3JU0A

Structure of the arm-type binding domain of hai7 integrase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
SLTDSKVKNAKSLEKEYKLTDGFGMHLLVHPNGSKYWRLSYRFEKKQRLLALGVYPAVSLADARQRRDEAKKLLAAGIDPSAKKQADNKTIQEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
molecule keywords Phage integrase
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13356 Arm-DNA-bind_3 Arm DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3ju0A00
3JTZA 3RMPA 3JU0A
chains in the Genus database with same CATH superfamily
4DV1E 2EN6A 4FK5C 2UXBE 2ELZA 3JTZA 4F6NA 3JAMC 2V8QB 2EL6A 1ZU1A 1I94E 4RHBB 2GPIA 5IWAE 4DV6E 5A69A 2ENAA 2L92A 1YFHA 4KZSA 1IBME 4MLQA 2LJUA 2ODRC 2YTEA 1YUIA 1A1IA 2N3HA 4I8OA 1EH8A 2EPMX 4DR2E 2EMWA 2EMFA 1KJKA 2E1MA 2EOOA 1MEYC 4DV7E 3HPZA 2EM2A 1GZ6A 2N8XA 3VHTB 4JI7E 2EQ3A 2A25A 2RQLA 3OTOE 2CT1A 1DI2A 1BB8A 3QG5C 5A6BA 4JI3E 3KZYA 5T6JA 4GKKE 3ADJA 2FV4B 5LL6R 4DR4E 2WBSA 4LF6E 4P7DA 2V88A 4WXDA 4DV0E 3T1YE 4Q28A 2YTOA 2EOJA 5A6JA 4P78A 4M0VA 1F2IG 2YTFA 4B3SE 4R2RA 3ZOQB 4R2CA 4LFBE 2V83A 2YWQA 3C6KA 4RH8A 4WX9A 3EPKA 4DV3E 2EN1A 5AASA 5A2QC 4DV2E 2WZOA 5LMUE 3P1XA 1EH6A 4ZYDA 1YUJA 2JXPA 3LMLA 3F6GA 2EM4A 2RPCA 3EQ1A 2EE8A 5AE1A 1J5EE 4HTGA 1WHQA 4BC9A 4WYQB 2EM8A 2EM0A 4ZYGA 3IWBA 1BBOA 2EPOA 4B3TE 3DJWA 5IV8B 1HR0E 1X6FA 2BBGA 1X49A 4DR6E 2YTQA 4TUGA 2DGCA 4R2SA 3MHSC 5DNYA 1WJPA 2EOEA 3VK6A 2J7JA 4R2QA 5CFFE 3VYXA 3AUZA 2DB2A 2GLIA 2LTRA 2EOSA 2FGGA 1YZ9A 3J81C 2YU5A 4WSPA 1B69A 1TN9A 2L8TA 4LF9E 5AE3A 4WXCA 4BC7A 2H36X 2L3CA 1STUA 3BIDA 2RTXA 5FLXC 4BHCA 4JYAE 2EPAA 4BCAA 2VF1A 2LCEA 2V85A 2KHXA 2L2KB 4R2AA 2EMIA 2JOXA 2EMHA 1GTKA 2YTDA 4DR5E 4NXME 1NCSA 3K6QA 2EMYA 2R1FA 4NHRA 2ODRD 2EMGA 2KOUA 2YZTA 2B7VA 2D9HA 1WXRA 4LFCE 1WHNA 3KZZA 2WBUA 5IXMB 4X64E 4GEQB 4JI5E 2N3GA 4OOGC 2DLQA 2EPUA 1X47A 2RSIA 4O24A 2LTSA 3HQ1A 2ZM6E 2EMXA 4OX9E 4WSGA 4GKJE 5F3WA 2BB8A 1G2DC 2LT7A 1PJTA 2HJJA 1PDAA 2M7QA 2YSPA 3IWDA 1IBKE 1NEIA 2EJ4A 2YRMA 2L2MA 3VYYA 2E72A 4ZYEA 2EOHA 1YPNA 2L33A 3HPSA 4LF7E 4JI4E 1SR9A 4J8ZA 1QU6A 2LO3A 4DV4E 4M9VC 2YRKA 4DR3E 1YYKA 1IQOA 2FTXB 4O5GA 4LF5E 3IWCA 1QNTA 2EMCA 4DV5E 1T4LB 1A1KA 4YY3E 1MGTA 1WRJA 3THOB 1N3GA 4MLVA 2LBSB 4DKKA 3AV0A 2EOYA 1J26A 4F6MA 4F54A 4F9AB 1FJGE 3MHHC 5AC5A 1DGCA 2EM6A 1ZR9A 2MC5A 3RMPA 2EL5A 1AH5A 2EN2A 1A1HA 4WPYA 2DLKA 2YSOA 3ADGA 1JK2A 2EOQA 5TSEA 1EH7A 2EOXA 4JI8E 4R2DA 1YYWA 1PJQA 2E5LE 4LF4E 4R2PA 4X9JA 1T38A 1LLMC 1TF3A 2JPAA 4LF8E 5IT9C 5KL6A 1X6HA 3F6HA 1IQSA 4X65E 2DSYA 2F8BA 1UILA 1GQEA 2YPNA 2Q8UA 2EPCA 2EPXA 1N36E 4DR7E 2HGHA 5ADZA 3T1HE 2EM5A 2UXCE 2MDGA 3J7AG 4NZVA 4M2ZA 2YTGA 4IS1C 2EMZA 2B9DA 1XMQE 2K7IA 2JY9A 2EORA 2V89A 4DR1E 2EMAA 2EN3A 2HHHE 4R03A 1UBDC 1DQ3A 1KYQA 3BGHA 1O0WA 3C4BA 2DMIA 2LV2A 1IMUA 2YT4A 4B3ME 2B3TB 3ADLA 5BR8E 3UK3C 2LE2A 4F9BB 3EPJA 2CTDA 2F4VE 2ENHA 3THNA 1PJSA 2EM9A 2EPNA 1A1LA 1PKPA 4HEIA 4LTYA 2VQFE 2NUFA 2EMBA 1RMDA 2EN7A 4M30A 2UUCE 2M1SA 4X62E 2LUPB 3OMLA 2EM3A 2YTNA 3JU0A 2MKNA 4F9CB 2K4VA 5A6AA 2ADRA 2EOFA 1HNXE 2JP9A 2EL4A 1SFEA 3ADIA 2V87A 4KHPE 3EPHA 2EZ6A 3EPLA 1YYOA 3M99B 5AC4A 2KONA 3HXLA 1UN6B 4AQYE 4LU9A 4JI2E 1XNRE 5KL2A 5A6BD 3LLHA 4DMIA 4GZNC 2JYAA 5KL3A 5KL4A 3BF2A 2NUEA 4B3RE 3L00A 2JVAA 5LMNE 2G7HA 1JK1A 2I13A 1L4SA 2NABA 2WCC3 2EPZA 2RS7A 2YRHA 5LLQA 2NUGA 2EMLA 2EP3A 2VE7C 2EQ1A 1AAYA 2UU9E 4BMJA 1X5WA 2LUQA 1A1JA 2LRSA 1TF6A 2MDRA 4R2EA 4JV5E 2EN8A 3HTXA 1N33E 4L8NA 1T39A 3TQMA 5KL7A 2L3JA 2EMKA 1Z1BA 2ENCA 2EN4A 1IBLE 2RSMA 1YSAC 5A6KA 4IJDA 4O4KA 4JI0E 1X48A 2YTPA 1N32E 1ZBTA 3MSWA 1RC7A 1ZBQA 2VQEE 4NXNE 2EQ0A 2JWOA 4BHBA 3DF6A 4LFAE 5AE2A 1EKZA 1HNZE 1A1GA 1FKAE 4WFTA 2IHR1 1HNWE 4DUZE 1BBGA 2EWLA 2RS6A 2LMZA 4F2JC 4K0KE 4BS9A 2EOZA 3C4TA 2M4IA 1XMOE 2M9AA 2B7TA 2EM7A 4KWYA 2DIXA 2ELYA 4O43A 4TUIA 4JI6E 2UUAE 2HC5A 1A1FA 1X6EA 4L5NC 4Q35B 2L2NA 2GHFA 2JOBA 2CPNA 2EPPA 2EPLX 2LJHA 1X3CA 4X66E 3J80C 3KWRA 3H09A 2R76A 2VRDA 5KL5A 2NA2A 4BBYA 4ZYHA 4JI1E 3C6MA 1T4OA 3J7Yp 1P47A 2JR1A 3ECRA 2V86A 2EPRA 2MKDA 2UXDE 1ZAAC 2L6MA 1XNQE 2EPKX 2EOIA 1UHZA 1T4NA 4N4RB 2YTIA 2PRTA 3BBGA 3FIGA 4DUYE 2I9IA 2DMYA 2UUBE 1N34E 2DRPA 2YU8A 4R8OA 2YTJA 1RQ0A 2MC6A 4X8WA 4YHHE 2WBTA 2CSHA 2EOMA 2LVHA 1G2FC
chains in the Genus database with same CATH topology
4DMIA 4F9AB 3VK6A 4DV1E 1FJGE 5CFFE 3VYXA 3AUZA 2UXBE 2NUEA 4B3RE 2DB2A 3JTZA 2MC5A 3RMPA 2JVAA 3JAMC 5LMNE 2G7HA 2LTRA 2FGGA 2V8QB 4WPYA 1YZ9A 3J81C 4WSPA 3ADGA 2L8TA 2RS7A 4LF9E 5AE3A 1I94E 2NUGA 4JI8E 4BC7A 1YYWA 2H36X 2VE7C 5IWAE 4DV6E 2L3CA 1STUA 2E5LE 2UU9E 4LF4E 2RTXA 4LF8E 5FLXC 4BMJA 2L92A 2LUQA 5IT9C 2LRSA 4KZSA 3F6HA 1IBME 4JYAE 2MDRA 4X65E 2ODRC 2DSYA 2F8BA 1UILA 4BCAA 1GQEA 2VF1A 4JV5E 2V85A 1N33E 3HTXA 2N3HA 4L8NA 2KHXA 4I8OA 2L2KB 1N36E 4DR7E 5ADZA 2L3JA 3T1HE 2UXCE 2JOXA 4DR2E 4DR5E 4NXME 2E1MA 3J7AG 1IBLE 2RSMA 4M2ZA 4DV7E 4JI0E 3K6QA 3HPZA 1X48A 1GZ6A 2B9DA 1N32E 1ZBTA 3MSWA 1XMQE 2JY9A 2ODRD 1RC7A 1ZBQA 2VQEE 4NXNE 4JI7E 2KOUA 2B7VA 2JWOA 2V89A 2YZTA 1WXRA 4DR1E 4LFCE 1WHNA 3DF6A 4LFAE 5AE2A 1EKZA 3OTOE 2HHHE 4R03A 1DI2A 1DQ3A 4X64E 4GEQB 4JI5E 1HNZE 1FKAE 1O0WA 3C4BA 4WFTA 5T6JA 4JI3E 2IHR1 3ADJA 2FV4B 4DUZE 4GKKE 1HNWE 5LL6R 4DR4E 2YT4A 2EWLA 2RS6A 2LMZA 2N3GA 2B3TB 4B3ME 3ADLA 4OOGC 5BR8E 4LF6E 4K0KE 4P7DA 2LE2A 1X47A 2V88A 4BS9A 4DV0E 3T1YE 3C4TA 2LTSA 2M4IA 3HQ1A 4Q28A 4F9BB 2ZM6E 1XMOE 2B7TA 4OX9E 5F3WA 4GKJE 4P78A 4M0VA 2DIXA 4TUIA 4JI6E 2F4VE 2M7QA 2UUAE 4B3SE 4L5NC 3ZOQB 4LFBE 2L2NA 2V83A 2JOBA 2CPNA 3IWDA 1IBKE 1PKPA 2LJHA 4DV3E 4X66E 3J80C 4LTYA 3KWRA 5AASA 3H09A 2VQFE 5A2QC 2NUFA 2L2MA 4DV2E 3VYYA 2NA2A 2WZOA 4BBYA 4JI1E 1T4OA 2L33A 3HPSA 3J7Yp 5LMUE 4LF7E 4M30A 2JR1A 3P1XA 2UUCE 1SR9A 4JI4E 2M1SA 4X62E 2LUPB 2V86A 1QU6A 3LMLA 3F6GA 3OMLA 4J8ZA 4DV4E 3JU0A 4F9CB 2K4VA 2UXDE 2L6MA 4DR3E 1YYKA 5AE1A 1XNQE 1HNXE 2FTXB 1UHZA 1J5EE 4LF5E 1WHQA 4BC9A 3IWCA 4WYQB 1T4NA 3IWBA 3ADIA 2V87A 4KHPE 4DV5E 1T4LB 3FIGA 4DUYE 4YY3E 4B3TE 2EZ6A 3DJWA 1HR0E 2DMYA 2UUBE 1YYOA 2LBSB 1N34E 1X49A 4DKKA 3AV0A 4R8OA 4DR6E 2KONA 3HXLA 1RQ0A 1J26A 2MC6A 4TUGA 4F54A 4X8WA 4AQYE 4YHHE 4LU9A 4JI2E 1XNRE 5DNYA 3LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3RMP A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 4DV1 E;  2EN6 A;  4FK5 C;  2UXB E;  2ELZ A;  3JTZ A;  4F6N A;  3JAM C;  2V8Q B;  2EL6 A;  1ZU1 A;  1I94 E;  4RHB B;  2GPI A;  5IWA E;  4DV6 E;  5A69 A;  2ENA A;  2L92 A;  1YFH A;  4KZS A;  1IBM E;  4MLQ A;  2LJU A;  2ODR C;  2YTE A;  1YUI A;  1A1I A;  2N3H A;  4I8O A;  1EH8 A;  2EPM X;  4DR2 E;  2EMW A;  2EMF A;  1KJK A;  2E1M A;  2EOO A;  1MEY C;  4DV7 E;  3HPZ A;  2EM2 A;  1GZ6 A;  2N8X A;  3VHT B;  4JI7 E;  2EQ3 A;  2A25 A;  2RQL A;  3OTO E;  2CT1 A;  1DI2 A;  1BB8 A;  3QG5 C;  5A6B A;  4JI3 E;  3KZY A;  5T6J A;  4GKK E;  3ADJ A;  2FV4 B;  5LL6 R;  4DR4 E;  2WBS A;  4LF6 E;  4P7D A;  2V88 A;  4WXD A;  4DV0 E;  3T1Y E;  4Q28 A;  2YTO A;  2EOJ A;  5A6J A;  4P78 A;  4M0V A;  1F2I G;  2YTF A;  4B3S E;  4R2R A;  3ZOQ B;  4R2C A;  4LFB E;  2V83 A;  2YWQ A;  3C6K A;  4RH8 A;  4WX9 A;  3EPK A;  4DV3 E;  2EN1 A;  5AAS A;  5A2Q C;  4DV2 E;  2WZO A;  5LMU E;  3P1X A;  1EH6 A;  4ZYD A;  1YUJ A;  2JXP A;  3LML A;  3F6G A;  2EM4 A;  2RPC A;  3EQ1 A;  2EE8 A;  5AE1 A;  1J5E E;  4HTG A;  1WHQ A;  4BC9 A;  4WYQ B;  2EM8 A;  2EM0 A;  4ZYG A;  3IWB A;  1BBO A;  2EPO A;  4B3T E;  3DJW A;  5IV8 B;  1HR0 E;  1X6F A;  2BBG A;  1X49 A;  4DR6 E;  2YTQ A;  4TUG A;  2DGC A;  4R2S A;  3MHS C;  5DNY A;  1WJP A;  2EOE A;  3VK6 A;  2J7J A;  4R2Q A;  5CFF E;  3VYX A;  3AUZ A;  2DB2 A;  2GLI A;  2LTR A;  2EOS A;  2FGG A;  1YZ9 A;  3J81 C;  2YU5 A;  4WSP A;  1B69 A;  1TN9 A;  2L8T A;  4LF9 E;  5AE3 A;  4WXC A;  4BC7 A;  2H36 X;  2L3C A;  1STU A;  3BID A;  2RTX A;  5FLX C;  4BHC A;  4JYA E;  2EPA A;  4BCA A;  2VF1 A;  2LCE A;  2V85 A;  2KHX A;  2L2K B;  4R2A A;  2EMI A;  2JOX A;  2EMH A;  1GTK A;  2YTD A;  4DR5 E;  4NXM E;  1NCS A;  3K6Q A;  2EMY A;  2R1F A;  4NHR A;  2ODR D;  2EMG A;  2KOU A;  2YZT A;  2B7V A;  2D9H A;  1WXR A;  4LFC E;  1WHN A;  3KZZ A;  2WBU A;  5IXM B;  4X64 E;  4GEQ B;  4JI5 E;  2N3G A;  4OOG C;  2DLQ A;  2EPU A;  1X47 A;  2RSI A;  4O24 A;  2LTS A;  3HQ1 A;  2ZM6 E;  2EMX A;  4OX9 E;  4WSG A;  4GKJ E;  5F3W A;  2BB8 A;  1G2D C;  2LT7 A;  1PJT A;  2HJJ A;  1PDA A;  2M7Q A;  2YSP A;  3IWD A;  1IBK E;  1NEI A;  2EJ4 A;  2YRM A;  2L2M A;  3VYY A;  2E72 A;  4ZYE A;  2EOH A;  1YPN A;  2L33 A;  3HPS A;  4LF7 E;  4JI4 E;  1SR9 A;  4J8Z A;  1QU6 A;  2LO3 A;  4DV4 E;  4M9V C;  2YRK A;  4DR3 E;  1YYK A;  1IQO A;  2FTX B;  4O5G A;  4LF5 E;  3IWC A;  1QNT A;  2EMC A;  4DV5 E;  1T4L B;  1A1K A;  4YY3 E;  1MGT A;  1WRJ A;  3THO B;  1N3G A;  4MLV A;  2LBS B;  4DKK A;  3AV0 A;  2EOY A;  1J26 A;  4F6M A;  4F54 A;  4F9A B;  1FJG E;  3MHH C;  5AC5 A;  1DGC A;  2EM6 A;  1ZR9 A;  2MC5 A;  3RMP A;  2EL5 A;  1AH5 A;  2EN2 A;  1A1H A;  4WPY A;  2DLK A;  2YSO A;  3ADG A;  1JK2 A;  2EOQ A;  5TSE A;  1EH7 A;  2EOX A;  4JI8 E;  4R2D A;  1YYW A;  1PJQ A;  2E5L E;  4LF4 E;  4R2P A;  4X9J A;  1T38 A;  1LLM C;  1TF3 A;  2JPA A;  4LF8 E;  5IT9 C;  5KL6 A;  1X6H A;  3F6H A;  1IQS A;  4X65 E;  2DSY A;  2F8B A;  1UIL A;  1GQE A;  2YPN A;  2Q8U A;  2EPC A;  2EPX A;  1N36 E;  4DR7 E;  2HGH A;  5ADZ A;  3T1H E;  2EM5 A;  2UXC E;  2MDG A;  3J7A G;  4NZV A;  4M2Z A;  2YTG A;  4IS1 C;  2EMZ A;  2B9D A;  1XMQ E;  2K7I A;  2JY9 A;  2EOR A;  2V89 A;  4DR1 E;  2EMA A;  2EN3 A;  2HHH E;  4R03 A;  1UBD C;  1DQ3 A;  1KYQ A;  3BGH A;  1O0W A;  3C4B A;  2DMI A;  2LV2 A;  1IMU A;  2YT4 A;  4B3M E;  2B3T B;  3ADL A;  5BR8 E;  3UK3 C;  2LE2 A;  4F9B B;  3EPJ A;  2CTD A;  2F4V E;  2ENH A;  3THN A;  1PJS A;  2EM9 A;  2EPN A;  1A1L A;  1PKP A;  4HEI A;  4LTY A;  2VQF E;  2NUF A;  2EMB A;  1RMD A;  2EN7 A;  4M30 A;  2UUC E;  2M1S A;  4X62 E;  2LUP B;  3OML A;  2EM3 A;  2YTN A;  3JU0 A;  2MKN A;  4F9C B;  2K4V A;  5A6A A;  2ADR A;  2EOF A;  1HNX E;  2JP9 A;  2EL4 A;  1SFE A;  3ADI A;  2V87 A;  4KHP E;  3EPH A;  2EZ6 A;  3EPL A;  1YYO A;  3M99 B;  5AC4 A;  2KON A;  3HXL A;  1UN6 B;  4AQY E;  4LU9 A;  4JI2 E;  1XNR E;  5KL2 A;  5A6B D;  3LLH A;  4DMI A;  4GZN C;  2JYA A;  5KL3 A;  5KL4 A;  3BF2 A;  2NUE A;  4B3R E;  3L00 A;  2JVA A;  5LMN E;  2G7H A;  1JK1 A;  2I13 A;  1L4S A;  2NAB A;  2WCC 3;  2EPZ A;  2RS7 A;  2YRH A;  5LLQ A;  2NUG A;  2EML A;  2EP3 A;  2VE7 C;  2EQ1 A;  1AAY A;  2UU9 E;  4BMJ A;  1X5W A;  2LUQ A;  1A1J A;  2LRS A;  1TF6 A;  2MDR A;  4R2E A;  4JV5 E;  2EN8 A;  3HTX A;  1N33 E;  4L8N A;  1T39 A;  3TQM A;  5KL7 A;  2L3J A;  2EMK A;  1Z1B A;  2ENC A;  2EN4 A;  1IBL E;  2RSM A;  1YSA C;  5A6K A;  4IJD A;  4O4K A;  4JI0 E;  1X48 A;  2YTP A;  1N32 E;  1ZBT A;  3MSW A;  1RC7 A;  1ZBQ A;  2VQE E;  4NXN E;  2EQ0 A;  2JWO A;  4BHB A;  3DF6 A;  4LFA E;  5AE2 A;  1EKZ A;  1HNZ E;  1A1G A;  1FKA E;  4WFT A;  2IHR 1;  1HNW E;  4DUZ E;  1BBG A;  2EWL A;  2RS6 A;  2LMZ A;  4F2J C;  4K0K E;  4BS9 A;  2EOZ A;  3C4T A;  2M4I A;  1XMO E;  2M9A A;  2B7T A;  2EM7 A;  4KWY A;  2DIX A;  2ELY A;  4O43 A;  4TUI A;  4JI6 E;  2UUA E;  2HC5 A;  1A1F A;  1X6E A;  4L5N C;  4Q35 B;  2L2N A;  2GHF A;  2JOB A;  2CPN A;  2EPP A;  2EPL X;  2LJH A;  1X3C A;  4X66 E;  3J80 C;  3KWR A;  3H09 A;  2R76 A;  2VRD A;  5KL5 A;  2NA2 A;  4BBY A;  4ZYH A;  4JI1 E;  3C6M A;  1T4O A;  3J7Y p;  1P47 A;  2JR1 A;  3ECR A;  2V86 A;  2EPR A;  2MKD A;  2UXD E;  1ZAA C;  2L6M A;  1XNQ E;  2EPK X;  2EOI A;  1UHZ A;  1T4N A;  4N4R B;  2YTI A;  2PRT A;  3BBG A;  3FIG A;  4DUY E;  2I9I A;  2DMY A;  2UUB E;  1N34 E;  2DRP A;  2YU8 A;  4R8O A;  2YTJ A;  1RQ0 A;  2MC6 A;  4X8W A;  4YHH E;  2WBT A;  2CSH A;  2EOM A;  2LVH A;  1G2F C; 
#chains in the Genus database with same CATH homology
 4DMI A;  4F9A B;  3VK6 A;  4DV1 E;  1FJG E;  5CFF E;  3VYX A;  3AUZ A;  2UXB E;  2NUE A;  4B3R E;  2DB2 A;  3JTZ A;  2MC5 A;  3RMP A;  2JVA A;  3JAM C;  5LMN E;  2G7H A;  2LTR A;  2FGG A;  2V8Q B;  4WPY A;  1YZ9 A;  3J81 C;  4WSP A;  3ADG A;  2L8T A;  2RS7 A;  4LF9 E;  5AE3 A;  1I94 E;  2NUG A;  4JI8 E;  4BC7 A;  1YYW A;  2H36 X;  2VE7 C;  5IWA E;  4DV6 E;  2L3C A;  1STU A;  2E5L E;  2UU9 E;  4LF4 E;  2RTX A;  4LF8 E;  5FLX C;  4BMJ A;  2L92 A;  2LUQ A;  5IT9 C;  2LRS A;  4KZS A;  3F6H A;  1IBM E;  4JYA E;  2MDR A;  4X65 E;  2ODR C;  2DSY A;  2F8B A;  1UIL A;  4BCA A;  1GQE A;  2VF1 A;  4JV5 E;  2V85 A;  1N33 E;  3HTX A;  2N3H A;  4L8N A;  2KHX A;  4I8O A;  2L2K B;  1N36 E;  4DR7 E;  5ADZ A;  2L3J A;  3T1H E;  2UXC E;  2JOX A;  4DR2 E;  4DR5 E;  4NXM E;  2E1M A;  3J7A G;  1IBL E;  2RSM A;  4M2Z A;  4DV7 E;  4JI0 E;  3K6Q A;  3HPZ A;  1X48 A;  1GZ6 A;  2B9D A;  1N32 E;  1ZBT A;  3MSW A;  1XMQ E;  2JY9 A;  2ODR D;  1RC7 A;  1ZBQ A;  2VQE E;  4NXN E;  4JI7 E;  2KOU A;  2B7V A;  2JWO A;  2V89 A;  2YZT A;  1WXR A;  4DR1 E;  4LFC E;  1WHN A;  3DF6 A;  4LFA E;  5AE2 A;  1EKZ A;  3OTO E;  2HHH E;  4R03 A;  1DI2 A;  1DQ3 A;  4X64 E;  4GEQ B;  4JI5 E;  1HNZ E;  1FKA E;  1O0W A;  3C4B A;  4WFT A;  5T6J A;  4JI3 E;  2IHR 1;  3ADJ A;  2FV4 B;  4DUZ E;  4GKK E;  1HNW E;  5LL6 R;  4DR4 E;  2YT4 A;  2EWL A;  2RS6 A;  2LMZ A;  2N3G A;  2B3T B;  4B3M E;  3ADL A;  4OOG C;  5BR8 E;  4LF6 E;  4K0K E;  4P7D A;  2LE2 A;  1X47 A;  2V88 A;  4BS9 A;  4DV0 E;  3T1Y E;  3C4T A;  2LTS A;  2M4I A;  3HQ1 A;  4Q28 A;  4F9B B;  2ZM6 E;  1XMO E;  2B7T A;  4OX9 E;  5F3W A;  4GKJ E;  4P78 A;  4M0V A;  2DIX A;  4TUI A;  4JI6 E;  2F4V E;  2M7Q A;  2UUA E;  4B3S E;  4L5N C;  3ZOQ B;  4LFB E;  2L2N A;  2V83 A;  2JOB A;  2CPN A;  3IWD A;  1IBK E;  1PKP A;  2LJH A;  4DV3 E;  4X66 E;  3J80 C;  4LTY A;  3KWR A;  5AAS A;  3H09 A;  2VQF E;  5A2Q C;  2NUF A;  2L2M A;  4DV2 E;  3VYY A;  2NA2 A;  2WZO A;  4BBY A;  4JI1 E;  1T4O A;  2L33 A;  3HPS A;  3J7Y p;  5LMU E;  4LF7 E;  4M30 A;  2JR1 A;  3P1X A;  2UUC E;  1SR9 A;  4JI4 E;  2M1S A;  4X62 E;  2LUP B;  2V86 A;  1QU6 A;  3LML A;  3F6G A;  3OML A;  4J8Z A;  4DV4 E;  3JU0 A;  4F9C B;  2K4V A;  2UXD E;  2L6M A;  4DR3 E;  1YYK A;  5AE1 A;  1XNQ E;  1HNX E;  2FTX B;  1UHZ A;  1J5E E;  4LF5 E;  1WHQ A;  4BC9 A;  3IWC A;  4WYQ B;  1T4N A;  3IWB A;  3ADI A;  2V87 A;  4KHP E;  4DV5 E;  1T4L B;  3FIG A;  4DUY E;  4YY3 E;  4B3T E;  2EZ6 A;  3DJW A;  1HR0 E;  2DMY A;  2UUB E;  1YYO A;  2LBS B;  1N34 E;  1X49 A;  4DKK A;  3AV0 A;  4R8O A;  4DR6 E;  2KON A;  3HXL A;  1RQ0 A;  1J26 A;  2MC6 A;  4TUG A;  4F54 A;  4X8W A;  4AQY E;  4YHH E;  4LU9 A;  4JI2 E;  1XNR E;  5DNY A;  3LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...