3JTWA

Crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
176
Chain Sequence
ARKVILFIAMSIDNYIADDQGAVDWLEKNVHGTESDDSYEKMYSKIDTVIMGRTTYEQVTQKLSPEKYVYADRQTYIVTSHLGEDTDKIKYWKQSPVELVKRIQKEKGKDVWIVGGAKIIDPLVQANLIDTYILTTVPIFLGSGIRLFDRLEEQVPVRLIDVYQKNELVYSIYQRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative dihydrofolate reductase (YP_805003.1) from PEDIOCOCCUS PENTOSACEUS ATCC 25745 at 1.90 A resolution
rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Pediococcus pentosaceus atcc 25745
total genus 47
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3jtwA00
5HI6A 1RA3A 3F0VX 4XT6A 2ANQA 4KM0A 1M78A 1DG7A 1U70A 1OHJA 4XE6X 4X5FA 1DR1A 3QLYA 3DL5A 5CCCA 1JOLA 3TD8A 1HFRA 1CD2A 1KLKA 1DR2A 2OBCA 1DR4A 3CD2A 3K47A 4KAKA 3FRAX 1RA1A 4KD7A 3F91A 3DAUA 4KJJA 4XT4A 2JYBA 2FZIA 3F8ZA 3N0HA 1RX1A 3ZPGA 1DG8A 1RA9A 3SR5X 4ELFA 5JA3A 1AOEA 1RD7A 4IXED 5U27A 1RX7A 4PTHA 1DREA 4X5HA 5HSRA 3TQAA 1VJ3A 4LAHX 2ITHA 7DFRA 1DYJA 2D0KA 3KJRA 3IROA 3QFXA 1RB2A 3IA5A 1DLSA 3R33A 5E8QA 4H97A 5HQYA 3NXVA 4I13A 4OR7A 3TQBA 2BLCA 4NX6A 3SH2A 1PD9A 4G95A 1RX9A 3EX8A 3F0SX 3GHCA 3FRBX 4P3RA 4EIZA 5ECXA 4OSGA 2DRCA 1RX8A 4P66A 3OCHA 3GHVA 3QGTA 1RA8A 4HA7A 2W9SA 3D84X 4G3MA 3F0BX 1JUVA 4Q0EA 1DRFA 3EEKA 1DDSA 3HJ3A 3QG2A 4ECKA 3FQ0A 3I8AX 4QI9A 3QLRA 3F0XX 2FZJA 3QYOA 4FHBA 3FQZA 1BZFA 1JOMA 3DATA 4DPDA 1YHOA 4RGCA 1DLRA 2H2QA 4Q6AA 4ELBA 3IX9A 4LAGX 3UM6A 4H96A 2B3ZA 5HVEA 4QJZD 1J3IA 1KMSA 3E0BA 1DR6A 4QHVA 5HF2X 1RA2A 1RG7A 1DHJA 3QLXA 2HM9A 3FQOA 1M7AA 1KMVA 3LG4A 2ANOA 3GYFA 3SQYX 2LF1A 2HQPA 3QLWA 1LY3A 4PSYA 2L28A 4DPHA 4PDJA 1LY4A 4KYAA 3DL6A 5HT5A 4XECX 1RX6A 1DIUA 3FREX 5HPBA 3NZDA 2W3BA 4HA9A 3ZPCA 3ROAA 1DHIA 2HXVA 4H95A 4M6LA 3DGAA 3FL9A 4KJLA 4G8ZX 3KGYA 1RH3A 3FQCA 4M7UA 4ELGA 4IXGX 3SA1A 3K2HA 3QL3A 2W3VA 3QLSA 3JWMA 4HOGA 1CZ3A 4KY8A 2GD9A 1RX2A 3JTWA 4Q67A 1PD8A 1U71A 3EEJA 3KFYA 3CL9A 4QJCA 3FY9X 4QLEA 1DDRA 1OHKA 1RF7A 1S3YA 4KBNA 3EIGA 1SEJA 1DR3A 3S7AA 1IA3A 3CSEA 2BL9A 3SA2A 3NRRA 1ZDRA 1DG5A 3SRQX 4QLGA 1DF7A 1DR7A 4KY4A 1RX5A 3KY8A 1D1GA 5U26A 3SRSX 1VDRA 4GH8A 3CLBA 1DHFA 4IXFX 2C2SA 1DRHA 1S3WA 4DP3A 2AZNA 3UM5A 3EEMA 4LAEX 3M09A 1DYHA 1DYIA 4KEBA 5ECCA 3FQFA 1DRBA 1E26A 4PSTA 3TQ8A 4EIGA 1IA2A 1RX4A 3INVA 3FRDX 4I1NA 2CIGA 3S3VA 3JWKA 3FQVA 3SAIA 4KFJA 1BOZA 2ZZAA 3JWCA 1LUDA 5HQZA 2INQA 1QZFA 5JG0X 3FY8X 3NZ9X 3NXRA 4EJ1A 2P4GA 2W9HA 3RO9A 5HVBA 1RB3A 3S9UA 4KL9A 4PTJA 3TQ9A 2DHFA 1HFPA 3Q1HA 4DDRA 5HF0X 4KLXA 5DXVA 3F0UX 1DR5A 3SGYA 4X5JA 4XRBA 4ELEA 2C2TA 3D80A 4XT5A 4FGHA 4Q0DA 3NZAX 1RC4A 2G6VA 1S3UA 2XW7A 1J3JA 1HFQA 3QL0A 4LEKX 3JWFA 3GI2A 2FZHA 3GHWA 4NX7A 1J3KA 3NXXA 1U72A 4QLFA 3K45A 4HOFA 3QYLA 3JW5A 2W9GA 3FYVX 6DFRA 2W3MA 4KNEA 4X5IA 3HBBA 3FYWX 4KJKA 1RX3A 2BLAA 3NZBX 2KGKA 3FL8A 3F0QX 4CD2A 3IRNA 2W3AA 4M6KA 5CC9A 3IRMA 3EELA 2O7PA 1MVTA 3NZCX 2W3WA 3F8YA 3DFRA 1AO8A 3JVXA 1DAJA 1TDRA 5HT4A 1MVSA 4KM2A 3L3RA 2W9TA 5DFRA 3VCOA 2CD2A 4TU5X 5FDAA 2QK8A 4FGGA 3KJSA 3UM8A 1PDBA 3SRRX 4X5GA 4H98A 3NXTA 4PSSA 1DISA 3QLZA 3NXYA 4P68A 1RE7A 2BLBA 3JSUA 3RG9A 3SRUX 3NZ6X 3M08A 3FRFX 3NU0A 4HOEA 1AI9A 5EAJA 3K74A 4XT8A 3FS6A 3NTZA 4P3QA 1IA4A 4DFRA 2OIPA 4M7VA 1S3VA 8DFRA 4M6JA 1IA1A 3NXOA 5HSUA 5HUIA 4XT7A 1DRAA 3DRCA 3OAFA 4EILA 2D5NA 3JW3A 1DYRA 3I3RA 1M79A 4ELHA 3DG8A 3IA4A 4M2XA 3SRWX
chains in the Genus database with same CATH superfamily
5HI6A 1RA3A 3F0VX 4XT6A 2ANQA 4KM0A 1M78A 1DG7A 1U70A 1OHJA 4XE6X 4X5FA 1DR1A 3QLYA 3DL5A 5CCCA 1JOLA 3TD8A 1HFRA 1CD2A 1KLKA 1DR2A 2OBCA 1DR4A 3CD2A 3K47A 4KAKA 3FRAX 1RA1A 4KD7A 3F91A 3DAUA 4KJJA 4XT4A 2JYBA 2FZIA 3F8ZA 3N0HA 1RX1A 3ZPGA 1DG8A 1RA9A 3SR5X 4ELFA 5JA3A 1AOEA 1RD7A 4IXED 5U27A 1RX7A 4PTHA 1DREA 4X5HA 5HSRA 3TQAA 1VJ3A 4LAHX 2ITHA 7DFRA 1DYJA 2D0KA 3KJRA 3IROA 3QFXA 1RB2A 3IA5A 1DLSA 3R33A 5E8QA 4H97A 5HQYA 3NXVA 4I13A 4OR7A 3TQBA 2BLCA 4NX6A 3SH2A 1PD9A 4G95A 1RX9A 3EX8A 3F0SX 3GHCA 3FRBX 4P3RA 4EIZA 5ECXA 4OSGA 2DRCA 1RX8A 4P66A 3OCHA 3GHVA 3QGTA 1RA8A 4HA7A 2W9SA 3D84X 4G3MA 3F0BX 1JUVA 4Q0EA 1DRFA 3EEKA 1DDSA 3HJ3A 3QG2A 4ECKA 3FQ0A 3I8AX 4QI9A 3QLRA 3F0XX 2FZJA 3QYOA 4FHBA 3FQZA 1BZFA 1JOMA 3DATA 4DPDA 1YHOA 4RGCA 1DLRA 2H2QA 4Q6AA 4ELBA 3IX9A 4LAGX 3UM6A 4H96A 2B3ZA 5HVEA 4QJZD 1J3IA 1KMSA 3E0BA 1DR6A 4QHVA 5HF2X 1RA2A 1RG7A 1DHJA 3QLXA 2HM9A 3FQOA 1M7AA 1KMVA 3LG4A 2ANOA 3GYFA 3SQYX 2LF1A 2HQPA 3QLWA 1LY3A 4PSYA 2L28A 4DPHA 4PDJA 1LY4A 4KYAA 3DL6A 5HT5A 4XECX 1RX6A 1DIUA 3FREX 5HPBA 3NZDA 2W3BA 4HA9A 3ZPCA 3ROAA 1DHIA 2HXVA 4H95A 4M6LA 3DGAA 3FL9A 4KJLA 4G8ZX 3KGYA 1RH3A 3FQCA 4M7UA 4ELGA 4IXGX 3SA1A 3K2HA 3QL3A 2W3VA 3QLSA 3JWMA 4HOGA 1CZ3A 4KY8A 2GD9A 1RX2A 3JTWA 4Q67A 1PD8A 1U71A 3EEJA 3KFYA 3CL9A 4QJCA 3FY9X 4QLEA 1DDRA 1OHKA 1RF7A 1S3YA 4KBNA 3EIGA 1SEJA 1DR3A 3S7AA 1IA3A 3CSEA 2BL9A 3SA2A 3NRRA 1ZDRA 1DG5A 3SRQX 4QLGA 1DF7A 1DR7A 4KY4A 1RX5A 3KY8A 1D1GA 5U26A 3SRSX 1VDRA 4GH8A 3CLBA 1DHFA 4IXFX 2C2SA 1DRHA 1S3WA 4DP3A 2AZNA 3UM5A 3EEMA 4LAEX 3M09A 1DYHA 1DYIA 4KEBA 5ECCA 3FQFA 1DRBA 1E26A 4PSTA 3TQ8A 4EIGA 1IA2A 1RX4A 3INVA 3FRDX 4I1NA 2CIGA 3S3VA 3JWKA 3FQVA 3SAIA 4KFJA 1BOZA 2ZZAA 3JWCA 1LUDA 5HQZA 2INQA 1QZFA 5JG0X 3FY8X 3NZ9X 3NXRA 4EJ1A 2P4GA 2W9HA 3RO9A 5HVBA 1RB3A 3S9UA 4KL9A 4PTJA 3TQ9A 2DHFA 1HFPA 3Q1HA 4DDRA 5HF0X 4KLXA 5DXVA 3F0UX 1DR5A 3SGYA 4X5JA 4XRBA 4ELEA 2C2TA 3D80A 4XT5A 4FGHA 4Q0DA 3NZAX 1RC4A 2G6VA 1S3UA 2XW7A 1J3JA 1HFQA 3QL0A 4LEKX 3JWFA 3GI2A 2FZHA 3GHWA 4NX7A 1J3KA 3NXXA 1U72A 4QLFA 3K45A 4HOFA 3QYLA 3JW5A 2W9GA 3FYVX 6DFRA 2W3MA 4KNEA 4X5IA 3HBBA 3FYWX 4KJKA 1RX3A 2BLAA 3NZBX 2KGKA 3FL8A 3F0QX 4CD2A 3IRNA 2W3AA 4M6KA 5CC9A 3IRMA 3EELA 2O7PA 1MVTA 3NZCX 2W3WA 3F8YA 3DFRA 1AO8A 3JVXA 1DAJA 1TDRA 5HT4A 1MVSA 4KM2A 3L3RA 2W9TA 5DFRA 3VCOA 2CD2A 4TU5X 5FDAA 2QK8A 4FGGA 3KJSA 3UM8A 1PDBA 3SRRX 4X5GA 4H98A 3NXTA 4PSSA 1DISA 3QLZA 3NXYA 4P68A 1RE7A 2BLBA 3JSUA 3RG9A 3SRUX 3NZ6X 3M08A 3FRFX 3NU0A 4HOEA 1AI9A 5EAJA 3K74A 4XT8A 3FS6A 3NTZA 4P3QA 1IA4A 4DFRA 2OIPA 4M7VA 1S3VA 8DFRA 4M6JA 1IA1A 3NXOA 5HSUA 5HUIA 4XT7A 1DRAA 3DRCA 3OAFA 4EILA 2D5NA 3JW3A 1DYRA 3I3RA 1M79A 4ELHA 3DG8A 3IA4A 4M2XA 3SRWX
chains in the Genus database with same CATH topology
5HI6A 1RA3A 3F0VX 4XT6A 2ANQA 4KM0A 1M78A 1DG7A 1U70A 1OHJA 4XE6X 4X5FA 1DR1A 3QLYA 3DL5A 5CCCA 1JOLA 3TD8A 1HFRA 1CD2A 1KLKA 1DR2A 2OBCA 1DR4A 3CD2A 3K47A 4KAKA 3FRAX 1RA1A 4KD7A 3F91A 3DAUA 4KJJA 4XT4A 2JYBA 2FZIA 3F8ZA 3N0HA 1RX1A 3ZPGA 1DG8A 1RA9A 3SR5X 4ELFA 5JA3A 1AOEA 1RD7A 4IXED 5U27A 1RX7A 4PTHA 1DREA 4X5HA 5HSRA 3TQAA 1VJ3A 4LAHX 2ITHA 7DFRA 1DYJA 2D0KA 3KJRA 3IROA 3QFXA 1RB2A 3IA5A 1DLSA 3R33A 5E8QA 4H97A 5HQYA 3NXVA 4I13A 4OR7A 3TQBA 2BLCA 4NX6A 3SH2A 1PD9A 4G95A 1RX9A 3EX8A 3F0SX 3GHCA 3FRBX 4P3RA 4EIZA 5ECXA 4OSGA 2DRCA 1RX8A 4P66A 3OCHA 3GHVA 3QGTA 1RA8A 4HA7A 2W9SA 3D84X 4G3MA 3F0BX 1JUVA 4Q0EA 1DRFA 3EEKA 1DDSA 3HJ3A 3QG2A 4ECKA 3FQ0A 3I8AX 4QI9A 3QLRA 3F0XX 2FZJA 3QYOA 4FHBA 3FQZA 1BZFA 1JOMA 3DATA 4DPDA 1YHOA 4RGCA 1DLRA 2H2QA 4Q6AA 4ELBA 3IX9A 4LAGX 3UM6A 4H96A 2B3ZA 5HVEA 4QJZD 1J3IA 1KMSA 3E0BA 1DR6A 4QHVA 5HF2X 1RA2A 1RG7A 1DHJA 3QLXA 2HM9A 3FQOA 1M7AA 1KMVA 3LG4A 2ANOA 3GYFA 3SQYX 2LF1A 2HQPA 3QLWA 1LY3A 4PSYA 2L28A 4DPHA 4PDJA 1LY4A 4KYAA 3DL6A 5HT5A 4XECX 1RX6A 1DIUA 3FREX 5HPBA 3NZDA 2W3BA 4HA9A 3ZPCA 3ROAA 1DHIA 2HXVA 4H95A 4M6LA 3DGAA 3FL9A 4KJLA 4G8ZX 3KGYA 1RH3A 3FQCA 4M7UA 4ELGA 4IXGX 3SA1A 3K2HA 3QL3A 2W3VA 3QLSA 3JWMA 4HOGA 1CZ3A 4KY8A 2GD9A 1RX2A 3JTWA 4Q67A 1PD8A 1U71A 3EEJA 3KFYA 3CL9A 4QJCA 3FY9X 4QLEA 1DDRA 1OHKA 1RF7A 1S3YA 4KBNA 3EIGA 1SEJA 1DR3A 3S7AA 1IA3A 3CSEA 2BL9A 3SA2A 3NRRA 1ZDRA 1DG5A 3SRQX 4QLGA 1DF7A 1DR7A 4KY4A 1RX5A 3KY8A 1D1GA 5U26A 3SRSX 1VDRA 4GH8A 3CLBA 1DHFA 4IXFX 2C2SA 1DRHA 1S3WA 4DP3A 2AZNA 3UM5A 3EEMA 4LAEX 3M09A 1DYHA 1DYIA 4KEBA 5ECCA 3FQFA 1DRBA 1E26A 4PSTA 3TQ8A 4EIGA 1IA2A 1RX4A 3INVA 3FRDX 4I1NA 2CIGA 3S3VA 3JWKA 3FQVA 3SAIA 4KFJA 1BOZA 2ZZAA 3JWCA 1LUDA 5HQZA 2INQA 1QZFA 5JG0X 3FY8X 3NZ9X 3NXRA 4EJ1A 2P4GA 2W9HA 3RO9A 5HVBA 1RB3A 3S9UA 4KL9A 4PTJA 3TQ9A 2DHFA 1HFPA 3Q1HA 4DDRA 5HF0X 4KLXA 5DXVA 3F0UX 1DR5A 3SGYA 4X5JA 4XRBA 4ELEA 2C2TA 3D80A 4XT5A 4FGHA 4Q0DA 3NZAX 1RC4A 2G6VA 1S3UA 2XW7A 1J3JA 1HFQA 3QL0A 4LEKX 3JWFA 3GI2A 2FZHA 3GHWA 4NX7A 1J3KA 3NXXA 1U72A 4QLFA 3K45A 4HOFA 3QYLA 3JW5A 2W9GA 3FYVX 6DFRA 2W3MA 4KNEA 4X5IA 3HBBA 3FYWX 4KJKA 1RX3A 2BLAA 3NZBX 2KGKA 3FL8A 3F0QX 4CD2A 3IRNA 2W3AA 4M6KA 5CC9A 3IRMA 3EELA 2O7PA 1MVTA 3NZCX 2W3WA 3F8YA 3DFRA 1AO8A 3JVXA 1DAJA 1TDRA 5HT4A 1MVSA 4KM2A 3L3RA 2W9TA 5DFRA 3VCOA 2CD2A 4TU5X 5FDAA 2QK8A 4FGGA 3KJSA 3UM8A 1PDBA 3SRRX 4X5GA 4H98A 3NXTA 4PSSA 1DISA 3QLZA 3NXYA 4P68A 1RE7A 2BLBA 3JSUA 3RG9A 3SRUX 3NZ6X 3M08A 3FRFX 3NU0A 4HOEA 1AI9A 5EAJA 3K74A 4XT8A 3FS6A 3NTZA 4P3QA 1IA4A 4DFRA 2OIPA 4M7VA 1S3VA 8DFRA 4M6JA 1IA1A 3NXOA 5HSUA 5HUIA 4XT7A 1DRAA 3DRCA 3OAFA 4EILA 2D5NA 3JW3A 1DYRA 3I3RA 1M79A 4ELHA 3DG8A 3IA4A 4M2XA 3SRWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI6 A;  1RA3 A;  3F0V X;  4XT6 A;  2ANQ A;  4KM0 A;  1M78 A;  1DG7 A;  1U70 A;  1OHJ A;  4XE6 X;  4X5F A;  1DR1 A;  3QLY A;  3DL5 A;  5CCC A;  1JOL A;  3TD8 A;  1HFR A;  1CD2 A;  1KLK A;  1DR2 A;  2OBC A;  1DR4 A;  3CD2 A;  3K47 A;  4KAK A;  3FRA X;  1RA1 A;  4KD7 A;  3F91 A;  3DAU A;  4KJJ A;  4XT4 A;  2JYB A;  2FZI A;  3F8Z A;  3N0H A;  1RX1 A;  3ZPG A;  1DG8 A;  1RA9 A;  3SR5 X;  4ELF A;  5JA3 A;  1AOE A;  1RD7 A;  4IXE D;  5U27 A;  1RX7 A;  4PTH A;  1DRE A;  4X5H A;  5HSR A;  3TQA A;  1VJ3 A;  4LAH X;  2ITH A;  7DFR A;  1DYJ A;  2D0K A;  3KJR A;  3IRO A;  3QFX A;  1RB2 A;  3IA5 A;  1DLS A;  3R33 A;  5E8Q A;  4H97 A;  5HQY A;  3NXV A;  4I13 A;  4OR7 A;  3TQB A;  2BLC A;  4NX6 A;  3SH2 A;  1PD9 A;  4G95 A;  1RX9 A;  3EX8 A;  3F0S X;  3GHC A;  3FRB X;  4P3R A;  4EIZ A;  5ECX A;  4OSG A;  2DRC A;  1RX8 A;  4P66 A;  3OCH A;  3GHV A;  3QGT A;  1RA8 A;  4HA7 A;  2W9S A;  3D84 X;  4G3M A;  3F0B X;  1JUV A;  4Q0E A;  1DRF A;  3EEK A;  1DDS A;  3HJ3 A;  3QG2 A;  4ECK A;  3FQ0 A;  3I8A X;  4QI9 A;  3QLR A;  3F0X X;  2FZJ A;  3QYO A;  4FHB A;  3FQZ A;  1BZF A;  1JOM A;  3DAT A;  4DPD A;  1YHO A;  4RGC A;  1DLR A;  2H2Q A;  4Q6A A;  4ELB A;  3IX9 A;  4LAG X;  3UM6 A;  4H96 A;  2B3Z A;  5HVE A;  4QJZ D;  1J3I A;  1KMS A;  3E0B A;  1DR6 A;  4QHV A;  5HF2 X;  1RA2 A;  1RG7 A;  1DHJ A;  3QLX A;  2HM9 A;  3FQO A;  1M7A A;  1KMV A;  3LG4 A;  2ANO A;  3GYF A;  3SQY X;  2LF1 A;  2HQP A;  3QLW A;  1LY3 A;  4PSY A;  2L28 A;  4DPH A;  4PDJ A;  1LY4 A;  4KYA A;  3DL6 A;  5HT5 A;  4XEC X;  1RX6 A;  1DIU A;  3FRE X;  5HPB A;  3NZD A;  2W3B A;  4HA9 A;  3ZPC A;  3ROA A;  1DHI A;  2HXV A;  4H95 A;  4M6L A;  3DGA A;  3FL9 A;  4KJL A;  4G8Z X;  3KGY A;  1RH3 A;  3FQC A;  4M7U A;  4ELG A;  4IXG X;  3SA1 A;  3K2H A;  3QL3 A;  2W3V A;  3QLS A;  3JWM A;  4HOG A;  1CZ3 A;  4KY8 A;  2GD9 A;  1RX2 A;  3JTW A;  4Q67 A;  1PD8 A;  1U71 A;  3EEJ A;  3KFY A;  3CL9 A;  4QJC A;  3FY9 X;  4QLE A;  1DDR A;  1OHK A;  1RF7 A;  1S3Y A;  4KBN A;  3EIG A;  1SEJ A;  1DR3 A;  3S7A A;  1IA3 A;  3CSE A;  2BL9 A;  3SA2 A;  3NRR A;  1ZDR A;  1DG5 A;  3SRQ X;  4QLG A;  1DF7 A;  1DR7 A;  4KY4 A;  1RX5 A;  3KY8 A;  1D1G A;  5U26 A;  3SRS X;  1VDR A;  4GH8 A;  3CLB A;  1DHF A;  4IXF X;  2C2S A;  1DRH A;  1S3W A;  4DP3 A;  2AZN A;  3UM5 A;  3EEM A;  4LAE X;  3M09 A;  1DYH A;  1DYI A;  4KEB A;  5ECC A;  3FQF A;  1DRB A;  1E26 A;  4PST A;  3TQ8 A;  4EIG A;  1IA2 A;  1RX4 A;  3INV A;  3FRD X;  4I1N A;  2CIG A;  3S3V A;  3JWK A;  3FQV A;  3SAI A;  4KFJ A;  1BOZ A;  2ZZA A;  3JWC A;  1LUD A;  5HQZ A;  2INQ A;  1QZF A;  5JG0 X;  3FY8 X;  3NZ9 X;  3NXR A;  4EJ1 A;  2P4G A;  2W9H A;  3RO9 A;  5HVB A;  1RB3 A;  3S9U A;  4KL9 A;  4PTJ A;  3TQ9 A;  2DHF A;  1HFP A;  3Q1H A;  4DDR A;  5HF0 X;  4KLX A;  5DXV A;  3F0U X;  1DR5 A;  3SGY A;  4X5J A;  4XRB A;  4ELE A;  2C2T A;  3D80 A;  4XT5 A;  4FGH A;  4Q0D A;  3NZA X;  1RC4 A;  2G6V A;  1S3U A;  2XW7 A;  1J3J A;  1HFQ A;  3QL0 A;  4LEK X;  3JWF A;  3GI2 A;  2FZH A;  3GHW A;  4NX7 A;  1J3K A;  3NXX A;  1U72 A;  4QLF A;  3K45 A;  4HOF A;  3QYL A;  3JW5 A;  2W9G A;  3FYV X;  6DFR A;  2W3M A;  4KNE A;  4X5I A;  3HBB A;  3FYW X;  4KJK A;  1RX3 A;  2BLA A;  3NZB X;  2KGK A;  3FL8 A;  3F0Q X;  4CD2 A;  3IRN A;  2W3A A;  4M6K A;  5CC9 A;  3IRM A;  3EEL A;  2O7P A;  1MVT A;  3NZC X;  2W3W A;  3F8Y A;  3DFR A;  1AO8 A;  3JVX A;  1DAJ A;  1TDR A;  5HT4 A;  1MVS A;  4KM2 A;  3L3R A;  2W9T A;  5DFR A;  3VCO A;  2CD2 A;  4TU5 X;  5FDA A;  2QK8 A;  4FGG A;  3KJS A;  3UM8 A;  1PDB A;  3SRR X;  4X5G A;  4H98 A;  3NXT A;  4PSS A;  1DIS A;  3QLZ A;  3NXY A;  4P68 A;  1RE7 A;  2BLB A;  3JSU A;  3RG9 A;  3SRU X;  3NZ6 X;  3M08 A;  3FRF X;  3NU0 A;  4HOE A;  1AI9 A;  5EAJ A;  3K74 A;  4XT8 A;  3FS6 A;  3NTZ A;  4P3Q A;  1IA4 A;  4DFR A;  2OIP A;  4M7V A;  1S3V A;  8DFR A;  4M6J A;  1IA1 A;  3NXO A;  5HSU A;  5HUI A;  4XT7 A;  1DRA A;  3DRC A;  3OAF A;  4EIL A;  2D5N A;  3JW3 A;  1DYR A;  3I3R A;  1M79 A;  4ELH A;  3DG8 A;  3IA4 A;  4M2X A;  3SRW X; 
#chains in the Genus database with same CATH topology
 5HI6 A;  1RA3 A;  3F0V X;  4XT6 A;  2ANQ A;  4KM0 A;  1M78 A;  1DG7 A;  1U70 A;  1OHJ A;  4XE6 X;  4X5F A;  1DR1 A;  3QLY A;  3DL5 A;  5CCC A;  1JOL A;  3TD8 A;  1HFR A;  1CD2 A;  1KLK A;  1DR2 A;  2OBC A;  1DR4 A;  3CD2 A;  3K47 A;  4KAK A;  3FRA X;  1RA1 A;  4KD7 A;  3F91 A;  3DAU A;  4KJJ A;  4XT4 A;  2JYB A;  2FZI A;  3F8Z A;  3N0H A;  1RX1 A;  3ZPG A;  1DG8 A;  1RA9 A;  3SR5 X;  4ELF A;  5JA3 A;  1AOE A;  1RD7 A;  4IXE D;  5U27 A;  1RX7 A;  4PTH A;  1DRE A;  4X5H A;  5HSR A;  3TQA A;  1VJ3 A;  4LAH X;  2ITH A;  7DFR A;  1DYJ A;  2D0K A;  3KJR A;  3IRO A;  3QFX A;  1RB2 A;  3IA5 A;  1DLS A;  3R33 A;  5E8Q A;  4H97 A;  5HQY A;  3NXV A;  4I13 A;  4OR7 A;  3TQB A;  2BLC A;  4NX6 A;  3SH2 A;  1PD9 A;  4G95 A;  1RX9 A;  3EX8 A;  3F0S X;  3GHC A;  3FRB X;  4P3R A;  4EIZ A;  5ECX A;  4OSG A;  2DRC A;  1RX8 A;  4P66 A;  3OCH A;  3GHV A;  3QGT A;  1RA8 A;  4HA7 A;  2W9S A;  3D84 X;  4G3M A;  3F0B X;  1JUV A;  4Q0E A;  1DRF A;  3EEK A;  1DDS A;  3HJ3 A;  3QG2 A;  4ECK A;  3FQ0 A;  3I8A X;  4QI9 A;  3QLR A;  3F0X X;  2FZJ A;  3QYO A;  4FHB A;  3FQZ A;  1BZF A;  1JOM A;  3DAT A;  4DPD A;  1YHO A;  4RGC A;  1DLR A;  2H2Q A;  4Q6A A;  4ELB A;  3IX9 A;  4LAG X;  3UM6 A;  4H96 A;  2B3Z A;  5HVE A;  4QJZ D;  1J3I A;  1KMS A;  3E0B A;  1DR6 A;  4QHV A;  5HF2 X;  1RA2 A;  1RG7 A;  1DHJ A;  3QLX A;  2HM9 A;  3FQO A;  1M7A A;  1KMV A;  3LG4 A;  2ANO A;  3GYF A;  3SQY X;  2LF1 A;  2HQP A;  3QLW A;  1LY3 A;  4PSY A;  2L28 A;  4DPH A;  4PDJ A;  1LY4 A;  4KYA A;  3DL6 A;  5HT5 A;  4XEC X;  1RX6 A;  1DIU A;  3FRE X;  5HPB A;  3NZD A;  2W3B A;  4HA9 A;  3ZPC A;  3ROA A;  1DHI A;  2HXV A;  4H95 A;  4M6L A;  3DGA A;  3FL9 A;  4KJL A;  4G8Z X;  3KGY A;  1RH3 A;  3FQC A;  4M7U A;  4ELG A;  4IXG X;  3SA1 A;  3K2H A;  3QL3 A;  2W3V A;  3QLS A;  3JWM A;  4HOG A;  1CZ3 A;  4KY8 A;  2GD9 A;  1RX2 A;  3JTW A;  4Q67 A;  1PD8 A;  1U71 A;  3EEJ A;  3KFY A;  3CL9 A;  4QJC A;  3FY9 X;  4QLE A;  1DDR A;  1OHK A;  1RF7 A;  1S3Y A;  4KBN A;  3EIG A;  1SEJ A;  1DR3 A;  3S7A A;  1IA3 A;  3CSE A;  2BL9 A;  3SA2 A;  3NRR A;  1ZDR A;  1DG5 A;  3SRQ X;  4QLG A;  1DF7 A;  1DR7 A;  4KY4 A;  1RX5 A;  3KY8 A;  1D1G A;  5U26 A;  3SRS X;  1VDR A;  4GH8 A;  3CLB A;  1DHF A;  4IXF X;  2C2S A;  1DRH A;  1S3W A;  4DP3 A;  2AZN A;  3UM5 A;  3EEM A;  4LAE X;  3M09 A;  1DYH A;  1DYI A;  4KEB A;  5ECC A;  3FQF A;  1DRB A;  1E26 A;  4PST A;  3TQ8 A;  4EIG A;  1IA2 A;  1RX4 A;  3INV A;  3FRD X;  4I1N A;  2CIG A;  3S3V A;  3JWK A;  3FQV A;  3SAI A;  4KFJ A;  1BOZ A;  2ZZA A;  3JWC A;  1LUD A;  5HQZ A;  2INQ A;  1QZF A;  5JG0 X;  3FY8 X;  3NZ9 X;  3NXR A;  4EJ1 A;  2P4G A;  2W9H A;  3RO9 A;  5HVB A;  1RB3 A;  3S9U A;  4KL9 A;  4PTJ A;  3TQ9 A;  2DHF A;  1HFP A;  3Q1H A;  4DDR A;  5HF0 X;  4KLX A;  5DXV A;  3F0U X;  1DR5 A;  3SGY A;  4X5J A;  4XRB A;  4ELE A;  2C2T A;  3D80 A;  4XT5 A;  4FGH A;  4Q0D A;  3NZA X;  1RC4 A;  2G6V A;  1S3U A;  2XW7 A;  1J3J A;  1HFQ A;  3QL0 A;  4LEK X;  3JWF A;  3GI2 A;  2FZH A;  3GHW A;  4NX7 A;  1J3K A;  3NXX A;  1U72 A;  4QLF A;  3K45 A;  4HOF A;  3QYL A;  3JW5 A;  2W9G A;  3FYV X;  6DFR A;  2W3M A;  4KNE A;  4X5I A;  3HBB A;  3FYW X;  4KJK A;  1RX3 A;  2BLA A;  3NZB X;  2KGK A;  3FL8 A;  3F0Q X;  4CD2 A;  3IRN A;  2W3A A;  4M6K A;  5CC9 A;  3IRM A;  3EEL A;  2O7P A;  1MVT A;  3NZC X;  2W3W A;  3F8Y A;  3DFR A;  1AO8 A;  3JVX A;  1DAJ A;  1TDR A;  5HT4 A;  1MVS A;  4KM2 A;  3L3R A;  2W9T A;  5DFR A;  3VCO A;  2CD2 A;  4TU5 X;  5FDA A;  2QK8 A;  4FGG A;  3KJS A;  3UM8 A;  1PDB A;  3SRR X;  4X5G A;  4H98 A;  3NXT A;  4PSS A;  1DIS A;  3QLZ A;  3NXY A;  4P68 A;  1RE7 A;  2BLB A;  3JSU A;  3RG9 A;  3SRU X;  3NZ6 X;  3M08 A;  3FRF X;  3NU0 A;  4HOE A;  1AI9 A;  5EAJ A;  3K74 A;  4XT8 A;  3FS6 A;  3NTZ A;  4P3Q A;  1IA4 A;  4DFR A;  2OIP A;  4M7V A;  1S3V A;  8DFR A;  4M6J A;  1IA1 A;  3NXO A;  5HSU A;  5HUI A;  4XT7 A;  1DRA A;  3DRC A;  3OAF A;  4EIL A;  2D5N A;  3JW3 A;  1DYR A;  3I3R A;  1M79 A;  4ELH A;  3DG8 A;  3IA4 A;  4M2X A;  3SRW X; 
#chains in the Genus database with same CATH homology
 5HI6 A;  1RA3 A;  3F0V X;  4XT6 A;  2ANQ A;  4KM0 A;  1M78 A;  1DG7 A;  1U70 A;  1OHJ A;  4XE6 X;  4X5F A;  1DR1 A;  3QLY A;  3DL5 A;  5CCC A;  1JOL A;  3TD8 A;  1HFR A;  1CD2 A;  1KLK A;  1DR2 A;  2OBC A;  1DR4 A;  3CD2 A;  3K47 A;  4KAK A;  3FRA X;  1RA1 A;  4KD7 A;  3F91 A;  3DAU A;  4KJJ A;  4XT4 A;  2JYB A;  2FZI A;  3F8Z A;  3N0H A;  1RX1 A;  3ZPG A;  1DG8 A;  1RA9 A;  3SR5 X;  4ELF A;  5JA3 A;  1AOE A;  1RD7 A;  4IXE D;  5U27 A;  1RX7 A;  4PTH A;  1DRE A;  4X5H A;  5HSR A;  3TQA A;  1VJ3 A;  4LAH X;  2ITH A;  7DFR A;  1DYJ A;  2D0K A;  3KJR A;  3IRO A;  3QFX A;  1RB2 A;  3IA5 A;  1DLS A;  3R33 A;  5E8Q A;  4H97 A;  5HQY A;  3NXV A;  4I13 A;  4OR7 A;  3TQB A;  2BLC A;  4NX6 A;  3SH2 A;  1PD9 A;  4G95 A;  1RX9 A;  3EX8 A;  3F0S X;  3GHC A;  3FRB X;  4P3R A;  4EIZ A;  5ECX A;  4OSG A;  2DRC A;  1RX8 A;  4P66 A;  3OCH A;  3GHV A;  3QGT A;  1RA8 A;  4HA7 A;  2W9S A;  3D84 X;  4G3M A;  3F0B X;  1JUV A;  4Q0E A;  1DRF A;  3EEK A;  1DDS A;  3HJ3 A;  3QG2 A;  4ECK A;  3FQ0 A;  3I8A X;  4QI9 A;  3QLR A;  3F0X X;  2FZJ A;  3QYO A;  4FHB A;  3FQZ A;  1BZF A;  1JOM A;  3DAT A;  4DPD A;  1YHO A;  4RGC A;  1DLR A;  2H2Q A;  4Q6A A;  4ELB A;  3IX9 A;  4LAG X;  3UM6 A;  4H96 A;  2B3Z A;  5HVE A;  4QJZ D;  1J3I A;  1KMS A;  3E0B A;  1DR6 A;  4QHV A;  5HF2 X;  1RA2 A;  1RG7 A;  1DHJ A;  3QLX A;  2HM9 A;  3FQO A;  1M7A A;  1KMV A;  3LG4 A;  2ANO A;  3GYF A;  3SQY X;  2LF1 A;  2HQP A;  3QLW A;  1LY3 A;  4PSY A;  2L28 A;  4DPH A;  4PDJ A;  1LY4 A;  4KYA A;  3DL6 A;  5HT5 A;  4XEC X;  1RX6 A;  1DIU A;  3FRE X;  5HPB A;  3NZD A;  2W3B A;  4HA9 A;  3ZPC A;  3ROA A;  1DHI A;  2HXV A;  4H95 A;  4M6L A;  3DGA A;  3FL9 A;  4KJL A;  4G8Z X;  3KGY A;  1RH3 A;  3FQC A;  4M7U A;  4ELG A;  4IXG X;  3SA1 A;  3K2H A;  3QL3 A;  2W3V A;  3QLS A;  3JWM A;  4HOG A;  1CZ3 A;  4KY8 A;  2GD9 A;  1RX2 A;  3JTW A;  4Q67 A;  1PD8 A;  1U71 A;  3EEJ A;  3KFY A;  3CL9 A;  4QJC A;  3FY9 X;  4QLE A;  1DDR A;  1OHK A;  1RF7 A;  1S3Y A;  4KBN A;  3EIG A;  1SEJ A;  1DR3 A;  3S7A A;  1IA3 A;  3CSE A;  2BL9 A;  3SA2 A;  3NRR A;  1ZDR A;  1DG5 A;  3SRQ X;  4QLG A;  1DF7 A;  1DR7 A;  4KY4 A;  1RX5 A;  3KY8 A;  1D1G A;  5U26 A;  3SRS X;  1VDR A;  4GH8 A;  3CLB A;  1DHF A;  4IXF X;  2C2S A;  1DRH A;  1S3W A;  4DP3 A;  2AZN A;  3UM5 A;  3EEM A;  4LAE X;  3M09 A;  1DYH A;  1DYI A;  4KEB A;  5ECC A;  3FQF A;  1DRB A;  1E26 A;  4PST A;  3TQ8 A;  4EIG A;  1IA2 A;  1RX4 A;  3INV A;  3FRD X;  4I1N A;  2CIG A;  3S3V A;  3JWK A;  3FQV A;  3SAI A;  4KFJ A;  1BOZ A;  2ZZA A;  3JWC A;  1LUD A;  5HQZ A;  2INQ A;  1QZF A;  5JG0 X;  3FY8 X;  3NZ9 X;  3NXR A;  4EJ1 A;  2P4G A;  2W9H A;  3RO9 A;  5HVB A;  1RB3 A;  3S9U A;  4KL9 A;  4PTJ A;  3TQ9 A;  2DHF A;  1HFP A;  3Q1H A;  4DDR A;  5HF0 X;  4KLX A;  5DXV A;  3F0U X;  1DR5 A;  3SGY A;  4X5J A;  4XRB A;  4ELE A;  2C2T A;  3D80 A;  4XT5 A;  4FGH A;  4Q0D A;  3NZA X;  1RC4 A;  2G6V A;  1S3U A;  2XW7 A;  1J3J A;  1HFQ A;  3QL0 A;  4LEK X;  3JWF A;  3GI2 A;  2FZH A;  3GHW A;  4NX7 A;  1J3K A;  3NXX A;  1U72 A;  4QLF A;  3K45 A;  4HOF A;  3QYL A;  3JW5 A;  2W9G A;  3FYV X;  6DFR A;  2W3M A;  4KNE A;  4X5I A;  3HBB A;  3FYW X;  4KJK A;  1RX3 A;  2BLA A;  3NZB X;  2KGK A;  3FL8 A;  3F0Q X;  4CD2 A;  3IRN A;  2W3A A;  4M6K A;  5CC9 A;  3IRM A;  3EEL A;  2O7P A;  1MVT A;  3NZC X;  2W3W A;  3F8Y A;  3DFR A;  1AO8 A;  3JVX A;  1DAJ A;  1TDR A;  5HT4 A;  1MVS A;  4KM2 A;  3L3R A;  2W9T A;  5DFR A;  3VCO A;  2CD2 A;  4TU5 X;  5FDA A;  2QK8 A;  4FGG A;  3KJS A;  3UM8 A;  1PDB A;  3SRR X;  4X5G A;  4H98 A;  3NXT A;  4PSS A;  1DIS A;  3QLZ A;  3NXY A;  4P68 A;  1RE7 A;  2BLB A;  3JSU A;  3RG9 A;  3SRU X;  3NZ6 X;  3M08 A;  3FRF X;  3NU0 A;  4HOE A;  1AI9 A;  5EAJ A;  3K74 A;  4XT8 A;  3FS6 A;  3NTZ A;  4P3Q A;  1IA4 A;  4DFR A;  2OIP A;  4M7V A;  1S3V A;  8DFR A;  4M6J A;  1IA1 A;  3NXO A;  5HSU A;  5HUI A;  4XT7 A;  1DRA A;  3DRC A;  3OAF A;  4EIL A;  2D5N A;  3JW3 A;  1DYR A;  3I3R A;  1M79 A;  4ELH A;  3DG8 A;  3IA4 A;  4M2X A;  3SRW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...