3JTXA

Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
396
structure length
392
Chain Sequence
b'GMNTLLKQLKPYPFARLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPGIKPAIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFTSLSRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAEDIVSLYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminotransferase
publication title Crystal structure of Aminotransferase (NP_283882.1) from NEISSERIA MENINGITIDIS Z2491 at 1.91 A resolution
rcsb
source organism Neisseria meningitidis z2491
molecule tags Transferase
total genus 139
structure length 392
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3jtxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3jtxA01
4WP0A 2PB2A 4EFFA 1BJWA 2Z9VA 1V2FA 3TQXA 1VJOA 1KL1A 1SZKA 3GZDC 4GE4A 3MC6C 3JWAA 1WSTA 3IHJA 4PIWA 3NUIA 4ATQA 1AHXA 2JJHA 4XK1A 4E3RA 1D2FA 4F5HA 5F9SA 8AATA 2BWOA 4OMAA 2D65A 3PDBB 5EUEA 5G2QA 1DGDA 4LW4A 1M6SA 1YJYA 3G0TA 3NRAA 4UOYA 2E54A 4WB0A 1Z3ZA 1IUGA 3LVLB 4RJYA 4U1TA 1ASBA 4BA4A 4N0BA 1M0QA 1PMMA 3F6TA 5EAVA 4EB7A 1TASA 1I48A 4LW2A 3UE8A 2CH2A 1ASGA 3GZDA 1XEYA 3MC6A 4W8IA 1AHYA 3WZFA 2ZY2A 2BIEA 4F5KA 2VGTA 3ASAA 1QITA 3I5TA 1B4XA 3K28A 2X3LA 1O62A 2W7GA 5DJ9A 2D63A 2YHKA 5JAYA 2FNUA 4ADEA 4TN4A 2NMPA 4XQ2A 2AY7A 2RFVA 1B9IA 1PMOA 4OTLA 3A9ZA 3DRDA 3II0A 1WYTB 1YIZA 1KKJA 1MLYA 4JEWA 1X29A 3HBXA 4WYDA 2EGYA 4JEZA 4B98A 3MAUA 1B9HA 2OKJA 2VMXA 4AZKA 4F5LA 1V72A 4Y0HA 2CJHA 2EPJA 4DGTA 2HUUA 3EI6A 2C7TA 1BQDA 1G7XA 3FVSA 4ZDLA 7AATA 2W7KA 2V1PA 2HP1A 4XJMA 1CQ8A 1B8GA 2CY8A 2WKAA 2AY4A 5FT6A 3JTXA 3HQTA 4OCAA 1SZSA 1AKAA 1AJRA 4XAUA 5AX8A 2PB0A 3WCOA 1ASMA 2W7IA 3VK2A 2BYLA 1QJ5A 2YKXA 4ZSYA 3GSBA 3A9XA 2W7DA 4OC9A 2JG2A 4JEXA 4IXOA 1DKAA 2Z61A 2DR1A 4KXKA 1M0NA 2VMPA 3QN6A 1WYUB 3WY7A 2AY6A 3FDDA 4MY5A 3ASBA 4GE9A 4CBSA 3A9YA 1JF9A 1H0CA 3N75A 3VAXA 2ZYJA 3I16A 3EZ1A 3FVXA 3E2ZA 4WYGA 3FTBA 3DC1A 3PD6A 2HOXA 5I92A 3MKJA 3RQ1A 4J8LA 1AY5A 1IX6A 1SFFA 4RAEA 3WX9A 5EIGB 1RVYA 3TATA 2D5YA 3LVMA 2OKKA 4CBRA 5LH9A 1AAMA 1S0AA 1IX8A 3RCHB 2D61A 2AY8A 4A0GA 2VMUA 3TFUA 1X2AA 3EIBA 5M4BA 2ZY4A 4LNLA 1C9CA 4L0OA 4M2KA 2VYCA 2BWPA 4IY7A 3G7QA 1I41A 4Y0DA 1C4KA 2OGAA 2YCPA 1FG3A 1CL2A 1WYVA 1GDEA 1LW4A 3BV0A 3EIAA 1U08A 4ZDOA 3AEMC 1YOOA 2W8VA 2W7FA 3BCBA 3AV7A 2ZSLA 4BQ0A 4ADBA 1AY4A 1GBNA 4XJOA 3E6GA 3JWBA 2DKJA 1MDOA 3UWCA 4I8AA 4WLJA 3CBFA 2VLHA 1BJOA 3ATHA 1M0OA 2FQ6A 3AENA 3GWPA 2VMOA 4R2NA 4F5IA 1SZUA 1UU2A 4KAMA 1AHEA 1I29A 1ORDA 3AEMA 3HL2A 5G09A 2OGEA 3P1TA 4GSAA 2CINA 1W23A 2EH6A 2FM1A 1ARIA 2O7CA 2Z9XA 3KE3A 2VGVA 3FQ7A 3ZRQA 4JF0A 3LWSA 3QM2A 4Q76A 2HOYA 2HOZA 3USFA 3QGUA 5HDMA 4A0HA 2VMVA 1GEXA 1RVUA 1C7GA 1TPLA 4FFCA 2VGSA 1EQBA 1YAAA 1Y4IA 2DGMA 1AMRA 1CL1A 1AAWA 3PDXA 1MDZA 5G0AA 1ASCA 3AELA 1J04A 4EMYA 1ZOBA 2X8UA 3JZLA 1O61A 1S07A 3MADA 4JEYA 2Q7WA 4WXBA 2PO3A 1MAPA 2DKBA 1O69A 3FQAA 1ASLA 2BKWA 4F5GA 4IXSA 4XJLA 1AIAA 4PVFA 2R5CB 1GEYA 4UHOA 1KL2A 4WXFA 3QHXA 2GMUA 2VIAA 5EFSA 2V0YA 4ZLVA 2ZJGA 3JW9A 1V2EA 2ZP7A 1S06A 4Q75A 2YCTA 3R4TA 2BHXA 2QLRA 3EUCA 3L8AA 4A6RA 5C6UA 4WYFA 1TOJA 5BJ4A 1AKCA 1VP4A 3FFRA 3KKIA 1MAQA 1H1CA 3K7YA 1UU1A 2D7ZA 1O4SA 4W1XA 1N8PA 5J8QA 4ZSWA 4RITA 4UHNA 3NTJA 1YJSA 2VI8A 1ASEA 1C7NA 2FN6A 4ZWVA 5F8VA 3EZSA 1ASFA 3DR4A 5G4IA 2CFBA 3BWOA 3GJUA 3BWNC 3FDBA 1AMSA 3I4JA 1LK9A 2HZPA 1TOKA 4TV7A 4CXRA 2C0RA 3ACZA 1LW5A 3AEJC 3FZ7A 1TOGA 4ZAHA 3VOMA 3NUBA 2DGLA 1AIBA 1MDXA 1AMAA 4W91A 1DJ9A 4A0RA 2EO5A 4Q31A 1W7MA 3FFHA 1QIRA 1CS1A 1E5EA 1ELUA 2CB1A 4F5MA 3BWNA 1PG8A 3WLXA 1X0MA 2HUIA 2VMQA 2W7EA 4WLHA 1W7NA 3UAKA 2VGUA 2D64A 1TATA 3AEJA 1B5PA 2DOUA 4WYCA 3H14A 4A72A 2WK9A 2CJGA 2OATA 4IYOB 4QGRA 2GQNA 2CH1A 2R5EA 5BJ3A 2X5FA 1GD9A 1GEWA 2YRIA 3CQ4A 1MLZA 2DGKA 2QB3A 4JEVA 1G4XA 3NNKA 1DFOA 1X28A 1AICA 1D7SA 3L44A 4MSOA 1E5FA 3Q8NA 4OBVA 3R9AA 1ARHA 3PDBA 2W7MA 3ELEA 1OHWA 3EI9A 4A6TA 4ZWMA 5E5IA 4LC3A 1CZEA 4GRXA 3DR7A 1ELQA 3E9KA 4WB0B 2W7LA 3NYSA 2CSTA 1ZC9A 2AY2A 2VMRA 4O6ZA 5D5SA 4F5JA 1QGNA 1SPAA 3TFTA 1KMJA 2W7JA 1D7UA 3ISLA 2VI9A 3BCXA 3IF2A 4LNJA 5M46A 3NYTA 1W3UA 5DB5A 3LV2A 1W7LA 1DJUA 2BI2A 3BC8A 3FKDA 2ZUKA 3TCMA 2VGWA 4B9BA 4AZJA 2GMSA 3BN1A 1ARSA 3GETA 3OP7A 4MKJA 3VP6A 1I43A 4R5ZA 1WYTA 1XI9A 2VMZA 3RUYA 5EUDA 4WYAA 3F9TA 1CQ7A 2W8WA 4XJPA 3N0LA 1YIYA 3B1EA 3EI8A 1IAXA 3HT4A 4Q6RA 2YKUA 4GE7A 4W1VA 3A8UX 1WKGA 5E3KA 3FCRA 9AATA 4IX8A 3P6KA 2Z9WA 4UQVA 1OHVA 1LC5A 1EJIA 2YOBA 3E2YA 3W1HA 4ADDA 2C44A 3RBLA 1N31A 3MBBA 4ZM4A 2JJGA 4R8DA 3QI6A 4JE5D 4MQQA 5M4DA 2AY3A 3H7FA 4H51A 3CQ5A 1DJEA 4FL0A 3WKSA 3ELPA 2Z67A 4PFFA 5EAAA 3W1IA 3LY1A 2VMYA 2CANA 2C81A 2QB2A 2Z1ZA 2JISA 1AY8A 4U2HA 3M5UA 5D95A 3EI5A 4E3QA 4MKKA 3HMUA 3PJ0A 4BHDA 5M49A 2BIGA 2VGZA 3E77A 3KGXA 1GCKA 2R2NA 3NX3A 1J32A 1WYUA 4M2JA 4RM1A 2W7HA 1ARTA 1D7VA 2YKVA 5FT4A 1AHFA 2ZY3A 1N2TA 3B46A 1MGVA 5E4ZA 2Z1YA 1SVVA 1AMQA 2CTZA 3E2FA 4PFNA 2G6WA 3COGA 4K2IA 5FT5A 1OXPA 3RBFA 1C0NA 5K8BA 3E2ZB 3LG0A 2W8TA 3DXWA 4K2BA 1BJ4A 3AATA 3PD6B 4ZASA 1BQAA 4EU1A 1GC0A 4F4EA 1TOIA 4OT8A 5EIGA 4J5UA 2HP2A 4HF8A 4ITGA 2E7JA 1SF2A 3VK4A 3RCHA 3DZZA 4JE5A 3PGYA 2D7YA 3N5MA 2VLFA 3WGCA 1DGEA 1G4VA 1ECXA 2O0RA 3ZRRA 1BKGA 3FZ6A 1DTYA 4ITXA 4WD2A 4DBCA 4BA5A 3VK3A 3D6KA 1ZODA 1QISA 2BI5A 2BI9A 4GEBA 2VMWA 2E7UA 4IXZA 2EZ1A 3FRKA 2BWNA 3MAFB 4WXGA 4AH3A 1WYVB 1TARA 4XEWA 2YCNA 2XH1A 1Z7DA 3OKSA 4AOAA 3AOVA 1IJIA 1AJSB 2JJEA 3PPLA 4JF1A 4R5FA 1TOEA 5G2PA 4AO4A 4EB5A 3NU8A 4ISYA 4P7YA 2AY1A 4HVKA 3HVYA 1OXOA 2E7IA 2BIAA 3EI7A 1M0PA 1FC4A 2JGTA 3AEOA 1RV3A 3CQ6A 3GZCA 3ZRPA 1CQ6A 1BJOB 2BI1A 4RLGA 3AENB 3BB8A 2HUFA 3K40A 4IW7A 4W1WA 4A00A 1M32A 4KYOA 3PIUA 3DYDA 4ZM3A 3PAAA 2F8JA 4MQRA 2WK8A 2W8JA 2ZY5A 5LHAA 1M7YA 1VEFA 3NU7A 4DQ6A 3GR9A 3MEBA 3ZZJA 3B1CA 4A6UA 2Z9UA 4CVQA 1JS3A 3W1JA 1OATA 4W5KA 4ATPA 4ZDPA 4BMKA 2AEVA 3NYUA 5EQCA 2QMAA 2ZC0A 3HDOA 4N0WA 2GB3A 2VMTA 1CZCA 5G4JA 1QZ9A 3WKRA 2ORDA 2W8UA 4M2MA 3LVJA 1CJ0A 1BS0A 2TPLA 3F0HA 1IAYA 3RI6A 1GC2A 1T3IA 2YRRA 1AKBA 1IX7A 2GSAA 3A2BA 1GC3A 5HXXA 3DODA 1UU0A 3JU7A 4RKDA 2VIBA 1D7RA 4Y0IA 1AHGA 3FVUA 2R5CA 4NOGA 2BYJA 2HORA 2O1BA 4WYEA 3ZZKA 1FG7A 1OHYA 4E1OA 2R0TA 4OYTA 2Z20A 3CAIA 3FZ8A 1WKHA 3QBOA 1LS3A 5DJ1A 3LVKA 4RKCA 2AY5A 3DU4A 2FYFA 4GDYA 2AEUA 4ADCA 3PA9A 3T32A 3AOWA 1KKPA 5EUNA 4CXQA 4P3MA 2AY9A 1YJZA 3DXVA 2QBTA 1BJNA 1UKJA 2AATA 1IBJA 4LNMA 3WCNA 4MQPA 1AX4A 3BCAA 1G7WA 3QPGA 3WGBA 3AEPA 2CJDA 4K2MA 2JJFA 5TF5A 3NDNA 3MAFA 1C7OA 1PFFA 1RV4A 2X5DA 4OBUA 3FD0A 5HHYA 1AJSA 1M4NA 2D66A 1JG8A 1LC7A 1ASDA 1P3WA 3KGWA 4E77A 2ZSMA 2YKYA 1S09A 3GBXA 4UHMA 3FQ8A 4MGRA 4WBTA 1QJ3A 2VMSA 2EZ2A 1ARGA 4AO9A 5IWQA 1V2DA 4F5FA 2XBNA 1KMKA 4TMRA 5FT8A 1BT4A 1S08A 2FNIA 1B5OA 1JS6A 1LKCA 1YNUA 2OQXA 2QA3A 2VMNA 2WK7A 3HLMA 3G8MA 4RIZA 3B8XA 3BS8A 1ASNA 3B1DA 4A0FA 4IYOA 1IVRA 1LC8A 1EG5A 4RJ0A 5DX5A 3FSLA 3ECDA 1BW0A 1GC4A 1ASAA 2BI3A
chains in the Genus database with same CATH superfamily
4WP0A 2PB2A 4EFFA 1BJWA 2Z9VA 1V2FA 3TQXA 1VJOA 1KL1A 1SZKA 3GZDC 4GE4A 3MC6C 3JWAA 1WSTA 3IHJA 4PIWA 3NUIA 4ATQA 1AHXA 2JJHA 4XK1A 4E3RA 1D2FA 4F5HA 5F9SA 8AATA 2BWOA 4OMAA 2D65A 3PDBB 5EUEA 5G2QA 1DGDA 4LW4A 1M6SA 1YJYA 3G0TA 3NRAA 4UOYA 2E54A 4WB0A 1Z3ZA 1IUGA 3LVLB 4RJYA 4U1TA 1ASBA 4BA4A 4N0BA 1M0QA 1PMMA 3F6TA 5EAVA 4EB7A 1TASA 1I48A 4LW2A 3UE8A 2CH2A 1ASGA 3GZDA 1XEYA 3MC6A 4W8IA 1AHYA 3WZFA 2ZY2A 2BIEA 4F5KA 2VGTA 3ASAA 1QITA 3I5TA 3N4XA 1B4XA 3K28A 2X3LA 1O62A 2W7GA 5DJ9A 2D63A 2YHKA 5JAYA 2FNUA 4ADEA 4TN4A 2NMPA 4XQ2A 2AY7A 2RFVA 1B9IA 1PMOA 4OTLA 3A9ZA 3DRDA 3II0A 1WYTB 1YIZA 1KKJA 1MLYA 4JEWA 1X29A 3HBXA 4WYDA 2EGYA 4JEZA 4B98A 3MAUA 1B9HA 2OKJA 2VMXA 4AZKA 4F5LA 1V72A 4Y0HA 2CJHA 2EPJA 4DGTA 2HUUA 3EI6A 2C7TA 1BQDA 1G7XA 3FVSA 4ZDLA 7AATA 2W7KA 2V1PA 2HP1A 4XJMA 1CQ8A 1B8GA 2CY8A 2WKAA 2AY4A 5FT6A 3JTXA 3HQTA 4OCAA 1SZSA 1AKAA 1AJRA 4XAUA 5AX8A 2PB0A 3WCOA 1ASMA 2W7IA 3VK2A 2BYLA 1QJ5A 2YKXA 4ZSYA 3GSBA 3A9XA 2W7DA 4OC9A 2JG2A 4JEXA 4IXOA 1DKAA 2Z61A 2DR1A 4KXKA 1M0NA 2VMPA 3QN6A 1WYUB 3WY7A 5KTBA 2AY6A 3FDDA 4MY5A 3ASBA 4GE9A 4CBSA 3A9YA 1JF9A 1H0CA 3N75A 3VAXA 2ZYJA 3I16A 3EZ1A 3FVXA 3E2ZA 4WYGA 3FTBA 3DC1A 3PD6A 2HOXA 5I92A 3MKJA 3RQ1A 4J8LA 1AY5A 1IX6A 1SFFA 4RAEA 3WX9A 2FKIA 5EIGB 1RVYA 3TATA 2D5YA 3LVMA 2OKKA 4CBRA 5LH9A 1AAMA 1S0AA 1IX8A 3RCHB 2D61A 2AY8A 4A0GA 2VMUA 3TFUA 1X2AA 3EIBA 5M4BA 2ZY4A 4LNLA 1C9CA 4L0OA 4M2KA 2VYCA 2BWPA 4IY7A 3G7QA 1I41A 4Y0DA 1C4KA 2OGAA 2YCPA 1FG3A 1CL2A 1WYVA 1GDEA 1LW4A 3BV0A 3EIAA 1U08A 4ZDOA 3AEMC 1YOOA 2W8VA 2W7FA 3BCBA 3AV7A 2ZSLA 4BQ0A 4ADBA 1AY4A 1GBNA 4XJOA 3E6GA 3JWBA 2DKJA 1MDOA 3UWCA 4I8AA 4WLJA 3CBFA 2VLHA 1BJOA 3ATHA 1M0OA 2FQ6A 3AENA 3GWPA 2VMOA 4R2NA 4F5IA 1SZUA 1UU2A 4KAMA 1AHEA 1I29A 1ORDA 3AEMA 3HL2A 5G09A 2OGEA 3P1TA 4GSAA 2CINA 1W23A 2EH6A 2FM1A 1ARIA 2O7CA 2Z9XA 3KE3A 2VGVA 3FQ7A 3ZRQA 4JF0A 3LWSA 3QM2A 4Q76A 2HOYA 2HOZA 3USFA 3QGUA 5HDMA 4A0HA 2VMVA 1GEXA 1RVUA 1C7GA 1TPLA 4FFCA 2VGSA 1EQBA 1YAAA 1Y4IA 2DGMA 1AMRA 1CL1A 1AAWA 3PDXA 1MDZA 5G0AA 1ASCA 3AELA 1J04A 4EMYA 1ZOBA 2X8UA 3JZLA 1O61A 1S07A 3MADA 4JEYA 2Q7WA 4WXBA 2PO3A 1MAPA 2DKBA 1O69A 3FQAA 1ASLA 2BKWA 4F5GA 4IXSA 4XJLA 1AIAA 4PVFA 2R5CB 1GEYA 4UHOA 1KL2A 4WXFA 3QHXA 2GMUA 2VIAA 5EFSA 4H63Q 2EYQA 2V0YA 4ZLVA 2ZJGA 3JW9A 1V2EA 2ZP7A 1S06A 4Q75A 2YCTA 3R4TA 2BHXA 2QLRA 3EUCA 3L8AA 4A6RA 5C6UA 4WYFA 1TOJA 5BJ4A 1AKCA 1VP4A 3FFRA 3KKIA 2QSRA 1MAQA 1H1CA 3K7YA 1UU1A 2D7ZA 1O4SA 4W1XA 1N8PA 5J8QA 4ZSWA 4RITA 4UHNA 3NTJA 1YJSA 2VI8A 1ASEA 1C7NA 2FN6A 4ZWVA 5F8VA 3H9XA 3EZSA 1ASFA 3DR4A 5G4IA 2CFBA 3BWOA 3GJUA 3BWNC 3FDBA 1AMSA 3I4JA 4K05A 1LK9A 2HZPA 1TOKA 4TV7A 4CXRA 2C0RA 3ACZA 1LW5A 3AEJC 3FZ7A 1TOGA 4ZAHA 3VOMA 3NUBA 2DGLA 1AIBA 1MDXA 1AMAA 4W91A 1DJ9A 4A0RA 2EO5A 4Q31A 1W7MA 3FFHA 1QIRA 1CS1A 1E5EA 1ELUA 2CB1A 4F5MA 3BWNA 1PG8A 3WLXA 1X0MA 2HUIA 2VMQA 2W7EA 4WLHA 1W7NA 3UAKA 2VGUA 2A1VA 2D64A 1TATA 3AEJA 1B5PA 2DOUA 4WYCA 3H14A 4A72A 2WK9A 2CJGA 2OATA 4IYOB 4QGRA 2GQNA 2CH1A 2R5EA 5BJ3A 2X5FA 1GD9A 1GEWA 2YRIA 3CQ4A 1MLZA 2DGKA 2QB3A 4JEVA 1G4XA 3NNKA 1DFOA 1X28A 1AICA 1D7SA 3L44A 4MSOA 1E5FA 3Q8NA 4OBVA 3R9AA 1ARHA 3PDBA 2W7MA 3ELEA 1OHWA 3EI9A 4A6TA 4ZWMA 1KAFA 5E5IA 4LC3A 1CZEA 4GRXA 3DR7A 1ELQA 3E9KA 4WB0B 2WB6A 2W7LA 3NYSA 2CSTA 1ZC9A 2AY2A 2VMRA 4O6ZA 5D5SA 4F5JA 1QGNA 1SPAA 3TFTA 1KMJA 2W7JA 1D7UA 3ISLA 2VI9A 3BCXA 3IF2A 4LNJA 5M46A 3NYTA 1W3UA 5DB5A 3LV2A 1W7LA 1DJUA 2BI2A 3BC8A 3FKDA 2ZUKA 3TCMA 2VGWA 4B9BA 4AZJA 2GMSA 3BN1A 1ARSA 3GETA 3OP7A 4MKJA 3VP6A 1I43A 4R5ZA 1WYTA 1XI9A 2VMZA 3RUYA 3N4RA 5EUDA 4WYAA 3F9TA 1CQ7A 2W8WA 4XJPA 3N0LA 1YIYA 3B1EA 3EI8A 1IAXA 3HT4A 4Q6RA 2YKUA 4GE7A 4W1VA 3A8UX 1WKGA 5E3KA 3FCRA 9AATA 4IX8A 3P6KA 2Z9WA 4UQVA 1OHVA 1LC5A 1EJIA 2YOBA 3E2YA 3W1HA 4ADDA 2C44A 3RBLA 1N31A 3MBBA 4ZM4A 2JJGA 4R8DA 3QI6A 4JE5D 4MQQA 5M4DA 2AY3A 3H7FA 4H51A 3CQ5A 1DJEA 4FL0A 3WKSA 3ELPA 2Z67A 4PFFA 5EAAA 3W1IA 3LY1A 2VMYA 2CANA 2C81A 2QB2A 2Z1ZA 2JISA 1AY8A 4U2HA 3M5UA 5D95A 3EI5A 4E3QA 4MKKA 3HMUA 3PJ0A 4BHDA 5M49A 2BIGA 2VGZA 3E77A 3KGXA 1GCKA 2R2NA 3NX3A 1J32A 1WYUA 4M2JA 4RM1A 2W7HA 1ARTA 1D7VA 2YKVA 5FT4A 1AHFA 2ZY3A 1N2TA 3B46A 1MGVA 5E4ZA 2Z1YA 1SVVA 1AMQA 2CTZA 3E2FA 4PFNA 2G6WA 3COGA 4K2IA 5FT5A 1OXPA 3RBFA 3N4SA 1C0NA 5K8BA 3E2ZB 3LG0A 2W8TA 3DXWA 4K2BA 1BJ4A 3AATA 3PD6B 4ZASA 1BQAA 4EU1A 1GC0A 4F4EA 1TOIA 4OT8A 5EIGA 4J5UA 2HP2A 4HF8A 4ITGA 2E7JA 1SF2A 3VK4A 3RCHA 3DZZA 4JE5A 3PGYA 2D7YA 3N5MA 2VLFA 3WGCA 1DGEA 1G4VA 1ECXA 2O0RA 3ZRRA 1BKGA 3FZ6A 1DTYA 4ITXA 4WD2A 4DBCA 4BA5A 3VK3A 3D6KA 1ZODA 1QISA 2BI5A 2BI9A 4GEBA 2VMWA 2E7UA 4IXZA 2EZ1A 3FRKA 2BWNA 3MAFB 4WXGA 4AH3A 1WYVB 1TARA 4XEWA 2YCNA 2XH1A 1Z7DA 3OKSA 4AOAA 3AOVA 1IJIA 1AJSB 2JJEA 3PPLA 4JF1A 4R5FA 1TOEA 5G2PA 4AO4A 4EB5A 3NU8A 4ISYA 4P7YA 2AY1A 4HVKA 3HVYA 1OXOA 2E7IA 2BIAA 3EI7A 1M0PA 1FC4A 2JGTA 3AEOA 1RV3A 3CQ6A 3GZCA 3ZRPA 1CQ6A 1BJOB 2BI1A 4RLGA 3AENB 3BB8A 2HUFA 3K40A 4IW7A 4W1WA 4A00A 1M32A 4KYOA 3PIUA 3DYDA 4ZM3A 3PAAA 2F8JA 4MQRA 2KFPA 2WK8A 2W8JA 2ZY5A 5LHAA 1M7YA 1VEFA 3NU7A 4DQ6A 3GR9A 3MEBA 3ZZJA 3B1CA 4A6UA 2Z9UA 4CVQA 1JS3A 3W1JA 1OATA 4W5KA 4ATPA 4ZDPA 4BMKA 2AEVA 3NYUA 5EQCA 2QMAA 2ZC0A 3HDOA 4N0WA 2GB3A 2VMTA 1CZCA 5G4JA 1QZ9A 3WKRA 2ORDA 2W8UA 4M2MA 3LVJA 1CJ0A 3N7NA 1BS0A 2TPLA 3F0HA 1IAYA 3RI6A 1GC2A 1T3IA 2YRRA 1AKBA 1IX7A 2GSAA 3A2BA 1GC3A 5HXXA 3DODA 1UU0A 3JU7A 4RKDA 2VIBA 1D7RA 4Y0IA 1AHGA 3FVUA 2R5CA 4NOGA 2BYJA 2HORA 2O1BA 4WYEA 3ZZKA 1FG7A 1OHYA 4E1OA 2R0TA 4OYTA 2Z20A 3CAIA 3FZ8A 1WKHA 3QBOA 1LS3A 5DJ1A 3LVKA 4RKCA 2AY5A 3DU4A 2FYFA 4GDYA 2G7JA 2AEUA 4ADCA 3PA9A 3T32A 3AOWA 1KKPA 5EUNA 4CXQA 4P3MA 2AY9A 1YJZA 3DXVA 2QBTA 1BJNA 1UKJA 2AATA 1IBJA 4LNMA 3WCNA 4MQPA 1AX4A 3BCAA 1G7WA 3QPGA 3WGBA 3AEPA 2CJDA 4K2MA 2JJFA 5TF5A 3NDNA 3MAFA 1C7OA 1PFFA 1RV4A 2X5DA 4OBUA 3FD0A 5HHYA 1AJSA 1M4NA 2D66A 1JG8A 1LC7A 1ASDA 1P3WA 3KGWA 4E77A 2ZSMA 2YKYA 1S09A 3GBXA 4UHMA 3FQ8A 4MGRA 4WBTA 1QJ3A 2VMSA 2EZ2A 1ARGA 4AO9A 5IWQA 1V2DA 4F5FA 2XBNA 1KMKA 4TMRA 5FT8A 1BT4A 1S08A 2FNIA 1B5OA 1JS6A 1LKCA 1YNUA 2OQXA 2QA3A 2VMNA 2WK7A 3HLMA 3G8MA 4RIZA 3B8XA 3BS8A 1ASNA 3B1DA 4A0FA 4IYOA 1IVRA 1LC8A 1EG5A 4RJ0A 5DX5A 3FSLA 3ECDA 1BW0A 1GC4A 1ASAA 2BI3A
chains in the Genus database with same CATH topology
4WP0A 2PB2A 4EFFA 1BJWA 2Z9VA 1V2FA 3TQXA 1VJOA 1KL1A 1SZKA 3GZDC 4GE4A 3MC6C 3JWAA 1WSTA 3IHJA 4PIWA 3NUIA 4ATQA 1AHXA 2JJHA 4XK1A 4E3RA 1D2FA 4F5HA 5F9SA 8AATA 2BWOA 4OMAA 2D65A 3PDBB 5EUEA 5G2QA 1DGDA 4LW4A 1M6SA 1YJYA 3G0TA 3NRAA 4UOYA 2E54A 4WB0A 1Z3ZA 1IUGA 3LVLB 4RJYA 4U1TA 1ASBA 4BA4A 4N0BA 1M0QA 1PMMA 3F6TA 5EAVA 4EB7A 1TASA 1I48A 4LW2A 3UE8A 2CH2A 1ASGA 3GZDA 1XEYA 3MC6A 4W8IA 1AHYA 3WZFA 2ZY2A 2BIEA 4F5KA 2VGTA 3ASAA 1QITA 3I5TA 3N4XA 1B4XA 3K28A 2X3LA 1O62A 2W7GA 5DJ9A 2D63A 2YHKA 5JAYA 2FNUA 4ADEA 4TN4A 2NMPA 4XQ2A 2AY7A 2RFVA 1B9IA 1PMOA 4OTLA 3A9ZA 3DRDA 3II0A 1WYTB 1YIZA 1KKJA 1MLYA 4JEWA 1X29A 3HBXA 4WYDA 2EGYA 4JEZA 4B98A 3MAUA 1B9HA 2OKJA 2VMXA 4AZKA 4F5LA 1V72A 4Y0HA 2CJHA 2EPJA 4DGTA 2HUUA 3EI6A 2C7TA 1BQDA 1G7XA 3FVSA 4ZDLA 7AATA 2W7KA 2V1PA 2HP1A 4XJMA 1CQ8A 1B8GA 2CY8A 2WKAA 2AY4A 5FT6A 3JTXA 3HQTA 4OCAA 1SZSA 1AKAA 1AJRA 4XAUA 5AX8A 2PB0A 3WCOA 1ASMA 2W7IA 3VK2A 2BYLA 1QJ5A 2YKXA 4ZSYA 3GSBA 3A9XA 2W7DA 4OC9A 2JG2A 4JEXA 4IXOA 1DKAA 2Z61A 2DR1A 4KXKA 1M0NA 2VMPA 3QN6A 1WYUB 3WY7A 5KTBA 2AY6A 3FDDA 4MY5A 3ASBA 4GE9A 4CBSA 3A9YA 1JF9A 1H0CA 3N75A 3VAXA 2ZYJA 3I16A 3EZ1A 3FVXA 3E2ZA 4WYGA 3FTBA 3DC1A 3PD6A 2HOXA 5I92A 3MKJA 3RQ1A 4J8LA 1AY5A 1IX6A 1SFFA 4RAEA 3WX9A 2FKIA 5EIGB 1RVYA 3TATA 2D5YA 3LVMA 2OKKA 4CBRA 5LH9A 1AAMA 1S0AA 1IX8A 3RCHB 2D61A 2AY8A 4A0GA 2VMUA 3TFUA 1X2AA 3EIBA 5M4BA 2ZY4A 4LNLA 1C9CA 4L0OA 4M2KA 2VYCA 2BWPA 4IY7A 3G7QA 1I41A 4Y0DA 1C4KA 2OGAA 2YCPA 1FG3A 1CL2A 1WYVA 1GDEA 1LW4A 3BV0A 3EIAA 1U08A 4ZDOA 3AEMC 1YOOA 2W8VA 2W7FA 3BCBA 3AV7A 2ZSLA 4BQ0A 4ADBA 1AY4A 1GBNA 4XJOA 3E6GA 3JWBA 2DKJA 1MDOA 3UWCA 4I8AA 4WLJA 3CBFA 2VLHA 1BJOA 3ATHA 1M0OA 2FQ6A 3AENA 3GWPA 2VMOA 4R2NA 4F5IA 1SZUA 1UU2A 4KAMA 1AHEA 1I29A 1ORDA 3AEMA 3HL2A 5G09A 2OGEA 3P1TA 4GSAA 2CINA 1W23A 2EH6A 2FM1A 1ARIA 2O7CA 2Z9XA 3KE3A 2VGVA 3FQ7A 3ZRQA 4JF0A 3LWSA 3QM2A 4Q76A 2HOYA 2HOZA 3USFA 3QGUA 5HDMA 4A0HA 2VMVA 1GEXA 1RVUA 1C7GA 1TPLA 4FFCA 2VGSA 1EQBA 1YAAA 1Y4IA 2DGMA 1AMRA 1CL1A 1AAWA 3PDXA 1MDZA 5G0AA 1ASCA 3AELA 1J04A 4EMYA 1ZOBA 2X8UA 3JZLA 1O61A 1S07A 3MADA 4JEYA 2Q7WA 4WXBA 2PO3A 1MAPA 2DKBA 1O69A 3FQAA 1ASLA 2BKWA 4F5GA 4IXSA 4XJLA 1AIAA 4PVFA 2R5CB 1GEYA 4UHOA 1KL2A 4WXFA 3QHXA 2GMUA 2VIAA 5EFSA 4H63Q 2EYQA 2V0YA 4ZLVA 2ZJGA 3JW9A 1V2EA 2ZP7A 1S06A 4Q75A 2YCTA 3R4TA 2BHXA 2QLRA 3EUCA 3L8AA 4A6RA 5C6UA 4WYFA 1TOJA 5BJ4A 1AKCA 1VP4A 3FFRA 3KKIA 2QSRA 1MAQA 1H1CA 3K7YA 1UU1A 2D7ZA 1O4SA 4W1XA 1N8PA 5J8QA 4ZSWA 4RITA 4UHNA 3NTJA 1YJSA 2VI8A 1ASEA 1C7NA 2FN6A 4ZWVA 5F8VA 3H9XA 3EZSA 1ASFA 3DR4A 5G4IA 2CFBA 3BWOA 3GJUA 3BWNC 3FDBA 1AMSA 3I4JA 4K05A 1LK9A 2HZPA 1TOKA 4TV7A 4CXRA 2C0RA 3ACZA 1LW5A 3AEJC 3FZ7A 1TOGA 4ZAHA 3VOMA 3NUBA 2DGLA 1AIBA 1MDXA 1AMAA 4W91A 1DJ9A 4A0RA 2EO5A 4Q31A 1W7MA 3FFHA 1QIRA 1CS1A 1E5EA 1ELUA 2CB1A 4F5MA 3BWNA 1PG8A 3WLXA 1X0MA 2HUIA 2VMQA 2W7EA 4WLHA 1W7NA 3UAKA 2VGUA 2A1VA 2D64A 1TATA 3AEJA 1B5PA 2DOUA 4WYCA 3H14A 4A72A 2WK9A 2CJGA 2OATA 4IYOB 4QGRA 2GQNA 2CH1A 2R5EA 5BJ3A 2X5FA 1GD9A 1GEWA 2YRIA 3CQ4A 1MLZA 2DGKA 2QB3A 4JEVA 1G4XA 3NNKA 1DFOA 1X28A 1AICA 1D7SA 3L44A 4MSOA 1E5FA 3Q8NA 4OBVA 3R9AA 1ARHA 3PDBA 2W7MA 3ELEA 1OHWA 3EI9A 4A6TA 4ZWMA 5E5IA 4LC3A 1CZEA 4GRXA 3DR7A 1ELQA 3E9KA 4WB0B 2WB6A 2W7LA 3NYSA 2CSTA 1ZC9A 2AY2A 2VMRA 4O6ZA 5D5SA 4F5JA 1QGNA 1SPAA 3TFTA 1KMJA 2W7JA 1D7UA 3ISLA 2VI9A 3BCXA 3IF2A 4LNJA 5M46A 3NYTA 1W3UA 5DB5A 3LV2A 1W7LA 1DJUA 2BI2A 3BC8A 3FKDA 2ZUKA 3TCMA 2VGWA 4B9BA 4AZJA 2GMSA 3BN1A 1ARSA 3GETA 3OP7A 4MKJA 3VP6A 1I43A 4R5ZA 1WYTA 1XI9A 2VMZA 3RUYA 3N4RA 5EUDA 4WYAA 3F9TA 1CQ7A 2W8WA 4XJPA 3N0LA 1YIYA 3B1EA 3EI8A 1IAXA 3HT4A 4Q6RA 2YKUA 4GE7A 4W1VA 3A8UX 1WKGA 5E3KA 3FCRA 9AATA 4IX8A 3P6KA 2Z9WA 4UQVA 1OHVA 1LC5A 1EJIA 2YOBA 3E2YA 3W1HA 4ADDA 2C44A 3RBLA 1N31A 3MBBA 4ZM4A 2JJGA 4R8DA 3QI6A 4JE5D 4MQQA 5M4DA 2AY3A 3H7FA 4H51A 3CQ5A 1DJEA 4FL0A 3WKSA 3ELPA 2Z67A 4PFFA 5EAAA 3W1IA 3LY1A 2VMYA 2CANA 2C81A 2QB2A 2Z1ZA 2JISA 1AY8A 4U2HA 3M5UA 5D95A 3EI5A 4E3QA 4MKKA 3HMUA 3PJ0A 4BHDA 5M49A 2BIGA 2VGZA 3E77A 3KGXA 1GCKA 2R2NA 3NX3A 1J32A 1WYUA 4M2JA 4RM1A 2W7HA 1ARTA 1D7VA 2YKVA 5FT4A 1AHFA 2ZY3A 1N2TA 3B46A 1MGVA 5E4ZA 2Z1YA 1SVVA 1AMQA 2CTZA 3E2FA 4PFNA 2G6WA 3COGA 4K2IA 5FT5A 1OXPA 3RBFA 3N4SA 1C0NA 5K8BA 3E2ZB 3LG0A 2W8TA 3DXWA 4K2BA 1BJ4A 3AATA 3PD6B 4ZASA 1BQAA 4EU1A 1GC0A 4F4EA 1TOIA 4OT8A 5EIGA 4J5UA 2HP2A 4HF8A 4ITGA 2E7JA 1SF2A 3VK4A 3RCHA 3DZZA 4JE5A 3PGYA 2D7YA 3N5MA 2VLFA 3WGCA 1DGEA 1G4VA 1ECXA 2O0RA 3ZRRA 1BKGA 3FZ6A 1DTYA 4ITXA 4WD2A 4DBCA 4BA5A 3VK3A 3D6KA 1ZODA 1QISA 2BI5A 2BI9A 4GEBA 2VMWA 2E7UA 4IXZA 2EZ1A 3FRKA 2BWNA 3MAFB 4WXGA 4AH3A 1WYVB 1TARA 4XEWA 2YCNA 2XH1A 1Z7DA 3OKSA 4AOAA 3AOVA 1IJIA 1AJSB 2JJEA 3PPLA 4JF1A 4R5FA 1TOEA 5G2PA 4AO4A 4EB5A 3NU8A 4ISYA 4P7YA 2AY1A 4HVKA 3HVYA 1OXOA 2E7IA 2BIAA 3EI7A 1M0PA 1FC4A 2JGTA 3AEOA 1RV3A 3CQ6A 3GZCA 3ZRPA 1CQ6A 1BJOB 2BI1A 4RLGA 3AENB 3BB8A 2HUFA 3K40A 4IW7A 4W1WA 4A00A 1M32A 4KYOA 3PIUA 3DYDA 4ZM3A 3PAAA 2F8JA 4MQRA 2KFPA 2WK8A 2W8JA 2ZY5A 5LHAA 1M7YA 1VEFA 3NU7A 4DQ6A 3GR9A 3MEBA 3ZZJA 3B1CA 4A6UA 2Z9UA 4CVQA 1JS3A 3W1JA 1OATA 4W5KA 4ATPA 4ZDPA 4BMKA 2AEVA 3NYUA 5EQCA 2QMAA 2ZC0A 3HDOA 4N0WA 2GB3A 2VMTA 1CZCA 5G4JA 1QZ9A 3WKRA 2ORDA 2W8UA 4M2MA 3LVJA 1CJ0A 3N7NA 1BS0A 2TPLA 3F0HA 1IAYA 3RI6A 1GC2A 1T3IA 2YRRA 1AKBA 1IX7A 2GSAA 3A2BA 1GC3A 5HXXA 3DODA 1UU0A 3JU7A 4RKDA 2VIBA 1D7RA 4Y0IA 1AHGA 3FVUA 2R5CA 4NOGA 2BYJA 2HORA 2O1BA 4WYEA 3ZZKA 1FG7A 1OHYA 4E1OA 2R0TA 4OYTA 2Z20A 3CAIA 3FZ8A 1WKHA 3QBOA 1LS3A 5DJ1A 3LVKA 4RKCA 2AY5A 3DU4A 2FYFA 4GDYA 2G7JA 2AEUA 4ADCA 3PA9A 3T32A 3AOWA 1KKPA 5EUNA 4CXQA 4P3MA 2AY9A 1YJZA 3DXVA 2QBTA 1BJNA 1UKJA 2AATA 1IBJA 4LNMA 3WCNA 4MQPA 1AX4A 3BCAA 1G7WA 3QPGA 3WGBA 3AEPA 2CJDA 4K2MA 2JJFA 5TF5A 3NDNA 3MAFA 1C7OA 1PFFA 1RV4A 2X5DA 4OBUA 3FD0A 5HHYA 1AJSA 1M4NA 2D66A 1JG8A 1LC7A 1ASDA 1P3WA 3KGWA 4E77A 2ZSMA 2YKYA 1S09A 3GBXA 4UHMA 3FQ8A 4MGRA 4WBTA 1QJ3A 2VMSA 2EZ2A 1ARGA 4AO9A 5IWQA 1V2DA 4F5FA 2XBNA 1KMKA 4TMRA 5FT8A 1BT4A 1S08A 2FNIA 1B5OA 1JS6A 1LKCA 1YNUA 2OQXA 2QA3A 2VMNA 2WK7A 3HLMA 3G8MA 4RIZA 3B8XA 3BS8A 1ASNA 3B1DA 4A0FA 4IYOA 1IVRA 1LC8A 1EG5A 4RJ0A 5DX5A 3FSLA 3ECDA 1BW0A 1GC4A 1ASAA 2BI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP0 A;  2PB2 A;  4EFF A;  1BJW A;  2Z9V A;  1V2F A;  3TQX A;  1VJO A;  1KL1 A;  1SZK A;  3GZD C;  4GE4 A;  3MC6 C;  3JWA A;  1WST A;  3IHJ A;  4PIW A;  3NUI A;  4ATQ A;  1AHX A;  2JJH A;  4XK1 A;  4E3R A;  1D2F A;  4F5H A;  5F9S A;  8AAT A;  2BWO A;  4OMA A;  2D65 A;  3PDB B;  5EUE A;  5G2Q A;  1DGD A;  4LW4 A;  1M6S A;  1YJY A;  3G0T A;  3NRA A;  4UOY A;  2E54 A;  4WB0 A;  1Z3Z A;  1IUG A;  3LVL B;  4RJY A;  4U1T A;  1ASB A;  4BA4 A;  4N0B A;  1M0Q A;  1PMM A;  3F6T A;  5EAV A;  4EB7 A;  1TAS A;  1I48 A;  4LW2 A;  3UE8 A;  2CH2 A;  1ASG A;  3GZD A;  1XEY A;  3MC6 A;  4W8I A;  1AHY A;  3WZF A;  2ZY2 A;  2BIE A;  4F5K A;  2VGT A;  3ASA A;  1QIT A;  3I5T A;  1B4X A;  3K28 A;  2X3L A;  1O62 A;  2W7G A;  5DJ9 A;  2D63 A;  2YHK A;  5JAY A;  2FNU A;  4ADE A;  4TN4 A;  2NMP A;  4XQ2 A;  2AY7 A;  2RFV A;  1B9I A;  1PMO A;  4OTL A;  3A9Z A;  3DRD A;  3II0 A;  1WYT B;  1YIZ A;  1KKJ A;  1MLY A;  4JEW A;  1X29 A;  3HBX A;  4WYD A;  2EGY A;  4JEZ A;  4B98 A;  3MAU A;  1B9H A;  2OKJ A;  2VMX A;  4AZK A;  4F5L A;  1V72 A;  4Y0H A;  2CJH A;  2EPJ A;  4DGT A;  2HUU A;  3EI6 A;  2C7T A;  1BQD A;  1G7X A;  3FVS A;  4ZDL A;  7AAT A;  2W7K A;  2V1P A;  2HP1 A;  4XJM A;  1CQ8 A;  1B8G A;  2CY8 A;  2WKA A;  2AY4 A;  5FT6 A;  3JTX A;  3HQT A;  4OCA A;  1SZS A;  1AKA A;  1AJR A;  4XAU A;  5AX8 A;  2PB0 A;  3WCO A;  1ASM A;  2W7I A;  3VK2 A;  2BYL A;  1QJ5 A;  2YKX A;  4ZSY A;  3GSB A;  3A9X A;  2W7D A;  4OC9 A;  2JG2 A;  4JEX A;  4IXO A;  1DKA A;  2Z61 A;  2DR1 A;  4KXK A;  1M0N A;  2VMP A;  3QN6 A;  1WYU B;  3WY7 A;  2AY6 A;  3FDD A;  4MY5 A;  3ASB A;  4GE9 A;  4CBS A;  3A9Y A;  1JF9 A;  1H0C A;  3N75 A;  3VAX A;  2ZYJ A;  3I16 A;  3EZ1 A;  3FVX A;  3E2Z A;  4WYG A;  3FTB A;  3DC1 A;  3PD6 A;  2HOX A;  5I92 A;  3MKJ A;  3RQ1 A;  4J8L A;  1AY5 A;  1IX6 A;  1SFF A;  4RAE A;  3WX9 A;  5EIG B;  1RVY A;  3TAT A;  2D5Y A;  3LVM A;  2OKK A;  4CBR A;  5LH9 A;  1AAM A;  1S0A A;  1IX8 A;  3RCH B;  2D61 A;  2AY8 A;  4A0G A;  2VMU A;  3TFU A;  1X2A A;  3EIB A;  5M4B A;  2ZY4 A;  4LNL A;  1C9C A;  4L0O A;  4M2K A;  2VYC A;  2BWP A;  4IY7 A;  3G7Q A;  1I41 A;  4Y0D A;  1C4K A;  2OGA A;  2YCP A;  1FG3 A;  1CL2 A;  1WYV A;  1GDE A;  1LW4 A;  3BV0 A;  3EIA A;  1U08 A;  4ZDO A;  3AEM C;  1YOO A;  2W8V A;  2W7F A;  3BCB A;  3AV7 A;  2ZSL A;  4BQ0 A;  4ADB A;  1AY4 A;  1GBN A;  4XJO A;  3E6G A;  3JWB A;  2DKJ A;  1MDO A;  3UWC A;  4I8A A;  4WLJ A;  3CBF A;  2VLH A;  1BJO A;  3ATH A;  1M0O A;  2FQ6 A;  3AEN A;  3GWP A;  2VMO A;  4R2N A;  4F5I A;  1SZU A;  1UU2 A;  4KAM A;  1AHE A;  1I29 A;  1ORD A;  3AEM A;  3HL2 A;  5G09 A;  2OGE A;  3P1T A;  4GSA A;  2CIN A;  1W23 A;  2EH6 A;  2FM1 A;  1ARI A;  2O7C A;  2Z9X A;  3KE3 A;  2VGV A;  3FQ7 A;  3ZRQ A;  4JF0 A;  3LWS A;  3QM2 A;  4Q76 A;  2HOY A;  2HOZ A;  3USF A;  3QGU A;  5HDM A;  4A0H A;  2VMV A;  1GEX A;  1RVU A;  1C7G A;  1TPL A;  4FFC A;  2VGS A;  1EQB A;  1YAA A;  1Y4I A;  2DGM A;  1AMR A;  1CL1 A;  1AAW A;  3PDX A;  1MDZ A;  5G0A A;  1ASC A;  3AEL A;  1J04 A;  4EMY A;  1ZOB A;  2X8U A;  3JZL A;  1O61 A;  1S07 A;  3MAD A;  4JEY A;  2Q7W A;  4WXB A;  2PO3 A;  1MAP A;  2DKB A;  1O69 A;  3FQA A;  1ASL A;  2BKW A;  4F5G A;  4IXS A;  4XJL A;  1AIA A;  4PVF A;  2R5C B;  1GEY A;  4UHO A;  1KL2 A;  4WXF A;  3QHX A;  2GMU A;  2VIA A;  5EFS A;  2V0Y A;  4ZLV A;  2ZJG A;  3JW9 A;  1V2E A;  2ZP7 A;  1S06 A;  4Q75 A;  2YCT A;  3R4T A;  2BHX A;  2QLR A;  3EUC A;  3L8A A;  4A6R A;  5C6U A;  4WYF A;  1TOJ A;  5BJ4 A;  1AKC A;  1VP4 A;  3FFR A;  3KKI A;  1MAQ A;  1H1C A;  3K7Y A;  1UU1 A;  2D7Z A;  1O4S A;  4W1X A;  1N8P A;  5J8Q A;  4ZSW A;  4RIT A;  4UHN A;  3NTJ A;  1YJS A;  2VI8 A;  1ASE A;  1C7N A;  2FN6 A;  4ZWV A;  5F8V A;  3EZS A;  1ASF A;  3DR4 A;  5G4I A;  2CFB A;  3BWO A;  3GJU A;  3BWN C;  3FDB A;  1AMS A;  3I4J A;  1LK9 A;  2HZP A;  1TOK A;  4TV7 A;  4CXR A;  2C0R A;  3ACZ A;  1LW5 A;  3AEJ C;  3FZ7 A;  1TOG A;  4ZAH A;  3VOM A;  3NUB A;  2DGL A;  1AIB A;  1MDX A;  1AMA A;  4W91 A;  1DJ9 A;  4A0R A;  2EO5 A;  4Q31 A;  1W7M A;  3FFH A;  1QIR A;  1CS1 A;  1E5E A;  1ELU A;  2CB1 A;  4F5M A;  3BWN A;  1PG8 A;  3WLX A;  1X0M A;  2HUI A;  2VMQ A;  2W7E A;  4WLH A;  1W7N A;  3UAK A;  2VGU A;  2D64 A;  1TAT A;  3AEJ A;  1B5P A;  2DOU A;  4WYC A;  3H14 A;  4A72 A;  2WK9 A;  2CJG A;  2OAT A;  4IYO B;  4QGR A;  2GQN A;  2CH1 A;  2R5E A;  5BJ3 A;  2X5F A;  1GD9 A;  1GEW A;  2YRI A;  3CQ4 A;  1MLZ A;  2DGK A;  2QB3 A;  4JEV A;  1G4X A;  3NNK A;  1DFO A;  1X28 A;  1AIC A;  1D7S A;  3L44 A;  4MSO A;  1E5F A;  3Q8N A;  4OBV A;  3R9A A;  1ARH A;  3PDB A;  2W7M A;  3ELE A;  1OHW A;  3EI9 A;  4A6T A;  4ZWM A;  5E5I A;  4LC3 A;  1CZE A;  4GRX A;  3DR7 A;  1ELQ A;  3E9K A;  4WB0 B;  2W7L A;  3NYS A;  2CST A;  1ZC9 A;  2AY2 A;  2VMR A;  4O6Z A;  5D5S A;  4F5J A;  1QGN A;  1SPA A;  3TFT A;  1KMJ A;  2W7J A;  1D7U A;  3ISL A;  2VI9 A;  3BCX A;  3IF2 A;  4LNJ A;  5M46 A;  3NYT A;  1W3U A;  5DB5 A;  3LV2 A;  1W7L A;  1DJU A;  2BI2 A;  3BC8 A;  3FKD A;  2ZUK A;  3TCM A;  2VGW A;  4B9B A;  4AZJ A;  2GMS A;  3BN1 A;  1ARS A;  3GET A;  3OP7 A;  4MKJ A;  3VP6 A;  1I43 A;  4R5Z A;  1WYT A;  1XI9 A;  2VMZ A;  3RUY A;  5EUD A;  4WYA A;  3F9T A;  1CQ7 A;  2W8W A;  4XJP A;  3N0L A;  1YIY A;  3B1E A;  3EI8 A;  1IAX A;  3HT4 A;  4Q6R A;  2YKU A;  4GE7 A;  4W1V A;  3A8U X;  1WKG A;  5E3K A;  3FCR A;  9AAT A;  4IX8 A;  3P6K A;  2Z9W A;  4UQV A;  1OHV A;  1LC5 A;  1EJI A;  2YOB A;  3E2Y A;  3W1H A;  4ADD A;  2C44 A;  3RBL A;  1N31 A;  3MBB A;  4ZM4 A;  2JJG A;  4R8D A;  3QI6 A;  4JE5 D;  4MQQ A;  5M4D A;  2AY3 A;  3H7F A;  4H51 A;  3CQ5 A;  1DJE A;  4FL0 A;  3WKS A;  3ELP A;  2Z67 A;  4PFF A;  5EAA A;  3W1I A;  3LY1 A;  2VMY A;  2CAN A;  2C81 A;  2QB2 A;  2Z1Z A;  2JIS A;  1AY8 A;  4U2H A;  3M5U A;  5D95 A;  3EI5 A;  4E3Q A;  4MKK A;  3HMU A;  3PJ0 A;  4BHD A;  5M49 A;  2BIG A;  2VGZ A;  3E77 A;  3KGX A;  1GCK A;  2R2N A;  3NX3 A;  1J32 A;  1WYU A;  4M2J A;  4RM1 A;  2W7H A;  1ART A;  1D7V A;  2YKV A;  5FT4 A;  1AHF A;  2ZY3 A;  1N2T A;  3B46 A;  1MGV A;  5E4Z A;  2Z1Y A;  1SVV A;  1AMQ A;  2CTZ A;  3E2F A;  4PFN A;  2G6W A;  3COG A;  4K2I A;  5FT5 A;  1OXP A;  3RBF A;  1C0N A;  5K8B A;  3E2Z B;  3LG0 A;  2W8T A;  3DXW A;  4K2B A;  1BJ4 A;  3AAT A;  3PD6 B;  4ZAS A;  1BQA A;  4EU1 A;  1GC0 A;  4F4E A;  1TOI A;  4OT8 A;  5EIG A;  4J5U A;  2HP2 A;  4HF8 A;  4ITG A;  2E7J A;  1SF2 A;  3VK4 A;  3RCH A;  3DZZ A;  4JE5 A;  3PGY A;  2D7Y A;  3N5M A;  2VLF A;  3WGC A;  1DGE A;  1G4V A;  1ECX A;  2O0R A;  3ZRR A;  1BKG A;  3FZ6 A;  1DTY A;  4ITX A;  4WD2 A;  4DBC A;  4BA5 A;  3VK3 A;  3D6K A;  1ZOD A;  1QIS A;  2BI5 A;  2BI9 A;  4GEB A;  2VMW A;  2E7U A;  4IXZ A;  2EZ1 A;  3FRK A;  2BWN A;  3MAF B;  4WXG A;  4AH3 A;  1WYV B;  1TAR A;  4XEW A;  2YCN A;  2XH1 A;  1Z7D A;  3OKS A;  4AOA A;  3AOV A;  1IJI A;  1AJS B;  2JJE A;  3PPL A;  4JF1 A;  4R5F A;  1TOE A;  5G2P A;  4AO4 A;  4EB5 A;  3NU8 A;  4ISY A;  4P7Y A;  2AY1 A;  4HVK A;  3HVY A;  1OXO A;  2E7I A;  2BIA A;  3EI7 A;  1M0P A;  1FC4 A;  2JGT A;  3AEO A;  1RV3 A;  3CQ6 A;  3GZC A;  3ZRP A;  1CQ6 A;  1BJO B;  2BI1 A;  4RLG A;  3AEN B;  3BB8 A;  2HUF A;  3K40 A;  4IW7 A;  4W1W A;  4A00 A;  1M32 A;  4KYO A;  3PIU A;  3DYD A;  4ZM3 A;  3PAA A;  2F8J A;  4MQR A;  2WK8 A;  2W8J A;  2ZY5 A;  5LHA A;  1M7Y A;  1VEF A;  3NU7 A;  4DQ6 A;  3GR9 A;  3MEB A;  3ZZJ A;  3B1C A;  4A6U A;  2Z9U A;  4CVQ A;  1JS3 A;  3W1J A;  1OAT A;  4W5K A;  4ATP A;  4ZDP A;  4BMK A;  2AEV A;  3NYU A;  5EQC A;  2QMA A;  2ZC0 A;  3HDO A;  4N0W A;  2GB3 A;  2VMT A;  1CZC A;  5G4J A;  1QZ9 A;  3WKR A;  2ORD A;  2W8U A;  4M2M A;  3LVJ A;  1CJ0 A;  1BS0 A;  2TPL A;  3F0H A;  1IAY A;  3RI6 A;  1GC2 A;  1T3I A;  2YRR A;  1AKB A;  1IX7 A;  2GSA A;  3A2B A;  1GC3 A;  5HXX A;  3DOD A;  1UU0 A;  3JU7 A;  4RKD A;  2VIB A;  1D7R A;  4Y0I A;  1AHG A;  3FVU A;  2R5C A;  4NOG A;  2BYJ A;  2HOR A;  2O1B A;  4WYE A;  3ZZK A;  1FG7 A;  1OHY A;  4E1O A;  2R0T A;  4OYT A;  2Z20 A;  3CAI A;  3FZ8 A;  1WKH A;  3QBO A;  1LS3 A;  5DJ1 A;  3LVK A;  4RKC A;  2AY5 A;  3DU4 A;  2FYF A;  4GDY A;  2AEU A;  4ADC A;  3PA9 A;  3T32 A;  3AOW A;  1KKP A;  5EUN A;  4CXQ A;  4P3M A;  2AY9 A;  1YJZ A;  3DXV A;  2QBT A;  1BJN A;  1UKJ A;  2AAT A;  1IBJ A;  4LNM A;  3WCN A;  4MQP A;  1AX4 A;  3BCA A;  1G7W A;  3QPG A;  3WGB A;  3AEP A;  2CJD A;  4K2M A;  2JJF A;  5TF5 A;  3NDN A;  3MAF A;  1C7O A;  1PFF A;  1RV4 A;  2X5D A;  4OBU A;  3FD0 A;  5HHY A;  1AJS A;  1M4N A;  2D66 A;  1JG8 A;  1LC7 A;  1ASD A;  1P3W A;  3KGW A;  4E77 A;  2ZSM A;  2YKY A;  1S09 A;  3GBX A;  4UHM A;  3FQ8 A;  4MGR A;  4WBT A;  1QJ3 A;  2VMS A;  2EZ2 A;  1ARG A;  4AO9 A;  5IWQ A;  1V2D A;  4F5F A;  2XBN A;  1KMK A;  4TMR A;  5FT8 A;  1BT4 A;  1S08 A;  2FNI A;  1B5O A;  1JS6 A;  1LKC A;  1YNU A;  2OQX A;  2QA3 A;  2VMN A;  2WK7 A;  3HLM A;  3G8M A;  4RIZ A;  3B8X A;  3BS8 A;  1ASN A;  3B1D A;  4A0F A;  4IYO A;  1IVR A;  1LC8 A;  1EG5 A;  4RJ0 A;  5DX5 A;  3FSL A;  3ECD A;  1BW0 A;  1GC4 A;  1ASA A;  2BI3 A; 
#chains in the Genus database with same CATH topology
 4WP0 A;  2PB2 A;  4EFF A;  1BJW A;  2Z9V A;  1V2F A;  3TQX A;  1VJO A;  1KL1 A;  1SZK A;  3GZD C;  4GE4 A;  3MC6 C;  3JWA A;  1WST A;  3IHJ A;  4PIW A;  3NUI A;  4ATQ A;  1AHX A;  2JJH A;  4XK1 A;  4E3R A;  1D2F A;  4F5H A;  5F9S A;  8AAT A;  2BWO A;  4OMA A;  2D65 A;  3PDB B;  5EUE A;  5G2Q A;  1DGD A;  4LW4 A;  1M6S A;  1YJY A;  3G0T A;  3NRA A;  4UOY A;  2E54 A;  4WB0 A;  1Z3Z A;  1IUG A;  3LVL B;  4RJY A;  4U1T A;  1ASB A;  4BA4 A;  4N0B A;  1M0Q A;  1PMM A;  3F6T A;  5EAV A;  4EB7 A;  1TAS A;  1I48 A;  4LW2 A;  3UE8 A;  2CH2 A;  1ASG A;  3GZD A;  1XEY A;  3MC6 A;  4W8I A;  1AHY A;  3WZF A;  2ZY2 A;  2BIE A;  4F5K A;  2VGT A;  3ASA A;  1QIT A;  3I5T A;  3N4X A;  1B4X A;  3K28 A;  2X3L A;  1O62 A;  2W7G A;  5DJ9 A;  2D63 A;  2YHK A;  5JAY A;  2FNU A;  4ADE A;  4TN4 A;  2NMP A;  4XQ2 A;  2AY7 A;  2RFV A;  1B9I A;  1PMO A;  4OTL A;  3A9Z A;  3DRD A;  3II0 A;  1WYT B;  1YIZ A;  1KKJ A;  1MLY A;  4JEW A;  1X29 A;  3HBX A;  4WYD A;  2EGY A;  4JEZ A;  4B98 A;  3MAU A;  1B9H A;  2OKJ A;  2VMX A;  4AZK A;  4F5L A;  1V72 A;  4Y0H A;  2CJH A;  2EPJ A;  4DGT A;  2HUU A;  3EI6 A;  2C7T A;  1BQD A;  1G7X A;  3FVS A;  4ZDL A;  7AAT A;  2W7K A;  2V1P A;  2HP1 A;  4XJM A;  1CQ8 A;  1B8G A;  2CY8 A;  2WKA A;  2AY4 A;  5FT6 A;  3JTX A;  3HQT A;  4OCA A;  1SZS A;  1AKA A;  1AJR A;  4XAU A;  5AX8 A;  2PB0 A;  3WCO A;  1ASM A;  2W7I A;  3VK2 A;  2BYL A;  1QJ5 A;  2YKX A;  4ZSY A;  3GSB A;  3A9X A;  2W7D A;  4OC9 A;  2JG2 A;  4JEX A;  4IXO A;  1DKA A;  2Z61 A;  2DR1 A;  4KXK A;  1M0N A;  2VMP A;  3QN6 A;  1WYU B;  3WY7 A;  5KTB A;  2AY6 A;  3FDD A;  4MY5 A;  3ASB A;  4GE9 A;  4CBS A;  3A9Y A;  1JF9 A;  1H0C A;  3N75 A;  3VAX A;  2ZYJ A;  3I16 A;  3EZ1 A;  3FVX A;  3E2Z A;  4WYG A;  3FTB A;  3DC1 A;  3PD6 A;  2HOX A;  5I92 A;  3MKJ A;  3RQ1 A;  4J8L A;  1AY5 A;  1IX6 A;  1SFF A;  4RAE A;  3WX9 A;  2FKI A;  5EIG B;  1RVY A;  3TAT A;  2D5Y A;  3LVM A;  2OKK A;  4CBR A;  5LH9 A;  1AAM A;  1S0A A;  1IX8 A;  3RCH B;  2D61 A;  2AY8 A;  4A0G A;  2VMU A;  3TFU A;  1X2A A;  3EIB A;  5M4B A;  2ZY4 A;  4LNL A;  1C9C A;  4L0O A;  4M2K A;  2VYC A;  2BWP A;  4IY7 A;  3G7Q A;  1I41 A;  4Y0D A;  1C4K A;  2OGA A;  2YCP A;  1FG3 A;  1CL2 A;  1WYV A;  1GDE A;  1LW4 A;  3BV0 A;  3EIA A;  1U08 A;  4ZDO A;  3AEM C;  1YOO A;  2W8V A;  2W7F A;  3BCB A;  3AV7 A;  2ZSL A;  4BQ0 A;  4ADB A;  1AY4 A;  1GBN A;  4XJO A;  3E6G A;  3JWB A;  2DKJ A;  1MDO A;  3UWC A;  4I8A A;  4WLJ A;  3CBF A;  2VLH A;  1BJO A;  3ATH A;  1M0O A;  2FQ6 A;  3AEN A;  3GWP A;  2VMO A;  4R2N A;  4F5I A;  1SZU A;  1UU2 A;  4KAM A;  1AHE A;  1I29 A;  1ORD A;  3AEM A;  3HL2 A;  5G09 A;  2OGE A;  3P1T A;  4GSA A;  2CIN A;  1W23 A;  2EH6 A;  2FM1 A;  1ARI A;  2O7C A;  2Z9X A;  3KE3 A;  2VGV A;  3FQ7 A;  3ZRQ A;  4JF0 A;  3LWS A;  3QM2 A;  4Q76 A;  2HOY A;  2HOZ A;  3USF A;  3QGU A;  5HDM A;  4A0H A;  2VMV A;  1GEX A;  1RVU A;  1C7G A;  1TPL A;  4FFC A;  2VGS A;  1EQB A;  1YAA A;  1Y4I A;  2DGM A;  1AMR A;  1CL1 A;  1AAW A;  3PDX A;  1MDZ A;  5G0A A;  1ASC A;  3AEL A;  1J04 A;  4EMY A;  1ZOB A;  2X8U A;  3JZL A;  1O61 A;  1S07 A;  3MAD A;  4JEY A;  2Q7W A;  4WXB A;  2PO3 A;  1MAP A;  2DKB A;  1O69 A;  3FQA A;  1ASL A;  2BKW A;  4F5G A;  4IXS A;  4XJL A;  1AIA A;  4PVF A;  2R5C B;  1GEY A;  4UHO A;  1KL2 A;  4WXF A;  3QHX A;  2GMU A;  2VIA A;  5EFS A;  4H63 Q;  2EYQ A;  2V0Y A;  4ZLV A;  2ZJG A;  3JW9 A;  1V2E A;  2ZP7 A;  1S06 A;  4Q75 A;  2YCT A;  3R4T A;  2BHX A;  2QLR A;  3EUC A;  3L8A A;  4A6R A;  5C6U A;  4WYF A;  1TOJ A;  5BJ4 A;  1AKC A;  1VP4 A;  3FFR A;  3KKI A;  2QSR A;  1MAQ A;  1H1C A;  3K7Y A;  1UU1 A;  2D7Z A;  1O4S A;  4W1X A;  1N8P A;  5J8Q A;  4ZSW A;  4RIT A;  4UHN A;  3NTJ A;  1YJS A;  2VI8 A;  1ASE A;  1C7N A;  2FN6 A;  4ZWV A;  5F8V A;  3H9X A;  3EZS A;  1ASF A;  3DR4 A;  5G4I A;  2CFB A;  3BWO A;  3GJU A;  3BWN C;  3FDB A;  1AMS A;  3I4J A;  4K05 A;  1LK9 A;  2HZP A;  1TOK A;  4TV7 A;  4CXR A;  2C0R A;  3ACZ A;  1LW5 A;  3AEJ C;  3FZ7 A;  1TOG A;  4ZAH A;  3VOM A;  3NUB A;  2DGL A;  1AIB A;  1MDX A;  1AMA A;  4W91 A;  1DJ9 A;  4A0R A;  2EO5 A;  4Q31 A;  1W7M A;  3FFH A;  1QIR A;  1CS1 A;  1E5E A;  1ELU A;  2CB1 A;  4F5M A;  3BWN A;  1PG8 A;  3WLX A;  1X0M A;  2HUI A;  2VMQ A;  2W7E A;  4WLH A;  1W7N A;  3UAK A;  2VGU A;  2A1V A;  2D64 A;  1TAT A;  3AEJ A;  1B5P A;  2DOU A;  4WYC A;  3H14 A;  4A72 A;  2WK9 A;  2CJG A;  2OAT A;  4IYO B;  4QGR A;  2GQN A;  2CH1 A;  2R5E A;  5BJ3 A;  2X5F A;  1GD9 A;  1GEW A;  2YRI A;  3CQ4 A;  1MLZ A;  2DGK A;  2QB3 A;  4JEV A;  1G4X A;  3NNK A;  1DFO A;  1X28 A;  1AIC A;  1D7S A;  3L44 A;  4MSO A;  1E5F A;  3Q8N A;  4OBV A;  3R9A A;  1ARH A;  3PDB A;  2W7M A;  3ELE A;  1OHW A;  3EI9 A;  4A6T A;  4ZWM A;  1KAF A;  5E5I A;  4LC3 A;  1CZE A;  4GRX A;  3DR7 A;  1ELQ A;  3E9K A;  4WB0 B;  2WB6 A;  2W7L A;  3NYS A;  2CST A;  1ZC9 A;  2AY2 A;  2VMR A;  4O6Z A;  5D5S A;  4F5J A;  1QGN A;  1SPA A;  3TFT A;  1KMJ A;  2W7J A;  1D7U A;  3ISL A;  2VI9 A;  3BCX A;  3IF2 A;  4LNJ A;  5M46 A;  3NYT A;  1W3U A;  5DB5 A;  3LV2 A;  1W7L A;  1DJU A;  2BI2 A;  3BC8 A;  3FKD A;  2ZUK A;  3TCM A;  2VGW A;  4B9B A;  4AZJ A;  2GMS A;  3BN1 A;  1ARS A;  3GET A;  3OP7 A;  4MKJ A;  3VP6 A;  1I43 A;  4R5Z A;  1WYT A;  1XI9 A;  2VMZ A;  3RUY A;  3N4R A;  5EUD A;  4WYA A;  3F9T A;  1CQ7 A;  2W8W A;  4XJP A;  3N0L A;  1YIY A;  3B1E A;  3EI8 A;  1IAX A;  3HT4 A;  4Q6R A;  2YKU A;  4GE7 A;  4W1V A;  3A8U X;  1WKG A;  5E3K A;  3FCR A;  9AAT A;  4IX8 A;  3P6K A;  2Z9W A;  4UQV A;  1OHV A;  1LC5 A;  1EJI A;  2YOB A;  3E2Y A;  3W1H A;  4ADD A;  2C44 A;  3RBL A;  1N31 A;  3MBB A;  4ZM4 A;  2JJG A;  4R8D A;  3QI6 A;  4JE5 D;  4MQQ A;  5M4D A;  2AY3 A;  3H7F A;  4H51 A;  3CQ5 A;  1DJE A;  4FL0 A;  3WKS A;  3ELP A;  2Z67 A;  4PFF A;  5EAA A;  3W1I A;  3LY1 A;  2VMY A;  2CAN A;  2C81 A;  2QB2 A;  2Z1Z A;  2JIS A;  1AY8 A;  4U2H A;  3M5U A;  5D95 A;  3EI5 A;  4E3Q A;  4MKK A;  3HMU A;  3PJ0 A;  4BHD A;  5M49 A;  2BIG A;  2VGZ A;  3E77 A;  3KGX A;  1GCK A;  2R2N A;  3NX3 A;  1J32 A;  1WYU A;  4M2J A;  4RM1 A;  2W7H A;  1ART A;  1D7V A;  2YKV A;  5FT4 A;  1AHF A;  2ZY3 A;  1N2T A;  3B46 A;  1MGV A;  5E4Z A;  2Z1Y A;  1SVV A;  1AMQ A;  2CTZ A;  3E2F A;  4PFN A;  2G6W A;  3COG A;  4K2I A;  5FT5 A;  1OXP A;  3RBF A;  3N4S A;  1C0N A;  5K8B A;  3E2Z B;  3LG0 A;  2W8T A;  3DXW A;  4K2B A;  1BJ4 A;  3AAT A;  3PD6 B;  4ZAS A;  1BQA A;  4EU1 A;  1GC0 A;  4F4E A;  1TOI A;  4OT8 A;  5EIG A;  4J5U A;  2HP2 A;  4HF8 A;  4ITG A;  2E7J A;  1SF2 A;  3VK4 A;  3RCH A;  3DZZ A;  4JE5 A;  3PGY A;  2D7Y A;  3N5M A;  2VLF A;  3WGC A;  1DGE A;  1G4V A;  1ECX A;  2O0R A;  3ZRR A;  1BKG A;  3FZ6 A;  1DTY A;  4ITX A;  4WD2 A;  4DBC A;  4BA5 A;  3VK3 A;  3D6K A;  1ZOD A;  1QIS A;  2BI5 A;  2BI9 A;  4GEB A;  2VMW A;  2E7U A;  4IXZ A;  2EZ1 A;  3FRK A;  2BWN A;  3MAF B;  4WXG A;  4AH3 A;  1WYV B;  1TAR A;  4XEW A;  2YCN A;  2XH1 A;  1Z7D A;  3OKS A;  4AOA A;  3AOV A;  1IJI A;  1AJS B;  2JJE A;  3PPL A;  4JF1 A;  4R5F A;  1TOE A;  5G2P A;  4AO4 A;  4EB5 A;  3NU8 A;  4ISY A;  4P7Y A;  2AY1 A;  4HVK A;  3HVY A;  1OXO A;  2E7I A;  2BIA A;  3EI7 A;  1M0P A;  1FC4 A;  2JGT A;  3AEO A;  1RV3 A;  3CQ6 A;  3GZC A;  3ZRP A;  1CQ6 A;  1BJO B;  2BI1 A;  4RLG A;  3AEN B;  3BB8 A;  2HUF A;  3K40 A;  4IW7 A;  4W1W A;  4A00 A;  1M32 A;  4KYO A;  3PIU A;  3DYD A;  4ZM3 A;  3PAA A;  2F8J A;  4MQR A;  2KFP A;  2WK8 A;  2W8J A;  2ZY5 A;  5LHA A;  1M7Y A;  1VEF A;  3NU7 A;  4DQ6 A;  3GR9 A;  3MEB A;  3ZZJ A;  3B1C A;  4A6U A;  2Z9U A;  4CVQ A;  1JS3 A;  3W1J A;  1OAT A;  4W5K A;  4ATP A;  4ZDP A;  4BMK A;  2AEV A;  3NYU A;  5EQC A;  2QMA A;  2ZC0 A;  3HDO A;  4N0W A;  2GB3 A;  2VMT A;  1CZC A;  5G4J A;  1QZ9 A;  3WKR A;  2ORD A;  2W8U A;  4M2M A;  3LVJ A;  1CJ0 A;  3N7N A;  1BS0 A;  2TPL A;  3F0H A;  1IAY A;  3RI6 A;  1GC2 A;  1T3I A;  2YRR A;  1AKB A;  1IX7 A;  2GSA A;  3A2B A;  1GC3 A;  5HXX A;  3DOD A;  1UU0 A;  3JU7 A;  4RKD A;  2VIB A;  1D7R A;  4Y0I A;  1AHG A;  3FVU A;  2R5C A;  4NOG A;  2BYJ A;  2HOR A;  2O1B A;  4WYE A;  3ZZK A;  1FG7 A;  1OHY A;  4E1O A;  2R0T A;  4OYT A;  2Z20 A;  3CAI A;  3FZ8 A;  1WKH A;  3QBO A;  1LS3 A;  5DJ1 A;  3LVK A;  4RKC A;  2AY5 A;  3DU4 A;  2FYF A;  4GDY A;  2G7J A;  2AEU A;  4ADC A;  3PA9 A;  3T32 A;  3AOW A;  1KKP A;  5EUN A;  4CXQ A;  4P3M A;  2AY9 A;  1YJZ A;  3DXV A;  2QBT A;  1BJN A;  1UKJ A;  2AAT A;  1IBJ A;  4LNM A;  3WCN A;  4MQP A;  1AX4 A;  3BCA A;  1G7W A;  3QPG A;  3WGB A;  3AEP A;  2CJD A;  4K2M A;  2JJF A;  5TF5 A;  3NDN A;  3MAF A;  1C7O A;  1PFF A;  1RV4 A;  2X5D A;  4OBU A;  3FD0 A;  5HHY A;  1AJS A;  1M4N A;  2D66 A;  1JG8 A;  1LC7 A;  1ASD A;  1P3W A;  3KGW A;  4E77 A;  2ZSM A;  2YKY A;  1S09 A;  3GBX A;  4UHM A;  3FQ8 A;  4MGR A;  4WBT A;  1QJ3 A;  2VMS A;  2EZ2 A;  1ARG A;  4AO9 A;  5IWQ A;  1V2D A;  4F5F A;  2XBN A;  1KMK A;  4TMR A;  5FT8 A;  1BT4 A;  1S08 A;  2FNI A;  1B5O A;  1JS6 A;  1LKC A;  1YNU A;  2OQX A;  2QA3 A;  2VMN A;  2WK7 A;  3HLM A;  3G8M A;  4RIZ A;  3B8X A;  3BS8 A;  1ASN A;  3B1D A;  4A0F A;  4IYO A;  1IVR A;  1LC8 A;  1EG5 A;  4RJ0 A;  5DX5 A;  3FSL A;  3ECD A;  1BW0 A;  1GC4 A;  1ASA A;  2BI3 A; 
#chains in the Genus database with same CATH homology
 4WP0 A;  2PB2 A;  4EFF A;  1BJW A;  2Z9V A;  1V2F A;  3TQX A;  1VJO A;  1KL1 A;  1SZK A;  3GZD C;  4GE4 A;  3MC6 C;  3JWA A;  1WST A;  3IHJ A;  4PIW A;  3NUI A;  4ATQ A;  1AHX A;  2JJH A;  4XK1 A;  4E3R A;  1D2F A;  4F5H A;  5F9S A;  8AAT A;  2BWO A;  4OMA A;  2D65 A;  3PDB B;  5EUE A;  5G2Q A;  1DGD A;  4LW4 A;  1M6S A;  1YJY A;  3G0T A;  3NRA A;  4UOY A;  2E54 A;  4WB0 A;  1Z3Z A;  1IUG A;  3LVL B;  4RJY A;  4U1T A;  1ASB A;  4BA4 A;  4N0B A;  1M0Q A;  1PMM A;  3F6T A;  5EAV A;  4EB7 A;  1TAS A;  1I48 A;  4LW2 A;  3UE8 A;  2CH2 A;  1ASG A;  3GZD A;  1XEY A;  3MC6 A;  4W8I A;  1AHY A;  3WZF A;  2ZY2 A;  2BIE A;  4F5K A;  2VGT A;  3ASA A;  1QIT A;  3I5T A;  3N4X A;  1B4X A;  3K28 A;  2X3L A;  1O62 A;  2W7G A;  5DJ9 A;  2D63 A;  2YHK A;  5JAY A;  2FNU A;  4ADE A;  4TN4 A;  2NMP A;  4XQ2 A;  2AY7 A;  2RFV A;  1B9I A;  1PMO A;  4OTL A;  3A9Z A;  3DRD A;  3II0 A;  1WYT B;  1YIZ A;  1KKJ A;  1MLY A;  4JEW A;  1X29 A;  3HBX A;  4WYD A;  2EGY A;  4JEZ A;  4B98 A;  3MAU A;  1B9H A;  2OKJ A;  2VMX A;  4AZK A;  4F5L A;  1V72 A;  4Y0H A;  2CJH A;  2EPJ A;  4DGT A;  2HUU A;  3EI6 A;  2C7T A;  1BQD A;  1G7X A;  3FVS A;  4ZDL A;  7AAT A;  2W7K A;  2V1P A;  2HP1 A;  4XJM A;  1CQ8 A;  1B8G A;  2CY8 A;  2WKA A;  2AY4 A;  5FT6 A;  3JTX A;  3HQT A;  4OCA A;  1SZS A;  1AKA A;  1AJR A;  4XAU A;  5AX8 A;  2PB0 A;  3WCO A;  1ASM A;  2W7I A;  3VK2 A;  2BYL A;  1QJ5 A;  2YKX A;  4ZSY A;  3GSB A;  3A9X A;  2W7D A;  4OC9 A;  2JG2 A;  4JEX A;  4IXO A;  1DKA A;  2Z61 A;  2DR1 A;  4KXK A;  1M0N A;  2VMP A;  3QN6 A;  1WYU B;  3WY7 A;  5KTB A;  2AY6 A;  3FDD A;  4MY5 A;  3ASB A;  4GE9 A;  4CBS A;  3A9Y A;  1JF9 A;  1H0C A;  3N75 A;  3VAX A;  2ZYJ A;  3I16 A;  3EZ1 A;  3FVX A;  3E2Z A;  4WYG A;  3FTB A;  3DC1 A;  3PD6 A;  2HOX A;  5I92 A;  3MKJ A;  3RQ1 A;  4J8L A;  1AY5 A;  1IX6 A;  1SFF A;  4RAE A;  3WX9 A;  2FKI A;  5EIG B;  1RVY A;  3TAT A;  2D5Y A;  3LVM A;  2OKK A;  4CBR A;  5LH9 A;  1AAM A;  1S0A A;  1IX8 A;  3RCH B;  2D61 A;  2AY8 A;  4A0G A;  2VMU A;  3TFU A;  1X2A A;  3EIB A;  5M4B A;  2ZY4 A;  4LNL A;  1C9C A;  4L0O A;  4M2K A;  2VYC A;  2BWP A;  4IY7 A;  3G7Q A;  1I41 A;  4Y0D A;  1C4K A;  2OGA A;  2YCP A;  1FG3 A;  1CL2 A;  1WYV A;  1GDE A;  1LW4 A;  3BV0 A;  3EIA A;  1U08 A;  4ZDO A;  3AEM C;  1YOO A;  2W8V A;  2W7F A;  3BCB A;  3AV7 A;  2ZSL A;  4BQ0 A;  4ADB A;  1AY4 A;  1GBN A;  4XJO A;  3E6G A;  3JWB A;  2DKJ A;  1MDO A;  3UWC A;  4I8A A;  4WLJ A;  3CBF A;  2VLH A;  1BJO A;  3ATH A;  1M0O A;  2FQ6 A;  3AEN A;  3GWP A;  2VMO A;  4R2N A;  4F5I A;  1SZU A;  1UU2 A;  4KAM A;  1AHE A;  1I29 A;  1ORD A;  3AEM A;  3HL2 A;  5G09 A;  2OGE A;  3P1T A;  4GSA A;  2CIN A;  1W23 A;  2EH6 A;  2FM1 A;  1ARI A;  2O7C A;  2Z9X A;  3KE3 A;  2VGV A;  3FQ7 A;  3ZRQ A;  4JF0 A;  3LWS A;  3QM2 A;  4Q76 A;  2HOY A;  2HOZ A;  3USF A;  3QGU A;  5HDM A;  4A0H A;  2VMV A;  1GEX A;  1RVU A;  1C7G A;  1TPL A;  4FFC A;  2VGS A;  1EQB A;  1YAA A;  1Y4I A;  2DGM A;  1AMR A;  1CL1 A;  1AAW A;  3PDX A;  1MDZ A;  5G0A A;  1ASC A;  3AEL A;  1J04 A;  4EMY A;  1ZOB A;  2X8U A;  3JZL A;  1O61 A;  1S07 A;  3MAD A;  4JEY A;  2Q7W A;  4WXB A;  2PO3 A;  1MAP A;  2DKB A;  1O69 A;  3FQA A;  1ASL A;  2BKW A;  4F5G A;  4IXS A;  4XJL A;  1AIA A;  4PVF A;  2R5C B;  1GEY A;  4UHO A;  1KL2 A;  4WXF A;  3QHX A;  2GMU A;  2VIA A;  5EFS A;  4H63 Q;  2EYQ A;  2V0Y A;  4ZLV A;  2ZJG A;  3JW9 A;  1V2E A;  2ZP7 A;  1S06 A;  4Q75 A;  2YCT A;  3R4T A;  2BHX A;  2QLR A;  3EUC A;  3L8A A;  4A6R A;  5C6U A;  4WYF A;  1TOJ A;  5BJ4 A;  1AKC A;  1VP4 A;  3FFR A;  3KKI A;  2QSR A;  1MAQ A;  1H1C A;  3K7Y A;  1UU1 A;  2D7Z A;  1O4S A;  4W1X A;  1N8P A;  5J8Q A;  4ZSW A;  4RIT A;  4UHN A;  3NTJ A;  1YJS A;  2VI8 A;  1ASE A;  1C7N A;  2FN6 A;  4ZWV A;  5F8V A;  3H9X A;  3EZS A;  1ASF A;  3DR4 A;  5G4I A;  2CFB A;  3BWO A;  3GJU A;  3BWN C;  3FDB A;  1AMS A;  3I4J A;  4K05 A;  1LK9 A;  2HZP A;  1TOK A;  4TV7 A;  4CXR A;  2C0R A;  3ACZ A;  1LW5 A;  3AEJ C;  3FZ7 A;  1TOG A;  4ZAH A;  3VOM A;  3NUB A;  2DGL A;  1AIB A;  1MDX A;  1AMA A;  4W91 A;  1DJ9 A;  4A0R A;  2EO5 A;  4Q31 A;  1W7M A;  3FFH A;  1QIR A;  1CS1 A;  1E5E A;  1ELU A;  2CB1 A;  4F5M A;  3BWN A;  1PG8 A;  3WLX A;  1X0M A;  2HUI A;  2VMQ A;  2W7E A;  4WLH A;  1W7N A;  3UAK A;  2VGU A;  2A1V A;  2D64 A;  1TAT A;  3AEJ A;  1B5P A;  2DOU A;  4WYC A;  3H14 A;  4A72 A;  2WK9 A;  2CJG A;  2OAT A;  4IYO B;  4QGR A;  2GQN A;  2CH1 A;  2R5E A;  5BJ3 A;  2X5F A;  1GD9 A;  1GEW A;  2YRI A;  3CQ4 A;  1MLZ A;  2DGK A;  2QB3 A;  4JEV A;  1G4X A;  3NNK A;  1DFO A;  1X28 A;  1AIC A;  1D7S A;  3L44 A;  4MSO A;  1E5F A;  3Q8N A;  4OBV A;  3R9A A;  1ARH A;  3PDB A;  2W7M A;  3ELE A;  1OHW A;  3EI9 A;  4A6T A;  4ZWM A;  5E5I A;  4LC3 A;  1CZE A;  4GRX A;  3DR7 A;  1ELQ A;  3E9K A;  4WB0 B;  2WB6 A;  2W7L A;  3NYS A;  2CST A;  1ZC9 A;  2AY2 A;  2VMR A;  4O6Z A;  5D5S A;  4F5J A;  1QGN A;  1SPA A;  3TFT A;  1KMJ A;  2W7J A;  1D7U A;  3ISL A;  2VI9 A;  3BCX A;  3IF2 A;  4LNJ A;  5M46 A;  3NYT A;  1W3U A;  5DB5 A;  3LV2 A;  1W7L A;  1DJU A;  2BI2 A;  3BC8 A;  3FKD A;  2ZUK A;  3TCM A;  2VGW A;  4B9B A;  4AZJ A;  2GMS A;  3BN1 A;  1ARS A;  3GET A;  3OP7 A;  4MKJ A;  3VP6 A;  1I43 A;  4R5Z A;  1WYT A;  1XI9 A;  2VMZ A;  3RUY A;  3N4R A;  5EUD A;  4WYA A;  3F9T A;  1CQ7 A;  2W8W A;  4XJP A;  3N0L A;  1YIY A;  3B1E A;  3EI8 A;  1IAX A;  3HT4 A;  4Q6R A;  2YKU A;  4GE7 A;  4W1V A;  3A8U X;  1WKG A;  5E3K A;  3FCR A;  9AAT A;  4IX8 A;  3P6K A;  2Z9W A;  4UQV A;  1OHV A;  1LC5 A;  1EJI A;  2YOB A;  3E2Y A;  3W1H A;  4ADD A;  2C44 A;  3RBL A;  1N31 A;  3MBB A;  4ZM4 A;  2JJG A;  4R8D A;  3QI6 A;  4JE5 D;  4MQQ A;  5M4D A;  2AY3 A;  3H7F A;  4H51 A;  3CQ5 A;  1DJE A;  4FL0 A;  3WKS A;  3ELP A;  2Z67 A;  4PFF A;  5EAA A;  3W1I A;  3LY1 A;  2VMY A;  2CAN A;  2C81 A;  2QB2 A;  2Z1Z A;  2JIS A;  1AY8 A;  4U2H A;  3M5U A;  5D95 A;  3EI5 A;  4E3Q A;  4MKK A;  3HMU A;  3PJ0 A;  4BHD A;  5M49 A;  2BIG A;  2VGZ A;  3E77 A;  3KGX A;  1GCK A;  2R2N A;  3NX3 A;  1J32 A;  1WYU A;  4M2J A;  4RM1 A;  2W7H A;  1ART A;  1D7V A;  2YKV A;  5FT4 A;  1AHF A;  2ZY3 A;  1N2T A;  3B46 A;  1MGV A;  5E4Z A;  2Z1Y A;  1SVV A;  1AMQ A;  2CTZ A;  3E2F A;  4PFN A;  2G6W A;  3COG A;  4K2I A;  5FT5 A;  1OXP A;  3RBF A;  3N4S A;  1C0N A;  5K8B A;  3E2Z B;  3LG0 A;  2W8T A;  3DXW A;  4K2B A;  1BJ4 A;  3AAT A;  3PD6 B;  4ZAS A;  1BQA A;  4EU1 A;  1GC0 A;  4F4E A;  1TOI A;  4OT8 A;  5EIG A;  4J5U A;  2HP2 A;  4HF8 A;  4ITG A;  2E7J A;  1SF2 A;  3VK4 A;  3RCH A;  3DZZ A;  4JE5 A;  3PGY A;  2D7Y A;  3N5M A;  2VLF A;  3WGC A;  1DGE A;  1G4V A;  1ECX A;  2O0R A;  3ZRR A;  1BKG A;  3FZ6 A;  1DTY A;  4ITX A;  4WD2 A;  4DBC A;  4BA5 A;  3VK3 A;  3D6K A;  1ZOD A;  1QIS A;  2BI5 A;  2BI9 A;  4GEB A;  2VMW A;  2E7U A;  4IXZ A;  2EZ1 A;  3FRK A;  2BWN A;  3MAF B;  4WXG A;  4AH3 A;  1WYV B;  1TAR A;  4XEW A;  2YCN A;  2XH1 A;  1Z7D A;  3OKS A;  4AOA A;  3AOV A;  1IJI A;  1AJS B;  2JJE A;  3PPL A;  4JF1 A;  4R5F A;  1TOE A;  5G2P A;  4AO4 A;  4EB5 A;  3NU8 A;  4ISY A;  4P7Y A;  2AY1 A;  4HVK A;  3HVY A;  1OXO A;  2E7I A;  2BIA A;  3EI7 A;  1M0P A;  1FC4 A;  2JGT A;  3AEO A;  1RV3 A;  3CQ6 A;  3GZC A;  3ZRP A;  1CQ6 A;  1BJO B;  2BI1 A;  4RLG A;  3AEN B;  3BB8 A;  2HUF A;  3K40 A;  4IW7 A;  4W1W A;  4A00 A;  1M32 A;  4KYO A;  3PIU A;  3DYD A;  4ZM3 A;  3PAA A;  2F8J A;  4MQR A;  2KFP A;  2WK8 A;  2W8J A;  2ZY5 A;  5LHA A;  1M7Y A;  1VEF A;  3NU7 A;  4DQ6 A;  3GR9 A;  3MEB A;  3ZZJ A;  3B1C A;  4A6U A;  2Z9U A;  4CVQ A;  1JS3 A;  3W1J A;  1OAT A;  4W5K A;  4ATP A;  4ZDP A;  4BMK A;  2AEV A;  3NYU A;  5EQC A;  2QMA A;  2ZC0 A;  3HDO A;  4N0W A;  2GB3 A;  2VMT A;  1CZC A;  5G4J A;  1QZ9 A;  3WKR A;  2ORD A;  2W8U A;  4M2M A;  3LVJ A;  1CJ0 A;  3N7N A;  1BS0 A;  2TPL A;  3F0H A;  1IAY A;  3RI6 A;  1GC2 A;  1T3I A;  2YRR A;  1AKB A;  1IX7 A;  2GSA A;  3A2B A;  1GC3 A;  5HXX A;  3DOD A;  1UU0 A;  3JU7 A;  4RKD A;  2VIB A;  1D7R A;  4Y0I A;  1AHG A;  3FVU A;  2R5C A;  4NOG A;  2BYJ A;  2HOR A;  2O1B A;  4WYE A;  3ZZK A;  1FG7 A;  1OHY A;  4E1O A;  2R0T A;  4OYT A;  2Z20 A;  3CAI A;  3FZ8 A;  1WKH A;  3QBO A;  1LS3 A;  5DJ1 A;  3LVK A;  4RKC A;  2AY5 A;  3DU4 A;  2FYF A;  4GDY A;  2G7J A;  2AEU A;  4ADC A;  3PA9 A;  3T32 A;  3AOW A;  1KKP A;  5EUN A;  4CXQ A;  4P3M A;  2AY9 A;  1YJZ A;  3DXV A;  2QBT A;  1BJN A;  1UKJ A;  2AAT A;  1IBJ A;  4LNM A;  3WCN A;  4MQP A;  1AX4 A;  3BCA A;  1G7W A;  3QPG A;  3WGB A;  3AEP A;  2CJD A;  4K2M A;  2JJF A;  5TF5 A;  3NDN A;  3MAF A;  1C7O A;  1PFF A;  1RV4 A;  2X5D A;  4OBU A;  3FD0 A;  5HHY A;  1AJS A;  1M4N A;  2D66 A;  1JG8 A;  1LC7 A;  1ASD A;  1P3W A;  3KGW A;  4E77 A;  2ZSM A;  2YKY A;  1S09 A;  3GBX A;  4UHM A;  3FQ8 A;  4MGR A;  4WBT A;  1QJ3 A;  2VMS A;  2EZ2 A;  1ARG A;  4AO9 A;  5IWQ A;  1V2D A;  4F5F A;  2XBN A;  1KMK A;  4TMR A;  5FT8 A;  1BT4 A;  1S08 A;  2FNI A;  1B5O A;  1JS6 A;  1LKC A;  1YNU A;  2OQX A;  2QA3 A;  2VMN A;  2WK7 A;  3HLM A;  3G8M A;  4RIZ A;  3B8X A;  3BS8 A;  1ASN A;  3B1D A;  4A0F A;  4IYO A;  1IVR A;  1LC8 A;  1EG5 A;  4RJ0 A;  5DX5 A;  3FSL A;  3ECD A;  1BW0 A;  1GC4 A;  1ASA A;  2BI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...