3JU0A

Structure of the arm-type binding domain of hai7 integrase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
SLTDSKVKNAKSLEKEYKLTDGFGMHLLVHPNGSKYWRLSYRFEKKQRLLALGVYPAVSLADARQRRDEAKKLLAAGIDPSAKKQADNKTIQEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
molecule keywords Phage integrase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13356 Arm-DNA-bind_3 Arm DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3ju0A00
3JU0A 3JTZA 3RMPA
chains in the Genus database with same CATH superfamily
4F6MA 2EOJA 1IBLE 4R2RA 1PKPA 2EN6A 2VF1A 1XMOE 2V89A 2DLKA 2DGCA 2EOZA 1A1JA 4LF6E 4R2SA 1WXRA 1F2IG 4P7DA 1YYOA 4DR7E 1RC7A 4WPYA 5AC5A 5LL6R 3EPJA 4DR1E 1PJQA 1A1FA 2KONA 2E5LE 2F8BA 4ZYEA 2L33A 2FGGA 2LE2A 3C4TA 5BR8E 4IJDA 5A6JA 4BHCA 2B3TB 2YZTA 3JTZA 2EPRA 4F6NA 2WBSA 2E72A 1L4SA 3BIDA 4WFTA 4BHBA 2JWOA 2LTSA 2EL6A 1SR9A 3HTXA 3LMLA 2EM2A 4GEQB 2D9HA 3HPSA 2E1MA 1I94E 2EM5A 2I9IA 3J7Yp 1TF6A 2UXCE 3HXLA 4WSPA 4DR3E 4OX9E 4NXME 4F54A 2EPNA 3LLHA 3KZYA 2EPZA 2YRKA 4BC7A 2ODRC 1NEIA 3M99B 3VYYA 3J80C 5KL5A 4LFAE 5LMUE 4Q28A 1KJKA 2EN1A 4KZSA 4R2AA 1ZBTA 4ZYGA 2EM6A 5LLQA 3QG5C 1B69A 2EZ6A 2DB2A 1IMUA 2V87A 1X47A 3OTOE 2NUEA 4TUIA 2EORA 2G7HA 4DKKA 3EPKA 1T4LB 2YTDA 3AV0A 4WXDA 1X48A 2EPOA 2VRDA 2LBSB 4R2QA 2EPXA 4LU9A 4M0VA 2EOIA 3BGHA 4MLVA 4L5NC 4R03A 2M7QA 2RTXA 3HPZA 5LMNE 2RS6A 2YRHA 5A2QC 2V83A 2FTXB 1YZ9A 1DI2A 4LF4E 1N34E 5AASA 4JI5E 4B3SE 1UILA 4JI2E 2LJUA 1DQ3A 5CFFE 5A6BA 2M9AA 2EM8A 2JXPA 1JK2A 4X66E 2MC5A 3EPLA 4LF7E 4YY3E 2DLQA 1A1KA 3C4BA 2EMWA 4R2PA 2HC5A 2CPNA 4JI8E 1RMDA 1QNTA 2EMIA 4DV6E 3MSWA 2EL4A 2EOHA 1YSAC 2YTQA 4O4KA 2YSPA 2RSIA 1XNQE 2LUQA 3IWBA 2MKDA 2B9DA 2YTGA 2WBUA 1MEYC 2DSYA 3P1XA 2R1FA 4DUZE 2L2KB 1AH5A 1FKAE 1UBDC 2EQ1A 2EE8A 1UHZA 2CT1A 2EJ4A 2EOYA 4B3RE 4O24A 4DUYE 1GTKA 2UXBE 1TF3A 2EN4A 2JOBA 4JI0E 1X49A 1A1IA 4DMIA 4B3TE 1IBME 5A6AA 1J26A 3EPHA 4LF5E 2J7JA 1WHQA 2NUFA 3C6KA 5A69A 4HTGA 2HJJA 5KL7A 4LF8E 1WJPA 2K7IA 4GZNC 2I13A 4JI4E 1X5WA 2JPAA 2JOXA 2N3HA 4DR6E 5KL6A 1IQSA 4F2JC 5AE1A 2ELZA 4M2ZA 2EN2A 3KZZA 3AUZA 3C6MA 2EMFA 2GPIA 1G2FC 2DIXA 3J7AG 3ADLA 2EMLA 1N36E 3H09A 4RHBB 2EMYA 2EWLA 4R2DA 4LTYA 4O5GA 3HQ1A 1LLMC 2L2NA 3ADGA 3UK3C 4BCAA 2EOOA 4JV5E 4ZYHA 2DMIA 2EN7A 2EM0A 2YTFA 3ADIA 1FJGE 2H36X 1EH6A 2EPMX 5ADZA 4X64E 1XMQE 1ZU1A 4DR4E 2LRSA 2MDGA 2JY9A 4F9BB 2RS7A 4WYQB 1Z1BA 2EPPA 1YYWA 2R76A 4DV0E 3VHTB 2LVHA 2YU5A 4F9AB 2MC6A 2MKNA 2YPNA 3DJWA 4GKJE 1P47A 2RQLA 5A6BD 2V8QB 4KHPE 2YTNA 1YFHA 2EMCA 4DV2E 1EH7A 1XNRE 2A25A 1PDAA 2LJHA 2YTJA 2Q8UA 2FV4B 2EMZA 2EN3A 4HEIA 4NHRA 2IHR1 4RH8A 2K4VA 2LTRA 3T1YE 2F4VE 2EM7A 1J5EE 4DR5E 4K0KE 1IQOA 3THNA 2VQEE 2EOMA 3MHHC 4Q35B 2EMAA 5IV8B 1TN9A 4L8NA 2N3GA 2UUAE 3RMPA 4X65E 2NUGA 2V86A 5AC4A 2EPKX 4R2CA 4BBYA 2V88A 2EN8A 5IT9C 5KL2A 2JR1A 1A1GA 5KL4A 2ENHA 4F9CB 5DNYA 1DGCA 2LT7A 3KWRA 1EKZA 1ZAAC 2YTEA 4NXNE 1ZBQA 3THOB 2ELYA 5IWAE 2VQFE 4DV4E 4O43A 1X3CA 2EM9A 2LO3A 1QU6A 4WXCA 3BBGA 4J8ZA 5FLXC 2RPCA 2YTIA 4M30A 2YWQA 4OOGC 5AE3A 4AQYE 5TSEA 5F3WA 1A1HA 2EMGA 1G2DC 1T4OA 1BBOA 1EH8A 4LFBE 1BB8A 2EL5A 2YTPA 2ZM6E 4P78A 2EMHA 2GHFA 4X9JA 2B7TA 2CTDA 1YYKA 4DV3E 2M1SA 2EMBA 2UUCE 2EOXA 2EPAA 3ECRA 4BC9A 2LMZA 3IWCA 2EMKA 3EQ1A 2CSHA 3K6QA 2GLIA 2JP9A 5IXMB 1STUA 4X62E 4N4RB 3ZOQB 2JVAA 1WHNA 2B7VA 2YU8A 3VYXA 4LF9E 3TQMA 1HR0E 2DMYA 3OMLA 1T39A 1X6EA 4DV5E 2DRPA 4I8OA 2KOUA 4YHHE 2L3JA 3MHSC 4JI1E 4JI6E 2LV2A 2EP3A 2RSMA 2HGHA 4FK5C 5T6JA 2MDRA 2PRTA 2EOEA 4JI3E 2EQ3A 4TUGA 1GZ6A 4IS1C 4BS9A 1T4NA 1X6HA 2L3CA 4DR2E 4B3ME 2EPUA 5A6KA 1NCSA 4LFCE 4NZVA 1X6FA 4JI7E 2EPCA 2EOSA 3BF2A 4BMJA 1SFEA 2LUPB 3L00A 2BB8A 2YT4A 2EM4A 1N32E 2L6MA 1UN6B 3F6GA 4WX9A 5AE2A 3J81C 1AAYA 3IWDA 1YUJA 2UU9E 4ZYDA 2L2MA 3VK6A 2N8XA 2EM3A 4WSGA 2YRMA 4MLQA 1GQEA 2UUBE 1YUIA 1IBKE 2ENAA 2YTOA 1HNZE 1A1LA 1JK1A 1PJSA 2V85A 1BBGA 3FIGA 2L92A 2ODRD 2HHHE 2EMXA 2EPLX 1YPNA 2WZOA 4R8OA 1T38A 1O0WA 3F6HA 2ADRA 1WRJA 3DF6A 4M9VC 3ADJA 2M4IA 4DV7E 1RQ0A 2BBGA 2NA2A 4GKKE 2L8TA 4JYAE 1KYQA 1MGTA 4DV1E 1HNWE 3T1HE 1ZR9A 3JU0A 2LCEA 4KWYA 4X8WA 2NABA 2WCC3 2EQ0A 2WBTA 1N33E 2ENCA 2JYAA 2YSOA 5KL3A 1HNXE 2VE7C 2KHXA 3JAMC 4R2EA 1N3GA 2EOFA 2EOQA 2UXDE 1PJTA
chains in the Genus database with same CATH topology
4B3SE 1UILA 4DV0E 4F9AB 1HR0E 1IBLE 2DMYA 2MC6A 4JI2E 3DJWA 1DQ3A 1PKPA 3OMLA 5CFFE 4GKJE 4DV5E 2V8QB 2VF1A 4I8OA 1XMOE 2KOUA 2V89A 4KHPE 4X66E 4YHHE 2MC5A 4LF7E 4YY3E 4DV2E 2L3JA 4JI1E 1XNRE 4JI6E 3C4BA 2RSMA 2LJHA 2CPNA 4LF6E 4JI8E 1WXRA 4P7DA 5T6JA 1YYOA 2MDRA 4DR7E 1RC7A 2FV4B 4WPYA 5LL6R 4DV6E 3MSWA 2IHR1 4DR1E 4JI3E 4TUGA 1GZ6A 2K4VA 2KONA 2LTRA 3T1YE 4BS9A 1T4NA 2L3CA 2F8BA 4DR2E 2E5LE 4B3ME 2F4VE 1J5EE 2L33A 4DR5E 4K0KE 4LFCE 2FGGA 2LE2A 2VQEE 1XNQE 2LUQA 3C4TA 3IWBA 5BR8E 2B3TB 2YZTA 3JTZA 2B9DA 4L8NA 2N3GA 2DSYA 2UUAE 3P1XA 4JI7E 3RMPA 4DUZE 4WFTA 2L2KB 4X65E 1FKAE 4BMJA 2LUPB 2JWOA 2LTSA 2NUGA 2V86A 2YT4A 1N32E 1UHZA 2L6MA 3F6GA 5AE2A 3J81C 4BBYA 2V88A 3IWDA 1SR9A 3HTXA 5IT9C 2UU9E 4B3RE 4DUYE 2L2MA 3LMLA 2JR1A 2UXBE 3VK6A 4GEQB 3HPSA 2E1MA 4F9CB 5DNYA 2JOBA 3KWRA 1I94E 1X49A 1EKZA 4JI0E 4NXNE 1ZBQA 4DMIA 4B3TE 1GQEA 1IBME 2UUBE 3J7Yp 2UXCE 1J26A 3HXLA 5IWAE 2VQFE 4LF5E 4WSPA 1WHQA 4DR3E 1IBKE 4OX9E 2NUFA 4F54A 3LLHA 1HNZE 4NXME 4DV4E 4LF8E 4BC7A 4JI4E 2V85A 2ODRC 2JOXA 3FIGA 2L92A 2ODRD 1QU6A 3VYYA 3J80C 2N3HA 2HHHE 4LFAE 4DR6E 5LMUE 4J8ZA 5FLXC 4Q28A 2WZOA 4M30A 4R8OA 5AE1A 1O0WA 3F6HA 4KZSA 4OOGC 5AE3A 4AQYE 5F3WA 4M2ZA 1ZBTA 3DF6A 2EZ6A 2DB2A 3ADJA 2M4IA 1T4OA 3AUZA 2V87A 4DV7E 1RQ0A 4LFBE 1X47A 2DIXA 3J7AG 3OTOE 2NUEA 2ZM6E 2NA2A 4P78A 4TUIA 1N36E 3ADLA 2G7HA 3H09A 4DKKA 2EWLA 4GKKE 1T4LB 4LTYA 3AV0A 2L8TA 2B7TA 3HQ1A 1X48A 4JYAE 1YYKA 4DV3E 2L2NA 4DV1E 2M1SA 3ADGA 2UUCE 4BCAA 2LBSB 4JI5E 1HNWE 4JV5E 4BC9A 3T1HE 2LMZA 3JU0A 4LU9A 4M0VA 3IWCA 1FJGE 4X8WA 3ADIA 2H36X 3K6QA 4L5NC 1N33E 4R03A 5ADZA 2RTXA 2M7QA 4X64E 1XMQE 1STUA 3HPZA 5LMNE 2RS6A 2VE7C 2KHXA 3JAMC 2LRSA 4X62E 5A2QC 1HNXE 2JVAA 3ZOQB 2JY9A 4F9BB 4DR4E 2V83A 1WHNA 2FTXB 1YZ9A 2B7VA 2RS7A 4LF4E 1DI2A 1N34E 4LF9E 3VYXA 2UXDE 4WYQB 5AASA 1YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JU0 A;  3JTZ A;  3RMP A; 
#chains in the Genus database with same CATH topology
 4F6M A;  2EOJ A;  1IBL E;  4R2R A;  1PKP A;  2EN6 A;  2VF1 A;  1XMO E;  2V89 A;  2DLK A;  2DGC A;  2EOZ A;  1A1J A;  4LF6 E;  4R2S A;  1WXR A;  1F2I G;  4P7D A;  1YYO A;  4DR7 E;  1RC7 A;  4WPY A;  5AC5 A;  5LL6 R;  3EPJ A;  4DR1 E;  1PJQ A;  1A1F A;  2KON A;  2E5L E;  2F8B A;  4ZYE A;  2L33 A;  2FGG A;  2LE2 A;  3C4T A;  5BR8 E;  4IJD A;  5A6J A;  4BHC A;  2B3T B;  2YZT A;  3JTZ A;  2EPR A;  4F6N A;  2WBS A;  2E72 A;  1L4S A;  3BID A;  4WFT A;  4BHB A;  2JWO A;  2LTS A;  2EL6 A;  1SR9 A;  3HTX A;  3LML A;  2EM2 A;  4GEQ B;  2D9H A;  3HPS A;  2E1M A;  1I94 E;  2EM5 A;  2I9I A;  3J7Y p;  1TF6 A;  2UXC E;  3HXL A;  4WSP A;  4DR3 E;  4OX9 E;  4NXM E;  4F54 A;  2EPN A;  3LLH A;  3KZY A;  2EPZ A;  2YRK A;  4BC7 A;  2ODR C;  1NEI A;  3M99 B;  3VYY A;  3J80 C;  5KL5 A;  4LFA E;  5LMU E;  4Q28 A;  1KJK A;  2EN1 A;  4KZS A;  4R2A A;  1ZBT A;  4ZYG A;  2EM6 A;  5LLQ A;  3QG5 C;  1B69 A;  2EZ6 A;  2DB2 A;  1IMU A;  2V87 A;  1X47 A;  3OTO E;  2NUE A;  4TUI A;  2EOR A;  2G7H A;  4DKK A;  3EPK A;  1T4L B;  2YTD A;  3AV0 A;  4WXD A;  1X48 A;  2EPO A;  2VRD A;  2LBS B;  4R2Q A;  2EPX A;  4LU9 A;  4M0V A;  2EOI A;  3BGH A;  4MLV A;  4L5N C;  4R03 A;  2M7Q A;  2RTX A;  3HPZ A;  5LMN E;  2RS6 A;  2YRH A;  5A2Q C;  2V83 A;  2FTX B;  1YZ9 A;  1DI2 A;  4LF4 E;  1N34 E;  5AAS A;  4JI5 E;  4B3S E;  1UIL A;  4JI2 E;  2LJU A;  1DQ3 A;  5CFF E;  5A6B A;  2M9A A;  2EM8 A;  2JXP A;  1JK2 A;  4X66 E;  2MC5 A;  3EPL A;  4LF7 E;  4YY3 E;  2DLQ A;  1A1K A;  3C4B A;  2EMW A;  4R2P A;  2HC5 A;  2CPN A;  4JI8 E;  1RMD A;  1QNT A;  2EMI A;  4DV6 E;  3MSW A;  2EL4 A;  2EOH A;  1YSA C;  2YTQ A;  4O4K A;  2YSP A;  2RSI A;  1XNQ E;  2LUQ A;  3IWB A;  2MKD A;  2B9D A;  2YTG A;  2WBU A;  1MEY C;  2DSY A;  3P1X A;  2R1F A;  4DUZ E;  2L2K B;  1AH5 A;  1FKA E;  1UBD C;  2EQ1 A;  2EE8 A;  1UHZ A;  2CT1 A;  2EJ4 A;  2EOY A;  4B3R E;  4O24 A;  4DUY E;  1GTK A;  2UXB E;  1TF3 A;  2EN4 A;  2JOB A;  4JI0 E;  1X49 A;  1A1I A;  4DMI A;  4B3T E;  1IBM E;  5A6A A;  1J26 A;  3EPH A;  4LF5 E;  2J7J A;  1WHQ A;  2NUF A;  3C6K A;  5A69 A;  4HTG A;  2HJJ A;  5KL7 A;  4LF8 E;  1WJP A;  2K7I A;  4GZN C;  2I13 A;  4JI4 E;  1X5W A;  2JPA A;  2JOX A;  2N3H A;  4DR6 E;  5KL6 A;  1IQS A;  4F2J C;  5AE1 A;  2ELZ A;  4M2Z A;  2EN2 A;  3KZZ A;  3AUZ A;  3C6M A;  2EMF A;  2GPI A;  1G2F C;  2DIX A;  3J7A G;  3ADL A;  2EML A;  1N36 E;  3H09 A;  4RHB B;  2EMY A;  2EWL A;  4R2D A;  4LTY A;  4O5G A;  3HQ1 A;  1LLM C;  2L2N A;  3ADG A;  3UK3 C;  4BCA A;  2EOO A;  4JV5 E;  4ZYH A;  2DMI A;  2EN7 A;  2EM0 A;  2YTF A;  3ADI A;  1FJG E;  2H36 X;  1EH6 A;  2EPM X;  5ADZ A;  4X64 E;  1XMQ E;  1ZU1 A;  4DR4 E;  2LRS A;  2MDG A;  2JY9 A;  4F9B B;  2RS7 A;  4WYQ B;  1Z1B A;  2EPP A;  1YYW A;  2R76 A;  4DV0 E;  3VHT B;  2LVH A;  2YU5 A;  4F9A B;  2MC6 A;  2MKN A;  2YPN A;  3DJW A;  4GKJ E;  1P47 A;  2RQL A;  5A6B D;  2V8Q B;  4KHP E;  2YTN A;  1YFH A;  2EMC A;  4DV2 E;  1EH7 A;  1XNR E;  2A25 A;  1PDA A;  2LJH A;  2YTJ A;  2Q8U A;  2FV4 B;  2EMZ A;  2EN3 A;  4HEI A;  4NHR A;  2IHR 1;  4RH8 A;  2K4V A;  2LTR A;  3T1Y E;  2F4V E;  2EM7 A;  1J5E E;  4DR5 E;  4K0K E;  1IQO A;  3THN A;  2VQE E;  2EOM A;  3MHH C;  4Q35 B;  2EMA A;  5IV8 B;  1TN9 A;  4L8N A;  2N3G A;  2UUA E;  3RMP A;  4X65 E;  2NUG A;  2V86 A;  5AC4 A;  2EPK X;  4R2C A;  4BBY A;  2V88 A;  2EN8 A;  5IT9 C;  5KL2 A;  2JR1 A;  1A1G A;  5KL4 A;  2ENH A;  4F9C B;  5DNY A;  1DGC A;  2LT7 A;  3KWR A;  1EKZ A;  1ZAA C;  2YTE A;  4NXN E;  1ZBQ A;  3THO B;  2ELY A;  5IWA E;  2VQF E;  4DV4 E;  4O43 A;  1X3C A;  2EM9 A;  2LO3 A;  1QU6 A;  4WXC A;  3BBG A;  4J8Z A;  5FLX C;  2RPC A;  2YTI A;  4M30 A;  2YWQ A;  4OOG C;  5AE3 A;  4AQY E;  5TSE A;  5F3W A;  1A1H A;  2EMG A;  1G2D C;  1T4O A;  1BBO A;  1EH8 A;  4LFB E;  1BB8 A;  2EL5 A;  2YTP A;  2ZM6 E;  4P78 A;  2EMH A;  2GHF A;  4X9J A;  2B7T A;  2CTD A;  1YYK A;  4DV3 E;  2M1S A;  2EMB A;  2UUC E;  2EOX A;  2EPA A;  3ECR A;  4BC9 A;  2LMZ A;  3IWC A;  2EMK A;  3EQ1 A;  2CSH A;  3K6Q A;  2GLI A;  2JP9 A;  5IXM B;  1STU A;  4X62 E;  4N4R B;  3ZOQ B;  2JVA A;  1WHN A;  2B7V A;  2YU8 A;  3VYX A;  4LF9 E;  3TQM A;  1HR0 E;  2DMY A;  3OML A;  1T39 A;  1X6E A;  4DV5 E;  2DRP A;  4I8O A;  2KOU A;  4YHH E;  2L3J A;  3MHS C;  4JI1 E;  4JI6 E;  2LV2 A;  2EP3 A;  2RSM A;  2HGH A;  4FK5 C;  5T6J A;  2MDR A;  2PRT A;  2EOE A;  4JI3 E;  2EQ3 A;  4TUG A;  1GZ6 A;  4IS1 C;  4BS9 A;  1T4N A;  1X6H A;  2L3C A;  4DR2 E;  4B3M E;  2EPU A;  5A6K A;  1NCS A;  4LFC E;  4NZV A;  1X6F A;  4JI7 E;  2EPC A;  2EOS A;  3BF2 A;  4BMJ A;  1SFE A;  2LUP B;  3L00 A;  2BB8 A;  2YT4 A;  2EM4 A;  1N32 E;  2L6M A;  1UN6 B;  3F6G A;  4WX9 A;  5AE2 A;  3J81 C;  1AAY A;  3IWD A;  1YUJ A;  2UU9 E;  4ZYD A;  2L2M A;  3VK6 A;  2N8X A;  2EM3 A;  4WSG A;  2YRM A;  4MLQ A;  1GQE A;  2UUB E;  1YUI A;  1IBK E;  2ENA A;  2YTO A;  1HNZ E;  1A1L A;  1JK1 A;  1PJS A;  2V85 A;  1BBG A;  3FIG A;  2L92 A;  2ODR D;  2HHH E;  2EMX A;  2EPL X;  1YPN A;  2WZO A;  4R8O A;  1T38 A;  1O0W A;  3F6H A;  2ADR A;  1WRJ A;  3DF6 A;  4M9V C;  3ADJ A;  2M4I A;  4DV7 E;  1RQ0 A;  2BBG A;  2NA2 A;  4GKK E;  2L8T A;  4JYA E;  1KYQ A;  1MGT A;  4DV1 E;  1HNW E;  3T1H E;  1ZR9 A;  3JU0 A;  2LCE A;  4KWY A;  4X8W A;  2NAB A;  2WCC 3;  2EQ0 A;  2WBT A;  1N33 E;  2ENC A;  2JYA A;  2YSO A;  5KL3 A;  1HNX E;  2VE7 C;  2KHX A;  3JAM C;  4R2E A;  1N3G A;  2EOF A;  2EOQ A;  2UXD E;  1PJT A; 
#chains in the Genus database with same CATH homology
 4B3S E;  1UIL A;  4DV0 E;  4F9A B;  1HR0 E;  1IBL E;  2DMY A;  2MC6 A;  4JI2 E;  3DJW A;  1DQ3 A;  1PKP A;  3OML A;  5CFF E;  4GKJ E;  4DV5 E;  2V8Q B;  2VF1 A;  4I8O A;  1XMO E;  2KOU A;  2V89 A;  4KHP E;  4X66 E;  4YHH E;  2MC5 A;  4LF7 E;  4YY3 E;  4DV2 E;  2L3J A;  4JI1 E;  1XNR E;  4JI6 E;  3C4B A;  2RSM A;  2LJH A;  2CPN A;  4LF6 E;  4JI8 E;  1WXR A;  4P7D A;  5T6J A;  1YYO A;  2MDR A;  4DR7 E;  1RC7 A;  2FV4 B;  4WPY A;  5LL6 R;  4DV6 E;  3MSW A;  2IHR 1;  4DR1 E;  4JI3 E;  4TUG A;  1GZ6 A;  2K4V A;  2KON A;  2LTR A;  3T1Y E;  4BS9 A;  1T4N A;  2L3C A;  2F8B A;  4DR2 E;  2E5L E;  4B3M E;  2F4V E;  1J5E E;  2L33 A;  4DR5 E;  4K0K E;  4LFC E;  2FGG A;  2LE2 A;  2VQE E;  1XNQ E;  2LUQ A;  3C4T A;  3IWB A;  5BR8 E;  2B3T B;  2YZT A;  3JTZ A;  2B9D A;  4L8N A;  2N3G A;  2DSY A;  2UUA E;  3P1X A;  4JI7 E;  3RMP A;  4DUZ E;  4WFT A;  2L2K B;  4X65 E;  1FKA E;  4BMJ A;  2LUP B;  2JWO A;  2LTS A;  2NUG A;  2V86 A;  2YT4 A;  1N32 E;  1UHZ A;  2L6M A;  3F6G A;  5AE2 A;  3J81 C;  4BBY A;  2V88 A;  3IWD A;  1SR9 A;  3HTX A;  5IT9 C;  2UU9 E;  4B3R E;  4DUY E;  2L2M A;  3LML A;  2JR1 A;  2UXB E;  3VK6 A;  4GEQ B;  3HPS A;  2E1M A;  4F9C B;  5DNY A;  2JOB A;  3KWR A;  1I94 E;  1X49 A;  1EKZ A;  4JI0 E;  4NXN E;  1ZBQ A;  4DMI A;  4B3T E;  1GQE A;  1IBM E;  2UUB E;  3J7Y p;  2UXC E;  1J26 A;  3HXL A;  5IWA E;  2VQF E;  4LF5 E;  4WSP A;  1WHQ A;  4DR3 E;  1IBK E;  4OX9 E;  2NUF A;  4F54 A;  3LLH A;  1HNZ E;  4NXM E;  4DV4 E;  4LF8 E;  4BC7 A;  4JI4 E;  2V85 A;  2ODR C;  2JOX A;  3FIG A;  2L92 A;  2ODR D;  1QU6 A;  3VYY A;  3J80 C;  2N3H A;  2HHH E;  4LFA E;  4DR6 E;  5LMU E;  4J8Z A;  5FLX C;  4Q28 A;  2WZO A;  4M30 A;  4R8O A;  5AE1 A;  1O0W A;  3F6H A;  4KZS A;  4OOG C;  5AE3 A;  4AQY E;  5F3W A;  4M2Z A;  1ZBT A;  3DF6 A;  2EZ6 A;  2DB2 A;  3ADJ A;  2M4I A;  1T4O A;  3AUZ A;  2V87 A;  4DV7 E;  1RQ0 A;  4LFB E;  1X47 A;  2DIX A;  3J7A G;  3OTO E;  2NUE A;  2ZM6 E;  2NA2 A;  4P78 A;  4TUI A;  1N36 E;  3ADL A;  2G7H A;  3H09 A;  4DKK A;  2EWL A;  4GKK E;  1T4L B;  4LTY A;  3AV0 A;  2L8T A;  2B7T A;  3HQ1 A;  1X48 A;  4JYA E;  1YYK A;  4DV3 E;  2L2N A;  4DV1 E;  2M1S A;  3ADG A;  2UUC E;  4BCA A;  2LBS B;  4JI5 E;  1HNW E;  4JV5 E;  4BC9 A;  3T1H E;  2LMZ A;  3JU0 A;  4LU9 A;  4M0V A;  3IWC A;  1FJG E;  4X8W A;  3ADI A;  2H36 X;  3K6Q A;  4L5N C;  1N33 E;  4R03 A;  5ADZ A;  2RTX A;  2M7Q A;  4X64 E;  1XMQ E;  1STU A;  3HPZ A;  5LMN E;  2RS6 A;  2VE7 C;  2KHX A;  3JAM C;  2LRS A;  4X62 E;  5A2Q C;  1HNX E;  2JVA A;  3ZOQ B;  2JY9 A;  4F9B B;  4DR4 E;  2V83 A;  1WHN A;  2FTX B;  1YZ9 A;  2B7V A;  2RS7 A;  4LF4 E;  1DI2 A;  1N34 E;  4LF9 E;  3VYX A;  2UXD E;  4WYQ B;  5AAS A;  1YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...