3JU0A

Structure of the arm-type binding domain of hai7 integrase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
SLTDSKVKNAKSLEKEYKLTDGFGMHLLVHPNGSKYWRLSYRFEKKQRLLALGVYPAVSLADARQRRDEAKKLLAAGIDPSAKKQADNKTIQEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
molecule keywords Phage integrase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13356 Arm-DNA-bind_3 Arm DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3ju0A00
3JU0A 3RMPA 3JTZA
chains in the Genus database with same CATH superfamily
4L5NC 2EOOA 2UUCE 4JI7E 4WXCA 5A2QC 1UHZA 2RTXA 1PJQA 2JWOA 2ADRA 2EMLA 1J5EE 4DR1E 1DGCA 3EPLA 4DV2E 4R2SA 2EPAA 2M9AA 2L92A 3J7AG 2EQ1A 2ENHA 2LVHA 1X6FA 4KWYA 4R2CA 2GPIA 2EOQA 3QG5C 4BCAA 2N3GA 3OTOE 1Z1BA 4F2JC 3H09A 2KONA 2EP3A 1NCSA 2N8XA 5ADZA 4X8WA 4NZVA 4ZYDA 2MC6A 2YU8A 1N34E 4K0KE 4O43A 2HGHA 2YZTA 1YSAC 1PKPA 4X65E 2Q8UA 4Q28A 2EOYA 4NXNE 2EM4A 2L2MA 2EORA 2V8QB 2CSHA 3T1HE 2EPPA 3L00A 4LF9E 1AH5A 1F2IG 3JU0A 1WXRA 2JOXA 1T4NA 3ADLA 2DB2A 2EWLA 4R2RA 3JTZA 1TF3A 1X5WA 4WSPA 4F6NA 2MDGA 3HPSA 1A1GA 2ELZA 4DR4E 1EH6A 2FTXB 2EQ3A 2RQLA 2LUQA 1QU6A 4L8NA 2VQEE 1HNWE 3HTXA 2DMIA 2DLKA 2EMIA 2H36X 4FK5C 4B3ME 3IWBA 2EJ4A 2D9HA 2EM0A 4WX9A 1ZBQA 3LLHA 3AUZA 1X6HA 3MSWA 2WCC3 1EH8A 4P7DA 2EL5A 4TUIA 2EPRA 4IS1C 1IBLE 3IWCA 1O0WA 1J26A 4ZYEA 2MKDA 4HTGA 4F9BB 2L6MA 3ZOQB 4AQYE 2LJUA 3THOB 2V87A 1ZU1A 2V89A 4F6MA 3TQMA 5KL6A 3RMPA 2L3JA 2UUBE 4DV5E 4DMIA 2LE2A 2JVAA 2EZ6A 2M4IA 2N3HA 2HC5A 2LUPB 4DUZE 2A25A 2EE8A 4BMJA 2EM2A 3MHHC 2YTNA 2EN3A 2WZOA 5A6BD 4JI3E 1UBDC 2EPXA 1A1LA 1G2FC 2YTJA 4JV5E 3JAMC 1L4SA 2EM5A 2LT7A 1WJPA 2EMKA 4DV3E 4DR3E 2KOUA 4YY3E 1LLMC 2KHXA 1EKZA 1NEIA 2EN7A 2JYAA 2RPCA 4B3SE 2V85A 1I94E 4LF6E 4P78A 2NUFA 2YWQA 3IWDA 5LL6R 1QNTA 4X62E 4DR2E 2EQ0A 1IQOA 3EPKA 4DV4E 2YU5A 3J80C 1ZR9A 2YTEA 1A1HA 4DUYE 1YUJA 2VE7C 2EPZA 2VF1A 4J8ZA 4DR6E 5FLXC 2EPCA 4R2PA 2EPOA 4JI0E 2E1MA 5KL7A 2GLIA 3AV0A 2R1FA 4LFBE 2L2NA 2NUGA 2F8BA 1IMUA 3EPHA 1HR0E 4JI2E 3ECRA 2L2KB 4ZYHA 2EM6A 2ELYA 2BB8A 1GTKA 3DF6A 3LMLA 4DR5E 2EMFA 3C6KA 2ENAA 2E5LE 4IJDA 4JYAE 4M2ZA 4DV0E 4DR7E 1MEYC 2YTPA 1JK2A 2I13A 3OMLA 2EMGA 5F3WA 2HHHE 2EM8A 5KL3A 1G2DC 2DRPA 4JI8E 1RC7A 4WPYA 1WRJA 4R2EA 5LMUE 5AE3A 1YFHA 1JK1A 4M0VA 4KHPE 2EN1A 2EOSA 2YSPA 4BHBA 3FIGA 2LBSB 1BBGA 3VYXA 1XNRE 1STUA 2EN4A 4RH8A 2CTDA 2J7JA 1IQSA 5IV8B 4JI1E 3VK6A 2HJJA 2VRDA 2YTIA 4F54A 1T4LB 3HQ1A 1ZAAC 4LF5E 2EL4A 2RSIA 2EPKX 1X3CA 5IWAE 1P47A 4O24A 5TSEA 2UU9E 1A1FA 2VQFE 4RHBB 5A6AA 2WBSA 2K4VA 1HNXE 3VYYA 2B9DA 2EOEA 2E72A 4OOGC 2FGGA 4KZSA 5A6JA 3C4TA 3MHSC 1YYWA 2JR1A 4DV7E 2UXBE 5BR8E 2ENCA 2I9IA 3THNA 2YRHA 2WBUA 4LF8E 3DJWA 3BBGA 1IBKE 1RQ0A 2YRKA 2EOHA 1GQEA 4R8OA 4TUGA 2JY9A 2ODRC 5DNYA 1KJKA 1DI2A 2DGCA 3BGHA 2UXCE 2EOIA 4MLQA 1FJGE 4LF4E 2EMXA 2PRTA 2YTGA 2EMHA 4DKKA 4GKJE 4LTYA 3KZZA 1T4OA 1WHNA 2UUAE 2JOBA 1XMOE 4JI4E 2EM9A 2BBGA 5CFFE 2LTRA 2LRSA 2YTDA 2EPNA 2EL6A 4DV1E 1X6EA 3J81C 2NUEA 1A1JA 2YSOA 2EN6A 2G7HA 2EM7A 2L33A 2EMWA 4X64E 2IHR1 1N33E 2V83A 2M7QA 1XNQE 3EPJA 2MKNA 2L8TA 4R2AA 2F4VE 2WBTA 4F9AB 4NHRA 1PJTA 1X48A 2LTSA 1B69A 3M99B 4R2DA 2EOMA 5LLQA 4LFCE 2EPLX 4X9JA 2EOZA 2JXPA 3C6MA 2DSYA 2EMAA 2LO3A 4MLVA 1SFEA 4X66E 4O5GA 3J7Yp 5AC4A 1A1KA 1A1IA 2EOJA 2EMBA 4I8OA 2EM3A 4LU9A 3P1XA 4R2QA 4DV6E 2EOXA 2NA2A 2YTQA 1HNZE 2YTOA 1YYKA 3ADIA 5AE1A 5KL4A 4BC7A 2MDRA 5A6KA 5A69A 1X47A 3F6HA 1IBME 4JI5E 3VHTB 2ODRD 2CPNA 2V86A 2YT4A 4BBYA 2RS7A 4LF7E 1BB8A 2R76A 1FKAE 5T6JA 3HXLA 5KL2A 3BF2A 3UK3C 1RMDA 2EMYA 2EN2A 2K7IA 4BC9A 4ZYGA 2B7TA 2CT1A 5AC5A 4YHHE 1PDAA 2ZM6E 3KWRA 1AAYA 2RSMA 2LCEA 1T38A 4B3TE 2UXDE 5LMNE 5AASA 4BHCA 1UN6B 4M9VC 2DMYA 2LMZA 3HPZA 1T39A 4JI6E 2MC5A 4WYQB 2DLQA 4WXDA 5IT9C 1N3GA 4HEIA 4N4RB 4NXME 2EOFA 1XMQE 5IXMB 2YTFA 4GZNC 3ADGA 3KZYA 3C4BA 5KL5A 3BIDA 4R03A 1BBOA 4Q35B 2B7VA 2YPNA 4M30A 1PJSA 2JP9A 3T1YE 1DQ3A 4BS9A 1SR9A 3F6GA 1YUIA 1TN9A 2M1SA 3EQ1A 1YPNA 1KYQA 1X49A 4B3RE 4LFAE 2JPAA 4F9CB 2YRMA 2NABA 2EN8A 2FV4B 1YYOA 2RS6A 2B3TB 1UILA 2EPUA 4GEQB 1WHQA 1N32E 1EH7A 2V88A 2EMZA 2LV2A 5AE2A 1ZBTA 4GKKE 4WFTA 2L3CA 2EMCA 4OX9E 3ADJA 3K6QA 1TF6A 1YZ9A 2GHFA 1MGTA 1N36E 5A6BA 2EPMX 2LJHA 2DIXA 1GZ6A 4O4KA 4WSGA
chains in the Genus database with same CATH topology
2V89A 4L5NC 4JI1E 2UUCE 3VK6A 3RMPA 2DSYA 2L3JA 2UUBE 4JI7E 4X66E 3J7Yp 5A2QC 4DV5E 4DMIA 1UHZA 2LE2A 2RTXA 4I8OA 2JVAA 2JWOA 3P1XA 4LU9A 2M4IA 4F54A 2N3HA 4DV6E 3HQ1A 1T4LB 2NA2A 4DUZE 4DR1E 2LUPB 1J5EE 1HNZE 4LF5E 1YYKA 3ADIA 5AE1A 5IWAE 4BC7A 2MDRA 4DV2E 4BMJA 1X47A 3F6HA 2UU9E 2L92A 2VQFE 1IBME 2EZ6A 3J7AG 2K4VA 4JI5E 2ODRD 2CPNA 2WZOA 3VYYA 1HNXE 4JI3E 2V86A 2YT4A 2B9DA 4BBYA 4JV5E 3JAMC 2RS7A 4LF7E 4OOGC 1FKAE 2FGGA 4KZSA 5T6JA 4DV3E 4DR3E 2KOUA 3C4TA 4YY3E 4BCAA 2N3GA 3OTOE 2KHXA 3HXLA 2JR1A 4DV7E 1EKZA 3H09A 1YYWA 2KONA 2UXBE 5BR8E 5ADZA 4X8WA 4BC9A 4YHHE 2B7TA 4B3SE 2V85A 1I94E 4LF8E 2MC6A 1N34E 2ZM6E 3DJWA 3KWRA 4K0KE 2YZTA 1PKPA 2RSMA 4X65E 4B3TE 4P78A 2NUFA 4Q28A 4LF6E 5LL6R 3IWDA 2UXDE 5LMNE 1IBKE 5AASA 4NXNE 1RQ0A 2L2MA 4X62E 4DR2E 1GQEA 2V8QB 3T1HE 4R8OA 2DMYA 4TUGA 4DV4E 3J80C 2LMZA 3HPZA 4JI6E 2MC5A 4WYQB 2JY9A 4LF9E 4DUYE 2ODRC 3JU0A 5DNYA 2VE7C 5IT9C 1DI2A 2VF1A 4J8ZA 4DR6E 5FLXC 2UXCE 1WXRA 2JOXA 4JI0E 4NXME 1T4NA 2E1MA 1XMQE 3ADLA 2DB2A 3ADGA 1FJGE 4LF4E 2EWLA 3AV0A 3C4BA 4LFBE 2L2NA 4DKKA 2NUGA 3JTZA 2F8BA 4R03A 2B7VA 1HR0E 4JI2E 4GKJE 2L2KB 4LTYA 4M30A 1T4OA 1WHNA 4WSPA 2JOBA 3T1YE 2UUAE 1DQ3A 3HPSA 1SR9A 3F6GA 4BS9A 1XMOE 4JI4E 3DF6A 4DR4E 5CFFE 3LMLA 2M1SA 4DR5E 2LTRA 2LRSA 2FTXB 1X49A 2E5LE 4B3RE 4JYAE 4LFAE 2LUQA 1QU6A 4F9CB 4M2ZA 4DV0E 4L8NA 2VQEE 4DR7E 4DV1E 3HTXA 3J81C 1HNWE 2NUEA 2H36X 4B3ME 3IWBA 3OMLA 5F3WA 2HHHE 2G7HA 1ZBQA 2FV4B 1YYOA 4JI8E 2RS6A 1RC7A 3LLHA 2B3TB 4WPYA 2L33A 1UILA 3AUZA 4GEQB 4X64E 5LMUE 3MSWA 1WHQA 2IHR1 5AE3A 1N32E 4P7DA 2V88A 1N33E 2V83A 2M7QA 4GKKE 5AE2A 1ZBTA 1XNQE 4M0VA 4WFTA 4TUIA 2L3CA 4KHPE 4OX9E 3ADJA 2L8TA 3K6QA 2F4VE 1IBLE 1YZ9A 4F9AB 3IWCA 1N36E 1O0WA 1J26A 4F9BB 1X48A 2LTSA 3FIGA 2L6MA 3ZOQB 2LJHA 4AQYE 2LBSB 3VYXA 2DIXA 1GZ6A 1STUA 4LFCE 1XNRE 2V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU0 A;  3RMP A;  3JTZ A; 
#chains in the Genus database with same CATH topology
 4L5N C;  2EOO A;  2UUC E;  4JI7 E;  4WXC A;  5A2Q C;  1UHZ A;  2RTX A;  1PJQ A;  2JWO A;  2ADR A;  2EML A;  1J5E E;  4DR1 E;  1DGC A;  3EPL A;  4DV2 E;  4R2S A;  2EPA A;  2M9A A;  2L92 A;  3J7A G;  2EQ1 A;  2ENH A;  2LVH A;  1X6F A;  4KWY A;  4R2C A;  2GPI A;  2EOQ A;  3QG5 C;  4BCA A;  2N3G A;  3OTO E;  1Z1B A;  4F2J C;  3H09 A;  2KON A;  2EP3 A;  1NCS A;  2N8X A;  5ADZ A;  4X8W A;  4NZV A;  4ZYD A;  2MC6 A;  2YU8 A;  1N34 E;  4K0K E;  4O43 A;  2HGH A;  2YZT A;  1YSA C;  1PKP A;  4X65 E;  2Q8U A;  4Q28 A;  2EOY A;  4NXN E;  2EM4 A;  2L2M A;  2EOR A;  2V8Q B;  2CSH A;  3T1H E;  2EPP A;  3L00 A;  4LF9 E;  1AH5 A;  1F2I G;  3JU0 A;  1WXR A;  2JOX A;  1T4N A;  3ADL A;  2DB2 A;  2EWL A;  4R2R A;  3JTZ A;  1TF3 A;  1X5W A;  4WSP A;  4F6N A;  2MDG A;  3HPS A;  1A1G A;  2ELZ A;  4DR4 E;  1EH6 A;  2FTX B;  2EQ3 A;  2RQL A;  2LUQ A;  1QU6 A;  4L8N A;  2VQE E;  1HNW E;  3HTX A;  2DMI A;  2DLK A;  2EMI A;  2H36 X;  4FK5 C;  4B3M E;  3IWB A;  2EJ4 A;  2D9H A;  2EM0 A;  4WX9 A;  1ZBQ A;  3LLH A;  3AUZ A;  1X6H A;  3MSW A;  2WCC 3;  1EH8 A;  4P7D A;  2EL5 A;  4TUI A;  2EPR A;  4IS1 C;  1IBL E;  3IWC A;  1O0W A;  1J26 A;  4ZYE A;  2MKD A;  4HTG A;  4F9B B;  2L6M A;  3ZOQ B;  4AQY E;  2LJU A;  3THO B;  2V87 A;  1ZU1 A;  2V89 A;  4F6M A;  3TQM A;  5KL6 A;  3RMP A;  2L3J A;  2UUB E;  4DV5 E;  4DMI A;  2LE2 A;  2JVA A;  2EZ6 A;  2M4I A;  2N3H A;  2HC5 A;  2LUP B;  4DUZ E;  2A25 A;  2EE8 A;  4BMJ A;  2EM2 A;  3MHH C;  2YTN A;  2EN3 A;  2WZO A;  5A6B D;  4JI3 E;  1UBD C;  2EPX A;  1A1L A;  1G2F C;  2YTJ A;  4JV5 E;  3JAM C;  1L4S A;  2EM5 A;  2LT7 A;  1WJP A;  2EMK A;  4DV3 E;  4DR3 E;  2KOU A;  4YY3 E;  1LLM C;  2KHX A;  1EKZ A;  1NEI A;  2EN7 A;  2JYA A;  2RPC A;  4B3S E;  2V85 A;  1I94 E;  4LF6 E;  4P78 A;  2NUF A;  2YWQ A;  3IWD A;  5LL6 R;  1QNT A;  4X62 E;  4DR2 E;  2EQ0 A;  1IQO A;  3EPK A;  4DV4 E;  2YU5 A;  3J80 C;  1ZR9 A;  2YTE A;  1A1H A;  4DUY E;  1YUJ A;  2VE7 C;  2EPZ A;  2VF1 A;  4J8Z A;  4DR6 E;  5FLX C;  2EPC A;  4R2P A;  2EPO A;  4JI0 E;  2E1M A;  5KL7 A;  2GLI A;  3AV0 A;  2R1F A;  4LFB E;  2L2N A;  2NUG A;  2F8B A;  1IMU A;  3EPH A;  1HR0 E;  4JI2 E;  3ECR A;  2L2K B;  4ZYH A;  2EM6 A;  2ELY A;  2BB8 A;  1GTK A;  3DF6 A;  3LML A;  4DR5 E;  2EMF A;  3C6K A;  2ENA A;  2E5L E;  4IJD A;  4JYA E;  4M2Z A;  4DV0 E;  4DR7 E;  1MEY C;  2YTP A;  1JK2 A;  2I13 A;  3OML A;  2EMG A;  5F3W A;  2HHH E;  2EM8 A;  5KL3 A;  1G2D C;  2DRP A;  4JI8 E;  1RC7 A;  4WPY A;  1WRJ A;  4R2E A;  5LMU E;  5AE3 A;  1YFH A;  1JK1 A;  4M0V A;  4KHP E;  2EN1 A;  2EOS A;  2YSP A;  4BHB A;  3FIG A;  2LBS B;  1BBG A;  3VYX A;  1XNR E;  1STU A;  2EN4 A;  4RH8 A;  2CTD A;  2J7J A;  1IQS A;  5IV8 B;  4JI1 E;  3VK6 A;  2HJJ A;  2VRD A;  2YTI A;  4F54 A;  1T4L B;  3HQ1 A;  1ZAA C;  4LF5 E;  2EL4 A;  2RSI A;  2EPK X;  1X3C A;  5IWA E;  1P47 A;  4O24 A;  5TSE A;  2UU9 E;  1A1F A;  2VQF E;  4RHB B;  5A6A A;  2WBS A;  2K4V A;  1HNX E;  3VYY A;  2B9D A;  2EOE A;  2E72 A;  4OOG C;  2FGG A;  4KZS A;  5A6J A;  3C4T A;  3MHS C;  1YYW A;  2JR1 A;  4DV7 E;  2UXB E;  5BR8 E;  2ENC A;  2I9I A;  3THN A;  2YRH A;  2WBU A;  4LF8 E;  3DJW A;  3BBG A;  1IBK E;  1RQ0 A;  2YRK A;  2EOH A;  1GQE A;  4R8O A;  4TUG A;  2JY9 A;  2ODR C;  5DNY A;  1KJK A;  1DI2 A;  2DGC A;  3BGH A;  2UXC E;  2EOI A;  4MLQ A;  1FJG E;  4LF4 E;  2EMX A;  2PRT A;  2YTG A;  2EMH A;  4DKK A;  4GKJ E;  4LTY A;  3KZZ A;  1T4O A;  1WHN A;  2UUA E;  2JOB A;  1XMO E;  4JI4 E;  2EM9 A;  2BBG A;  5CFF E;  2LTR A;  2LRS A;  2YTD A;  2EPN A;  2EL6 A;  4DV1 E;  1X6E A;  3J81 C;  2NUE A;  1A1J A;  2YSO A;  2EN6 A;  2G7H A;  2EM7 A;  2L33 A;  2EMW A;  4X64 E;  2IHR 1;  1N33 E;  2V83 A;  2M7Q A;  1XNQ E;  3EPJ A;  2MKN A;  2L8T A;  4R2A A;  2F4V E;  2WBT A;  4F9A B;  4NHR A;  1PJT A;  1X48 A;  2LTS A;  1B69 A;  3M99 B;  4R2D A;  2EOM A;  5LLQ A;  4LFC E;  2EPL X;  4X9J A;  2EOZ A;  2JXP A;  3C6M A;  2DSY A;  2EMA A;  2LO3 A;  4MLV A;  1SFE A;  4X66 E;  4O5G A;  3J7Y p;  5AC4 A;  1A1K A;  1A1I A;  2EOJ A;  2EMB A;  4I8O A;  2EM3 A;  4LU9 A;  3P1X A;  4R2Q A;  4DV6 E;  2EOX A;  2NA2 A;  2YTQ A;  1HNZ E;  2YTO A;  1YYK A;  3ADI A;  5AE1 A;  5KL4 A;  4BC7 A;  2MDR A;  5A6K A;  5A69 A;  1X47 A;  3F6H A;  1IBM E;  4JI5 E;  3VHT B;  2ODR D;  2CPN A;  2V86 A;  2YT4 A;  4BBY A;  2RS7 A;  4LF7 E;  1BB8 A;  2R76 A;  1FKA E;  5T6J A;  3HXL A;  5KL2 A;  3BF2 A;  3UK3 C;  1RMD A;  2EMY A;  2EN2 A;  2K7I A;  4BC9 A;  4ZYG A;  2B7T A;  2CT1 A;  5AC5 A;  4YHH E;  1PDA A;  2ZM6 E;  3KWR A;  1AAY A;  2RSM A;  2LCE A;  1T38 A;  4B3T E;  2UXD E;  5LMN E;  5AAS A;  4BHC A;  1UN6 B;  4M9V C;  2DMY A;  2LMZ A;  3HPZ A;  1T39 A;  4JI6 E;  2MC5 A;  4WYQ B;  2DLQ A;  4WXD A;  5IT9 C;  1N3G A;  4HEI A;  4N4R B;  4NXM E;  2EOF A;  1XMQ E;  5IXM B;  2YTF A;  4GZN C;  3ADG A;  3KZY A;  3C4B A;  5KL5 A;  3BID A;  4R03 A;  1BBO A;  4Q35 B;  2B7V A;  2YPN A;  4M30 A;  1PJS A;  2JP9 A;  3T1Y E;  1DQ3 A;  4BS9 A;  1SR9 A;  3F6G A;  1YUI A;  1TN9 A;  2M1S A;  3EQ1 A;  1YPN A;  1KYQ A;  1X49 A;  4B3R E;  4LFA E;  2JPA A;  4F9C B;  2YRM A;  2NAB A;  2EN8 A;  2FV4 B;  1YYO A;  2RS6 A;  2B3T B;  1UIL A;  2EPU A;  4GEQ B;  1WHQ A;  1N32 E;  1EH7 A;  2V88 A;  2EMZ A;  2LV2 A;  5AE2 A;  1ZBT A;  4GKK E;  4WFT A;  2L3C A;  2EMC A;  4OX9 E;  3ADJ A;  3K6Q A;  1TF6 A;  1YZ9 A;  2GHF A;  1MGT A;  1N36 E;  5A6B A;  2EPM X;  2LJH A;  2DIX A;  1GZ6 A;  4O4K A;  4WSG A; 
#chains in the Genus database with same CATH homology
 2V89 A;  4L5N C;  4JI1 E;  2UUC E;  3VK6 A;  3RMP A;  2DSY A;  2L3J A;  2UUB E;  4JI7 E;  4X66 E;  3J7Y p;  5A2Q C;  4DV5 E;  4DMI A;  1UHZ A;  2LE2 A;  2RTX A;  4I8O A;  2JVA A;  2JWO A;  3P1X A;  4LU9 A;  2M4I A;  4F54 A;  2N3H A;  4DV6 E;  3HQ1 A;  1T4L B;  2NA2 A;  4DUZ E;  4DR1 E;  2LUP B;  1J5E E;  1HNZ E;  4LF5 E;  1YYK A;  3ADI A;  5AE1 A;  5IWA E;  4BC7 A;  2MDR A;  4DV2 E;  4BMJ A;  1X47 A;  3F6H A;  2UU9 E;  2L92 A;  2VQF E;  1IBM E;  2EZ6 A;  3J7A G;  2K4V A;  4JI5 E;  2ODR D;  2CPN A;  2WZO A;  3VYY A;  1HNX E;  4JI3 E;  2V86 A;  2YT4 A;  2B9D A;  4BBY A;  4JV5 E;  3JAM C;  2RS7 A;  4LF7 E;  4OOG C;  1FKA E;  2FGG A;  4KZS A;  5T6J A;  4DV3 E;  4DR3 E;  2KOU A;  3C4T A;  4YY3 E;  4BCA A;  2N3G A;  3OTO E;  2KHX A;  3HXL A;  2JR1 A;  4DV7 E;  1EKZ A;  3H09 A;  1YYW A;  2KON A;  2UXB E;  5BR8 E;  5ADZ A;  4X8W A;  4BC9 A;  4YHH E;  2B7T A;  4B3S E;  2V85 A;  1I94 E;  4LF8 E;  2MC6 A;  1N34 E;  2ZM6 E;  3DJW A;  3KWR A;  4K0K E;  2YZT A;  1PKP A;  2RSM A;  4X65 E;  4B3T E;  4P78 A;  2NUF A;  4Q28 A;  4LF6 E;  5LL6 R;  3IWD A;  2UXD E;  5LMN E;  1IBK E;  5AAS A;  4NXN E;  1RQ0 A;  2L2M A;  4X62 E;  4DR2 E;  1GQE A;  2V8Q B;  3T1H E;  4R8O A;  2DMY A;  4TUG A;  4DV4 E;  3J80 C;  2LMZ A;  3HPZ A;  4JI6 E;  2MC5 A;  4WYQ B;  2JY9 A;  4LF9 E;  4DUY E;  2ODR C;  3JU0 A;  5DNY A;  2VE7 C;  5IT9 C;  1DI2 A;  2VF1 A;  4J8Z A;  4DR6 E;  5FLX C;  2UXC E;  1WXR A;  2JOX A;  4JI0 E;  4NXM E;  1T4N A;  2E1M A;  1XMQ E;  3ADL A;  2DB2 A;  3ADG A;  1FJG E;  4LF4 E;  2EWL A;  3AV0 A;  3C4B A;  4LFB E;  2L2N A;  4DKK A;  2NUG A;  3JTZ A;  2F8B A;  4R03 A;  2B7V A;  1HR0 E;  4JI2 E;  4GKJ E;  2L2K B;  4LTY A;  4M30 A;  1T4O A;  1WHN A;  4WSP A;  2JOB A;  3T1Y E;  2UUA E;  1DQ3 A;  3HPS A;  1SR9 A;  3F6G A;  4BS9 A;  1XMO E;  4JI4 E;  3DF6 A;  4DR4 E;  5CFF E;  3LML A;  2M1S A;  4DR5 E;  2LTR A;  2LRS A;  2FTX B;  1X49 A;  2E5L E;  4B3R E;  4JYA E;  4LFA E;  2LUQ A;  1QU6 A;  4F9C B;  4M2Z A;  4DV0 E;  4L8N A;  2VQE E;  4DR7 E;  4DV1 E;  3HTX A;  3J81 C;  1HNW E;  2NUE A;  2H36 X;  4B3M E;  3IWB A;  3OML A;  5F3W A;  2HHH E;  2G7H A;  1ZBQ A;  2FV4 B;  1YYO A;  4JI8 E;  2RS6 A;  1RC7 A;  3LLH A;  2B3T B;  4WPY A;  2L33 A;  1UIL A;  3AUZ A;  4GEQ B;  4X64 E;  5LMU E;  3MSW A;  1WHQ A;  2IHR 1;  5AE3 A;  1N32 E;  4P7D A;  2V88 A;  1N33 E;  2V83 A;  2M7Q A;  4GKK E;  5AE2 A;  1ZBT A;  1XNQ E;  4M0V A;  4WFT A;  4TUI A;  2L3C A;  4KHP E;  4OX9 E;  3ADJ A;  2L8T A;  3K6Q A;  2F4V E;  1IBL E;  1YZ9 A;  4F9A B;  3IWC A;  1N36 E;  1O0W A;  1J26 A;  4F9B B;  1X48 A;  2LTS A;  3FIG A;  2L6M A;  3ZOQ B;  2LJH A;  4AQY E;  2LBS B;  3VYX A;  2DIX A;  1GZ6 A;  1STU A;  4LFC E;  1XNR E;  2V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...