3JTXA

Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
396
structure length
392
Chain Sequence
GMNTLLKQLKPYPFARLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPGIKPAIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFTSLSRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAEDIVSLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminotransferase
publication title Crystal structure of Aminotransferase (NP_283882.1) from NEISSERIA MENINGITIDIS Z2491 at 1.91 A resolution
rcsb
source organism Neisseria meningitidis z2491
molecule tags Transferase
total genus 139
structure length 392
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3jtxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3jtxA01
3CAIA 2FN6A 1C4KA 4B98A 3NX3A 2GMSA 1JS3A 1ARIA 3BN1A 3FDDA 1PG8A 4PFFA 1BJOA 1IX6A 3JWBA 1KKPA 2ZY4A 3FZ7A 3VK4A 3CQ5A 3FZ8A 1CQ8A 2VMTA 5DX5A 2CY8A 2F8JA 4ATQA 2OGEA 5AX8A 4J5UA 4ZWMA 3VK2A 1W23A 2O1BA 4AOAA 1BJ4A 2W7MA 4XJOA 2CSTA 1X29A 1TARA 4IY7A 1ASEA 1RV3A 1OXPA 2X5FA 3JTXA 1TATA 4AO9A 4ZSWA 3W1HA 4JF1A 1DJUA 3NRAA 2BI5A 4BHDA 3DC1A 4RLGA 5E4ZA 3WCOA 2AY5A 4GEBA 1M7YA 1DTYA 3HQTA 3KGWA 3RCHB 2W7DA 1IUGA 4MY5A 2R5CA 2Z67A 3OKSA 4EMYA 2CJHA 2YKXA 2JISA 3GSBA 3MAFA 2CFBA 3FZ6A 2E7JA 3AATA 4LW4A 4ZSYA 1QGNA 3RUYA 4A6RA 2W7IA 1Z7DA 5M49A 3PGYA 2Z1YA 4UHMA 1PMMA 3EIAA 3PDBA 3WCNA 1BJWA 4M2KA 1AKAA 3PD6B 4OCAA 3ZZJA 4JEWA 5E5IA 2HOXA 2EO5A 2W7KA 3BCAA 4AO4A 3EI9A 1H1CA 3Q8NA 1DJ9A 2AY3A 2HZPA 2W7FA 4O6ZA 4Q75A 1IX7A 1AHYA 1GEXA 1JF9A 2ZUKA 2AY4A 1AMRA 3AEPA 3MEBA 3PA9A 1MAQA 3I5TA 1WKHA 3JU7A 8AATA 3LG0A 5FT5A 1C0NA 3ELEA 4RJ0A 1GC0A 1JS6A 1YIYA 1D7RA 2C0RA 3CQ6A 3RCHA 4JE5A 2YCPA 1KMJA 5I92A 5D5SA 1AMSA 1D7UA 1M0NA 2EPJA 3RQ1A 2YHKA 2XH1A 4FL0A 3JZLA 1T3IA 2X3LA 3GWPA 1D7SA 3P1TA 3NU8A 3MKJA 4DBCA 3AELA 3GZDC 1ASAA 4RIZA 1G7WA 1IBJA 1GC3A 4Y0HA 1FG7A 1KL1A 2AY8A 4RJYA 4W1WA 2W8VA 3E2ZB 1B8GA 3FCRA 3DXWA 2W7HA 3ACZA 1Z3ZA 3DZZA 1UU1A 4UHOA 4CBSA 1EJIA 1GD9A 1SPAA 2WK8A 3GZDA 2W8TA 2Q7WA 5DJ1A 1AHGA 3FKDA 4ZDLA 1ORDA 1M32A 1G7XA 1YJSA 1EG5A 1GC4A 2HUUA 1OHYA 3NDNA 1ECXA 1IAYA 1MLZA 2FNIA 4IXOA 3WX9A 4ZM4A 9AATA 1I48A 2YKUA 2AEUA 3QI6A 4F5JA 1WYUB 3EZ1A 3IHJA 1S07A 4OBVA 5EUEA 4AH3A 3JW9A 1ASBA 4WYAA 3BWOA 2EZ2A 7AATA 2O7CA 3A2BA 1M0PA 2R5EA 4U2HA 4F5MA 1CJ0A 3BB8A 3NUIA 4WBTA 2GMUA 1C7OA 1SFFA 5EQCA 5DJ9A 3RBLA 1G4VA 1I41A 3FVUA 2GSAA 3DODA 2RFVA 5G4JA 4IYOA 1ARHA 4EU1A 1E5EA 1AIBA 3FVSA 1AHXA 3E77A 1QZ9A 1KMKA 1ARSA 3HDOA 2EH6A 3MAUA 3A8UX 3LVMA 4ZLVA 2YOBA 2VIBA 4ZDPA 2CH1A 2X8UA 3EI7A 5HHYA 3FTBA 2JJFA 4EFFA 4RKDA 1V2FA 4OTLA 4LW2A 4BQ0A 1ASGA 2G6WA 1GDEA 3G0TA 4IXZA 1DGDA 2VGWA 3H7FA 3NTJA 3FFRA 1SF2A 3E2ZA 3MADA 4CVQA 1TOEA 1B4XA 4F4EA 1PMOA 1SVVA 1OHVA 3B1DA 1TASA 2DKJA 1YNUA 4KXKA 4LNJA 4R2NA 1U08A 5HXXA 4XJMA 3QGUA 2DKBA 4AZKA 3LVLB 4A0RA 1X2AA 3I4JA 1AJSB 1GEWA 2VGSA 3E2YA 1M0OA 1YJZA 4BMKA 4JF0A 2D63A 3USFA 1WYUA 2HP2A 3VOMA 1Y4IA 1O69A 1YJYA 2ZSMA 4N0WA 1DGEA 2W8WA 2VGUA 4HF8A 2AY9A 2FYFA 2VGZA 2Z9WA 4RM1A 3BS8A 1J32A 1I43A 2HOYA 2D7ZA 2OQXA 5LH9A 2HUIA 1ELUA 1GCKA 2BYJA 1B9IA 4WYCA 4K2MA 2YRRA 4FFCA 1BW0A 2ORDA 3VAXA 3AEJA 3IF2A 4R8DA 4Y0DA 3JWAA 4ADBA 4WXBA 4WLHA 5G2PA 4JE5D 4F5HA 5FT6A 4A0FA 1CL1A 4OYTA 1QIRA 5F8VA 3I16A 3D6KA 2QA3A 3GBXA 2OKKA 4LNMA 1X0MA 4EB5A 1V72A 2JJHA 1DKAA 1RVUA 1AAWA 3BWNC 1AY5A 4ITXA 5J8QA 1ZODA 3BCBA 3NNKA 4GRXA 3W1IA 1EQBA 1W7MA 4JEVA 1C7NA 1ASNA 1KL2A 4OBUA 1C7GA 3K28A 4WYDA 2CH2A 2QBTA 1X28A 3PPLA 2VMRA 4XAUA 4GDYA 3BWNA 2CB1A 4TMRA 3T32A 2X5DA 2BKWA 1N8PA 5TF5A 3II0A 4ZM3A 2BI1A 3UAKA 2QMAA 2WK7A 4HVKA 1CS1A 1O62A 2OGAA 1AJSA 1LW4A 1GBNA 3LY1A 3L44A 2DOUA 2R0TA 4UOYA 5F9SA 3TQXA 3PAAA 4RKCA 4ADDA 4B9BA 4F5KA 3KE3A 2VGVA 5EFSA 4M2JA 4ADCA 2WKAA 1ASCA 1TOJA 3A9YA 3HL2A 1LC5A 5G09A 2VLHA 3DR7A 3DYDA 4JEXA 3ZRPA 2CJGA 4RITA 1AIAA 2VI8A 4WXGA 3FVXA 1MDXA 1DFOA 3FSLA 1VJOA 1YIZA 1OATA 3VK3A 3COGA 2JJGA 2VMUA 2VYCA 1AY4A 3FQ8A 1WYVB 4MQQA 1BQAA 2D64A 3AEMC 2CTZA 1IVRA 3ECDA 1JG8A 1AKBA 1I29A 1LKCA 1MDZA 1N2TA 3E2FA 1TOKA 4XK1A 3AOVA 3BCXA 2QB2A 2C81A 3AV7A 1O4SA 2JGTA 4K2IA 3EZSA 1PFFA 3HMUA 3FQAA 4XQ2A 2QB3A 1WYTB 1QISA 2W8JA 2W7GA 3AEMA 1SZKA 4I8AA 3MC6A 4DGTA 2R2NA 1ASMA 2Z9VA 1BT4A 3MBBA 3QHXA 1B5PA 1LC8A 1AHFA 4ITGA 4ATPA 1WKGA 1SZUA 2DGLA 3PD6A 4WYGA 3W1JA 2D66A 2BIGA 3ZRQA 4CXQA 1M4NA 2VMOA 3EI5A 1ELQA 2E7UA 4GE7A 3ISLA 1AICA 2BI3A 2V1PA 2VMZA 1CZCA 4MGRA 2XBNA 3FQ7A 2EGYA 2ZJGA 2YKYA 5M46A 3AENB 3LVKA 3WY7A 1BJOB 4GE4A 1IJIA 2FM1A 3PDXA 4IX8A 4OC9A 4W8IA 3DXVA 5EUNA 4GSAA 1ASLA 4F5LA 4J8LA 2Z9UA 3WGCA 4E77A 4WXFA 1ZOBA 3NYTA 2BI9A 4JEYA 2V0YA 4R5FA 2DR1A 3F6TA 2VMPA 1OHWA 4W1XA 2Z61A 2YCNA 5FT8A 4XEWA 1W3UA 2DGKA 3QPGA 1LW5A 3BV0A 1LK9A 2OKJA 5EUDA 2OATA 1FG3A 4EB7A 3EI8A 2VLFA 3KKIA 1QJ3A 1ARGA 4BA4A 2GQNA 2YCTA 2R5CB 3R4TA 1UKJA 1WYVA 2PB0A 3RBFA 5BJ3A 4F5GA 2DGMA 5E3KA 4Q76A 3DRDA 3BC8A 4P3MA 4PIWA 5M4BA 3HT4A 1CL2A 4WLJA 4Y0IA 1C9CA 2EZ1A 3N75A 1ASDA 3PDBB 4E3QA 2BYLA 3AEJC 1VP4A 1AHEA 2PO3A 2PB2A 1M0QA 1RVYA 2O0RA 3QM2A 4AZJA 3HBXA 4ISYA 5D95A 4W5KA 3FDBA 5K8BA 3DR4A 1UU0A 3TFUA 2ZC0A 3A9ZA 1WSTA 1P3WA 1AAMA 5G4IA 4A00A 4U1TA 3OP7A 2BIEA 5G0AA 5IWQA 4IXSA 3WGBA 2BWOA 3AENA 4R5ZA 4WYFA 4PFNA 4WD2A 4MKKA 1W7LA 1BS0A 1W7NA 2VMVA 3WLXA 3K40A 5BJ4A 1MDOA 3HLMA 2BWNA 4A0HA 4H51A 4TV7A 2VGTA 5LHAA 4OMAA 4Q31A 4WP0A 4A0GA 3GETA 2C7TA 4E1OA 3HVYA 3NUBA 1BKGA 4A6UA 1DJEA 4W1VA 1ASFA 4E3RA 1AY8A 4ZAHA 4MQRA 1ARTA 1H0CA 2VMXA 3ELPA 2D61A 4GE9A 4CBRA 2NMPA 1MLYA 4LC3A 4ZASA 4N0BA 3ATHA 3ZZKA 2ZP7A 3FRKA 4WB0B 3E9KA 2D5YA 2AY2A 3DU4A 3LWSA 3E6GA 4K2BA 3RI6A 2Z20A 3L8AA 2WK9A 4A72A 4L0OA 2QLRA 4NOGA 3F0HA 3KGXA 1VEFA 3QN6A 3WZFA 3PIUA 3H14A 1BQDA 1CZEA 2VMNA 1O61A 3CQ4A 3GJUA 4IW7A 4IYOB 4M2MA 5DB5A 1XEYA 1N31A 2HUFA 2VMSA 1IX8A 1MAPA 4TN4A 1J04A 2D65A 1TOGA 3P6KA 2GB3A 5JAYA 3FFHA 1SZSA 3MC6C 5FT4A 4JEZA 3B1EA 1D2FA 1QITA 2BHXA 2W7JA 3NYSA 1YOOA 1KKJA 2E54A 2ZY5A 1AMAA 2JJEA 4UQVA 4F5FA 4MSOA 4PVFA 3NYUA 3EUCA 1UU2A 1IAXA 2JG2A 3UWCA 4OT8A 2CJDA 4MQPA 1S08A 3N0LA 5C6UA 2VI9A 2AY7A 3AEOA 3K7YA 1GEYA 1V2EA 2CANA 1AX4A 2Z1ZA 2AY6A 2ZSLA 3FD0A 1CQ6A 2ZYJA 5EIGB 3VP6A 5EAAA 4XJLA 1RV4A 3LVJA 1XI9A 1OXOA 2TPLA 3GZCA 3WKRA 3WKSA 3R9AA 2YRIA 4ZDOA 1AMQA 4WB0A 4RAEA 4DQ6A 5HDMA 2AY1A 3G8MA 4XJPA 3PJ0A 5G2QA 2Z9XA 3GR9A 1CQ7A 1GC2A 1D7VA 2HP1A 1LS3A 2VIAA 2VMQA 2BIAA 2W7LA 2ZY3A 2AATA 2YKVA 1MGVA 4F5IA 3M5UA 1S0AA 1S09A 2W7EA 3B46A 4ZWVA 2AEVA 4A6TA 1B5OA 2CINA 2BI2A 3TATA 5EAVA 3AOWA 3QBOA 4MKJA 4P7YA 3CBFA 2FNUA 3G7QA 4KAMA 1LC7A 3ASAA 1BJNA 3LV2A 1YAAA 1ZC9A 4UHNA 1S06A 2HOZA 3TFTA 3A9XA 3MAFB 1G4XA 3TCMA 4WYEA 3EIBA 3ASBA 4KYOA 1AJRA 2BWPA 3F9TA 1FC4A 4LNLA 2VMWA 2VMYA 3B1CA 3NU7A 2FQ6A 2C44A 4QGRA 3ZRRA 1WYTA 2W8UA 1TOIA 4Q6RA 1AKCA 4W91A 4CXRA 1B9HA 3N5MA 2ZY2A 2E7IA 1E5FA 3B8XA 1TPLA 2D7YA 2HORA 1QJ5A 3UE8A 5M4DA 4ADEA 1V2DA 5EIGA 1M6SA 4BA5A 3EI6A
chains in the Genus database with same CATH superfamily
3CAIA 2FN6A 1C4KA 4B98A 3NX3A 2GMSA 1JS3A 1ARIA 3BN1A 3FDDA 1PG8A 4PFFA 1BJOA 1IX6A 3JWBA 1KKPA 2ZY4A 3FZ7A 3VK4A 3CQ5A 3FZ8A 1CQ8A 2VMTA 5DX5A 2CY8A 2F8JA 2QSRA 4ATQA 2OGEA 5AX8A 4J5UA 4ZWMA 3VK2A 1W23A 2O1BA 4AOAA 1BJ4A 2W7MA 4XJOA 2CSTA 1X29A 1TARA 4IY7A 1ASEA 1RV3A 1OXPA 2X5FA 3JTXA 1TATA 4AO9A 4ZSWA 3W1HA 4JF1A 1DJUA 3NRAA 2BI5A 4BHDA 3DC1A 4RLGA 5E4ZA 3WCOA 2AY5A 4GEBA 1M7YA 1DTYA 3HQTA 3KGWA 3RCHB 2W7DA 1IUGA 4MY5A 2R5CA 2Z67A 3OKSA 4EMYA 2CJHA 2YKXA 2JISA 3GSBA 3MAFA 2CFBA 3FZ6A 2E7JA 3AATA 4LW4A 4ZSYA 1QGNA 3RUYA 4A6RA 2W7IA 1Z7DA 5M49A 3PGYA 2Z1YA 4UHMA 1PMMA 3EIAA 3PDBA 3WCNA 1BJWA 4M2KA 1AKAA 3PD6B 4OCAA 3ZZJA 4JEWA 5E5IA 2HOXA 2EO5A 2W7KA 3BCAA 4AO4A 3EI9A 1H1CA 3Q8NA 1DJ9A 2AY3A 2HZPA 2W7FA 4O6ZA 4Q75A 1IX7A 1AHYA 1GEXA 1JF9A 2ZUKA 2AY4A 1AMRA 3AEPA 3MEBA 3PA9A 1MAQA 3I5TA 1WKHA 3JU7A 8AATA 3LG0A 5FT5A 1C0NA 3ELEA 4RJ0A 1GC0A 1JS6A 1YIYA 1D7RA 2C0RA 3CQ6A 3RCHA 4JE5A 2YCPA 1KMJA 5I92A 5D5SA 1AMSA 1D7UA 1M0NA 2EPJA 3RQ1A 3H9XA 2YHKA 2XH1A 4FL0A 3JZLA 1T3IA 2X3LA 3GWPA 1D7SA 3P1TA 3NU8A 3MKJA 4DBCA 3AELA 3GZDC 1ASAA 4RIZA 1G7WA 1IBJA 1GC3A 4Y0HA 1FG7A 1KL1A 2AY8A 4RJYA 4W1WA 2W8VA 3E2ZB 1B8GA 3FCRA 3DXWA 2W7HA 3ACZA 1Z3ZA 3DZZA 1UU1A 4UHOA 4CBSA 1EJIA 1GD9A 1SPAA 2WK8A 3GZDA 2W8TA 2Q7WA 5DJ1A 1AHGA 2FKIA 3FKDA 4ZDLA 1ORDA 1M32A 1G7XA 1YJSA 1EG5A 1GC4A 2HUUA 1OHYA 3NDNA 1ECXA 1IAYA 1MLZA 2FNIA 4IXOA 3WX9A 4ZM4A 9AATA 1I48A 2YKUA 2AEUA 3QI6A 4F5JA 1WYUB 3EZ1A 3IHJA 1S07A 4OBVA 5EUEA 4AH3A 4H63Q 3JW9A 1KAFA 1ASBA 4WYAA 3BWOA 2EZ2A 7AATA 2O7CA 3A2BA 1M0PA 2R5EA 4U2HA 4F5MA 1CJ0A 3BB8A 3NUIA 4WBTA 2GMUA 1C7OA 1SFFA 5EQCA 5DJ9A 3RBLA 1G4VA 1I41A 3FVUA 2GSAA 3DODA 2RFVA 5G4JA 4IYOA 1ARHA 4EU1A 1E5EA 1AIBA 3FVSA 1AHXA 3E77A 1QZ9A 1KMKA 1ARSA 3HDOA 2EH6A 3MAUA 3A8UX 3LVMA 4ZLVA 2YOBA 2VIBA 4ZDPA 2CH1A 2X8UA 3EI7A 5HHYA 3FTBA 2JJFA 4EFFA 4RKDA 1V2FA 4OTLA 4LW2A 4BQ0A 1ASGA 2G6WA 1GDEA 3G0TA 4IXZA 1DGDA 2VGWA 3H7FA 3NTJA 3FFRA 1SF2A 3E2ZA 3MADA 4CVQA 1TOEA 1B4XA 4F4EA 1PMOA 1SVVA 1OHVA 3B1DA 1TASA 2DKJA 1YNUA 4KXKA 4LNJA 4R2NA 1U08A 5HXXA 4XJMA 3QGUA 2DKBA 4AZKA 3LVLB 4A0RA 1X2AA 3I4JA 1AJSB 1GEWA 2VGSA 3E2YA 1M0OA 1YJZA 4BMKA 4JF0A 2D63A 3USFA 1WYUA 2HP2A 3VOMA 1Y4IA 1O69A 1YJYA 2ZSMA 4N0WA 1DGEA 2W8WA 2VGUA 4HF8A 2AY9A 2FYFA 2VGZA 2Z9WA 4RM1A 3BS8A 1J32A 1I43A 2HOYA 2D7ZA 2OQXA 5LH9A 2HUIA 1ELUA 1GCKA 2BYJA 1B9IA 4WYCA 4K2MA 2YRRA 4FFCA 1BW0A 2ORDA 3VAXA 3AEJA 3IF2A 4R8DA 4Y0DA 3JWAA 4ADBA 4WXBA 4WLHA 4K05A 5G2PA 4JE5D 4F5HA 5FT6A 4A0FA 1CL1A 4OYTA 1QIRA 5F8VA 3I16A 3D6KA 3N4XA 2QA3A 3GBXA 2OKKA 4LNMA 1X0MA 4EB5A 1V72A 2JJHA 1DKAA 1RVUA 1AAWA 3BWNC 1AY5A 4ITXA 5J8QA 1ZODA 3BCBA 3NNKA 4GRXA 3W1IA 1EQBA 1W7MA 4JEVA 1C7NA 1ASNA 1KL2A 4OBUA 1C7GA 3K28A 4WYDA 2CH2A 2QBTA 1X28A 3PPLA 2VMRA 4XAUA 4GDYA 3BWNA 2CB1A 4TMRA 3T32A 2X5DA 2BKWA 1N8PA 5TF5A 3II0A 4ZM3A 2BI1A 3UAKA 2QMAA 2WK7A 4HVKA 1CS1A 1O62A 2OGAA 1AJSA 1LW4A 1GBNA 3LY1A 3L44A 2DOUA 2R0TA 4UOYA 5F9SA 3TQXA 3PAAA 4RKCA 4ADDA 4B9BA 4F5KA 3KE3A 2VGVA 5EFSA 4M2JA 4ADCA 2WKAA 1ASCA 1TOJA 3A9YA 3HL2A 1LC5A 5G09A 2VLHA 3DR7A 3DYDA 4JEXA 3ZRPA 2CJGA 4RITA 1AIAA 2VI8A 4WXGA 3FVXA 1MDXA 1DFOA 3FSLA 1VJOA 1YIZA 1OATA 3VK3A 3COGA 2JJGA 2VMUA 2VYCA 1AY4A 3FQ8A 1WYVB 4MQQA 1BQAA 2D64A 3AEMC 2CTZA 1IVRA 3ECDA 1JG8A 1AKBA 1I29A 1LKCA 1MDZA 1N2TA 3E2FA 1TOKA 4XK1A 3AOVA 3BCXA 2QB2A 2C81A 3AV7A 1O4SA 2JGTA 4K2IA 3EZSA 1PFFA 3HMUA 3FQAA 4XQ2A 2QB3A 1WYTB 1QISA 2W8JA 2W7GA 3AEMA 1SZKA 4I8AA 3MC6A 4DGTA 2R2NA 1ASMA 2Z9VA 1BT4A 3MBBA 3QHXA 1B5PA 1LC8A 1AHFA 4ITGA 4ATPA 1WKGA 1SZUA 2DGLA 3PD6A 4WYGA 3W1JA 2D66A 2BIGA 3ZRQA 4CXQA 1M4NA 2VMOA 3EI5A 1ELQA 2E7UA 4GE7A 3ISLA 1AICA 2BI3A 2V1PA 2VMZA 1CZCA 4MGRA 2XBNA 3FQ7A 2EGYA 2ZJGA 2YKYA 5M46A 3N4RA 3AENB 3LVKA 3WY7A 1BJOB 4GE4A 1IJIA 2FM1A 3PDXA 4IX8A 4OC9A 4W8IA 3DXVA 5EUNA 4GSAA 1ASLA 4F5LA 4J8LA 2Z9UA 3WGCA 4E77A 4WXFA 1ZOBA 3NYTA 2KFPA 2BI9A 2EYQA 4JEYA 2V0YA 4R5FA 2DR1A 3F6TA 2VMPA 1OHWA 4W1XA 2Z61A 2YCNA 5FT8A 4XEWA 1W3UA 2DGKA 3QPGA 1LW5A 3BV0A 1LK9A 2OKJA 5EUDA 2OATA 1FG3A 4EB7A 3EI8A 2VLFA 3KKIA 1QJ3A 1ARGA 4BA4A 2GQNA 2YCTA 2R5CB 3R4TA 1UKJA 1WYVA 2PB0A 3RBFA 5BJ3A 4F5GA 2DGMA 5E3KA 4Q76A 3DRDA 3BC8A 4P3MA 4PIWA 5M4BA 3HT4A 1CL2A 4WLJA 4Y0IA 1C9CA 2EZ1A 3N75A 1ASDA 3PDBB 4E3QA 2BYLA 3AEJC 1VP4A 1AHEA 2PO3A 2PB2A 1M0QA 1RVYA 2O0RA 3QM2A 4AZJA 3HBXA 4ISYA 5D95A 4W5KA 3FDBA 5K8BA 3DR4A 1UU0A 3TFUA 2ZC0A 3A9ZA 1WSTA 1P3WA 1AAMA 5G4IA 4A00A 4U1TA 3OP7A 2BIEA 5G0AA 5IWQA 4IXSA 3WGBA 2BWOA 3AENA 4R5ZA 4WYFA 4PFNA 4WD2A 4MKKA 1W7LA 3N4SA 1BS0A 1W7NA 2VMVA 3WLXA 3K40A 3N7NA 5BJ4A 1MDOA 3HLMA 2BWNA 4A0HA 4H51A 4TV7A 2VGTA 5LHAA 4OMAA 4Q31A 4WP0A 4A0GA 2G7JA 3GETA 2C7TA 4E1OA 3HVYA 3NUBA 1BKGA 4A6UA 1DJEA 4W1VA 1ASFA 4E3RA 1AY8A 4ZAHA 4MQRA 1ARTA 1H0CA 2VMXA 3ELPA 2D61A 4GE9A 4CBRA 2NMPA 1MLYA 4LC3A 4ZASA 4N0BA 3ATHA 3ZZKA 2ZP7A 3FRKA 4WB0B 3E9KA 2D5YA 2AY2A 3DU4A 3LWSA 3E6GA 4K2BA 3RI6A 2Z20A 3L8AA 2WK9A 4A72A 4L0OA 2QLRA 4NOGA 2A1VA 3F0HA 3KGXA 1VEFA 3QN6A 3WZFA 3PIUA 3H14A 1BQDA 1CZEA 2VMNA 1O61A 3CQ4A 3GJUA 4IW7A 4IYOB 4M2MA 5DB5A 1XEYA 1N31A 2HUFA 2VMSA 1IX8A 1MAPA 4TN4A 1J04A 2D65A 1TOGA 5KTBA 3P6KA 2GB3A 5JAYA 3FFHA 1SZSA 3MC6C 5FT4A 4JEZA 3B1EA 1D2FA 1QITA 2BHXA 2W7JA 3NYSA 1YOOA 1KKJA 2E54A 2ZY5A 1AMAA 2JJEA 4UQVA 4F5FA 4MSOA 4PVFA 3NYUA 3EUCA 1UU2A 1IAXA 2JG2A 3UWCA 4OT8A 2CJDA 4MQPA 1S08A 3N0LA 5C6UA 2VI9A 2AY7A 3AEOA 3K7YA 1GEYA 1V2EA 2CANA 1AX4A 2Z1ZA 2AY6A 2ZSLA 3FD0A 1CQ6A 2ZYJA 5EIGB 3VP6A 5EAAA 4XJLA 1RV4A 3LVJA 1XI9A 1OXOA 2TPLA 3GZCA 3WKRA 3WKSA 3R9AA 2YRIA 4ZDOA 1AMQA 4WB0A 4RAEA 4DQ6A 5HDMA 2AY1A 3G8MA 4XJPA 3PJ0A 5G2QA 2Z9XA 3GR9A 1CQ7A 1GC2A 1D7VA 2HP1A 1LS3A 2VIAA 2VMQA 2BIAA 2W7LA 2ZY3A 2AATA 2YKVA 1MGVA 4F5IA 3M5UA 1S0AA 1S09A 2W7EA 3B46A 4ZWVA 2AEVA 4A6TA 1B5OA 2CINA 2BI2A 3TATA 5EAVA 3AOWA 3QBOA 4MKJA 4P7YA 3CBFA 2FNUA 3G7QA 4KAMA 1LC7A 3ASAA 1BJNA 3LV2A 1YAAA 1ZC9A 4UHNA 1S06A 2HOZA 3TFTA 3A9XA 3MAFB 1G4XA 3TCMA 4WYEA 3EIBA 3ASBA 4KYOA 1AJRA 2BWPA 3F9TA 1FC4A 4LNLA 2VMWA 2VMYA 3B1CA 3NU7A 2FQ6A 2C44A 4QGRA 3ZRRA 1WYTA 2W8UA 1TOIA 4Q6RA 1AKCA 4W91A 4CXRA 1B9HA 3N5MA 2ZY2A 2E7IA 1E5FA 3B8XA 1TPLA 2D7YA 2HORA 1QJ5A 3UE8A 5M4DA 4ADEA 1V2DA 5EIGA 1M6SA 2WB6A 4BA5A 3EI6A
chains in the Genus database with same CATH topology
3CAIA 2FN6A 1C4KA 4B98A 3NX3A 2GMSA 1JS3A 1ARIA 3BN1A 3FDDA 1PG8A 4PFFA 1BJOA 1IX6A 3JWBA 1KKPA 2ZY4A 3FZ7A 3VK4A 3CQ5A 3FZ8A 1CQ8A 2VMTA 5DX5A 2CY8A 2F8JA 2QSRA 4ATQA 2OGEA 5AX8A 4J5UA 4ZWMA 3VK2A 1W23A 2O1BA 4AOAA 1BJ4A 2W7MA 4XJOA 2CSTA 1X29A 1TARA 4IY7A 1ASEA 1RV3A 1OXPA 2X5FA 3JTXA 1TATA 4AO9A 4ZSWA 3W1HA 4JF1A 1DJUA 3NRAA 2BI5A 4BHDA 3DC1A 4RLGA 5E4ZA 3WCOA 2AY5A 4GEBA 1M7YA 1DTYA 3HQTA 3KGWA 3RCHB 2W7DA 1IUGA 4MY5A 2R5CA 2Z67A 3OKSA 4EMYA 2CJHA 2YKXA 2JISA 3GSBA 3MAFA 2CFBA 3FZ6A 2E7JA 3AATA 4LW4A 4ZSYA 1QGNA 3RUYA 4A6RA 2W7IA 1Z7DA 5M49A 3PGYA 2Z1YA 4UHMA 1PMMA 3EIAA 3PDBA 3WCNA 1BJWA 4M2KA 1AKAA 3PD6B 4OCAA 3ZZJA 4JEWA 5E5IA 2HOXA 2EO5A 2W7KA 3BCAA 4AO4A 3EI9A 1H1CA 3Q8NA 1DJ9A 2AY3A 2HZPA 2W7FA 4O6ZA 4Q75A 1IX7A 1AHYA 1GEXA 1JF9A 2ZUKA 2AY4A 1AMRA 3AEPA 3MEBA 3PA9A 1MAQA 3I5TA 1WKHA 3JU7A 8AATA 3LG0A 5FT5A 1C0NA 3ELEA 4RJ0A 1GC0A 1JS6A 1YIYA 1D7RA 2C0RA 3CQ6A 3RCHA 4JE5A 2YCPA 1KMJA 5I92A 5D5SA 1AMSA 1D7UA 1M0NA 2EPJA 3RQ1A 3H9XA 2YHKA 2XH1A 4FL0A 3JZLA 1T3IA 2X3LA 3GWPA 1D7SA 3P1TA 3NU8A 3MKJA 4DBCA 3AELA 3GZDC 1ASAA 4RIZA 1G7WA 1IBJA 1GC3A 4Y0HA 1FG7A 1KL1A 2AY8A 4RJYA 4W1WA 2W8VA 3E2ZB 1B8GA 3FCRA 3DXWA 2W7HA 3ACZA 1Z3ZA 3DZZA 1UU1A 4UHOA 4CBSA 1EJIA 1GD9A 1SPAA 2WK8A 3GZDA 2W8TA 2Q7WA 5DJ1A 1AHGA 2FKIA 3FKDA 4ZDLA 1ORDA 1M32A 1G7XA 1YJSA 1EG5A 1GC4A 2HUUA 1OHYA 3NDNA 1ECXA 1IAYA 1MLZA 2FNIA 4IXOA 3WX9A 4ZM4A 9AATA 1I48A 2YKUA 2AEUA 3QI6A 4F5JA 1WYUB 3EZ1A 3IHJA 1S07A 4OBVA 5EUEA 4AH3A 4H63Q 3JW9A 1ASBA 4WYAA 3BWOA 2EZ2A 7AATA 2O7CA 3A2BA 1M0PA 2R5EA 4U2HA 4F5MA 1CJ0A 3BB8A 3NUIA 4WBTA 2GMUA 1C7OA 1SFFA 5EQCA 5DJ9A 3RBLA 1G4VA 1I41A 3FVUA 2GSAA 3DODA 2RFVA 5G4JA 4IYOA 1ARHA 4EU1A 1E5EA 1AIBA 3FVSA 1AHXA 3E77A 1QZ9A 1KMKA 1ARSA 3HDOA 2EH6A 3MAUA 3A8UX 3LVMA 4ZLVA 2YOBA 2VIBA 4ZDPA 2CH1A 2X8UA 3EI7A 5HHYA 3FTBA 2JJFA 4EFFA 4RKDA 1V2FA 4OTLA 4LW2A 4BQ0A 1ASGA 2G6WA 1GDEA 3G0TA 4IXZA 1DGDA 2VGWA 3H7FA 3NTJA 3FFRA 1SF2A 3E2ZA 3MADA 4CVQA 1TOEA 1B4XA 4F4EA 1PMOA 1SVVA 1OHVA 3B1DA 1TASA 2DKJA 1YNUA 4KXKA 4LNJA 4R2NA 1U08A 5HXXA 4XJMA 3QGUA 2DKBA 4AZKA 3LVLB 4A0RA 1X2AA 3I4JA 1AJSB 1GEWA 2VGSA 3E2YA 1M0OA 1YJZA 4BMKA 4JF0A 2D63A 3USFA 1WYUA 2HP2A 3VOMA 1Y4IA 1O69A 1YJYA 2ZSMA 4N0WA 1DGEA 2W8WA 2VGUA 4HF8A 2AY9A 2FYFA 2VGZA 2Z9WA 4RM1A 3BS8A 1J32A 1I43A 2HOYA 2D7ZA 2OQXA 5LH9A 2HUIA 1ELUA 1GCKA 2BYJA 1B9IA 4WYCA 4K2MA 2YRRA 4FFCA 1BW0A 2ORDA 3VAXA 3AEJA 3IF2A 4R8DA 4Y0DA 3JWAA 4ADBA 4WXBA 4WLHA 4K05A 5G2PA 4JE5D 4F5HA 5FT6A 4A0FA 1CL1A 4OYTA 1QIRA 5F8VA 3I16A 3D6KA 3N4XA 2QA3A 3GBXA 2OKKA 4LNMA 1X0MA 4EB5A 1V72A 2JJHA 1DKAA 1RVUA 1AAWA 3BWNC 1AY5A 4ITXA 5J8QA 1ZODA 3BCBA 3NNKA 4GRXA 3W1IA 1EQBA 1W7MA 4JEVA 1C7NA 1ASNA 1KL2A 4OBUA 1C7GA 3K28A 4WYDA 2CH2A 2QBTA 1X28A 3PPLA 2VMRA 4XAUA 4GDYA 3BWNA 2CB1A 4TMRA 3T32A 2X5DA 2BKWA 1N8PA 5TF5A 3II0A 4ZM3A 2BI1A 3UAKA 2QMAA 2WK7A 4HVKA 1CS1A 1O62A 2OGAA 1AJSA 1LW4A 1GBNA 3LY1A 3L44A 2DOUA 2R0TA 4UOYA 5F9SA 3TQXA 3PAAA 4RKCA 4ADDA 4B9BA 4F5KA 3KE3A 2VGVA 5EFSA 4M2JA 4ADCA 2WKAA 1ASCA 1TOJA 3A9YA 3HL2A 1LC5A 5G09A 2VLHA 3DR7A 3DYDA 4JEXA 3ZRPA 2CJGA 4RITA 1AIAA 2VI8A 4WXGA 3FVXA 1MDXA 1DFOA 3FSLA 1VJOA 1YIZA 1OATA 3VK3A 3COGA 2JJGA 2VMUA 2VYCA 1AY4A 3FQ8A 1WYVB 4MQQA 1BQAA 2D64A 3AEMC 2CTZA 1IVRA 3ECDA 1JG8A 1AKBA 1I29A 1LKCA 1MDZA 1N2TA 3E2FA 1TOKA 4XK1A 3AOVA 3BCXA 2QB2A 2C81A 3AV7A 1O4SA 2JGTA 4K2IA 3EZSA 1PFFA 3HMUA 3FQAA 4XQ2A 2QB3A 1WYTB 1QISA 2W8JA 2W7GA 3AEMA 1SZKA 4I8AA 3MC6A 4DGTA 2R2NA 1ASMA 2Z9VA 1BT4A 3MBBA 3QHXA 1B5PA 1LC8A 1AHFA 4ITGA 4ATPA 1WKGA 1SZUA 2DGLA 3PD6A 4WYGA 3W1JA 2D66A 2BIGA 3ZRQA 4CXQA 1M4NA 2VMOA 3EI5A 1ELQA 2E7UA 4GE7A 3ISLA 1AICA 2BI3A 2V1PA 2VMZA 1CZCA 4MGRA 2XBNA 3FQ7A 2EGYA 2ZJGA 2YKYA 5M46A 3N4RA 3AENB 3LVKA 3WY7A 1BJOB 4GE4A 1IJIA 2FM1A 3PDXA 4IX8A 4OC9A 4W8IA 3DXVA 5EUNA 4GSAA 1ASLA 4F5LA 4J8LA 2Z9UA 3WGCA 4E77A 4WXFA 1ZOBA 3NYTA 2KFPA 2BI9A 2EYQA 4JEYA 2V0YA 4R5FA 2DR1A 3F6TA 2VMPA 1OHWA 4W1XA 2Z61A 2YCNA 5FT8A 4XEWA 1W3UA 2DGKA 3QPGA 1LW5A 3BV0A 1LK9A 2OKJA 5EUDA 2OATA 1FG3A 4EB7A 3EI8A 2VLFA 3KKIA 1QJ3A 1ARGA 4BA4A 2GQNA 2YCTA 2R5CB 3R4TA 1UKJA 1WYVA 2PB0A 3RBFA 5BJ3A 4F5GA 2DGMA 5E3KA 4Q76A 3DRDA 3BC8A 4P3MA 4PIWA 5M4BA 3HT4A 1CL2A 4WLJA 4Y0IA 1C9CA 2EZ1A 3N75A 1ASDA 3PDBB 4E3QA 2BYLA 3AEJC 1VP4A 1AHEA 2PO3A 2PB2A 1M0QA 1RVYA 2O0RA 3QM2A 4AZJA 3HBXA 4ISYA 5D95A 4W5KA 3FDBA 5K8BA 3DR4A 1UU0A 3TFUA 2ZC0A 3A9ZA 1WSTA 1P3WA 1AAMA 5G4IA 4A00A 4U1TA 3OP7A 2BIEA 5G0AA 5IWQA 4IXSA 3WGBA 2BWOA 3AENA 4R5ZA 4WYFA 4PFNA 4WD2A 4MKKA 1W7LA 3N4SA 1BS0A 1W7NA 2VMVA 3WLXA 3K40A 3N7NA 5BJ4A 1MDOA 3HLMA 2BWNA 4A0HA 4H51A 4TV7A 2VGTA 5LHAA 4OMAA 4Q31A 4WP0A 4A0GA 2G7JA 3GETA 2C7TA 4E1OA 3HVYA 3NUBA 1BKGA 4A6UA 1DJEA 4W1VA 1ASFA 4E3RA 1AY8A 4ZAHA 4MQRA 1ARTA 1H0CA 2VMXA 3ELPA 2D61A 4GE9A 4CBRA 2NMPA 1MLYA 4LC3A 4ZASA 4N0BA 3ATHA 3ZZKA 2ZP7A 3FRKA 4WB0B 3E9KA 2D5YA 2AY2A 3DU4A 3LWSA 3E6GA 4K2BA 3RI6A 2Z20A 3L8AA 2WK9A 4A72A 4L0OA 2QLRA 4NOGA 2A1VA 3F0HA 3KGXA 1VEFA 3QN6A 3WZFA 3PIUA 3H14A 1BQDA 1CZEA 2VMNA 1O61A 3CQ4A 3GJUA 4IW7A 4IYOB 4M2MA 5DB5A 1XEYA 1N31A 2HUFA 2VMSA 1IX8A 1MAPA 4TN4A 1J04A 2D65A 1TOGA 5KTBA 3P6KA 2GB3A 5JAYA 3FFHA 1SZSA 3MC6C 5FT4A 4JEZA 3B1EA 1D2FA 1QITA 2BHXA 2W7JA 3NYSA 1YOOA 1KKJA 2E54A 2ZY5A 1AMAA 2JJEA 4UQVA 4F5FA 4MSOA 4PVFA 3NYUA 3EUCA 1UU2A 1IAXA 2JG2A 3UWCA 4OT8A 2CJDA 4MQPA 1S08A 3N0LA 5C6UA 2VI9A 2AY7A 3AEOA 3K7YA 1GEYA 1V2EA 2CANA 1AX4A 2Z1ZA 2AY6A 2ZSLA 3FD0A 1CQ6A 2ZYJA 5EIGB 3VP6A 5EAAA 4XJLA 1RV4A 3LVJA 1XI9A 1OXOA 2TPLA 3GZCA 3WKRA 3WKSA 3R9AA 2YRIA 4ZDOA 1AMQA 4WB0A 4RAEA 4DQ6A 5HDMA 2AY1A 3G8MA 4XJPA 3PJ0A 5G2QA 2Z9XA 3GR9A 1CQ7A 1GC2A 1D7VA 2HP1A 1LS3A 2VIAA 2VMQA 2BIAA 2W7LA 2ZY3A 2AATA 2YKVA 1MGVA 4F5IA 3M5UA 1S0AA 1S09A 2W7EA 3B46A 4ZWVA 2AEVA 4A6TA 1B5OA 2CINA 2BI2A 3TATA 5EAVA 3AOWA 3QBOA 4MKJA 4P7YA 3CBFA 2FNUA 3G7QA 4KAMA 1LC7A 3ASAA 1BJNA 3LV2A 1YAAA 1ZC9A 4UHNA 1S06A 2HOZA 3TFTA 3A9XA 3MAFB 1G4XA 3TCMA 4WYEA 3EIBA 3ASBA 4KYOA 1AJRA 2BWPA 3F9TA 1FC4A 4LNLA 2VMWA 2VMYA 3B1CA 3NU7A 2FQ6A 2C44A 4QGRA 3ZRRA 1WYTA 2W8UA 1TOIA 4Q6RA 1AKCA 4W91A 4CXRA 1B9HA 3N5MA 2ZY2A 2E7IA 1E5FA 3B8XA 1TPLA 2D7YA 2HORA 1QJ5A 3UE8A 5M4DA 4ADEA 1V2DA 5EIGA 1M6SA 2WB6A 4BA5A 3EI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAI A;  2FN6 A;  1C4K A;  4B98 A;  3NX3 A;  2GMS A;  1JS3 A;  1ARI A;  3BN1 A;  3FDD A;  1PG8 A;  4PFF A;  1BJO A;  1IX6 A;  3JWB A;  1KKP A;  2ZY4 A;  3FZ7 A;  3VK4 A;  3CQ5 A;  3FZ8 A;  1CQ8 A;  2VMT A;  5DX5 A;  2CY8 A;  2F8J A;  4ATQ A;  2OGE A;  5AX8 A;  4J5U A;  4ZWM A;  3VK2 A;  1W23 A;  2O1B A;  4AOA A;  1BJ4 A;  2W7M A;  4XJO A;  2CST A;  1X29 A;  1TAR A;  4IY7 A;  1ASE A;  1RV3 A;  1OXP A;  2X5F A;  3JTX A;  1TAT A;  4AO9 A;  4ZSW A;  3W1H A;  4JF1 A;  1DJU A;  3NRA A;  2BI5 A;  4BHD A;  3DC1 A;  4RLG A;  5E4Z A;  3WCO A;  2AY5 A;  4GEB A;  1M7Y A;  1DTY A;  3HQT A;  3KGW A;  3RCH B;  2W7D A;  1IUG A;  4MY5 A;  2R5C A;  2Z67 A;  3OKS A;  4EMY A;  2CJH A;  2YKX A;  2JIS A;  3GSB A;  3MAF A;  2CFB A;  3FZ6 A;  2E7J A;  3AAT A;  4LW4 A;  4ZSY A;  1QGN A;  3RUY A;  4A6R A;  2W7I A;  1Z7D A;  5M49 A;  3PGY A;  2Z1Y A;  4UHM A;  1PMM A;  3EIA A;  3PDB A;  3WCN A;  1BJW A;  4M2K A;  1AKA A;  3PD6 B;  4OCA A;  3ZZJ A;  4JEW A;  5E5I A;  2HOX A;  2EO5 A;  2W7K A;  3BCA A;  4AO4 A;  3EI9 A;  1H1C A;  3Q8N A;  1DJ9 A;  2AY3 A;  2HZP A;  2W7F A;  4O6Z A;  4Q75 A;  1IX7 A;  1AHY A;  1GEX A;  1JF9 A;  2ZUK A;  2AY4 A;  1AMR A;  3AEP A;  3MEB A;  3PA9 A;  1MAQ A;  3I5T A;  1WKH A;  3JU7 A;  8AAT A;  3LG0 A;  5FT5 A;  1C0N A;  3ELE A;  4RJ0 A;  1GC0 A;  1JS6 A;  1YIY A;  1D7R A;  2C0R A;  3CQ6 A;  3RCH A;  4JE5 A;  2YCP A;  1KMJ A;  5I92 A;  5D5S A;  1AMS A;  1D7U A;  1M0N A;  2EPJ A;  3RQ1 A;  2YHK A;  2XH1 A;  4FL0 A;  3JZL A;  1T3I A;  2X3L A;  3GWP A;  1D7S A;  3P1T A;  3NU8 A;  3MKJ A;  4DBC A;  3AEL A;  3GZD C;  1ASA A;  4RIZ A;  1G7W A;  1IBJ A;  1GC3 A;  4Y0H A;  1FG7 A;  1KL1 A;  2AY8 A;  4RJY A;  4W1W A;  2W8V A;  3E2Z B;  1B8G A;  3FCR A;  3DXW A;  2W7H A;  3ACZ A;  1Z3Z A;  3DZZ A;  1UU1 A;  4UHO A;  4CBS A;  1EJI A;  1GD9 A;  1SPA A;  2WK8 A;  3GZD A;  2W8T A;  2Q7W A;  5DJ1 A;  1AHG A;  3FKD A;  4ZDL A;  1ORD A;  1M32 A;  1G7X A;  1YJS A;  1EG5 A;  1GC4 A;  2HUU A;  1OHY A;  3NDN A;  1ECX A;  1IAY A;  1MLZ A;  2FNI A;  4IXO A;  3WX9 A;  4ZM4 A;  9AAT A;  1I48 A;  2YKU A;  2AEU A;  3QI6 A;  4F5J A;  1WYU B;  3EZ1 A;  3IHJ A;  1S07 A;  4OBV A;  5EUE A;  4AH3 A;  3JW9 A;  1ASB A;  4WYA A;  3BWO A;  2EZ2 A;  7AAT A;  2O7C A;  3A2B A;  1M0P A;  2R5E A;  4U2H A;  4F5M A;  1CJ0 A;  3BB8 A;  3NUI A;  4WBT A;  2GMU A;  1C7O A;  1SFF A;  5EQC A;  5DJ9 A;  3RBL A;  1G4V A;  1I41 A;  3FVU A;  2GSA A;  3DOD A;  2RFV A;  5G4J A;  4IYO A;  1ARH A;  4EU1 A;  1E5E A;  1AIB A;  3FVS A;  1AHX A;  3E77 A;  1QZ9 A;  1KMK A;  1ARS A;  3HDO A;  2EH6 A;  3MAU A;  3A8U X;  3LVM A;  4ZLV A;  2YOB A;  2VIB A;  4ZDP A;  2CH1 A;  2X8U A;  3EI7 A;  5HHY A;  3FTB A;  2JJF A;  4EFF A;  4RKD A;  1V2F A;  4OTL A;  4LW2 A;  4BQ0 A;  1ASG A;  2G6W A;  1GDE A;  3G0T A;  4IXZ A;  1DGD A;  2VGW A;  3H7F A;  3NTJ A;  3FFR A;  1SF2 A;  3E2Z A;  3MAD A;  4CVQ A;  1TOE A;  1B4X A;  4F4E A;  1PMO A;  1SVV A;  1OHV A;  3B1D A;  1TAS A;  2DKJ A;  1YNU A;  4KXK A;  4LNJ A;  4R2N A;  1U08 A;  5HXX A;  4XJM A;  3QGU A;  2DKB A;  4AZK A;  3LVL B;  4A0R A;  1X2A A;  3I4J A;  1AJS B;  1GEW A;  2VGS A;  3E2Y A;  1M0O A;  1YJZ A;  4BMK A;  4JF0 A;  2D63 A;  3USF A;  1WYU A;  2HP2 A;  3VOM A;  1Y4I A;  1O69 A;  1YJY A;  2ZSM A;  4N0W A;  1DGE A;  2W8W A;  2VGU A;  4HF8 A;  2AY9 A;  2FYF A;  2VGZ A;  2Z9W A;  4RM1 A;  3BS8 A;  1J32 A;  1I43 A;  2HOY A;  2D7Z A;  2OQX A;  5LH9 A;  2HUI A;  1ELU A;  1GCK A;  2BYJ A;  1B9I A;  4WYC A;  4K2M A;  2YRR A;  4FFC A;  1BW0 A;  2ORD A;  3VAX A;  3AEJ A;  3IF2 A;  4R8D A;  4Y0D A;  3JWA A;  4ADB A;  4WXB A;  4WLH A;  5G2P A;  4JE5 D;  4F5H A;  5FT6 A;  4A0F A;  1CL1 A;  4OYT A;  1QIR A;  5F8V A;  3I16 A;  3D6K A;  2QA3 A;  3GBX A;  2OKK A;  4LNM A;  1X0M A;  4EB5 A;  1V72 A;  2JJH A;  1DKA A;  1RVU A;  1AAW A;  3BWN C;  1AY5 A;  4ITX A;  5J8Q A;  1ZOD A;  3BCB A;  3NNK A;  4GRX A;  3W1I A;  1EQB A;  1W7M A;  4JEV A;  1C7N A;  1ASN A;  1KL2 A;  4OBU A;  1C7G A;  3K28 A;  4WYD A;  2CH2 A;  2QBT A;  1X28 A;  3PPL A;  2VMR A;  4XAU A;  4GDY A;  3BWN A;  2CB1 A;  4TMR A;  3T32 A;  2X5D A;  2BKW A;  1N8P A;  5TF5 A;  3II0 A;  4ZM3 A;  2BI1 A;  3UAK A;  2QMA A;  2WK7 A;  4HVK A;  1CS1 A;  1O62 A;  2OGA A;  1AJS A;  1LW4 A;  1GBN A;  3LY1 A;  3L44 A;  2DOU A;  2R0T A;  4UOY A;  5F9S A;  3TQX A;  3PAA A;  4RKC A;  4ADD A;  4B9B A;  4F5K A;  3KE3 A;  2VGV A;  5EFS A;  4M2J A;  4ADC A;  2WKA A;  1ASC A;  1TOJ A;  3A9Y A;  3HL2 A;  1LC5 A;  5G09 A;  2VLH A;  3DR7 A;  3DYD A;  4JEX A;  3ZRP A;  2CJG A;  4RIT A;  1AIA A;  2VI8 A;  4WXG A;  3FVX A;  1MDX A;  1DFO A;  3FSL A;  1VJO A;  1YIZ A;  1OAT A;  3VK3 A;  3COG A;  2JJG A;  2VMU A;  2VYC A;  1AY4 A;  3FQ8 A;  1WYV B;  4MQQ A;  1BQA A;  2D64 A;  3AEM C;  2CTZ A;  1IVR A;  3ECD A;  1JG8 A;  1AKB A;  1I29 A;  1LKC A;  1MDZ A;  1N2T A;  3E2F A;  1TOK A;  4XK1 A;  3AOV A;  3BCX A;  2QB2 A;  2C81 A;  3AV7 A;  1O4S A;  2JGT A;  4K2I A;  3EZS A;  1PFF A;  3HMU A;  3FQA A;  4XQ2 A;  2QB3 A;  1WYT B;  1QIS A;  2W8J A;  2W7G A;  3AEM A;  1SZK A;  4I8A A;  3MC6 A;  4DGT A;  2R2N A;  1ASM A;  2Z9V A;  1BT4 A;  3MBB A;  3QHX A;  1B5P A;  1LC8 A;  1AHF A;  4ITG A;  4ATP A;  1WKG A;  1SZU A;  2DGL A;  3PD6 A;  4WYG A;  3W1J A;  2D66 A;  2BIG A;  3ZRQ A;  4CXQ A;  1M4N A;  2VMO A;  3EI5 A;  1ELQ A;  2E7U A;  4GE7 A;  3ISL A;  1AIC A;  2BI3 A;  2V1P A;  2VMZ A;  1CZC A;  4MGR A;  2XBN A;  3FQ7 A;  2EGY A;  2ZJG A;  2YKY A;  5M46 A;  3AEN B;  3LVK A;  3WY7 A;  1BJO B;  4GE4 A;  1IJI A;  2FM1 A;  3PDX A;  4IX8 A;  4OC9 A;  4W8I A;  3DXV A;  5EUN A;  4GSA A;  1ASL A;  4F5L A;  4J8L A;  2Z9U A;  3WGC A;  4E77 A;  4WXF A;  1ZOB A;  3NYT A;  2BI9 A;  4JEY A;  2V0Y A;  4R5F A;  2DR1 A;  3F6T A;  2VMP A;  1OHW A;  4W1X A;  2Z61 A;  2YCN A;  5FT8 A;  4XEW A;  1W3U A;  2DGK A;  3QPG A;  1LW5 A;  3BV0 A;  1LK9 A;  2OKJ A;  5EUD A;  2OAT A;  1FG3 A;  4EB7 A;  3EI8 A;  2VLF A;  3KKI A;  1QJ3 A;  1ARG A;  4BA4 A;  2GQN A;  2YCT A;  2R5C B;  3R4T A;  1UKJ A;  1WYV A;  2PB0 A;  3RBF A;  5BJ3 A;  4F5G A;  2DGM A;  5E3K A;  4Q76 A;  3DRD A;  3BC8 A;  4P3M A;  4PIW A;  5M4B A;  3HT4 A;  1CL2 A;  4WLJ A;  4Y0I A;  1C9C A;  2EZ1 A;  3N75 A;  1ASD A;  3PDB B;  4E3Q A;  2BYL A;  3AEJ C;  1VP4 A;  1AHE A;  2PO3 A;  2PB2 A;  1M0Q A;  1RVY A;  2O0R A;  3QM2 A;  4AZJ A;  3HBX A;  4ISY A;  5D95 A;  4W5K A;  3FDB A;  5K8B A;  3DR4 A;  1UU0 A;  3TFU A;  2ZC0 A;  3A9Z A;  1WST A;  1P3W A;  1AAM A;  5G4I A;  4A00 A;  4U1T A;  3OP7 A;  2BIE A;  5G0A A;  5IWQ A;  4IXS A;  3WGB A;  2BWO A;  3AEN A;  4R5Z A;  4WYF A;  4PFN A;  4WD2 A;  4MKK A;  1W7L A;  1BS0 A;  1W7N A;  2VMV A;  3WLX A;  3K40 A;  5BJ4 A;  1MDO A;  3HLM A;  2BWN A;  4A0H A;  4H51 A;  4TV7 A;  2VGT A;  5LHA A;  4OMA A;  4Q31 A;  4WP0 A;  4A0G A;  3GET A;  2C7T A;  4E1O A;  3HVY A;  3NUB A;  1BKG A;  4A6U A;  1DJE A;  4W1V A;  1ASF A;  4E3R A;  1AY8 A;  4ZAH A;  4MQR A;  1ART A;  1H0C A;  2VMX A;  3ELP A;  2D61 A;  4GE9 A;  4CBR A;  2NMP A;  1MLY A;  4LC3 A;  4ZAS A;  4N0B A;  3ATH A;  3ZZK A;  2ZP7 A;  3FRK A;  4WB0 B;  3E9K A;  2D5Y A;  2AY2 A;  3DU4 A;  3LWS A;  3E6G A;  4K2B A;  3RI6 A;  2Z20 A;  3L8A A;  2WK9 A;  4A72 A;  4L0O A;  2QLR A;  4NOG A;  3F0H A;  3KGX A;  1VEF A;  3QN6 A;  3WZF A;  3PIU A;  3H14 A;  1BQD A;  1CZE A;  2VMN A;  1O61 A;  3CQ4 A;  3GJU A;  4IW7 A;  4IYO B;  4M2M A;  5DB5 A;  1XEY A;  1N31 A;  2HUF A;  2VMS A;  1IX8 A;  1MAP A;  4TN4 A;  1J04 A;  2D65 A;  1TOG A;  3P6K A;  2GB3 A;  5JAY A;  3FFH A;  1SZS A;  3MC6 C;  5FT4 A;  4JEZ A;  3B1E A;  1D2F A;  1QIT A;  2BHX A;  2W7J A;  3NYS A;  1YOO A;  1KKJ A;  2E54 A;  2ZY5 A;  1AMA A;  2JJE A;  4UQV A;  4F5F A;  4MSO A;  4PVF A;  3NYU A;  3EUC A;  1UU2 A;  1IAX A;  2JG2 A;  3UWC A;  4OT8 A;  2CJD A;  4MQP A;  1S08 A;  3N0L A;  5C6U A;  2VI9 A;  2AY7 A;  3AEO A;  3K7Y A;  1GEY A;  1V2E A;  2CAN A;  1AX4 A;  2Z1Z A;  2AY6 A;  2ZSL A;  3FD0 A;  1CQ6 A;  2ZYJ A;  5EIG B;  3VP6 A;  5EAA A;  4XJL A;  1RV4 A;  3LVJ A;  1XI9 A;  1OXO A;  2TPL A;  3GZC A;  3WKR A;  3WKS A;  3R9A A;  2YRI A;  4ZDO A;  1AMQ A;  4WB0 A;  4RAE A;  4DQ6 A;  5HDM A;  2AY1 A;  3G8M A;  4XJP A;  3PJ0 A;  5G2Q A;  2Z9X A;  3GR9 A;  1CQ7 A;  1GC2 A;  1D7V A;  2HP1 A;  1LS3 A;  2VIA A;  2VMQ A;  2BIA A;  2W7L A;  2ZY3 A;  2AAT A;  2YKV A;  1MGV A;  4F5I A;  3M5U A;  1S0A A;  1S09 A;  2W7E A;  3B46 A;  4ZWV A;  2AEV A;  4A6T A;  1B5O A;  2CIN A;  2BI2 A;  3TAT A;  5EAV A;  3AOW A;  3QBO A;  4MKJ A;  4P7Y A;  3CBF A;  2FNU A;  3G7Q A;  4KAM A;  1LC7 A;  3ASA A;  1BJN A;  3LV2 A;  1YAA A;  1ZC9 A;  4UHN A;  1S06 A;  2HOZ A;  3TFT A;  3A9X A;  3MAF B;  1G4X A;  3TCM A;  4WYE A;  3EIB A;  3ASB A;  4KYO A;  1AJR A;  2BWP A;  3F9T A;  1FC4 A;  4LNL A;  2VMW A;  2VMY A;  3B1C A;  3NU7 A;  2FQ6 A;  2C44 A;  4QGR A;  3ZRR A;  1WYT A;  2W8U A;  1TOI A;  4Q6R A;  1AKC A;  4W91 A;  4CXR A;  1B9H A;  3N5M A;  2ZY2 A;  2E7I A;  1E5F A;  3B8X A;  1TPL A;  2D7Y A;  2HOR A;  1QJ5 A;  3UE8 A;  5M4D A;  4ADE A;  1V2D A;  5EIG A;  1M6S A;  4BA5 A;  3EI6 A; 
#chains in the Genus database with same CATH topology
 3CAI A;  2FN6 A;  1C4K A;  4B98 A;  3NX3 A;  2GMS A;  1JS3 A;  1ARI A;  3BN1 A;  3FDD A;  1PG8 A;  4PFF A;  1BJO A;  1IX6 A;  3JWB A;  1KKP A;  2ZY4 A;  3FZ7 A;  3VK4 A;  3CQ5 A;  3FZ8 A;  1CQ8 A;  2VMT A;  5DX5 A;  2CY8 A;  2F8J A;  2QSR A;  4ATQ A;  2OGE A;  5AX8 A;  4J5U A;  4ZWM A;  3VK2 A;  1W23 A;  2O1B A;  4AOA A;  1BJ4 A;  2W7M A;  4XJO A;  2CST A;  1X29 A;  1TAR A;  4IY7 A;  1ASE A;  1RV3 A;  1OXP A;  2X5F A;  3JTX A;  1TAT A;  4AO9 A;  4ZSW A;  3W1H A;  4JF1 A;  1DJU A;  3NRA A;  2BI5 A;  4BHD A;  3DC1 A;  4RLG A;  5E4Z A;  3WCO A;  2AY5 A;  4GEB A;  1M7Y A;  1DTY A;  3HQT A;  3KGW A;  3RCH B;  2W7D A;  1IUG A;  4MY5 A;  2R5C A;  2Z67 A;  3OKS A;  4EMY A;  2CJH A;  2YKX A;  2JIS A;  3GSB A;  3MAF A;  2CFB A;  3FZ6 A;  2E7J A;  3AAT A;  4LW4 A;  4ZSY A;  1QGN A;  3RUY A;  4A6R A;  2W7I A;  1Z7D A;  5M49 A;  3PGY A;  2Z1Y A;  4UHM A;  1PMM A;  3EIA A;  3PDB A;  3WCN A;  1BJW A;  4M2K A;  1AKA A;  3PD6 B;  4OCA A;  3ZZJ A;  4JEW A;  5E5I A;  2HOX A;  2EO5 A;  2W7K A;  3BCA A;  4AO4 A;  3EI9 A;  1H1C A;  3Q8N A;  1DJ9 A;  2AY3 A;  2HZP A;  2W7F A;  4O6Z A;  4Q75 A;  1IX7 A;  1AHY A;  1GEX A;  1JF9 A;  2ZUK A;  2AY4 A;  1AMR A;  3AEP A;  3MEB A;  3PA9 A;  1MAQ A;  3I5T A;  1WKH A;  3JU7 A;  8AAT A;  3LG0 A;  5FT5 A;  1C0N A;  3ELE A;  4RJ0 A;  1GC0 A;  1JS6 A;  1YIY A;  1D7R A;  2C0R A;  3CQ6 A;  3RCH A;  4JE5 A;  2YCP A;  1KMJ A;  5I92 A;  5D5S A;  1AMS A;  1D7U A;  1M0N A;  2EPJ A;  3RQ1 A;  3H9X A;  2YHK A;  2XH1 A;  4FL0 A;  3JZL A;  1T3I A;  2X3L A;  3GWP A;  1D7S A;  3P1T A;  3NU8 A;  3MKJ A;  4DBC A;  3AEL A;  3GZD C;  1ASA A;  4RIZ A;  1G7W A;  1IBJ A;  1GC3 A;  4Y0H A;  1FG7 A;  1KL1 A;  2AY8 A;  4RJY A;  4W1W A;  2W8V A;  3E2Z B;  1B8G A;  3FCR A;  3DXW A;  2W7H A;  3ACZ A;  1Z3Z A;  3DZZ A;  1UU1 A;  4UHO A;  4CBS A;  1EJI A;  1GD9 A;  1SPA A;  2WK8 A;  3GZD A;  2W8T A;  2Q7W A;  5DJ1 A;  1AHG A;  2FKI A;  3FKD A;  4ZDL A;  1ORD A;  1M32 A;  1G7X A;  1YJS A;  1EG5 A;  1GC4 A;  2HUU A;  1OHY A;  3NDN A;  1ECX A;  1IAY A;  1MLZ A;  2FNI A;  4IXO A;  3WX9 A;  4ZM4 A;  9AAT A;  1I48 A;  2YKU A;  2AEU A;  3QI6 A;  4F5J A;  1WYU B;  3EZ1 A;  3IHJ A;  1S07 A;  4OBV A;  5EUE A;  4AH3 A;  4H63 Q;  3JW9 A;  1KAF A;  1ASB A;  4WYA A;  3BWO A;  2EZ2 A;  7AAT A;  2O7C A;  3A2B A;  1M0P A;  2R5E A;  4U2H A;  4F5M A;  1CJ0 A;  3BB8 A;  3NUI A;  4WBT A;  2GMU A;  1C7O A;  1SFF A;  5EQC A;  5DJ9 A;  3RBL A;  1G4V A;  1I41 A;  3FVU A;  2GSA A;  3DOD A;  2RFV A;  5G4J A;  4IYO A;  1ARH A;  4EU1 A;  1E5E A;  1AIB A;  3FVS A;  1AHX A;  3E77 A;  1QZ9 A;  1KMK A;  1ARS A;  3HDO A;  2EH6 A;  3MAU A;  3A8U X;  3LVM A;  4ZLV A;  2YOB A;  2VIB A;  4ZDP A;  2CH1 A;  2X8U A;  3EI7 A;  5HHY A;  3FTB A;  2JJF A;  4EFF A;  4RKD A;  1V2F A;  4OTL A;  4LW2 A;  4BQ0 A;  1ASG A;  2G6W A;  1GDE A;  3G0T A;  4IXZ A;  1DGD A;  2VGW A;  3H7F A;  3NTJ A;  3FFR A;  1SF2 A;  3E2Z A;  3MAD A;  4CVQ A;  1TOE A;  1B4X A;  4F4E A;  1PMO A;  1SVV A;  1OHV A;  3B1D A;  1TAS A;  2DKJ A;  1YNU A;  4KXK A;  4LNJ A;  4R2N A;  1U08 A;  5HXX A;  4XJM A;  3QGU A;  2DKB A;  4AZK A;  3LVL B;  4A0R A;  1X2A A;  3I4J A;  1AJS B;  1GEW A;  2VGS A;  3E2Y A;  1M0O A;  1YJZ A;  4BMK A;  4JF0 A;  2D63 A;  3USF A;  1WYU A;  2HP2 A;  3VOM A;  1Y4I A;  1O69 A;  1YJY A;  2ZSM A;  4N0W A;  1DGE A;  2W8W A;  2VGU A;  4HF8 A;  2AY9 A;  2FYF A;  2VGZ A;  2Z9W A;  4RM1 A;  3BS8 A;  1J32 A;  1I43 A;  2HOY A;  2D7Z A;  2OQX A;  5LH9 A;  2HUI A;  1ELU A;  1GCK A;  2BYJ A;  1B9I A;  4WYC A;  4K2M A;  2YRR A;  4FFC A;  1BW0 A;  2ORD A;  3VAX A;  3AEJ A;  3IF2 A;  4R8D A;  4Y0D A;  3JWA A;  4ADB A;  4WXB A;  4WLH A;  4K05 A;  5G2P A;  4JE5 D;  4F5H A;  5FT6 A;  4A0F A;  1CL1 A;  4OYT A;  1QIR A;  5F8V A;  3I16 A;  3D6K A;  3N4X A;  2QA3 A;  3GBX A;  2OKK A;  4LNM A;  1X0M A;  4EB5 A;  1V72 A;  2JJH A;  1DKA A;  1RVU A;  1AAW A;  3BWN C;  1AY5 A;  4ITX A;  5J8Q A;  1ZOD A;  3BCB A;  3NNK A;  4GRX A;  3W1I A;  1EQB A;  1W7M A;  4JEV A;  1C7N A;  1ASN A;  1KL2 A;  4OBU A;  1C7G A;  3K28 A;  4WYD A;  2CH2 A;  2QBT A;  1X28 A;  3PPL A;  2VMR A;  4XAU A;  4GDY A;  3BWN A;  2CB1 A;  4TMR A;  3T32 A;  2X5D A;  2BKW A;  1N8P A;  5TF5 A;  3II0 A;  4ZM3 A;  2BI1 A;  3UAK A;  2QMA A;  2WK7 A;  4HVK A;  1CS1 A;  1O62 A;  2OGA A;  1AJS A;  1LW4 A;  1GBN A;  3LY1 A;  3L44 A;  2DOU A;  2R0T A;  4UOY A;  5F9S A;  3TQX A;  3PAA A;  4RKC A;  4ADD A;  4B9B A;  4F5K A;  3KE3 A;  2VGV A;  5EFS A;  4M2J A;  4ADC A;  2WKA A;  1ASC A;  1TOJ A;  3A9Y A;  3HL2 A;  1LC5 A;  5G09 A;  2VLH A;  3DR7 A;  3DYD A;  4JEX A;  3ZRP A;  2CJG A;  4RIT A;  1AIA A;  2VI8 A;  4WXG A;  3FVX A;  1MDX A;  1DFO A;  3FSL A;  1VJO A;  1YIZ A;  1OAT A;  3VK3 A;  3COG A;  2JJG A;  2VMU A;  2VYC A;  1AY4 A;  3FQ8 A;  1WYV B;  4MQQ A;  1BQA A;  2D64 A;  3AEM C;  2CTZ A;  1IVR A;  3ECD A;  1JG8 A;  1AKB A;  1I29 A;  1LKC A;  1MDZ A;  1N2T A;  3E2F A;  1TOK A;  4XK1 A;  3AOV A;  3BCX A;  2QB2 A;  2C81 A;  3AV7 A;  1O4S A;  2JGT A;  4K2I A;  3EZS A;  1PFF A;  3HMU A;  3FQA A;  4XQ2 A;  2QB3 A;  1WYT B;  1QIS A;  2W8J A;  2W7G A;  3AEM A;  1SZK A;  4I8A A;  3MC6 A;  4DGT A;  2R2N A;  1ASM A;  2Z9V A;  1BT4 A;  3MBB A;  3QHX A;  1B5P A;  1LC8 A;  1AHF A;  4ITG A;  4ATP A;  1WKG A;  1SZU A;  2DGL A;  3PD6 A;  4WYG A;  3W1J A;  2D66 A;  2BIG A;  3ZRQ A;  4CXQ A;  1M4N A;  2VMO A;  3EI5 A;  1ELQ A;  2E7U A;  4GE7 A;  3ISL A;  1AIC A;  2BI3 A;  2V1P A;  2VMZ A;  1CZC A;  4MGR A;  2XBN A;  3FQ7 A;  2EGY A;  2ZJG A;  2YKY A;  5M46 A;  3N4R A;  3AEN B;  3LVK A;  3WY7 A;  1BJO B;  4GE4 A;  1IJI A;  2FM1 A;  3PDX A;  4IX8 A;  4OC9 A;  4W8I A;  3DXV A;  5EUN A;  4GSA A;  1ASL A;  4F5L A;  4J8L A;  2Z9U A;  3WGC A;  4E77 A;  4WXF A;  1ZOB A;  3NYT A;  2KFP A;  2BI9 A;  2EYQ A;  4JEY A;  2V0Y A;  4R5F A;  2DR1 A;  3F6T A;  2VMP A;  1OHW A;  4W1X A;  2Z61 A;  2YCN A;  5FT8 A;  4XEW A;  1W3U A;  2DGK A;  3QPG A;  1LW5 A;  3BV0 A;  1LK9 A;  2OKJ A;  5EUD A;  2OAT A;  1FG3 A;  4EB7 A;  3EI8 A;  2VLF A;  3KKI A;  1QJ3 A;  1ARG A;  4BA4 A;  2GQN A;  2YCT A;  2R5C B;  3R4T A;  1UKJ A;  1WYV A;  2PB0 A;  3RBF A;  5BJ3 A;  4F5G A;  2DGM A;  5E3K A;  4Q76 A;  3DRD A;  3BC8 A;  4P3M A;  4PIW A;  5M4B A;  3HT4 A;  1CL2 A;  4WLJ A;  4Y0I A;  1C9C A;  2EZ1 A;  3N75 A;  1ASD A;  3PDB B;  4E3Q A;  2BYL A;  3AEJ C;  1VP4 A;  1AHE A;  2PO3 A;  2PB2 A;  1M0Q A;  1RVY A;  2O0R A;  3QM2 A;  4AZJ A;  3HBX A;  4ISY A;  5D95 A;  4W5K A;  3FDB A;  5K8B A;  3DR4 A;  1UU0 A;  3TFU A;  2ZC0 A;  3A9Z A;  1WST A;  1P3W A;  1AAM A;  5G4I A;  4A00 A;  4U1T A;  3OP7 A;  2BIE A;  5G0A A;  5IWQ A;  4IXS A;  3WGB A;  2BWO A;  3AEN A;  4R5Z A;  4WYF A;  4PFN A;  4WD2 A;  4MKK A;  1W7L A;  3N4S A;  1BS0 A;  1W7N A;  2VMV A;  3WLX A;  3K40 A;  3N7N A;  5BJ4 A;  1MDO A;  3HLM A;  2BWN A;  4A0H A;  4H51 A;  4TV7 A;  2VGT A;  5LHA A;  4OMA A;  4Q31 A;  4WP0 A;  4A0G A;  2G7J A;  3GET A;  2C7T A;  4E1O A;  3HVY A;  3NUB A;  1BKG A;  4A6U A;  1DJE A;  4W1V A;  1ASF A;  4E3R A;  1AY8 A;  4ZAH A;  4MQR A;  1ART A;  1H0C A;  2VMX A;  3ELP A;  2D61 A;  4GE9 A;  4CBR A;  2NMP A;  1MLY A;  4LC3 A;  4ZAS A;  4N0B A;  3ATH A;  3ZZK A;  2ZP7 A;  3FRK A;  4WB0 B;  3E9K A;  2D5Y A;  2AY2 A;  3DU4 A;  3LWS A;  3E6G A;  4K2B A;  3RI6 A;  2Z20 A;  3L8A A;  2WK9 A;  4A72 A;  4L0O A;  2QLR A;  4NOG A;  2A1V A;  3F0H A;  3KGX A;  1VEF A;  3QN6 A;  3WZF A;  3PIU A;  3H14 A;  1BQD A;  1CZE A;  2VMN A;  1O61 A;  3CQ4 A;  3GJU A;  4IW7 A;  4IYO B;  4M2M A;  5DB5 A;  1XEY A;  1N31 A;  2HUF A;  2VMS A;  1IX8 A;  1MAP A;  4TN4 A;  1J04 A;  2D65 A;  1TOG A;  5KTB A;  3P6K A;  2GB3 A;  5JAY A;  3FFH A;  1SZS A;  3MC6 C;  5FT4 A;  4JEZ A;  3B1E A;  1D2F A;  1QIT A;  2BHX A;  2W7J A;  3NYS A;  1YOO A;  1KKJ A;  2E54 A;  2ZY5 A;  1AMA A;  2JJE A;  4UQV A;  4F5F A;  4MSO A;  4PVF A;  3NYU A;  3EUC A;  1UU2 A;  1IAX A;  2JG2 A;  3UWC A;  4OT8 A;  2CJD A;  4MQP A;  1S08 A;  3N0L A;  5C6U A;  2VI9 A;  2AY7 A;  3AEO A;  3K7Y A;  1GEY A;  1V2E A;  2CAN A;  1AX4 A;  2Z1Z A;  2AY6 A;  2ZSL A;  3FD0 A;  1CQ6 A;  2ZYJ A;  5EIG B;  3VP6 A;  5EAA A;  4XJL A;  1RV4 A;  3LVJ A;  1XI9 A;  1OXO A;  2TPL A;  3GZC A;  3WKR A;  3WKS A;  3R9A A;  2YRI A;  4ZDO A;  1AMQ A;  4WB0 A;  4RAE A;  4DQ6 A;  5HDM A;  2AY1 A;  3G8M A;  4XJP A;  3PJ0 A;  5G2Q A;  2Z9X A;  3GR9 A;  1CQ7 A;  1GC2 A;  1D7V A;  2HP1 A;  1LS3 A;  2VIA A;  2VMQ A;  2BIA A;  2W7L A;  2ZY3 A;  2AAT A;  2YKV A;  1MGV A;  4F5I A;  3M5U A;  1S0A A;  1S09 A;  2W7E A;  3B46 A;  4ZWV A;  2AEV A;  4A6T A;  1B5O A;  2CIN A;  2BI2 A;  3TAT A;  5EAV A;  3AOW A;  3QBO A;  4MKJ A;  4P7Y A;  3CBF A;  2FNU A;  3G7Q A;  4KAM A;  1LC7 A;  3ASA A;  1BJN A;  3LV2 A;  1YAA A;  1ZC9 A;  4UHN A;  1S06 A;  2HOZ A;  3TFT A;  3A9X A;  3MAF B;  1G4X A;  3TCM A;  4WYE A;  3EIB A;  3ASB A;  4KYO A;  1AJR A;  2BWP A;  3F9T A;  1FC4 A;  4LNL A;  2VMW A;  2VMY A;  3B1C A;  3NU7 A;  2FQ6 A;  2C44 A;  4QGR A;  3ZRR A;  1WYT A;  2W8U A;  1TOI A;  4Q6R A;  1AKC A;  4W91 A;  4CXR A;  1B9H A;  3N5M A;  2ZY2 A;  2E7I A;  1E5F A;  3B8X A;  1TPL A;  2D7Y A;  2HOR A;  1QJ5 A;  3UE8 A;  5M4D A;  4ADE A;  1V2D A;  5EIG A;  1M6S A;  2WB6 A;  4BA5 A;  3EI6 A; 
#chains in the Genus database with same CATH homology
 3CAI A;  2FN6 A;  1C4K A;  4B98 A;  3NX3 A;  2GMS A;  1JS3 A;  1ARI A;  3BN1 A;  3FDD A;  1PG8 A;  4PFF A;  1BJO A;  1IX6 A;  3JWB A;  1KKP A;  2ZY4 A;  3FZ7 A;  3VK4 A;  3CQ5 A;  3FZ8 A;  1CQ8 A;  2VMT A;  5DX5 A;  2CY8 A;  2F8J A;  2QSR A;  4ATQ A;  2OGE A;  5AX8 A;  4J5U A;  4ZWM A;  3VK2 A;  1W23 A;  2O1B A;  4AOA A;  1BJ4 A;  2W7M A;  4XJO A;  2CST A;  1X29 A;  1TAR A;  4IY7 A;  1ASE A;  1RV3 A;  1OXP A;  2X5F A;  3JTX A;  1TAT A;  4AO9 A;  4ZSW A;  3W1H A;  4JF1 A;  1DJU A;  3NRA A;  2BI5 A;  4BHD A;  3DC1 A;  4RLG A;  5E4Z A;  3WCO A;  2AY5 A;  4GEB A;  1M7Y A;  1DTY A;  3HQT A;  3KGW A;  3RCH B;  2W7D A;  1IUG A;  4MY5 A;  2R5C A;  2Z67 A;  3OKS A;  4EMY A;  2CJH A;  2YKX A;  2JIS A;  3GSB A;  3MAF A;  2CFB A;  3FZ6 A;  2E7J A;  3AAT A;  4LW4 A;  4ZSY A;  1QGN A;  3RUY A;  4A6R A;  2W7I A;  1Z7D A;  5M49 A;  3PGY A;  2Z1Y A;  4UHM A;  1PMM A;  3EIA A;  3PDB A;  3WCN A;  1BJW A;  4M2K A;  1AKA A;  3PD6 B;  4OCA A;  3ZZJ A;  4JEW A;  5E5I A;  2HOX A;  2EO5 A;  2W7K A;  3BCA A;  4AO4 A;  3EI9 A;  1H1C A;  3Q8N A;  1DJ9 A;  2AY3 A;  2HZP A;  2W7F A;  4O6Z A;  4Q75 A;  1IX7 A;  1AHY A;  1GEX A;  1JF9 A;  2ZUK A;  2AY4 A;  1AMR A;  3AEP A;  3MEB A;  3PA9 A;  1MAQ A;  3I5T A;  1WKH A;  3JU7 A;  8AAT A;  3LG0 A;  5FT5 A;  1C0N A;  3ELE A;  4RJ0 A;  1GC0 A;  1JS6 A;  1YIY A;  1D7R A;  2C0R A;  3CQ6 A;  3RCH A;  4JE5 A;  2YCP A;  1KMJ A;  5I92 A;  5D5S A;  1AMS A;  1D7U A;  1M0N A;  2EPJ A;  3RQ1 A;  3H9X A;  2YHK A;  2XH1 A;  4FL0 A;  3JZL A;  1T3I A;  2X3L A;  3GWP A;  1D7S A;  3P1T A;  3NU8 A;  3MKJ A;  4DBC A;  3AEL A;  3GZD C;  1ASA A;  4RIZ A;  1G7W A;  1IBJ A;  1GC3 A;  4Y0H A;  1FG7 A;  1KL1 A;  2AY8 A;  4RJY A;  4W1W A;  2W8V A;  3E2Z B;  1B8G A;  3FCR A;  3DXW A;  2W7H A;  3ACZ A;  1Z3Z A;  3DZZ A;  1UU1 A;  4UHO A;  4CBS A;  1EJI A;  1GD9 A;  1SPA A;  2WK8 A;  3GZD A;  2W8T A;  2Q7W A;  5DJ1 A;  1AHG A;  2FKI A;  3FKD A;  4ZDL A;  1ORD A;  1M32 A;  1G7X A;  1YJS A;  1EG5 A;  1GC4 A;  2HUU A;  1OHY A;  3NDN A;  1ECX A;  1IAY A;  1MLZ A;  2FNI A;  4IXO A;  3WX9 A;  4ZM4 A;  9AAT A;  1I48 A;  2YKU A;  2AEU A;  3QI6 A;  4F5J A;  1WYU B;  3EZ1 A;  3IHJ A;  1S07 A;  4OBV A;  5EUE A;  4AH3 A;  4H63 Q;  3JW9 A;  1ASB A;  4WYA A;  3BWO A;  2EZ2 A;  7AAT A;  2O7C A;  3A2B A;  1M0P A;  2R5E A;  4U2H A;  4F5M A;  1CJ0 A;  3BB8 A;  3NUI A;  4WBT A;  2GMU A;  1C7O A;  1SFF A;  5EQC A;  5DJ9 A;  3RBL A;  1G4V A;  1I41 A;  3FVU A;  2GSA A;  3DOD A;  2RFV A;  5G4J A;  4IYO A;  1ARH A;  4EU1 A;  1E5E A;  1AIB A;  3FVS A;  1AHX A;  3E77 A;  1QZ9 A;  1KMK A;  1ARS A;  3HDO A;  2EH6 A;  3MAU A;  3A8U X;  3LVM A;  4ZLV A;  2YOB A;  2VIB A;  4ZDP A;  2CH1 A;  2X8U A;  3EI7 A;  5HHY A;  3FTB A;  2JJF A;  4EFF A;  4RKD A;  1V2F A;  4OTL A;  4LW2 A;  4BQ0 A;  1ASG A;  2G6W A;  1GDE A;  3G0T A;  4IXZ A;  1DGD A;  2VGW A;  3H7F A;  3NTJ A;  3FFR A;  1SF2 A;  3E2Z A;  3MAD A;  4CVQ A;  1TOE A;  1B4X A;  4F4E A;  1PMO A;  1SVV A;  1OHV A;  3B1D A;  1TAS A;  2DKJ A;  1YNU A;  4KXK A;  4LNJ A;  4R2N A;  1U08 A;  5HXX A;  4XJM A;  3QGU A;  2DKB A;  4AZK A;  3LVL B;  4A0R A;  1X2A A;  3I4J A;  1AJS B;  1GEW A;  2VGS A;  3E2Y A;  1M0O A;  1YJZ A;  4BMK A;  4JF0 A;  2D63 A;  3USF A;  1WYU A;  2HP2 A;  3VOM A;  1Y4I A;  1O69 A;  1YJY A;  2ZSM A;  4N0W A;  1DGE A;  2W8W A;  2VGU A;  4HF8 A;  2AY9 A;  2FYF A;  2VGZ A;  2Z9W A;  4RM1 A;  3BS8 A;  1J32 A;  1I43 A;  2HOY A;  2D7Z A;  2OQX A;  5LH9 A;  2HUI A;  1ELU A;  1GCK A;  2BYJ A;  1B9I A;  4WYC A;  4K2M A;  2YRR A;  4FFC A;  1BW0 A;  2ORD A;  3VAX A;  3AEJ A;  3IF2 A;  4R8D A;  4Y0D A;  3JWA A;  4ADB A;  4WXB A;  4WLH A;  4K05 A;  5G2P A;  4JE5 D;  4F5H A;  5FT6 A;  4A0F A;  1CL1 A;  4OYT A;  1QIR A;  5F8V A;  3I16 A;  3D6K A;  3N4X A;  2QA3 A;  3GBX A;  2OKK A;  4LNM A;  1X0M A;  4EB5 A;  1V72 A;  2JJH A;  1DKA A;  1RVU A;  1AAW A;  3BWN C;  1AY5 A;  4ITX A;  5J8Q A;  1ZOD A;  3BCB A;  3NNK A;  4GRX A;  3W1I A;  1EQB A;  1W7M A;  4JEV A;  1C7N A;  1ASN A;  1KL2 A;  4OBU A;  1C7G A;  3K28 A;  4WYD A;  2CH2 A;  2QBT A;  1X28 A;  3PPL A;  2VMR A;  4XAU A;  4GDY A;  3BWN A;  2CB1 A;  4TMR A;  3T32 A;  2X5D A;  2BKW A;  1N8P A;  5TF5 A;  3II0 A;  4ZM3 A;  2BI1 A;  3UAK A;  2QMA A;  2WK7 A;  4HVK A;  1CS1 A;  1O62 A;  2OGA A;  1AJS A;  1LW4 A;  1GBN A;  3LY1 A;  3L44 A;  2DOU A;  2R0T A;  4UOY A;  5F9S A;  3TQX A;  3PAA A;  4RKC A;  4ADD A;  4B9B A;  4F5K A;  3KE3 A;  2VGV A;  5EFS A;  4M2J A;  4ADC A;  2WKA A;  1ASC A;  1TOJ A;  3A9Y A;  3HL2 A;  1LC5 A;  5G09 A;  2VLH A;  3DR7 A;  3DYD A;  4JEX A;  3ZRP A;  2CJG A;  4RIT A;  1AIA A;  2VI8 A;  4WXG A;  3FVX A;  1MDX A;  1DFO A;  3FSL A;  1VJO A;  1YIZ A;  1OAT A;  3VK3 A;  3COG A;  2JJG A;  2VMU A;  2VYC A;  1AY4 A;  3FQ8 A;  1WYV B;  4MQQ A;  1BQA A;  2D64 A;  3AEM C;  2CTZ A;  1IVR A;  3ECD A;  1JG8 A;  1AKB A;  1I29 A;  1LKC A;  1MDZ A;  1N2T A;  3E2F A;  1TOK A;  4XK1 A;  3AOV A;  3BCX A;  2QB2 A;  2C81 A;  3AV7 A;  1O4S A;  2JGT A;  4K2I A;  3EZS A;  1PFF A;  3HMU A;  3FQA A;  4XQ2 A;  2QB3 A;  1WYT B;  1QIS A;  2W8J A;  2W7G A;  3AEM A;  1SZK A;  4I8A A;  3MC6 A;  4DGT A;  2R2N A;  1ASM A;  2Z9V A;  1BT4 A;  3MBB A;  3QHX A;  1B5P A;  1LC8 A;  1AHF A;  4ITG A;  4ATP A;  1WKG A;  1SZU A;  2DGL A;  3PD6 A;  4WYG A;  3W1J A;  2D66 A;  2BIG A;  3ZRQ A;  4CXQ A;  1M4N A;  2VMO A;  3EI5 A;  1ELQ A;  2E7U A;  4GE7 A;  3ISL A;  1AIC A;  2BI3 A;  2V1P A;  2VMZ A;  1CZC A;  4MGR A;  2XBN A;  3FQ7 A;  2EGY A;  2ZJG A;  2YKY A;  5M46 A;  3N4R A;  3AEN B;  3LVK A;  3WY7 A;  1BJO B;  4GE4 A;  1IJI A;  2FM1 A;  3PDX A;  4IX8 A;  4OC9 A;  4W8I A;  3DXV A;  5EUN A;  4GSA A;  1ASL A;  4F5L A;  4J8L A;  2Z9U A;  3WGC A;  4E77 A;  4WXF A;  1ZOB A;  3NYT A;  2KFP A;  2BI9 A;  2EYQ A;  4JEY A;  2V0Y A;  4R5F A;  2DR1 A;  3F6T A;  2VMP A;  1OHW A;  4W1X A;  2Z61 A;  2YCN A;  5FT8 A;  4XEW A;  1W3U A;  2DGK A;  3QPG A;  1LW5 A;  3BV0 A;  1LK9 A;  2OKJ A;  5EUD A;  2OAT A;  1FG3 A;  4EB7 A;  3EI8 A;  2VLF A;  3KKI A;  1QJ3 A;  1ARG A;  4BA4 A;  2GQN A;  2YCT A;  2R5C B;  3R4T A;  1UKJ A;  1WYV A;  2PB0 A;  3RBF A;  5BJ3 A;  4F5G A;  2DGM A;  5E3K A;  4Q76 A;  3DRD A;  3BC8 A;  4P3M A;  4PIW A;  5M4B A;  3HT4 A;  1CL2 A;  4WLJ A;  4Y0I A;  1C9C A;  2EZ1 A;  3N75 A;  1ASD A;  3PDB B;  4E3Q A;  2BYL A;  3AEJ C;  1VP4 A;  1AHE A;  2PO3 A;  2PB2 A;  1M0Q A;  1RVY A;  2O0R A;  3QM2 A;  4AZJ A;  3HBX A;  4ISY A;  5D95 A;  4W5K A;  3FDB A;  5K8B A;  3DR4 A;  1UU0 A;  3TFU A;  2ZC0 A;  3A9Z A;  1WST A;  1P3W A;  1AAM A;  5G4I A;  4A00 A;  4U1T A;  3OP7 A;  2BIE A;  5G0A A;  5IWQ A;  4IXS A;  3WGB A;  2BWO A;  3AEN A;  4R5Z A;  4WYF A;  4PFN A;  4WD2 A;  4MKK A;  1W7L A;  3N4S A;  1BS0 A;  1W7N A;  2VMV A;  3WLX A;  3K40 A;  3N7N A;  5BJ4 A;  1MDO A;  3HLM A;  2BWN A;  4A0H A;  4H51 A;  4TV7 A;  2VGT A;  5LHA A;  4OMA A;  4Q31 A;  4WP0 A;  4A0G A;  2G7J A;  3GET A;  2C7T A;  4E1O A;  3HVY A;  3NUB A;  1BKG A;  4A6U A;  1DJE A;  4W1V A;  1ASF A;  4E3R A;  1AY8 A;  4ZAH A;  4MQR A;  1ART A;  1H0C A;  2VMX A;  3ELP A;  2D61 A;  4GE9 A;  4CBR A;  2NMP A;  1MLY A;  4LC3 A;  4ZAS A;  4N0B A;  3ATH A;  3ZZK A;  2ZP7 A;  3FRK A;  4WB0 B;  3E9K A;  2D5Y A;  2AY2 A;  3DU4 A;  3LWS A;  3E6G A;  4K2B A;  3RI6 A;  2Z20 A;  3L8A A;  2WK9 A;  4A72 A;  4L0O A;  2QLR A;  4NOG A;  2A1V A;  3F0H A;  3KGX A;  1VEF A;  3QN6 A;  3WZF A;  3PIU A;  3H14 A;  1BQD A;  1CZE A;  2VMN A;  1O61 A;  3CQ4 A;  3GJU A;  4IW7 A;  4IYO B;  4M2M A;  5DB5 A;  1XEY A;  1N31 A;  2HUF A;  2VMS A;  1IX8 A;  1MAP A;  4TN4 A;  1J04 A;  2D65 A;  1TOG A;  5KTB A;  3P6K A;  2GB3 A;  5JAY A;  3FFH A;  1SZS A;  3MC6 C;  5FT4 A;  4JEZ A;  3B1E A;  1D2F A;  1QIT A;  2BHX A;  2W7J A;  3NYS A;  1YOO A;  1KKJ A;  2E54 A;  2ZY5 A;  1AMA A;  2JJE A;  4UQV A;  4F5F A;  4MSO A;  4PVF A;  3NYU A;  3EUC A;  1UU2 A;  1IAX A;  2JG2 A;  3UWC A;  4OT8 A;  2CJD A;  4MQP A;  1S08 A;  3N0L A;  5C6U A;  2VI9 A;  2AY7 A;  3AEO A;  3K7Y A;  1GEY A;  1V2E A;  2CAN A;  1AX4 A;  2Z1Z A;  2AY6 A;  2ZSL A;  3FD0 A;  1CQ6 A;  2ZYJ A;  5EIG B;  3VP6 A;  5EAA A;  4XJL A;  1RV4 A;  3LVJ A;  1XI9 A;  1OXO A;  2TPL A;  3GZC A;  3WKR A;  3WKS A;  3R9A A;  2YRI A;  4ZDO A;  1AMQ A;  4WB0 A;  4RAE A;  4DQ6 A;  5HDM A;  2AY1 A;  3G8M A;  4XJP A;  3PJ0 A;  5G2Q A;  2Z9X A;  3GR9 A;  1CQ7 A;  1GC2 A;  1D7V A;  2HP1 A;  1LS3 A;  2VIA A;  2VMQ A;  2BIA A;  2W7L A;  2ZY3 A;  2AAT A;  2YKV A;  1MGV A;  4F5I A;  3M5U A;  1S0A A;  1S09 A;  2W7E A;  3B46 A;  4ZWV A;  2AEV A;  4A6T A;  1B5O A;  2CIN A;  2BI2 A;  3TAT A;  5EAV A;  3AOW A;  3QBO A;  4MKJ A;  4P7Y A;  3CBF A;  2FNU A;  3G7Q A;  4KAM A;  1LC7 A;  3ASA A;  1BJN A;  3LV2 A;  1YAA A;  1ZC9 A;  4UHN A;  1S06 A;  2HOZ A;  3TFT A;  3A9X A;  3MAF B;  1G4X A;  3TCM A;  4WYE A;  3EIB A;  3ASB A;  4KYO A;  1AJR A;  2BWP A;  3F9T A;  1FC4 A;  4LNL A;  2VMW A;  2VMY A;  3B1C A;  3NU7 A;  2FQ6 A;  2C44 A;  4QGR A;  3ZRR A;  1WYT A;  2W8U A;  1TOI A;  4Q6R A;  1AKC A;  4W91 A;  4CXR A;  1B9H A;  3N5M A;  2ZY2 A;  2E7I A;  1E5F A;  3B8X A;  1TPL A;  2D7Y A;  2HOR A;  1QJ5 A;  3UE8 A;  5M4D A;  4ADE A;  1V2D A;  5EIG A;  1M6S A;  2WB6 A;  4BA5 A;  3EI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...