3JU0A

Structure of the arm-type binding domain of hai7 integrase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
b'SLTDSKVKNAKSLEKEYKLTDGFGMHLLVHPNGSKYWRLSYRFEKKQRLLALGVYPAVSLADARQRRDEAKKLLAAGIDPSAKKQADNKTIQEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage integrase
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13356 Arm-DNA-bind_3 Arm DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3ju0A00
3JTZA 3JU0A 3RMPA
chains in the Genus database with same CATH superfamily
1EH6A 2EPMX 1PKPA 2YTGA 4DR3E 2EP3A 2EOSA 5A2QC 1HR0E 2YZTA 2EOZA 4WXDA 4LF4E 2EPAA 1XNRE 2ENAA 2YTOA 2M4IA 4DV1E 1N3GA 4B3SE 2JR1A 2MKDA 2K7IA 2UUCE 2L2NA 2LRSA 2CSHA 4B3ME 2V8QB 1J26A 4DR7E 1IMUA 1A1HA 3K6QA 1FJGE 2EOYA 5KL7A 3VHTB 2DB2A 5KL4A 3KZYA 4BMJA 2LV2A 5FLXC 4P78A 2B7VA 2EM3A 4WSGA 2V85A 2EPXA 4M0VA 3JU0A 1A1LA 4LU9A 2EQ0A 1DGCA 1GZ6A 1QU6A 1X6HA 1IBKE 1X49A 4NZVA 4R03A 2N3GA 1X5WA 3JTZA 4WFTA 5AC5A 3THNA 2EM6A 4HEIA 4J8ZA 3QG5C 1ZBTA 4DV2E 2EPLX 2ZM6E 3HQ1A 4TUIA 1XNQE 4DV5E 4O43A 2EPKX 2MC6A 3LLHA 1X47A 2BB8A 1IBME 4NXME 2EPRA 3EPLA 2F4VE 4ZYHA 1BBOA 2EZ6A 2D9HA 2EMZA 5A6KA 2HHHE 2JP9A 2EMCA 2NUGA 4F6NA 2L2KB 1MEYC 2GHFA 4BCAA 4R2AA 1YUIA 4GKKE 4ZYEA 3FIGA 1HNZE 4R2PA 1TN9A 2JPAA 5A6JA 2ODRD 2LVHA 4MLQA 2WCC3 2LTRA 4WYQB 5KL5A 5IT9C 3J81C 2EMFA 2B7TA 2EN6A 4JI4E 4F9BB 1T38A 5IXMB 1KYQA 4DV6E 3L00A 4LF9E 2EN2A 4KHPE 2EM0A 4GKJE 1B69A 1Z1BA 4DR5E 1AH5A 1UN6B 2MC5A 4L8NA 2YTPA 1YFHA 4X64E 5LL6R 2RQLA 2HJJA 3AUZA 4WSPA 4WXCA 1TF3A 2EMKA 2J7JA 2YRHA 2EMAA 3ZOQB 1P47A 4M30A 4BBYA 5CFFE 1N34E 4WPYA 3HXLA 2YTJA 3MHSC 3KZZA 2JOBA 3EPHA 1IQOA 2RSIA 1KJKA 2LE2A 2EL5A 5AE1A 1XMQE 2V83A 4JI0E 4LFCE 2B3TB 4JI7E 5A6BA 1PJTA 5AASA 2I9IA 4OX9E 2YTFA 5IWAE 4KZSA 1IBLE 2IHR1 3H09A 4DUYE 2DSYA 2V87A 2RSMA 1XMOE 1YPNA 4LTYA 5AC4A 4X9JA 4X8WA 4X65E 1AAYA 4ZYGA 5IV8B 4LF8E 4DUZE 4O24A 2YTIA 3BIDA 2EPCA 4F6MA 4DR2E 2EOQA 2MDRA 2EMIA 4F9CB 1NCSA 2EQ1A 3F6GA 2WBSA 2ADRA 1HNWE 3M99B 2VF1A 3IWDA 3ECRA 1GQEA 2EN8A 4RHBB 2DRPA 4LF5E 2YRMA 3ADJA 3EPKA 2HGHA 3C4BA 2EPZA 4LF7E 3VYXA 2EM4A 5LLQA 4WX9A 4TUGA 3T1HE 2EPUA 2EOEA 2JXPA 1JK2A 2EOIA 2DMYA 2Q8UA 1X6FA 2NABA 2I13A 4IS1C 1WRJA 1ZR9A 2GLIA 1G2DC 4OOGC 2PRTA 5KL2A 2VQFE 2KONA 4GZNC 2YU8A 4DKKA 1RC7A 2YWQA 2FTXB 4O5GA 2EM5A 1GTKA 2ELZA 2E5LE 2EMXA 3F6HA 4BC9A 1T4OA 2EOXA 2YTNA 1L4SA 2WBTA 4BHBA 2G7HA 1BBGA 2JY9A 2R1FA 4AQYE 1T4LB 5F3WA 1YYKA 3C4TA 5A6BD 1WJPA 1PJQA 4F9AB 4R2DA 2L3CA 4DV3E 1ZAAC 3DF6A 1FKAE 4HTGA 1PJSA 1A1IA 5AE3A 2VRDA 3UK3C 1N36E 1A1JA 5AE2A 2EM8A 1EH8A 2M9AA 5LMUE 3ADLA 2EOMA 3ADGA 2LJHA 4X62E 1X48A 2LMZA 2EPNA 3BGHA 1YYWA 2EOHA 2LCEA 3C6MA 4YY3E 5ADZA 2V86A 2R76A 2NA2A 1HNXE 2CTDA 1N33E 2E1MA 1YSAC 2KHXA 2EMYA 2FGGA 2EM9A 2M1SA 5KL6A 4YHHE 2V89A 1YUJA 2EMHA 2UXBE 3MSWA 3T1YE 1EKZA 5A6AA 5TSEA 2ENCA 2EM7A 2EN1A 4X66E 2NUFA 2A25A 2RPCA 4F54A 5BR8E 2YSPA 3OMLA 2DMIA 2N8XA 4M2ZA 2M7QA 1ZU1A 2NUEA 2YSOA 4KWYA 5A69A 2EPOA 2YPNA 2L6MA 2VQEE 2EOJA 1NEIA 2HC5A 2RS7A 2L92A 2JVAA 2EJ4A 3EQ1A 2WZOA 2EL6A 1JK1A 4JI1E 4R8OA 2LBSB 4K0KE 2DLKA 3ADIA 2MKNA 3BF2A 2YTQA 3J80C 1IQSA 2E72A 1WHNA 3EPJA 2B9DA 2VE7C 4JI2E 3THOB 4O4KA 4IJDA 2DLQA 2LTSA 2UUAE 4BS9A 1I94E 2EMGA 1RQ0A 1LLMC 2UU9E 2JOXA 4DMIA 4B3RE 4MLVA 2H36X 4L5NC 1BB8A 1DI2A 4DR6E 2YTEA 3HPSA 1F2IG 1WHQA 2WBUA 2YT4A 2KOUA 2EOOA 2YRKA 2EN7A 4R2EA 4LFAE 4M9VC 3OTOE 1YZ9A 4R2RA 4JI6E 4GEQB 4BC7A 1ZBQA 2F8BA 3RMPA 3C6KA 1A1KA 2CT1A 2EPPA 2JWOA 2RS6A 3P1XA 2L33A 2N3HA 1X6EA 2EORA 2FV4B 4NHRA 4DV7E 1T4NA 3HPZA 1O0WA 2LJUA 4R2SA 3LMLA 4DR1E 1PDAA 2L2MA 2BBGA 4R2QA 4NXNE 1MGTA 2LO3A 2LT7A 4R2CA 4DV0E 2EN4A 1UBDC 3HTXA 4FK5C 2UXDE 2JYAA 3VK6A 2K4VA 2YU5A 2DIXA 4ZYDA 2EQ3A 4DR4E 2EE8A 1UILA 4Q28A 5KL3A 2MDGA 4F2JC 1DQ3A 4JI8E 4JI5E 3KWRA 2EWLA 5LMNE 1WXRA 2UUBE 1A1FA 1G2FC 2DGCA 4P7DA 1T39A 2EMLA 4JI3E 2RTXA 1YYOA 1SFEA 1SR9A 1QNTA 3AV0A 2ENHA 2YTDA 5T6JA 2EMWA 3MHHC 3IWBA 4JYAE 1STUA 3J7AG 3DJWA 4JV5E 1RMDA 4RH8A 2GPIA 3BBGA 2L3JA 2LUPB 2L8TA 4BHCA 2ELYA 1EH7A 5DNYA 1A1GA 2UXCE 4Q35B 2EM2A 2V88A 1UHZA 3VYYA 1J5EE 2CPNA 4LF6E 2LUQA 1TF6A 3TQMA 1X3CA 2ODRC 4LFBE 3J7Yp 2EN3A 2EMBA 2EOFA 4B3TE 4N4RB 3IWCA 4DV4E 1N32E 3JAMC 2EL4A 4I8OA
chains in the Genus database with same CATH topology
5LL6R 2KOUA 3AUZA 1PKPA 4WSPA 4DR3E 5F3WA 1T4LB 4LFAE 3OTOE 1YYKA 3ZOQB 1YZ9A 3C4TA 4M30A 5A2QC 1HR0E 4BBYA 5CFFE 1N34E 4WPYA 4JI6E 4GEQB 4BC7A 2YZTA 3HXLA 4LF4E 4F9AB 1ZBQA 2L3CA 2F8BA 4DV3E 1XNRE 3DF6A 3RMPA 1FKAE 2JWOA 2M4IA 2RS6A 3P1XA 2JOBA 2L33A 2N3HA 5AE3A 4DV1E 1N36E 2JR1A 4B3SE 2LE2A 2FV4B 5AE2A 4DV7E 1T4NA 3HPZA 1O0WA 5AE1A 2UUCE 2L2NA 1XMQE 1N32E 5LMUE 2V83A 3ADLA 2LRSA 3ADGA 2LJHA 3LMLA 2B3TB 4JI7E 4X62E 2L2MA 4DR1E 4B3ME 1X48A 5AASA 2V8QB 1J26A 4OX9E 2LMZA 1YYWA 4DR7E 5IWAE 4KZSA 1IBLE 3K6QA 2IHR1 3H09A 4DUYE 4NXNE 1FJGE 4YY3E 1HNXE 2DSYA 2V86A 2V87A 2NA2A 2RSMA 5ADZA 1XMOE 1N33E 2E1MA 4DV0E 2KHXA 4LTYA 2DB2A 4X8WA 4X65E 3HTXA 4BMJA 2FGGA 5FLXC 4P78A 2M1SA 2UXDE 2B7VA 4YHHE 4LF8E 2V89A 3VK6A 4DUZE 2K4VA 2DIXA 2UXBE 2V85A 3MSWA 4M0VA 3JU0A 4DR4E 3T1YE 1EKZA 1UILA 4LU9A 4Q28A 4DR2E 1GZ6A 2MDRA 4F9CB 1QU6A 4X66E 2NUFA 1DQ3A 1IBKE 4JI8E 1X49A 4F54A 3KWRA 5BR8E 4JI5E 2EWLA 3F6GA 3OMLA 5LMNE 4R03A 1WXRA 2UUBE 2N3GA 3JTZA 4P7DA 4WFTA 1HNWE 4J8ZA 2VF1A 3IWDA 4M2ZA 2M7QA 2RTXA 1YYOA 4JI3E 1GQEA 4LF5E 1SR9A 1ZBTA 2NUEA 4DV2E 3AV0A 2ZM6E 3HQ1A 4TUIA 2L6MA 5T6JA 4DV5E 1XNQE 2MC6A 3LLHA 2VQEE 1X47A 3ADJA 1IBME 4NXME 3C4BA 3IWBA 4JYAE 4LF7E 2RS7A 2F4VE 4LFCE 1STUA 3VYXA 2L92A 2JVAA 2EZ6A 2WZOA 4TUGA 4JI1E 4R8OA 3T1HE 3J7AG 3DJWA 2LBSB 2HHHE 4K0KE 4JV5E 3ADIA 2L3JA 2DMYA 3J80C 2LUPB 2L8TA 1WHNA 2B9DA 2VE7C 4JI2E 2NUGA 4JI0E 2L2KB 4BCAA 5DNYA 2UXCE 2LTSA 4OOGC 4GKKE 3FIGA 2UUAE 1HNZE 2V88A 2VQFE 2KONA 2ODRD 1UHZA 4BS9A 3VYYA 1I94E 1RQ0A 2LTRA 4WYQB 2CPNA 5IT9C 4DKKA 3J81C 1J5EE 4LF6E 1RC7A 2B7TA 2UU9E 2JOXA 4DMIA 4B3RE 4JI4E 2FTXB 2LUQA 4F9BB 2ODRC 2H36X 4L5NC 4DV6E 4LF9E 4KHPE 2E5LE 4GKJE 1DI2A 4BC9A 3F6HA 4DR6E 4LFBE 1T4OA 4DR5E 3HPSA 3J7Yp 1WHQA 4B3TE 2YT4A 2MC5A 3IWCA 4L8NA 2G7HA 2JY9A 4DV4E 4X64E 3JAMC 4AQYE 4I8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3JU0 A;  3RMP A; 
#chains in the Genus database with same CATH topology
 1EH6 A;  2EPM X;  1PKP A;  2YTG A;  4DR3 E;  2EP3 A;  2EOS A;  5A2Q C;  1HR0 E;  2YZT A;  2EOZ A;  4WXD A;  4LF4 E;  2EPA A;  1XNR E;  2ENA A;  2YTO A;  2M4I A;  4DV1 E;  1N3G A;  4B3S E;  2JR1 A;  2MKD A;  2K7I A;  2UUC E;  2L2N A;  2LRS A;  2CSH A;  4B3M E;  2V8Q B;  1J26 A;  4DR7 E;  1IMU A;  1A1H A;  3K6Q A;  1FJG E;  2EOY A;  5KL7 A;  3VHT B;  2DB2 A;  5KL4 A;  3KZY A;  4BMJ A;  2LV2 A;  5FLX C;  4P78 A;  2B7V A;  2EM3 A;  4WSG A;  2V85 A;  2EPX A;  4M0V A;  3JU0 A;  1A1L A;  4LU9 A;  2EQ0 A;  1DGC A;  1GZ6 A;  1QU6 A;  1X6H A;  1IBK E;  1X49 A;  4NZV A;  4R03 A;  2N3G A;  1X5W A;  3JTZ A;  4WFT A;  5AC5 A;  3THN A;  2EM6 A;  4HEI A;  4J8Z A;  3QG5 C;  1ZBT A;  4DV2 E;  2EPL X;  2ZM6 E;  3HQ1 A;  4TUI A;  1XNQ E;  4DV5 E;  4O43 A;  2EPK X;  2MC6 A;  3LLH A;  1X47 A;  2BB8 A;  1IBM E;  4NXM E;  2EPR A;  3EPL A;  2F4V E;  4ZYH A;  1BBO A;  2EZ6 A;  2D9H A;  2EMZ A;  5A6K A;  2HHH E;  2JP9 A;  2EMC A;  2NUG A;  4F6N A;  2L2K B;  1MEY C;  2GHF A;  4BCA A;  4R2A A;  1YUI A;  4GKK E;  4ZYE A;  3FIG A;  1HNZ E;  4R2P A;  1TN9 A;  2JPA A;  5A6J A;  2ODR D;  2LVH A;  4MLQ A;  2WCC 3;  2LTR A;  4WYQ B;  5KL5 A;  5IT9 C;  3J81 C;  2EMF A;  2B7T A;  2EN6 A;  4JI4 E;  4F9B B;  1T38 A;  5IXM B;  1KYQ A;  4DV6 E;  3L00 A;  4LF9 E;  2EN2 A;  4KHP E;  2EM0 A;  4GKJ E;  1B69 A;  1Z1B A;  4DR5 E;  1AH5 A;  1UN6 B;  2MC5 A;  4L8N A;  2YTP A;  1YFH A;  4X64 E;  5LL6 R;  2RQL A;  2HJJ A;  3AUZ A;  4WSP A;  4WXC A;  1TF3 A;  2EMK A;  2J7J A;  2YRH A;  2EMA A;  3ZOQ B;  1P47 A;  4M30 A;  4BBY A;  5CFF E;  1N34 E;  4WPY A;  3HXL A;  2YTJ A;  3MHS C;  3KZZ A;  2JOB A;  3EPH A;  1IQO A;  2RSI A;  1KJK A;  2LE2 A;  2EL5 A;  5AE1 A;  1XMQ E;  2V83 A;  4JI0 E;  4LFC E;  2B3T B;  4JI7 E;  5A6B A;  1PJT A;  5AAS A;  2I9I A;  4OX9 E;  2YTF A;  5IWA E;  4KZS A;  1IBL E;  2IHR 1;  3H09 A;  4DUY E;  2DSY A;  2V87 A;  2RSM A;  1XMO E;  1YPN A;  4LTY A;  5AC4 A;  4X9J A;  4X8W A;  4X65 E;  1AAY A;  4ZYG A;  5IV8 B;  4LF8 E;  4DUZ E;  4O24 A;  2YTI A;  3BID A;  2EPC A;  4F6M A;  4DR2 E;  2EOQ A;  2MDR A;  2EMI A;  4F9C B;  1NCS A;  2EQ1 A;  3F6G A;  2WBS A;  2ADR A;  1HNW E;  3M99 B;  2VF1 A;  3IWD A;  3ECR A;  1GQE A;  2EN8 A;  4RHB B;  2DRP A;  4LF5 E;  2YRM A;  3ADJ A;  3EPK A;  2HGH A;  3C4B A;  2EPZ A;  4LF7 E;  3VYX A;  2EM4 A;  5LLQ A;  4WX9 A;  4TUG A;  3T1H E;  2EPU A;  2EOE A;  2JXP A;  1JK2 A;  2EOI A;  2DMY A;  2Q8U A;  1X6F A;  2NAB A;  2I13 A;  4IS1 C;  1WRJ A;  1ZR9 A;  2GLI A;  1G2D C;  4OOG C;  2PRT A;  5KL2 A;  2VQF E;  2KON A;  4GZN C;  2YU8 A;  4DKK A;  1RC7 A;  2YWQ A;  2FTX B;  4O5G A;  2EM5 A;  1GTK A;  2ELZ A;  2E5L E;  2EMX A;  3F6H A;  4BC9 A;  1T4O A;  2EOX A;  2YTN A;  1L4S A;  2WBT A;  4BHB A;  2G7H A;  1BBG A;  2JY9 A;  2R1F A;  4AQY E;  1T4L B;  5F3W A;  1YYK A;  3C4T A;  5A6B D;  1WJP A;  1PJQ A;  4F9A B;  4R2D A;  2L3C A;  4DV3 E;  1ZAA C;  3DF6 A;  1FKA E;  4HTG A;  1PJS A;  1A1I A;  5AE3 A;  2VRD A;  3UK3 C;  1N36 E;  1A1J A;  5AE2 A;  2EM8 A;  1EH8 A;  2M9A A;  5LMU E;  3ADL A;  2EOM A;  3ADG A;  2LJH A;  4X62 E;  1X48 A;  2LMZ A;  2EPN A;  3BGH A;  1YYW A;  2EOH A;  2LCE A;  3C6M A;  4YY3 E;  5ADZ A;  2V86 A;  2R76 A;  2NA2 A;  1HNX E;  2CTD A;  1N33 E;  2E1M A;  1YSA C;  2KHX A;  2EMY A;  2FGG A;  2EM9 A;  2M1S A;  5KL6 A;  4YHH E;  2V89 A;  1YUJ A;  2EMH A;  2UXB E;  3MSW A;  3T1Y E;  1EKZ A;  5A6A A;  5TSE A;  2ENC A;  2EM7 A;  2EN1 A;  4X66 E;  2NUF A;  2A25 A;  2RPC A;  4F54 A;  5BR8 E;  2YSP A;  3OML A;  2DMI A;  2N8X A;  4M2Z A;  2M7Q A;  1ZU1 A;  2NUE A;  2YSO A;  4KWY A;  5A69 A;  2EPO A;  2YPN A;  2L6M A;  2VQE E;  2EOJ A;  1NEI A;  2HC5 A;  2RS7 A;  2L92 A;  2JVA A;  2EJ4 A;  3EQ1 A;  2WZO A;  2EL6 A;  1JK1 A;  4JI1 E;  4R8O A;  2LBS B;  4K0K E;  2DLK A;  3ADI A;  2MKN A;  3BF2 A;  2YTQ A;  3J80 C;  1IQS A;  2E72 A;  1WHN A;  3EPJ A;  2B9D A;  2VE7 C;  4JI2 E;  3THO B;  4O4K A;  4IJD A;  2DLQ A;  2LTS A;  2UUA E;  4BS9 A;  1I94 E;  2EMG A;  1RQ0 A;  1LLM C;  2UU9 E;  2JOX A;  4DMI A;  4B3R E;  4MLV A;  2H36 X;  4L5N C;  1BB8 A;  1DI2 A;  4DR6 E;  2YTE A;  3HPS A;  1F2I G;  1WHQ A;  2WBU A;  2YT4 A;  2KOU A;  2EOO A;  2YRK A;  2EN7 A;  4R2E A;  4LFA E;  4M9V C;  3OTO E;  1YZ9 A;  4R2R A;  4JI6 E;  4GEQ B;  4BC7 A;  1ZBQ A;  2F8B A;  3RMP A;  3C6K A;  1A1K A;  2CT1 A;  2EPP A;  2JWO A;  2RS6 A;  3P1X A;  2L33 A;  2N3H A;  1X6E A;  2EOR A;  2FV4 B;  4NHR A;  4DV7 E;  1T4N A;  3HPZ A;  1O0W A;  2LJU A;  4R2S A;  3LML A;  4DR1 E;  1PDA A;  2L2M A;  2BBG A;  4R2Q A;  4NXN E;  1MGT A;  2LO3 A;  2LT7 A;  4R2C A;  4DV0 E;  2EN4 A;  1UBD C;  3HTX A;  4FK5 C;  2UXD E;  2JYA A;  3VK6 A;  2K4V A;  2YU5 A;  2DIX A;  4ZYD A;  2EQ3 A;  4DR4 E;  2EE8 A;  1UIL A;  4Q28 A;  5KL3 A;  2MDG A;  4F2J C;  1DQ3 A;  4JI8 E;  4JI5 E;  3KWR A;  2EWL A;  5LMN E;  1WXR A;  2UUB E;  1A1F A;  1G2F C;  2DGC A;  4P7D A;  1T39 A;  2EML A;  4JI3 E;  2RTX A;  1YYO A;  1SFE A;  1SR9 A;  1QNT A;  3AV0 A;  2ENH A;  2YTD A;  5T6J A;  2EMW A;  3MHH C;  3IWB A;  4JYA E;  1STU A;  3J7A G;  3DJW A;  4JV5 E;  1RMD A;  4RH8 A;  2GPI A;  3BBG A;  2L3J A;  2LUP B;  2L8T A;  4BHC A;  2ELY A;  1EH7 A;  5DNY A;  1A1G A;  2UXC E;  4Q35 B;  2EM2 A;  2V88 A;  1UHZ A;  3VYY A;  1J5E E;  2CPN A;  4LF6 E;  2LUQ A;  1TF6 A;  3TQM A;  1X3C A;  2ODR C;  4LFB E;  3J7Y p;  2EN3 A;  2EMB A;  2EOF A;  4B3T E;  4N4R B;  3IWC A;  4DV4 E;  1N32 E;  3JAM C;  2EL4 A;  4I8O A; 
#chains in the Genus database with same CATH homology
 5LL6 R;  2KOU A;  3AUZ A;  1PKP A;  4WSP A;  4DR3 E;  5F3W A;  1T4L B;  4LFA E;  3OTO E;  1YYK A;  3ZOQ B;  1YZ9 A;  3C4T A;  4M30 A;  5A2Q C;  1HR0 E;  4BBY A;  5CFF E;  1N34 E;  4WPY A;  4JI6 E;  4GEQ B;  4BC7 A;  2YZT A;  3HXL A;  4LF4 E;  4F9A B;  1ZBQ A;  2L3C A;  2F8B A;  4DV3 E;  1XNR E;  3DF6 A;  3RMP A;  1FKA E;  2JWO A;  2M4I A;  2RS6 A;  3P1X A;  2JOB A;  2L33 A;  2N3H A;  5AE3 A;  4DV1 E;  1N36 E;  2JR1 A;  4B3S E;  2LE2 A;  2FV4 B;  5AE2 A;  4DV7 E;  1T4N A;  3HPZ A;  1O0W A;  5AE1 A;  2UUC E;  2L2N A;  1XMQ E;  1N32 E;  5LMU E;  2V83 A;  3ADL A;  2LRS A;  3ADG A;  2LJH A;  3LML A;  2B3T B;  4JI7 E;  4X62 E;  2L2M A;  4DR1 E;  4B3M E;  1X48 A;  5AAS A;  2V8Q B;  1J26 A;  4OX9 E;  2LMZ A;  1YYW A;  4DR7 E;  5IWA E;  4KZS A;  1IBL E;  3K6Q A;  2IHR 1;  3H09 A;  4DUY E;  4NXN E;  1FJG E;  4YY3 E;  1HNX E;  2DSY A;  2V86 A;  2V87 A;  2NA2 A;  2RSM A;  5ADZ A;  1XMO E;  1N33 E;  2E1M A;  4DV0 E;  2KHX A;  4LTY A;  2DB2 A;  4X8W A;  4X65 E;  3HTX A;  4BMJ A;  2FGG A;  5FLX C;  4P78 A;  2M1S A;  2UXD E;  2B7V A;  4YHH E;  4LF8 E;  2V89 A;  3VK6 A;  4DUZ E;  2K4V A;  2DIX A;  2UXB E;  2V85 A;  3MSW A;  4M0V A;  3JU0 A;  4DR4 E;  3T1Y E;  1EKZ A;  1UIL A;  4LU9 A;  4Q28 A;  4DR2 E;  1GZ6 A;  2MDR A;  4F9C B;  1QU6 A;  4X66 E;  2NUF A;  1DQ3 A;  1IBK E;  4JI8 E;  1X49 A;  4F54 A;  3KWR A;  5BR8 E;  4JI5 E;  2EWL A;  3F6G A;  3OML A;  5LMN E;  4R03 A;  1WXR A;  2UUB E;  2N3G A;  3JTZ A;  4P7D A;  4WFT A;  1HNW E;  4J8Z A;  2VF1 A;  3IWD A;  4M2Z A;  2M7Q A;  2RTX A;  1YYO A;  4JI3 E;  1GQE A;  4LF5 E;  1SR9 A;  1ZBT A;  2NUE A;  4DV2 E;  3AV0 A;  2ZM6 E;  3HQ1 A;  4TUI A;  2L6M A;  5T6J A;  4DV5 E;  1XNQ E;  2MC6 A;  3LLH A;  2VQE E;  1X47 A;  3ADJ A;  1IBM E;  4NXM E;  3C4B A;  3IWB A;  4JYA E;  4LF7 E;  2RS7 A;  2F4V E;  4LFC E;  1STU A;  3VYX A;  2L92 A;  2JVA A;  2EZ6 A;  2WZO A;  4TUG A;  4JI1 E;  4R8O A;  3T1H E;  3J7A G;  3DJW A;  2LBS B;  2HHH E;  4K0K E;  4JV5 E;  3ADI A;  2L3J A;  2DMY A;  3J80 C;  2LUP B;  2L8T A;  1WHN A;  2B9D A;  2VE7 C;  4JI2 E;  2NUG A;  4JI0 E;  2L2K B;  4BCA A;  5DNY A;  2UXC E;  2LTS A;  4OOG C;  4GKK E;  3FIG A;  2UUA E;  1HNZ E;  2V88 A;  2VQF E;  2KON A;  2ODR D;  1UHZ A;  4BS9 A;  3VYY A;  1I94 E;  1RQ0 A;  2LTR A;  4WYQ B;  2CPN A;  5IT9 C;  4DKK A;  3J81 C;  1J5E E;  4LF6 E;  1RC7 A;  2B7T A;  2UU9 E;  2JOX A;  4DMI A;  4B3R E;  4JI4 E;  2FTX B;  2LUQ A;  4F9B B;  2ODR C;  2H36 X;  4L5N C;  4DV6 E;  4LF9 E;  4KHP E;  2E5L E;  4GKJ E;  1DI2 A;  4BC9 A;  3F6H A;  4DR6 E;  4LFB E;  1T4O A;  4DR5 E;  3HPS A;  3J7Y p;  1WHQ A;  4B3T E;  2YT4 A;  2MC5 A;  3IWC A;  4L8N A;  2G7H A;  2JY9 A;  4DV4 E;  4X64 E;  3JAM C;  4AQY E;  4I8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...