EIBA 1NEUA 3N85L 2CK2A 2RHEA 5J11B 3IAGC 5FHAH 2WP3O 3IDMA 2DQDH 1ZANH 3O11B 4BQ6A 3LEVL 1MFBL 4X6BA 1ADQH 3C5SB 4F7PA 3RUGF 2VITA 3B6SB 2CIKA 4NNXB 1DLHB 3MUJA 2M26A 1VKXA 1N5AA 3VMNA 3L5XH 5I16B 4DN4L 5E2UL 3MRJA 3GMNA 3MRQA 1KLGB 1AO7D 2DJ4A 3VRJB 1TJHH 1B6DA 3S4SB 3ETBF 3ROLB 3S88L 2APVA 4G8IA 3BN3B 3OKOA 5AZ2H 3QI9C 4JZJA 4LCWA 3QHFL 5JHLH 2IANA 2B2XH 5H35A 3FO1B 4HHAB 4PRHA 1JCKA 2D7QA 4MNQB 1G7PB 5EO1B 4J3TA 3QYCA 4F37K 4Z7UF 5C3TA 3WJLC 43C9B 3GI9L 1U8MA 1A6PA 4Z0BH 5C07B 5C0CD 1PBYA 3O2WH 3DGCR 2JTDA 2YEZA 4MJID 4PJ5D 3ULUF 1S7UB 3T0EC 3P0YH 2X9YA 3BD4A 5H8DA 2E7LC 4WUUA 2BMKB 3MODL 1IC7L 1MFDL 1O7VA 4CMHB 5DJAA 2IALA 2W9EL 4YHPA 1C08B 1XMWA 2Y1VA 3MRDB 1KJ2L 5CZXD 1R0AH 1U91B 5MP6H 1JF1A 4L1DA 4LGRB 2DAVA 4BUGA 4WWKB 1NCAH 1BOYA 2VLMD 4PRNB 4XP1H 5DXWA 5L88H 4EKXA 1B0WA 3GSQB 2IAMB 1CFNB 2ED9A 3CMOL 2VL4A 3K1DA 4XMKH 1AXSA 4LSQL 1FL5A 4R7NA 1RD6A 5DYOB 4N8VA 1I75A 2ADJB 5GRJL 3D9AH 1EEYB 4OI9A 3LN4B 1S7WA 4XBGA 1S8DB 4LP5A 1KCRH 4M7KL 4OIAA 1FBIH 4HUXA 1WZ1L 2HT3C 4KH2A 4Y89A 3SQBA 1UACH 1N6UA 3EYVB 5D1ZA 2NY1C 1C5DA 1OAXH 1P7QB 4Z7VF 1MJ8L 2Z92A 1WEJH 1F90H 5DJCA 2OZ4H 1AKJB 2VQ1A 3QISA 1ZS8A 4WWID 5DD3H 3VW3L 5EORH 2XPGA 4PBWD 4ODWB 3VGAB 4FHBD 4W4OC 3MNZA 4F15B 1MCPL 3D3VD 4ZODA 1H0DB 4JHWH 4DK3A 1RUKH 2GSIB 2VXTL 2HKFH 3U82B 5IOPA 3OAYH 4H5SB 4Q9CA 4LIQE 1F8TH 4UV4L 5JIHA 1BAFL 3PGCA 1SMAA 5AYQA 2WBWB 1G7MA 1FN4A 1ZVSB 1HHGA 4WW2F 1A1OB 2D4DA 1A6AA 2OR9H 4MXVF 3BZFA 4LCWD 4P3DA 1INDL 4TSBH 2IAND 2A2QT 4PJCB 4PRHD 3GSXA 4GKZA 1DN0A 1NGYA 2X42A 4NHCL 1NGZA 2A6IA 3WN5B 4PJDE 3U7YL 4XZUA 4Z5RB 2EDLA 3V6BR 5DDHB 2P24A 1J0YA 1GOFA 5BXFA 3GKZA 5E6IB 2XA8H 1ZK9A 2H3NB 3WFDH 3MRGA 5JZ7C 3DO7A 1VB9A 5D9SA 3C2SA 3VGFA 3L7EB 4U3CA 5EA0H 2VDNL 3GRWH 5KSBE 2FATL 4Y4KC 1C5CH 1A1NA 1HI6A 5DVLA 2ZKHH 1D6VL 1P5UA 4GRLA 3V2AR 4J8RB 5IGXL 3FRUB 1SJXA 4BZYA 5IJKA 3KPPA 1U8LA 3OB0K 4QEGA 1A6WH 1IT9H 4QHLA 1WFNA 2B1AH 5C09E 4OZIE 4GMSL 3FZUD 2ADFH 2C4XA 2Y36L 3HRZA 5SX4I 4MA8L 3ZE2F 3GO1L 3FT2A 4PJAB 1QO3A 1IFHL 4D0DB 4F9LA 4OGXH 4CMMA 3WO4C 3E2HC 2BOCB 2DM2A 5AAMA 1T5XA 3HZKB 3UTPD 2VDMH 1CL7H 3AROA 5IROA 1MOEA 5ERWA 2CR3A 4MNGE 5A2FA 4NQVA 3GJFH 1BWWA 2VSDA 1G1YA 1KELL 1TTGA 2F53B 3IYLW 5CLWA 4X7SH 4BZ1H 4P57B 4WHYH 2QADB 1J1PL 4U4BA 3AUVA 2G5RA 5L2JA 3MA9H 5AZEH 4M5ZL 2NY2C 5ENWB 4YNYB 4KDVA 2HN7B 5F9OL 2P47B 1RJZB 5D1ZD 1FFQA 3BO8A 4JRXA 3UTZA 4PLNC 4NRZA 5JW5A 5DC4B 4MAUH 2HJLB 2Y5EA 4ODHL 4OLWH 4XNUL 1JWMB 3MBXL 3RIAK 3BKML 3UZEA 2A9NH 3P77B 2X4TB 3IGAA 3KR3L 4MDIA 1OY3B 4C54A 1ZGLB 1QHPA 4M7LH 1KEGL 2WUCH 1FAIH 5LGHH 5FEBA 1QSEB 1YYMH 1LEKA 3TT1H 1FZKA 1MH5A 2EC9U 1GC1H 4HMCA 5CLTA 3WNKA 1KGCE 4UT9L 2J8UE 4HSQA 4L3EA 1T20B 4A2MA 4P2YA 4XCEA 1LEGB 2Y07H 5F3HA 5I1AA 4OUUB 2H2SD 4S1SH 3WIFA 1PKOA 1MRCH 2FBJH 3ALXA 4P4RB 5FUCC 1WZKA 1YPZA 1A6TB 4RX4A 2PCPA 1EAPA 5GGVL 3SE3C 3BZEA 1OAUH 3F5WB 2EYRA 5B3JF 5DEGA 4HIIA 1P7QD 1UJ3B 5BCAA 2NYYD 2XY1A 5ETUA 1RZJL 3WDJA 4ZUTB 4Q2ZA 4ZDHA 2XA3A 3MA7A 1UXWB 1Q38A 3RWJA 2ESVA 4XNQB 1LE5A 4PTUA 4M48H 5DUBA 4G43A 3EO1B 4Q6IA 4R90H 3TIEB 4AEEA 2WP3T 3CXDH 1NSNL 2O61A 5E8DH 4MZ2A 5DD0L 1WCBA 3OX8B 5HHMB 2VABB 2GJ6B 5HSFA 4YBHA 5E99L 2J8HA 5JORA 3OGOE 2YK1L 3E6FB 1MEXL 4FQJH 5IW3A 3FMGL 3DWTA 5H2BA 1VDGA 3IKCA 4GRLD 1LQSR 4KAQH 4J3XA 4I18A 5CJOL 1PW3A 2CLVA 5F1NB 1HHIB 2Z8SA 4D9LH 1OPGH 4E41E 3AREB 4KHXH 5KS9A 4OZGF 1I1YB 4B50A 4OCNC 4KU1A 4OM1H 4F3FA 3V5DB 2C7UB 2VDOL 4V3DB 4RAUA 1S7RA 4DAGH 1J86A 1FZJB 1LVEA 1NCBL 3KLAB 3R0MA 4MWFA 3SJVB 5BS0A 1A7BA 1H3TA 1CXIA 1MCIA 3OBAA 4CNIB 1ZTXH 1J5OH 4G6FB 4R2GB 4TUOA 4IDJH 2O93L 4P5MA 4XNMA 5E2WL 4NKOA 2H32H 1MCWW 1D5ZB 4ETQA 2I5YL 4QGTA 3JTCA 1AXTH 2ILLA 2QSVA 3PNWB 1FYTB 3MNVA 1MIEL 4EN3C 1J88A 5KJRH 4XH2A 3B8SA 3SDAB 1AJ7H 4BQ8A 1TXKA 2HJFA 1N8ZA 4JG1L 4PJFE 4LFHG 5HPMB 5ICXA 3PUCA 5T1MB 1F97A 3IFLH 5J6HA 1RIUH 4X7CC 4YQXL 2WBJC 3RDTA 2Y72A 3FQUA 2XZCL 3GMPA 4LKXA 3LKNB 1ND0B 4PJ9A 4L3ED 3ARXA 3FQXB 5CIPB 1KJMB 2ZSWA 5K9KB 4L4TD 5CEYA 4LCIH 5GRWA 3ZDZE 3EKCA 3OKDA 4RX4D 4LSUH 4N0UE 4U33A 2UWEF 3CXHK 1BOGA 3VXNB 1E28B 4J23A 2AEQL 1F6AB 1ZLVH 5I8EA 1AE6H 5CGYC 3FFCB 4P2OC 3BEVA 4YHOL 1T22B 1SJVA 5JLZB 1OD9A 2ESVD 4NC2B 4RRPG 5DJXA 4JREC 2F5BH 5KVDL 4OSUH 1BX2A 3HAEA 3JWOH 4U1JA 1LO0H 3KGRA 3WD5H 3LQZB 4NZJA 1YMHB 3CSYB 4EDXA 4ZXBB 5EOCH 3BZ4B 1SJEB 5A40E 2FSEA 4G59A 2BNQA 3TO4A 4I8DA 1A7PL 2BX5A 3NCFB 4OCWL 5EU4A 1CTNA 1LO4H 4HUMB 5DD5H 1TZHB 4M7JL 3GB7B 5J3HD 3UCRA 3DX9A 3F58L 1NFIB 5CZKA 1HH6A 2R4SL 1MJ7H 1TQCC 1Y6MR 1I7ZA 3UYRL 3UTTB 2PYEA 4HQQH 4KK5C 3WXWL 5GRUH 4UIMB 4Y19E 3MJ9A 2B5IB 1S5IH 3FOMB 5DRWA 1NUNB 3OXRB 2YPKA 2NTFB 1X6LA 4X4ZA 3VWJB 1UZ6E 5A2JH 1DEEB 1NBYB 4GAGH 2ZOLA 4PP1D 4ZUSB 1GPOH 4P5TA 4HF5H 2EZ0D 2GJ6D 4PD4J 1NAMB 3RWGA 5IJVA 4HKBB 3H9ZA 1U92B 1F2XK 3HUJA 4JO3H 4UU9A 3DRTB 1BPVA 3RWEA 4NN5B 4WGWB 4B5EA 4JM2F 1DQTA 2V9RA 1N64L 3EOYG 3VFTB 3QUZC 4P4KB 2CPCA 5KVFL 1JNLL 3BFOA 3BT2H 4F2MA 1BZQK 5HD8C 2Z35B 4ZOEA 4LVNC 4Y4FA 1EBAA 3ARED 1YEFL 4PB9H 1CXLA 1GGCH 4QRTA 2R1WB 5J6GA 1NFKA 1YMMA 1MHEB 1OM3L 3MV8D 4OZFB 5FYJU 3DRQA 1I9RH 3KYOB 2NZ9C 5ALBL 3EYUH 4HWEH 2GQHA 4PGZA 2AJZA 2E8ZA 3MMEA 4U1KA 4NNYB 4LEXL 4ELMA 3RDTD 2CLZB 5J9PA 3CLEL 3MLRL 2VZSA 2X7LB 3EFFA 3IU4L 4PJ7B 3NFPB 4DKEH 3AXLA 5DMGD 1RY7B 4MD0B 5HHXH 4MJ6A 3FT4A 5IB2A 2BVTA 3BDYL 3MGOB 3OKYA 2D7TH 3ARDA 4FS0A 3BP7B 5DA4A 1ZHKB 2CR6A 3BHBA 1MREH 4IEFB 3MRNA 1MCOH 2DLEA 2JJTC 1ZOXA 4AIOA 3LRGA 1BREA 3STZA 5FB8B 2OK0H 4GRWE 2MOVA 4YDVA 4Z78A 3L5JA 3SKUD 3ZKQD 2VUOA 5BRZE 2R4RH 3F7VA 5IWLC 4D3CH 2BVYA 4ZPVA 5EIIA 2RBLA 1AC6A 3JV5A 4JJ5B 4L8CB 3TBWA 2Q86B 3WKML 4QXUH 3VH8G 1B2WL 1FC2D 5KG9A 1J10A 3NVQA 1NFDE 1MFAH 5F96L 1FE8L 3B9DA 3MUGB 3TO4D 2H41A 4LOUC 4RBPH 2Z91B 2R15A 5SWZE 4ODXA 1S9VA 5I18L 1XGYL 4JRYD 4HW6A 4HIJA 1AGBA 4K55A 4O5LL 5FYJE 5DHVB 3O81A 3AM8C 1YEJH 1ETZA 2PUQT 2PYED 4Y2DA 4H0HB 5IHLB 4Z7OE 3QIWC 2VXVL 5HHQB 4P99A 3VXTB 3NCEB 2AJSL 5GGTH 1YN6A 3BPNC 1CZ8H 5I30H 3MROB 2FHBA 4HCRL 3DECA 1T4KA 3DURB 3QCVH 3MJ9L 2AXGA 3VG9B 4K8RL 5C0IA 1HXMB 5MERB 4P5TD 2MHAB 3L3GB 1IQWL 3FN0H 1H8NA 2Q76A 3G9VA 5FO8B 2BSSA 4K7FB 5IFAH 4UDTA 2JIXA 5IFJA 1FL6B 3QIBA 3S37X 1EO8L 1CYGA 5F7UA 2YA2A 3FB7B 1I7TB 1KXTB 5DJ8A 4EDWL 5D6CA 4Q74A 3GSRA 3Q6GH 1MIMH 3FL7A 3ARPA 1Z0NA 5T3XE 4WU7B 1CCZA 3X13A 1JPGB 4Y4FD 1BJ1J 4UT7H 5FYKL 5B22A 3O41B 5IT2L 4F7EB 4OI7A 4KY1H 3VFOB 2IFGA 3T8XB 1YMMD 3MLYH 5DEFA 1T04B 1ZSDA 1TQBC 4HBCL 2VLJB 5EBLB 3DV6A 1JWUA 1QBLL 1U42A 4MA7L 1JTPA 2BY3A 2PXYA 1PSKH 2HFEA 4GXVH 5EPMB 1CGXA 1MY5A 1TNNA 1JFMA 4U2ZA 1I3GH 3OWEA 4ZAKA 3C60A 3BSZH 3EO0A 1BGXL 2AJ3A 1ZT7A 1R6VA 3UZVB 5F7DB 2DQGL 3ARDD 2OZ4A 3TBTB 4ONGL 1NGXB 4G8GB 2C26A 3NAAH 3BYTA 4PBXA 3RIFF 1FLRH 4NO0A 3MRCB 2I9LB 2JJUA 2H9GA 5H37H 1ZT4B 4YDKH 4YAQB 2APBA 3ULSA 2DQDL 1ZANL 1QLRB 5CP7A 4HGWA 3MUHL 3ZKMD 5KSBB 4XBEH 4YHZL 1UWXH 5IV2B 1Y0LB 5CFHA 1GGIL 3B2VH 4QRPE 5E7FA 2HH0H 4H1LG 4D0CA 5AD0A 3H7BB 3ZT6A 1FNEA 2BVQA 3UAJC 1R3IL 5IVXE 4PYHA 4L3CA 4QNPF 3WLBA 4L8SB 3NMEA 2BFVH 2Q7YA 2YA1A 3DETD 3N50A 4OKVB 4PJDA 4OZHB 2XFXB 3MRMB 4HH9A 1C16B 1I1RA 3QXWA 4Z95H 1TETL 3RX5A 1VEOA 4H0GA 3G5VB 3D87B 4NQDE 1HQRB 1I7UB 4Y2DD 4G6AC 2FO4A 1U8PA 5F1KC 1JP5A 3QEUB 4WJ5B 4MNGB 5EO0B 4U1SB 3QCTH 2VZ1A 3QXDA 4JFEE 4DGYH 4HFUL 3EZJB 1G7JB 3GRWA 5GGUA 2P5WE 4FMKA 2JCCE 3O2WL 4U6XA 1CFTA 2J8OA 4QHUB 3T2OA 2X1XR 5A2IH 4Q9QH 4PJEF 1I1FA 5HYQA 4HUWB 3I9GH 2BHUA 4E5XB 1RUAL 3UO1H 1J1XL 2FWOA 3B9EA 1NGPH 1S78C 2BSTA 3FONA 3PGFH 3QIBD 2IFFH 4NJAL 5BW7C 2ZJSL 3O6MH 4JFZL 5C09A 3ILQC 3V6OC 4OZIA 1GC1C 3MRHA 4DKFH 4I5BB 5ITBL 3GSOB 4X8JB 4OQ1A 1E6OH 1R0AL 3CFBA 3W9EB 4WRLA 5MP6L 3AS2A 2PO6C 4G80A 3Q1SH 1CL7I 1NCAL 4ZPTB 1W0YT 3U46A 1M05A 2IADA 4GKOA 2OBGA 4XP1L 3GJFA 5DO2D 4FQQB 3DVFA 1S7VA 5FUOH 1VESA 1GZPA 2KQNA 4YBLB 3WO3B 1J05B 4PJGB 1I3VA 5CAYB 1K3IA 4OAWA 4XMKL 4MAYB 2VB5A 2R69H 5D6DC 3RWIA 4LSSL 1K8DB 3K4ZA 4X4YB 4WV1B 1JN6B 1HOCA 4XXCC 4ZAKD 3C60D 2V2WA 1KCRL 2NNAA 4N90E 4EUPG 2EDBA 1V5JA 1FBIL 1OWWA 2E7BA 5E8OA 5DVNA 3WHXA 3U7WL 2HFGL 3RNQB 4BQ9A 4I0KA 2HVKA 2N1KA 2X4PA 2W0LA 1Q9KA 1G7HB 3H9HB 3T4AB 1L7TH 1XF2A 4PY8J 5JOFA 3T1FA 3LDBB 3EOAB 1OAXL 4NO0D 2FRGP 3L6FA 3U9PH 2OZ4L 4RGNE 2ITCB 3KS0J 1JE6A 1VENA 5KSAB 5DD3L 1I1AC 2YBRB 5EORL 3E0GA 5EC2A 2J8UA 1UM5H 1Z3GH 4Y4HA 2PTTB 1ULVA 1CGYA 4JFFB 3IXTB 3ULVH 3K4DA 1P1ZA 3WFEH 1TCRB 4JHWL 1RUKL 1HHKB 1ZHNA 4OTXL 1EEQA 2HKFL 4J3SA 2ENSA 2R23B 2OJEA 3STBA 4DGIH 3IVKB 2GAZB 5C0EB 1J87A 3OAZH 4DN3H 2HP4A 5GS2D 2OR9L 4OBRA 5BQ7A 4IHOB 1NAKL 2NXZB 3F7RA 1II4E 4I9WE 4U1IA 2YD7A 4LRNL 1FCGA 5F88B 5EBGA 3DGGA 2DKMA 5GISL 1KPRB 4YK4C 1NEZB 1A7OH 2VKWA 1DE4B 1VGEL 5GJSH 3MLPA 1C12B 1F00I 3TGXA 4NCC1 5IKCB 5DFTA 3GNMH 3TFKA 4XTRC 5ID1A 3DSFH 2DYPA 1EERB 2MKWA 1YY8B 1KC5L 4IDLA 5DQJA 3GRWL 1BZ9B 2VN4A 3SQOH 2PYFA 4QT5B 1C5CL 4F8TA 4E41A 5DT1H 2FL5B 1ONQA 1SJHB 1Z9LA 1D9KB 5CZXC 2ZKHL 4YHIA 2ZPKH 3MYJB 2AXFB 3X14B 5CBAB 1CD1A 5C09D 3I50H 1AD9B 1KCKA 4OCSL 5C0AB 1A5FL 1R3LA 4ZS6D 4XBPA 4PJFB 4EI5B 1CQYA 3RUGE 4H26A 1VFOA 4Y5VA 1IT9L 5CIPH 5D7JC 1RZIA 1FNGA 25C8H 4PY7B 2AJXH 2XKNA 2ADFL 3H9SB 3GZKA 4NC1C 2O5YH 2VOTA 3TVMD 1CXEA 3O9WA 5DI8B 3VXQA 4MB5A 4QRUB 2VDML 1UQSB 1CL7L 3NA9H 2WW8A 2E7MA 3LMJH 3SKOA 1G7QA 2NR6C 2BC4A 1A4JA 5A3IC 1OCWH 4PLJC 3GMRB 4UINH 1CS6A 3G6DL 3QEQE 3S7GA 3QNYA 3JWOC 5AZEL 1NPUA 4ZS7H 5D70H 3OKKB 2R2BA 3D69B 4ZUWA 2WY3A 2OQJA 1AD0A 5DTFB 5CHNA 3R4DA 4OLWL 4GW4A 3K8LA 5GZNC 1E4WH 1N6VA 1QBMH 2FNBA 3ULUE 4EIZC 1A9EA 1KGCD 3QNXB 2A9NL 1FHGA 1I8IA 3D0LB 2HMID 3KLHD 4R4ND 4Y4HD 4KRPC 1P9MA 2PNDA 2PR4H 1SY6A 4M7LL 4G42B 1FAIL 5LGHL 1YYML 5ITFA 1W72A 3TT1L 4PJBB 3S5LG 3HCVA 1GC1L 4F9PA 1A4KA 1UC6A 4UV7L 5EZOH 4N0UA 1CBVH 5SWQB 5JW3L 3NACH 4H20H 1U8KA 5CD3A 1CQKA 4JHZA 3WE6B 1ZA3B 3D39E 3EJZD 4NZUL 3CGTA 4S1SL 3WFHB 1P69B 2FBJL 2JK5A 1CD8A 4PGDA 1F13A 3LS5L 3FHAA 3HE6A 1C1EL 1NAMH 5IIEA 3O45B 3L1OH 1K6QH 2P8LA 3LSOB 1EUUA 3WFZA 3MFFA 4TOYL 4G7YH 4P9ML 1FFPA 5C0JB 1FLTX 4ODUB 3L95A 2QR0A 4LQ1A 5MEOB 2LE9A 4APQB 2DB8A 2XWJB 3L3JA 3VXSB 2A6KA 1PKQE 4GG8B 2GTZA 3M45A 3TFKD 4Q58C 2FEDD 1T21B 2X9XA 4R90L 3O8XB 5L2KE 3C6LA 4MSWA 4U31A 4WO4B 3CXDL 2DYPD 3M1BA 4GT7A 5E8DL 4LDLB 4PTTA 3UTQB 3OG4B 3NCYS 4JLRA 5BJTB 4JFDE 1KEML 4OZFH 2BOBA 1WWWX 4LLAA 4OLYL 4E41D 1DBAH 1FGNL 3SDXF 2X4UB 5FV2A 4U1LB 5I8CB 5DD1L 3UYPA 4G7VH 4Y19A 4NSKB 5JW4Q 4ZFZB 1V05A 3A6OA 5IM7A 2F74A 1R5VA 1T89C 1DSFH 5EBMB 1GOGA 1OPGL 4P49A 3FQNB 1NCTA 3TO2B 4O2FA 4P9HC 3JWNC 3OG6B 3NCYP 3C08L 4LPUA 2NY0D 3JSSA 4OM1L 1JYWA 3VJ6B 1PD6A 5C0DB 4IS6B 5TE4H 3NCJH 3LOWA 4ETYA 5GGQH 3O9WD 1TVBB 2A38A 3C87A 5IBTH 1DANU 4OCYH 1XF4B 4NNXA 1P4BH 4CMHC 1X7QB 4IDJL 4WEMB 2BCKA 1D9KD 4YHYB 4FXKA 1LK3H 5I9QB 3DUUA 2F19L 2WINA 4RZCA 2J2ZA 3CIQA 1FVCA 3QHZH 2GITB 4NO5A 4YZFF 1AXTL 3WDHA 4DZBB 4N1CA 4IRSA 5D5MB 1IJ9A 5FECB 4LCCB 3WCYA 2X1QA 1CGSH 3ZTJH 5C7XL 3AMLA 2IAMC 1KF9B 3AS1A 1AJ7L 1OTTC 3TN0B 1DVFA 2FH6A 3IT8D 1EXUB 4MNQA 5EO1A 1G7PA 4HWBA 4KDTA 1YEIL 1SM3H 4MZ3A 1RZ7L 1NFDB 2EECA 5DHVH 3IFLL 1RIUL 4NM8H 5C07A 5MEPB 3NIDE 5DGRA 5GS1A 5IW6B 4AENB 2W60B 1SY6L 4JAMA 5ISZE 3EDJA 2NX5E 2XKSA 4DUXA 5INDA 1P84J 1YJDH 3NOIA 3KPRB 3T65A 2NYYC 4XI5C 4XP5L 2ARWA 1WBZB 2BP3A 3G5XA 3HE6D 4X0KB 3P4MA 3P0GB 4R0LA 2R1YB 4PJXA 3VGAC 3RPIB 1HHHB 1Z9SA 4F15C 2AI0H 1A9BB 3ZKND 3H3KA 4OF0A 3T4YB 1MQKH 1XGQA 4OD3H 4WWKA 3NN8B 5I1JH 5IHZB 5A2KH 3H2WA 4ZO7A 4NKIL 2BVOA 4R3SA 2PETA 5L0QB 1LO0L 3S8WA 2CRYA 3GSQA 1FPTH 3SO3B 5SWZA 3HC4H 5F7EH 2VLRE 3NZHH 5EOCL 3U4BL 1X5KA 4I4WB 4U6VH 5GJTH 1WIOA 1F4HA 3CX5J 5DHYA 5DD5L 1LO4L 2OLDA 3BP6B 4Y19D 2A83B 4YPGA 1HQ4A 2H1PH 3WN5C 1EUTA 1Y18A 5D1XA 5KVMC 1SEQL 4PRAB 5JPMB 2R8SH 1F4YL 5GGTA 1JHTB 3G04B 5AUMA 1KACB 4JFHE 4HQQL 1X3DA 4XX1E 1U8NA 5E6IC 2W0PA 1S9XB 3GJEB 2Y9RT 3K8MA 4RCAA 1OF2B 4LPYA 3B43A 4Y5XA 1MHPH 1RHHB 3NTCH 4GAGL 5D93B 3HI5H 3DX8B 2ATKA 4YLQT 4HF5L 1NGWA 3WIIH 4TQEH 4ZYKA 2OSLB 3V5KA 1FIEA 5F6IB 1J0KA 2HWZH 1DL7L 3QZWG 3OKEA 5F1IB 1INQA 4LFHD 1G9EA 5ACLA 5B38A 1KLFA 1ORSB 1H3VA 4WU5B 4WTWA 4FTVB 3BIKB 4I3RL 3BT2L 3QCUH 3HPLA 3PDOA 2AKRB 4IRSD 1PG7H 4LCUA 5E8NA 3VH8B 3HRPA 3MRRB 4DVRL 2XTLA 3LPWA 1T2XA 1J18A 4QRPB 4PJCA 2CDEB 1X5AA 2IBZY 5HGDA 5FGBA 1DVFD 3TYFB 1IGFL 3QO1B 5E2VH 2X4OA 4OGAC 4FQXB 2Q8AH 2BSED 2QQLH 4Z5RA 1FG2A 2YPLB 5DDHA 1P4IH 4FNLL 5IMMB 4XCFH 1CU4H 4AM0A 4OCXH 4QF1B 1JV5B 3KYMB 4PR5A 3A0OA 2W9LA 2QADC 2FEEI 5I66A 1LQVA 2EDJA 4K7PL 3OGCA 1TVHA 3VXME 1BBDL 3MREB 3PL6A 4DKEL 5IMKB 4OZGE 1L9NA 4NKDB 1NCDL 4PJIB 4ZTOH 5J1AB 2D7TL 5BRZD 1IILE 1IVLA 4CL7A 1MREL 4QHKJ 3CPLB 4YGAB 4YXLH 1KUMA 3MLTB 5C2BH 3VFRB 4CVXA 4GQ9L 4Y16B 1U8JB 1OTSD 4FXGA 5JA9A 1DEDA 2FX9H 1E6JL 1TMCB 3MLUL 3A6BH 2IPKB 1FFNA 1M6OA 2B7DT 4O2CB 3TBVB 3RPKA 1CDUA 4NQXA 3MLVL 2UVEA 4RISL 1EZVX 4C83A 3QDGE 5CJXC 5SWZD 3VGHA 4QXUL 3OKLB 2OTUB 1Q8MA 2DIAA 2I27N 2H2PC 3OB0H 4RFOL 5FYJD 1H5BB 1MFAL 2OXGA 3RWFA 4NQDA 1OT2A 4P57A 4WW1B 2G2RA 4NQTA 2V5SA 5FYJL 4JFEA 5D1XD 1LE9B 4PYGA 5HYJE 4G9FE 2P5WA 2JCCA 5I15H 3EO9H 3HG1B 4I2XB 3N1PC 3VDBA 3BP4B 4RA3A 1F4XL 3KXFE 1HZHH 2AV7A 1AGEB 4PP1C 5GGTL 3PP3K 1CZ8L 2V9TA 5E03A 4WY7H 3TM6A 1M7DB 1W0VA 3IJHA 1UENA 1I8LC 3V4UH 2KZWA 4HFWA 3TT3L 1NDMA 2UWEE 2VUYA 5HDQH 2B1HL 3V5HB 4Z77B 1NQBA 1ZHLB 2JJWA 3SKMB 3ULVC 3QEGH 3JTTB 1DBBH 2GUOB 2HJKA 1QFWH 3AREC 4OUUA 1I4FA 3F7QA 1MCCA 1MIML 1NMBL 4P4RA 5M95B 4H1LB 3JUYA 3C6SA 3BJLA 3H8NA 4UT7L 3QSKB 1HHJA 5GRVL 4KY1L 4YDIH 4U7MA 1NANH 1UJ3A 3MLYL 1ACYH 4KRLB 4XAWL 5CBEB 3EJYD 3RA7L 1RJYA 5I71C 1T1ZA 1T7VA 1UXWA 3VI3F 3HFMH 4HXAH 4R2GC 5DMGC 4Z18A 4FRWA 4DGVL 1PSKL 4GXVL 4FFVC 2VH5H 4LLUB 4UQ3A 4R9HA 5FHBH 2D03L 3PL6D 3QO0B 4QLRA 4X98B 4CDHA 3ARUA 3JVGA 5GS3A 2VABA 4XVUD 4Y5YB 3FOLB 1CDIA 5D7IE 4X4XB 1U3HD 5GRYA 4LASH 1NGQH 2IG2H 3SDAC 2NTSP 3I6KA 1N26A 3V7AE 1XIWB 3NAAL 1MY7A 4N1EA 3AS3A 3QG6A 1MCFA 3ZYOA 4ZTPL 1H3GA 3LKQB 3HI6H 1IKNA 5K9JL 1DBJH 3V52H 4YDKL 1RURH 5DA0B 4ZNEE 3BD5A 2CRZA 2MJWA 4E9LA 2X05A 3O2DA 5TDPA 2ZUWA 4LSVH 2VRAA 4PREA 3IKKA 1TZGL 2DMKA 3G6AB 2EDQA 1BF2A 1YPZF 2EE3A 4XBEL 4R4BB 3M17B 3REVB 1CK0L 1D5XB 1CLCA 2C4FT 3B2VL 3RGVB 1IEHA 4R8WH 1QFUH 1MCWM 4OCRL 2EIBA 3VFWB 1CDYA 4JY5H 3LQAH 4X4MA 1BFOA 1HSBB 2VDLH 2XKUA 4WHTB 2FHCA 4JQXA 1TJGL 4NQDD 4N5EC 5DJ0B 3GIVB 2O5XH 2QKIA 5ECJE 5C6TL 1B3JA 4JFED 1GGUA 4XP6L 4F7TA 4N9GB 4RWYL 3P9LB 4QXWA 2AK1H 1PEWA 2P5WD 5FGCB 4NGHH 3VFNA 4X6CE 2HT4C 1DCLA 4EUPB 3QCTL 1HIMH 3TCLB 1WBYA 3ARFA 4JKPL 3VXRE 1XR8B 5C9JA 1JPST 1MCDA 3EYQC 4HDIB 4ZXBC 4KDWA 1Q9LA 5TE7L 2IH1B 5FK9A 1F3DH 4NT6A 3F12B 3TA3A 4Z7UB 1BVKA 4Q9QL 1K4CA 5KS9F 3I9GL 2C3HA 4M3KB 2AJVH 4LMQE 3RUGA 3C2AH 4AG4H 4HPYH 3V79C 5J4MA 3PIQB 3UDWA 3MLZH 3O3BA 5DS8B 4S0UC 1CICB 4ACPA 4CW1B 3Q5YA 2GTWB 1CE1L 3I75B 4DKFL 7CGTA 5F7MC 2B5IC 1IGYA 4C59B 4FQ1H 1QLFA 1VADA 1QHOA 2R0KL 1YY9C 3FCTB 3I02A 2Q3ZA 3VWJC 3WXVL 4YGVB 1P53A 4H25B 4F33B 4DUVA 4GRMA 3F7YB 4HUUB 3V6FA 5HYSG 5MEQA 4YIQA 3L3HB 2BNRE 5D2NE 2AP2A 3QEQA 5JA8B 4NN5C 5HY9B 3IS1X 5C0BE 4W4NA 4F7CB 2XRAH 2WMPA 4GFTB 4HKXA 3WS6C 2FECI 4RGND 3OMZA 1EBPA 1IAMA 3L3DA 5DFVD 1TZIB 3L7FB 1FG9C 3ZSTA 1JGEB 4TSCH 2GY7B 3WHE0 4IIQB 4WFGE 1C5BL 2D3VA 3W9DA 1KTDA 4EXKA 3U9PL 4LLMB 1R5IB 3C8KA 4BSJA 4J4PC 4YHKH 3IDIA 3UTTA 1IQDA 4L3AA 1JWSA 1UM5L 1Z3GL 1U93A 2C3VA 3K8KA 4NPYB 3Q5TA 2ZNXA 1WBXA 3WNNA 4Z7VB 1JZ6A 1EPFA 3D39A 4FQHA 3MPCA 4MD5B 3O2DL 3VFGL 2NTFA 5I8KL 5SX5K 3ARVA 1BQHG 5H94A 4J6RL 1LWRA 1BBJA 1Z9MA 3DETC 4HBQA 3VFVB 5JPNA 3RZCB 4AIZA 4I9WD 1P4LA 4KV5F 3QHTC 4QOKE 1NAMA 1OGTB 3IFPB 3D0VB 1U92A 4HUVB 3DRTA 1RULH 1X5YA 5DZOA 5EUOA 2P5EB 5T1DH 3CAFA 3KPTA 5F7HA 4BK5A 3VFTA 4P4KA 5JW4N 1PKQA 5LBSH 3DROB 2EYTB 4P2RB 4G9DB 5L2KA 1KPUA 1T66C 1TIUA 1VGKB 1CWVA 3FO9B 4WW2B 1A7OL 4R96A 4JHAH 4DZ8A 5B8CA 4FABH 3D6GA 3PHOB 3T1WA 2FZ3A 3ARFD 1SYSB 3DVGA 4JVWA 4OV6F 4OKDA 3KYOA 4BH7A 4L4VE 4XPBH 5T1LA 4ENED 1A6VL 2HLFC 4IRZL 4RDQF 1FL3B 3TA3D 4JY4B 1ITCA 1KIRB 5BMFH 1KXQE 3TNMA 5I2IA 1XFPA 1FNSH 1OSZB 2Q6WB 3SCMB 5E5MB 2HLAB 2UY6A 5DT1L 1QA9A 1CLOH 3NZ8B 3QG7H 1D5MB 4MD0A 5ICYA 1EA9C 1Q9WB 3QDJB 4Z7WF 4S2SA 1OL0A 1ES0B 1QQDA 3MGOA 3QI9B 4TTDD 3S5LB 4PRDB 4OFVA 4N0CA 3VMOA 5ACZB 1BEYL 1AH1A 1W2KT 2GT9B 3HUJF 3X12B 2Y5TA 2AJXL 3OAUH 1J8HB 1MCQA 2FJHA 4KKCD 3VG9C 4R7DA 2JB5H 4M93B 2FD6L 4PP2A 4LP4A 4QNPE 1B4JH 5HI5D 2AEWA 2H26A 2X10A 3LEYH 3QEQD 4EEEA 4S10A 5IK3B 4X7TA 1PZUB 3LMJL 1RIVL 3WL9A 3EBAA 3QNZA 1KYOK 3CJJA 1YEGH 2ZUYA 2F8VA 4GAYA 2AABH 5D7SH 4ISVB 4YPJA 2NW3B 5EBWB 5DRNB 1OGAE 4WTZA 4HUNB 3ULUD 3OXSA 5IP4A 4ZS7L 5D70L 2P8MB 1XAUA 4ELMF 3STLB 1UXSA 2UZIH 1A3QA 4ZQKA 1OW0A 4MQ7B 1LHZA 3BRGC 5DHVA 1QBML 1ACZA 5I1HL 3IFNH 3HZMA 3MZGB 1M7IB 2ICEB 5ISZA 2NXYD 2NX5A 2PR4L 5HHQA 1GZQB 4XPHL 3D39D 4KJWC 1GAFH 1I3RB 3MRBA 3MUZ1 3MROA 3GMQB 1KPVB 3G6JF 5EZOL 1CBVL 2HVJB 3BGFB 1U95B 1N5YH 3NACL 3K46A 4H0IA 3BPCA 2XY2A 5L8LB 5JOEA 3C9NB 1V8HA 2UVFA 1FL6A 1A8JH 2ZOKB 2CKBA 3FB7A 3ZE1E 3A6CH 1NAML 5JO5A 4CUCA 1NKRA 5BVJB 2DQIL 4M7LT 2R2EB 1HXYB 3SBWA 3BMVA 1K6QL 5L2KD 4PG9B 4G7YL 4HS6B 1AGDB 1VFAA 4JG0L 2FJGB 4JFDD 3MV11 3KWWB 3RWDA 3K80A 4I3SL 4JM4H 5D7LE 4HG4K 2VR5A 3VWKB 4G6KH 5F89A 3P4LA 1DQLH 2AQ1A 3BZDA 5T1LD 3PHSA 3DMMB 3G5YB 4L8SC 2GW5A 2VZVA 4MVBA 5F97E 4GKSA 4F58L 3KPQA 4YO0B 1IE5A 1DBAL 4KK9C 5JDJA 3IXAB 3BAEL 3CCHA 3Q2CA 3V0WH 3P4OA 3H9YA 1NDGA 1ED3A 1KB9K 5E94B 1UEMA 5K9QG 4QRRB 1MAMH 2WAHA 4N0CD 2J3SA 1RK1B 1XCQB 4LARL 4Q0XL 3TVMC 4C56E 4K3EH 1AGFB 4FP8H 2IMMA 1XGRA 5TE4L 4ZOBA 1ZT4A 1JHLL 2IH3B 4P48A 2FH8A 2V17L 5GGQL 1N59A 3CZFB 3QUMH 1XR9A 1X5ZA 1D5BB 5TF1H 3QRGH 1RJLA 1KCGC 4TNWK 2VZUA 1Y0LA 4OV5B 3DBXB 5C8JB 1P4BL 2W38A 1A14L 4URTB 3OR7A 4JFQA 3I2CH 4ZSOB 1NKOA 4MQXD 4JFPB 5E08L 4MXWH 4QRQA 4P23B 3N1QC 3HR5B 4KRNA 4TUJB 1C7TA 3QHZL 3P9MB 1L6ZA 2GJZB 1YEDB 4OZHA 1MLBA 3T2PA 2DKSA 2Z31B 2C1OA 4P2QB 5FOBB 1CGSL 2HMIC 4YBLC 3G5VA 5DQ9B 3S36L 3KNBB 5FYLH 1I7UA 4MAYC 3V4PH 1SM3L 5CJQH 4WJ5A 4MA3A 1A3RL 5ISZD 2NX5D 4JPKH 3CSGA 4WV1C 4UAOB 4OZGA 1OAYH 4NWUL 3VD7A 3GGWA 4FQPA 4NM8L 1KCVH 1S7QA 2X4SA 4GMTH 4MD4A 2DWDA 4AH2A 1GHFH 1NCUA 4JB9L 5DUMH 4QHMA 4OZ4B 5DSCB 1G6RB 5CEZE 2ADIA 2CDGB 4OD2B 1RZFL 2QQKL 1YJDL 4XP4H 4BJLA 3BH8A 5E00B 4LRIC 5JQ6L 4LDEB 2VSCA 1DQJA 5HHVL 2NY2B 3HMWH 5TQ2H 5KSAC 3MJGX 3IDYB 4O51B 1WSST 5KTEH 3DV4A 2DQUH 2XG5A 3BPOB 3QDGA 3S34H 2CKBL 3WIHH 3QZWB 2VLRD 2VAAB 4CKVX 1MQKL 5I1JL 4LEOA 4PJDF 2FB4H 3E3QC 4H1LH 3K2UL 4I0CC 1NMAH 4K3HA 1RUPH 4A6YB 3EDFA 4TPRH 4Z76A 1K5NB 4GG6E 3O0RL 2BJMH 3SKNB 1FPTL 2E8YA 1M1SA 5GQBA 2Y06H 3HC4L 5D71L 4MVBD 3NZHL 3PWUA 4LGPB 3WUZA 5HYJA 4G9FA 2NXZC 2XT1B 3OZ9H 5GJTL 4X4YA 4QHNA 4JFHD 5JIPA 1MI5E 1TDQA 2BRRH 5FO7B 1UADC 2Y23A 2HTKC 3RNQA 2R8SL 2ADGB 4PRBA 3DARA 4NRYB 3UBXG 2YD2A 3TIDA 4U3HA 3EOAA 3CLFL 4QRSB 2ZP0T 2GJJA 4DFIA 2DL2A 1CD0A 2ZUSA 3MO1B 1MHPL 1KENL 1BD2E 3PDDA 1KN2H 3I3EA 4TNVK 2DQFB 4MLSA 1VERA 5SV4A 3T08A 3B9KB 4XP9H 1D9KC 3O6FA 2QV2A 2X1PA 2AEPL 3S3SA 3ARGB 3O3EB 2QQNL 3GMOA 4LLVA 4DEPB 4NQSB 4HS3B 5HI3D 4XNYH 2YXFA 4EI5C 3MLWH 2HRLA 3ZT5A 4UIKH 3RY4A 3WSQH 3I6GB 1RJCA 1NANI 2R9HD 4LSTH 5ILTH 1BWMA 1NC4B 1LNUA 1PG7L 4FG6C 4JO1H 3LQAC 5HHPB 1XF3B 3B5HA 1P5VA 2CMRH 2YWYA 2KBGA 4HLZG 4TTGA 4JM2B 5F88A 1YEHL 3LPFA 3JV4B 4P5KA 3TWCL 2GIYA 5CWSA 3RNKB 5E2VL 3VXMD 4NM4L 5E6YA 1DE4A 5ID0A 3MJ8B 1LO3H 5CMAB 4NOBA 1XGTB 4N0FA 3RTQB 2WIIB 3SDXE 3W0WB 2YC1B 4XCFL 5D7IA 3BKYH 5C0ND 3CFCL 1KIQB 1RZ8B 1FJ1B 4FQIL 5EU7C 3TJHA 3H3PH 1YY8A 3DVNB 1PY4A 5IB5A 1B4RA 4EUPH 3QFJB 5I8OL 1UCTA 3PWVB 3V6ZB 5JQHC 4BK4A 3D2UB 2J8UF 2A1WH 4QWWC 2EH8H 4ZUVB 1NLDH 2IPTH 4ZNEA 4GKNB 3IDNB 4B7LA 4K23H 1RZGA 3T2NH 2AXFA 5CBAA 1GH7A 1H15A 4PRPB 4YXLL 2L7UA 3P2TA 4TRPL 4NZTH 2I24N 1QSZA 3QDGD 4KVNH 4F7MA 2HA1A 4BUHA 2FX9L 1QD0A 4P3CH 3ARBA 1OP5K 1UEYA 2AJYH 2ARJA 1JTOA 3DXAE 4JPVH 3HC0B 1WUNT 5DI8A 2CLRA 3QPXH 3MV9E 4MS8A 1CFSA 4QRUA 4WI7A 4YZFE 5KZCD 3TCXA 2G9HB 4HIEA 5F9AC 4DQOH 2VC2H 3HMXA 3VD3A 5HYJD 4G9FD 5HDOA 3AS0A 2LABA 4AEIH 4GBXB 1MPAH 1KIPB 2NLJA 4X6CA 1LEIA 1ORQA 3KXFD 4L8BA 4UTBH 2DQJH 3LB6C 5JXAH 1FCCA 1MWAA 1T5WA 4OF7A 3D25B 4APQC 3QPQD 1H8OA 2XXMB 2BNRB 3HZVB 4UDUA 1T3FA 5D2NB 3AAZB 2CIIB 3EO9L 1OT1A 4WO4C 1DFBH 1U8IA 1HZHL 3H6JA 43CAB 3BWAB 2BVPB 1K8IA 4FFWD 4I77H 2DMBA 1FH5H 1NJ9A 4JREB 1QSFB 3VXPB 1W0WA 1H3WM 3OPZL 3V4UL 3QDAA 2YS4A 3QULB 5IBLD 1DQDH 4DVBB 5CILL 3O6FD 4O2EA 1UM6L 4HJGA 5HDQL 3QJHA 4YH6A 4L5FH 4JANA 2A6JA 5D1QB 4X6DE 3FB5B 1WFUA 3M8OL 3ABZA 1QFWL 3HNSH 1S7XB 2O5ZL 3KPSE 3WFHA 4NOFA 4D8PA 4CU6A 1S3KH 1WZLA 4QY8B 1MRFL 1ERNA 3GMLB 1TQCB 4V1DB 4HD9A 4YDIL 1HEZA 3LSOA 3U6RA 4K94H 2EIEA 2F54E 4OGYL 1DBKL 5HHOB 3SDDA 3GSWB 3HFML 1JYXA 3VXSA 1MJUL 4JFXA 1DZBA 2Z93A 2K1MA 1T21A 4GAJH 3O8XA 1JZ7A 3H42H 5IG7A 1Z9OA 2ATPB 3PABA 4NQCE 4U7SA 4HWZB 4YHYC 5I9QC 2COQA 4OLXL 3TJHD 2VZ3A 4X6EB 1OAQH 5FHBL 1S9YB 3GSNA 5BJTA 3LV3A 5IW1B 4DUWA 1JPFB 3IJSB 4LCCC 5DK2A 4KKAD 5HDLA 3CH1A 5HJ3B 4WUUE 1IEBB 2O26U 3TN0C 3X11A 3ZDZF 1OTSC 2HYMA 1CGUA 3HI6L 1RURL 3BGMA 3KPNB 4D94A 3QQ4A 2VDKL 2P43B 1T0NA 3ARZA 4PJ8B 4LBEA 2X1OA 3L9RB 3FQRA 4W6XB 5C0DA 4QOKA 4PV9A 3ARBD 3EOBA 1NCCH 4EI6A 5IB4B 4GAFB 4JPWH 4R8WL 1LO5A 2RFXB 1A0QH 4YFLF 1QFUL 1TVBA 2XTJB 2CQVA 5CJBA 1AHWB 5DGQA 5I1LB 4JY5L 4KGLA 4OFYA 1T1YB 4NHUE 4EOWH 1XF5A 4M6OH 5EZJA 2QLVB 4LPWA 4NRXB 3SOBH 3WJJA 1VEMA 2DM3A 1CFVH 1G9NC 1BZ7A 3F6IA 2O5XL 1NBVH 3HMXL 2ZCLL 3JWDC 3MBEB 4NCC2 5GS0D 4MXQC 3CVHA 3VXRD 4DZBA 2JJSC 4LNRB 4NGHL 3TLRA 1XGUA 3T0EE 4XWOD 2F5AH 2FO1A 4XC3H 1FNLA 3SY0A 2OJZL 5GS0L 1MWAL 2E7LE 1HIML 3IDJA 2LTQB 2V2TA 3O6KH 3SO3C 5J1SC 3SEPA 5IVZB 4P46D 1Z5LB 2IGFH 4BH8B 1PY9A 2BDNH 4LPCA 1X5FA 4W81A 1MHCB 4JDVA 1WCQA 1UZ6F 3Q3GB 4HWNA 3VMPA 1CT8B 2AJVL 3RKDC 1YEEH 3C2AL 2OI9A 1FO0B 3G5ZA 3BKCH 1D3CA 5HYSA 1I1CA 3JTSA 3DTXA 2X5PA 4PJEB 3PWLB 4NDMA 3BD3A 1P2CB 2BNRD 3EHBD 1BQHB 1CGWA 3EJJX 2VE6A 4HV8B 3RWHB 4NQEE 4QKXB 1G0DA 4HPOL 3QEHB 3RPIA 4OLUH 5C0BD 3LH2H 1QR1A 1U2HA 3QUXA 4KRMB 5D93C 3QXAA 1A9BA 1G7LB 3CDGB 4JFYB 5M7QA 4M6NH 3SDDD 3MV7E 1NCWH 2VXQH 2R0ZL 4MJ5B 4ERSH 1JK8B 3O4LB 2EIZA 3PV6A 5F6IC 1OGAA 5I1DA 3QJFA 4PS4H 1KG0A 5C0RL 3SGJC 1NLBH 2IWGA 3BW9B 4F80A 3OR6B 4LF3A 3FB8B 1N2RA 3QIUB 3LD8B 5JXEC 2QSCH 3RVWC 1U3HC 4Z7NF 2MCPH 4OLZH 1FZMA 4FQCH 2ORBH 1YN7B 1DN2A 5JR1L 4I4WA 3MOBL 2R29H 1TFHA 5EWIL 1WQVT 1IGCH 3GSNL 1KTLB 4NWTL 3KPMB 1TNMA 2FGWH 3RWCB 1BFVL 2MQ3A 3HE7A 5I1KL 4U1HB 4KUZH 4YHKL 2A6DA 1BVLA 4YDJB 3V7MA 1HILB 2NQCA 1S9XA 1UWGH 4QXTB 3RY6A 4GRWF 4KI5C 4YHLL 1OB1B 4QOKD 2VERN 5GGRY 5CUSH 4XVJH 1OF2A 1IM3B 3MR9A 4PGBA 4PJXF 3L3OA 2EDRA 4WI8A 4X9HA 5KOVC 4KPHH 4G6ML 1ZV5A 8CGTA 4OFYD 1RULL 3LIZL 4NUJA 1MLCB 2DDQH 3S3PA 2OL3B 4NKMB 1AC0A 2VL5B 5T1KB 3HS0B 3IDXL 4XCNB 4Y16C 3UJTL 1ORSA 4WU5A 2I07B 5D7LA 1SYVA 2DICA 1N7MH 3VFUB 1JNNH 5GPRA 4L4VD 4JRXE 3MRRA 4PDCE 2X70A 3DHMA 4JHAL 3HR6A 4PB0H 3CVHL 2ITDB 1KFAH 1MCNA 2GY5A 3GUTB 4FQXA 3CFKA 4XPBL 1H5BC 5IMMA 3A67L 1G0XA 1K2DA 5ICZB 1AP2B 1NBQA 3KYMA 1FNSL 4O9HH 1UVQA 1B0RA 3SKJL 3B83A 4OB5H 4L9LB 4L3EE 3U0WH 3QG7L 3BJ91 4RGOH 1I7RA 4J1UB 1KTKE 4HGMA 3PJSA 3TV3H 3K7UA 3JZ7A 4NKDA 5K93A 2B0SH 4U49A 5J1AA 1TJIH 1QTYT 2JKXA 1S7TA 5JUEH 4ZUUA 3T0BA 1I8KB 4IRJA 4RMWA 3QUMA 1G6RH 3EGSA 3FRPG 3GSVB 3OAUL 3MLTA 4XRCB 3FAWA 2JB5L 5IF0B 1UZ8B 2GK0B 3D85A 5TH2A 1KNOA 5EOCJ 5ANMB 1OGAD 4JQVC 2CJUL 2AK4E 1DLFH 1EO7A 3J8F7 1RU9H 1YEGL 4XC1H 4FFZL 3BEWA 2AABL 4PJCF 1IGJB 3NA4A 3U36B 3UC0L 5FDWA 5JHDA 4YWGL 4M5YH 1I85A 2EDOA 1AQKH 5C3LD 3HAEG 1KBGH 4LPTA 1ZVHA 1T1WA 3REWB 5IB1B 1IC4H 3VCLA 2W9DH 1PLGH 4ONHB 3BXNB 3ARWA 3ZKXB 3HB3D 1ZA6A 1A7RH 2X4QB 2WBKA 1I9IH 2QHRL 1ZLUK 3HE7D 4HZLA 2PO6B 4Z8FH 1YUHB 5KS9E 5T3ZH 4FZEL 5FUCE 5GGRB 3BP4A 4RDQG 4KWUA 2WWMD 1X5JA 2VQTA 5CCKH 5HHNA 3WUWB 1N6QL 2LV4A 2Y7QA 3E8UL 3U0PB 4Y5YC 4YHML 1U8HB 1M7DA 5BS0E 2D31A 2JELL 1N5YL 3ROOB 1IC5L 4BA8A 2VLLB 2F8XC 1XIWC 1FSKB 1D5IL 1HE7A 4IMKA 3FQTB 4M9PA 2RJMA 1MCBA 3PP3H 3WIHA 1U8QA 5IEHB 3PWJB 4KJPD 4X5XA 2J88L 2UYLA 2YSSB 1K4DA 4KKLC 5D7LD 2XZZA 2Z4QB 3KHQA 4GG6A 3SE4A 3IAQA 4JO4L 4GUPA 4Z9KB 5F1SA 4HIHB 3UYOD 3CFJB 1T1XB 1OLLA 3MRKB 1QRNE 3RGVC 3SDCA 4LQFL 3SE9H 5KSVA 3QUYA 2NY6D 3B2UC 2OCFD 4JM4L 4R4FH 3X3FH 3I3BA 4AT6B 2K9UA 2IQ9H 4G6KL 3MRIB 3OJ2C 2HAZA 1MI5A 2BY1A 5EFIB 5AG9A 3GSUA 1AO7B 4R97B 2DLIA 2JCCF 1UB6B 4OFIA 1CE6B 5C9KA 4CGTA 1RUQH 4OCLC 1VACA 2HTLD 1FQ9C 5IB3A 4TTDC 4X98A 1IAOB 1MRDH 1L6XA 4C56D 3BVNB 4X9BA 1MHHB 3NFNB 3V0WL 3WYRA 2VXUL 2W0FA 5F7LB 3DX7A 2PW1A 1MAML 3CDYA 3KYNA 3LN9A 5HGBA 3ZMRA 1BD2A 2GK2A 5EU5B 3U2SA 3MGTA 5FYKU 3VI4E 3GIZL 1OSPH 3FN9A 3C5ZA 1IGML 4FP8L 5C0CB 3NABL 3LN5A 1JGDA 4MJIB 3QUML 4PJ5B 3D85D 4K9EH 5TF1L 3PQYE 5LGJA 4UILL 1FZOB 1NCNA 1KJ2B 5E95B 1XH3A 4JN1H 5IMLA 4HWUA 3ZZ1A 3O3AB 1CICC 4KQ4L 3ULUC 3MNWA 1UB5B 3IF1B 3MJ7B 1HSBA 4X6FB 5SWSE 3S37H 3QR2A 2C4FU 2BNQE 3ES6B 3QXTA 5D2LB 4BSWA 3LKRB 2IF7A 3AY4C 4WHDA 3WLWC 5F7NC 3D5OF 1PYWA 2LFGA 3LZFL 1GCFA 2VYRE 1F4AA 2NXYC 2VMFA 1HCVA 5TDNA 4OUOA 5FYLL 4R26H 3T0AA 4JPIB 1EZVY 1DUYA 5DMKB 5FO9B 5LQBH 1DQQA 3MRFA 3EYOB 3VE0A 4HIXH 5CJQL 3T0XA 3ZYZA 1MFCH 3OSKA 5CEZD 1ZT1A 2A0LC 1GOHA 3ECBB 1RVFH 2VWEE 4Z7WE 3KDMA 4RFEA 3U79A 3BP5B 2YHGA 5MENE 4NNPH 2AW2A 1YQVH 3UBXB 5TFSL 5HVWA 1GHFL 5CEZL 3HI1A 1AI1H 4MCYA 3OHXB 4HX1B 4XP4L 1MQ8A 4IIQC 3GM8A 5FYKE 4G8EB 3HMWL 3VGDA 3FT3A 5TQ2L 5DS8A 1OTUD 3W11C 2RCSH 3MZTA 3AC0A 3WFBL 3DXAA 4U1NA 4XMLH 4X99A 2RGSA 4X6BB 2A73A 1QOKA 4OJFH 4TVPE 3MV9A 3W39A 3WIHL 4F7PB 2YRLA 2VITB 3SDCD 5DLMH 3D3VB 3QUYD 1A22B 1LK2B 2FB4L 4I0PA 1RUPL 1D6EA 3MRJB 4U1GB 1MI5D 2ZCKH 4AL8H 2Y06L 3MRQB 5GGVY 5DK0A 2FR4A 3RRQA 4K94C 4LLWA 4CU7A 4ELME 4UB0H 3PGDA 4G8IB 1QVOA 5F3BA 2WLYA 3GMMA 4JZJB 4LCWB 4LAQH 4YE4H 5BV7L 2IANB 5H35B 3TZVA 3QQ9D 4PRHB 1DQMH 4DWHA 4WW2C 4WFHE 1T0PB 2DLFL 2XQBL 2EDKA 5C08A 4M1CC 1BD2D 3IS0X 12E8H 4G3YH 1KN4H 4WEUD 5FOJA 2IBZX 3C5ZD 4M43H 3G6JE 1GGYA 3KYKH 4HH8A 1D7FA 4WI2A 1E4KA 1JNHA 3FN3A 2YEZB 4NUGH 2Q87A 1KN2L 2ZUUA 4X6DA 3SCMC 4LDOB 1JPSH 5FM4A 4XP9L 3HN3A 3KPSA 3DLQR 1GIGH 4LL9A 4WUUB 1Q1JH 1WWAX 3PWPE 2APWA 4GXUM 3RVXD 1T80A 1J12A 3PE9A 4XNYL 5DJAB 2IALB 4YHPB 3RZCA 4JN2A 3WSQL 3NFSL 3D0VA 3OJDA 3CK0L 5KN5A 2AERT 3V95A 2F54A 1JF1B 3ZE0E 3S35X 1F42A 5ILTL 2KL6A 1J1OH 1PJ9A 4XHJD 4JO1L 3D48R 4EBQH 2A77H 2CMRL 4G8FA 1G9MC 4M93C 3QH3A 5JMRA 3LKPA 2EYTA 5SX5H 4XNXL 5FUZH 4NQCA 5K9OA 1UYWH 2FIKA 1AIFB 1AXSB 4R7NB 3SDYH 1EGJH 4S1RH 3WNLA 5FA4B 4N8VB 1SYSA 5CKGA 3AB0B 3BKYL 3UJJL 4XBGB 1Q0XL 1KB5A 4HUXB 1ZGLP 1YECH 4JY4A 1M71A 5CSZB 2EEBA 2A1WL 1NMCB 4DTGH 2EH8L 5D1ZB 5I0DA 2IPTL 1C5DB 5E5MA 3Q48A 3UX9B 4K23L 1ZMYA 1D5MA 4K3JH 2Z92B 2B4CC 1YC8A 1NUDA 2VQ1B 2N4IA 2XPGB 3QI9A 3DXAD 5I1CL 2ZNWA 4NZTL 1V7MH 5ACZA 3MNZB 3MV9D 3VDAA 2P7TA 4PLKD 5D7KE 3X12A 32C2A 3V4VH 3T2QA 5EUOF 4P3CL 4Q7DA 4I0PD 4ZOAA 2GKIA 3WJLA 3BQUD 4NHUA 3BGFC 2ZCHL 5IOPB 1P7HL 4XPGH 3QPXL 5C0FA 3PGCB 3S6CA 1XZ0A 3RBSA 3MXWL 1G7MB 1A7NL 5E2TH 5E8PA 4DQOL 1HHGB 1A6AB 4Z7QE 2VXSH 3MRLA 3P11H 3HNVH 2VDRH 3BZFB 4KKNA 4AEIL 4UTAH 5DF0A 2EXYD 4P3DB 3ZYJA 4WHYG 5EN2A 3T3PE 3T0EA 2QBWA 1MPAL 1DDHA 4UTBL 4GKZB 1DN0B 1NGYB 4P3WA 2E7LA 2A6IB 2P42B 5DD6A 3PP4L 3V0VA 2IQAB 2P24B 4XWGH 4NKQB 3IDGA 4OT1H 2EXWD 5BXFB 1RZKH 3VWKC 4DOHB 2BXZA 3MRGB 3DO7B 3DMMC 3QUKA 5LCVH 5D9SB 1OQOA 2EYSA 3VXUE 1FH5L 1F45A 4ZFFB 5A16A 2DI9A 3QAZB 1KJ3H 1JGUH 3KPSD 5ADOL 1A1NB 2KUTA 1HI6B 3W2DH 1CLZH 3GHEL 3QWOA 4GRLB 4NQEA 1IL1B 4HKJA 3KPPB 3HNSL 4GH7B 1U8LB 2F54D 4UQ2A 1QBBA 4QHLB 5B4MC 1PG7W 2F58L 3MV7A 2H6PB 1NBZA 5CKAA 3FT2B 1QO3B 4K94L 2UY7A 4CMMB 4NQCD 1AR1C 2NY5H 2OL3H 1T5XB 4HS6A 5C0NC 1AGDA 3TF7C 5ERWB 5AWNL 4HJJH 5B39B 3ALWA 3O4OB 4U6YB 1JRHH 4J3WA 3RVUC 1V3KA 1R3HA 2DLHA 4WUUD 5L2JB 4P23C 5E8EA 1RUMH 3NIDF 3DI3B 5KOMC 3ZSSA 1G7IA 2Z31C 3BO8B 3UTZB 1KB5L 4NRZB 5JW5B 4DK6A 3OKNA 4XPFH 3LHPL 3MXVH 4HMDA 3MCG1 4CDGC 1MAJA 1OP9A 4QYOA 1YDPA 2XWTA 4MDIB 3FB6A 4UAOC 2VNCA 4KK6D 1LEKB 4G6JL 5GHWH 1MH5B 1EHLH 1S7SB 3HLAA 2FGZA 3FO0H 1NCCL 1CFQA 2ZUQB 2PW2A 3BISA 4JPWL 2XN9E 3NCBB 1BVZA 1A0QL 2FX8H 4L3EB 1LP9B 4XCEB 5F3HB 5DUPH 5ADPL 4L4TB 5I1AB 3NIGE 2AV1A 5EU6E 1P6FA 3V0AC 4RIRA 3AFLA 3WIFB 2BNUA 1YPZB 1AFVH 2PCPB 1EAPB 4EOWL 2OP4H 4LHQB 3BZEB 2EYRB 2DQHH 5DEGB 4Y4KA 3IDYC 3T0ED 1RFDH 3QPQC 3RJDA 2A74A 1NBVL 4V3EB 5ETUB 3BPOC 3VFMA 4XGZA 4O4YH 4Q2ZB 4ZDHB 2AGJL 4Q6YA 2H8PA 5DURD 3MA7B 3S36X 6FABH 4X80H 3RWJB 2ESVB 5JNYA 4JGJA 1OAZH 6CGTA 2D2OA 4S1DC 3RJQB 1LE5B 3S96A 3KVQA 4PTUB 4XPTH 5FGRA 2V7NA 4G43B 3RFZC 4ONFH 4H8WC 5IHUL 2O61B 5LWYH 1WCBB 3NH7H 3PF2A 3V6OE 5IBLC 4JZOA 1ZEAH 2VZOA 3EOTH 3GDBA 4EXPX 1KCLA 5E9DE 3U7AA 5JORB 1FV1A 3QFDA 4MCZA 3E2HA 2EDHA 1QACA 1BQUA 2Z9TA 2DQCL 3WNMA 3IKCB 5GGSA 3CC5B 3MCKA 3IETB 4ZFGH 4DJMA 4NQED 3BKCL 4I18B 1H3UA 1PAMA 2CLVB 1G6RA 1BLNB 5T5FH 1CI5A 4QTHB 3LS4H 4LSRH 1VFMA 2V2XA 5IQ9A 5KS9B 2HG5A 2HT3D 3MV7D 4TN9A 4F3FB 3IFOA 5F72S 3UTSA 2NY1D 3DX6A 5I1GL 3PWNA 2AK4A 4KTEH 4RAUB 3TPUE 1S7RB 1EEZA 1MFBH 1BJMA 3CUPB 3OL2A 3N0PB 4MWFB 5F8QC 3B9KC 3BN9D 3IU3A 1WIUA 4M6NL 1NCWL 4ERSL 3ARGC 2XI9A 5DHXB 4HJ0D 1VFBA 3MRPA 4DEPC 4OZHF 1R5WA 4TUOB 4KZEH 3GHBH 1NLBL 4P5MB 3G9AB 4XNMB 1R24A 4DN4H 5E2UH 1FGVH 2QSCL 3U4AA 3H3BC 4EQ2A 3VXOA 4E0RA 2MCPL 5F9WB 2B20A 4ETQB 1IAKA 2ORBL 1WIPA 3MNVB 1HKLH 5IBUG 3M07A 2C5DC 1B0GA 2L7JA 1UFUA 3QHFH 4JM2C 2ZG3A 1YNTA 4AEFA 3NGBB 4XH2B 2ICWI 2ICWA 5F9JA 3GEWB 2FGWL 3SE3A 3MV8B 2HJFB 3UTOA 2Y25A 1N8ZB 3JV0A 3TBYA 3S3JA 3LKSA 3RTQC 4KUZL 3S98A 5ICXB 4ESKA 5J6HB 1QYGL 5I71B 5BOPA 1UWGL 3RDTB 4CADA 3FQUB 1ZLVK 3GMPB 2MNUA 4LKXB 1S9WB 4PJ9B 1RQ5A 4LKCB 2J6EA 1WISA 4MHHG 5T5NF 2ZSWB 5CEYB 3I6LE 4OF6A 4I48B 2DTML 2L0DA 2BZDA 4KFZC 5JZ7D 3R8BB 4PJHE 4KPHL 1FRGH 3OKDB 3MODH 4UUJA 4Y4KD 1BOGB 3DNKA 4JRXD 4K9EC 2DDQL 4WI5A 5F7KC 1QRNA 4K3DL 4NZRL 4NO3A 1A1MB 2P49B 2EE2A 5I8EB 3BEVB 4XWOC 1JNJA 1N7ML 4LPVA 4Y7MA 4P46C 3ET9F 5DJXB 4ZG1A 2Z8WC 3MOAL 3B9AA 1BX2B 3HAEB 1Q9OA 3QXVA 4JZNA 4PB0L 4U1JB 1U58A 3MLSH 4NBYB 5CSGA 3CMOH 3GKWH 1RMFH 1FNHA 4QXGL 3FQWA 4EDXB 4PGJA 1Y6KR 3SGEH 2FSEB 5GRJH 4GBXC 3TO4B 3FRPA 1Q94A 4XAKE 1KIQA 4PRIE 4XVSH 1I8MB 4N5UA 4L4JA 1K9TA 4M7KH 3O3UN 4NC1E 4OB5L 2VLKE 3DX9B 4JRYB 2MCG1 4YXKH 3PHQA 1HH6B 4X5LA 5D2NC 1L9MA 3D2UA 1I7ZB 4POUB 4OBSA 4PUBH 2PYEB 2M8XA 3RL2A 1KT2A 5JUEL 3UEZA 1HSAA 3FO2A 3RIAF 5DRWB 1G6RL 3L3KA 3PQYA 4MX7A 4EN3A 3VW3H 1UKTA 4WEBL 2AK4D 2YPKB 4IOFC 1V7NL 3KLDA 1BIIA 2R1XB 4XCYA 2ZOLB 5L9DL 4P5TB 1R3KA 5F7YC 5IJVB 4YFDB 3SPVB 3HUJB 5SWSA 4UU9B 1WAAE 3RWEB 5D1QC 2ED8A 2DN7A 1O5DT 4NYLA 3C8DA 2WBJA 2XXCB 2Q3AA 3INUH 1BAFH 5F7FA 3E6HA 2G9HA 4OFDA 3R1GH 3SGDH 4DW2L 4F2MB 1KBGL 4O00A 3EZ8A 4Y4FB 2W9DL 1PLGL 4QRTB 5J6GB 4HCRA 2R39A 5D7IF 1YMMB 1OP5H 4GS7C 2QHLA 2V5MA 2FBOJ 1QPXA 3DRQB 3U7YH 1MUJA 4Z7WA 5KVEL 2MWCA 4KUCF 4RSVA 5ESQA 2RIKA 1RIHH 3LKOA 5MENA 5BS0D 4P2OA 3MMEB 4U1KB 2DWEA 2ZSVA 5E1AA 1S5HA 4GLRH 4ELMB 5J9PB 2I9TA 1A3LH 5FM8A 3EFFB 3GI8H 3VA2C 4J12A 5I76A 2VDNH 4MJ6B 1T7WA 3FT4B 4LHUA 5IB2B 2XWBA 3QULA 1CF8H 3K74B 3GK8L 3ARDB 3E1F1 5EOQL 2J6EL 1D6VH 5EC1A 4D2NA 1IAIH 3BHBB 1U8OA 3ZHKA 3MRNB 4YHNA 4OIIH 1QRND 5IMOB 3T77A 5K59E 5IGXH 4ALAL 3TNNA 3U4EA 5BZDA 1HYSC 4YXHL 5IESL 3STZB 4JFOA 1S7XA 5EU3A 4YDVB 1JVKA 3RU8H 4PJ8C 3F7VB 1CDCA 1PEZA 4HULB 3VRLE 5B38G 5I1EL 3WKNA 2GCYA 2NY4B 4ZPVB 4Z7NE 1I9JL 2E9BA 2XTJC 4RMQA 1IFHH 5EIIB 4RAHA 5EUKA 3TBWB 1AHWC 4MNQE 3X3FL 4X6CF 4P59H 2GFBA 3CX2A 1KCSH 2NZIA 5GIRA 4PJ9D 5KG9B 4KGJA 4P9HH 5F6HI 4M03A 1KELH 4BM7A 5C07E 3HPJA 2ATPA 1X4XA 5I6XB 4ODXB 1SBSH 1S9VB 1QEWA 3PXHA 3MBEC 5FDYA 1PZ5A 5HVFB 1QNZH 2HT2C 1MRDL 4HIJB 1AGBB 4M5ZH 5F9OH 3G6JA 1ADQA 5F9DC 4J3OC 1ETZB 4Y2DB 1J7VR 3QUZA 1YQ2A 1LDSA 5GSRA 1L7IL 4YR6A 4XNUH 2LTQC 4CAGA 4RQQB 3MBXH 1IKFL 8FABA 2LVEA 3PQYD 4EN3D 1OSPL 4PJXE 4B53A 4XMPL 5H37G 1NC2A 1T4KB 3KR3H 5DMYA 1EO5A 2AXGB 5C0IB 4KQ3H 1PVHA 4M61B 3PWPA 4HK3J 5F21B 4M00A 2AJUL 5SWSD 2Q76B 2BSSB 2BNQD 4UDTB 5IFJB 5IEKA 3QIBB 3IJYA 4JN1L 5C6WH 2E9WA 2WBJD 3FFDA 3LRSB 5DJ8B 2HRPH 5D6CB 3RVTC 3GSRB 3HB3C 2GSGA 4L8DB 1CD9B 3G08A 4BQCA 4W68A 4BYHA 1ROWA 5GGVH 3X13B 1A6ZA 3DIFA 1GJIA 4JDTH 5DJZA 5BZWA 4M1GL 4JDZA 1CG9A 5DEFB 5BO1H 4K8RD 1ZSDB 3RVVD 3WS3B 1EGJA 3DV6B 1U36A 2WWMC 1JWUB 2JJTA 4LNRA 1CXKA 5MEND 5CGYD 5LQBL 4P2OD 2Y6SC 2HFEB 4HIXL 1MFCL 4WNQA 3QIUC 3LD8C 1NSNH 5IWLA 5A43C 4HAGA 3MV01 3N1FC 4N0YL 5TGBB 1MJJA 1GGBL 4ZAKB 3C60B 3EO0B 1HCFX 1RZKC 5FYKD 1YQVL 2AJ3B 1ZT7B 5I17A 4LHUD 1AI1L 1MHCA 3P73A 3FMGH 4LHJB 3Q3GA 2VIRA 1ZLWK 4NO0B 4QO1A 3BH9A 4S11A 4TVPD 4M6AA 4Z0XA 4M8QA 2H9GB 5CJOH 3VD5A 3ULSB 3N1GC 5CP7B 4HGWB 4TVPL 4XMLL 5F93C 1E4XH 5BVPL 4BFIB 5LXGL 3AM8A 1YEKH 5DLML 1TLKA 2WLZA 1IGTA 4PJCE 2X6MA 5AD0B 4KK5D 1FNFA 1FNEB 3QIWA 2BVQB 4MNHA 3VFPA 4AL8L 2FDBP 4ODSH 4L3CB 3WLBB 1O7SA 2PTUA 1YNLH 2Q7YB 1XCTA 4WFHD 5CEXA 2NY5C 2DQEH 1XGPA 3KPLA 3OR6A 1OAKH 4PJDB 3QWRA 5INCA 4HH9B 5HGHA 5CS7A 4LAQL 2Y4SA 3UJIH 2I5YH 5FA3A 5L8KB 1MIEH 4NBZB 2C3WA 2FO4B 5FHAL 3QUZD 1U8PB 4KXZH 3VXUA 2B8OT 2UUDK 12E8L 1KTLA 3QXDB 1KN4L 1WC7A 2NY4D 1ADQL 2JB6A 4KJQC 5GGUB 5DJYA 4JG1H 3I84A 3KYKL 1NC2D 3EYSH 4U6XB 1CFTB 2FHFA 3LEXA 2GEEA 3PWPD 4NUGL 1FVDA 3ZYIA 1W8NA 1I1FB 3L5XL 1MVFA 4QXTA 2NZ9D 3H0TA 1JPSL 1EAJA 4KK8C 2FWOB 2XZCH 4L9LC 2BSTB 2WV3A 2XZQH 5DC9B 1TJHL 4PJAE 3FONB 1BMGA 1QG3A 1GIGL 1Q1JL 1A21A 5C09B 4IJ3B 4OZIB 5TJWK 2J4WH 2V7HA 3MRHB 5AZ2L 3TJEH 5JHLL 2B2XL 3AMKA 3CFBB 2W92A 3QDMA 2F53E 1KTRL 1QKZH 4JKKA 5E70A 2DM7A 2OL3A 4G80B 3U46B 4EBQL 1M05B 2IADB 3GJFB 3AGVA 3TVMB 4Z0BL 3OV6A 1GZPB 3EYFB 5FKPA 1JRHI 3CNKA 2X1WL 4OAWB 1F3DJ 1KLUB 3SDYL 1AGCA 5KVDH 1EGJL 4S1RL 4LCYA 2CK0H 3P0YL 3R06A 1BM3H 1HOCB 3T09A 2JIXD 2V2WB 2NY7H 2NNAB 5FCSH 5A2LH 4L9DA 4LLDB 5E8OB 1QSEE 3F7PC 3WHXB