3JU0A

Structure of the arm-type binding domain of hai7 integrase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
SLTDSKVKNAKSLEKEYKLTDGFGMHLLVHPNGSKYWRLSYRFEKKQRLLALGVYPAVSLADARQRRDEAKKLLAAGIDPSAKKQADNKTIQEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phage integrase
publication title Structures of the arm-type binding domains of HPI and HAI7 integrases
pubmed doi rcsb
source organism Pectobacterium atrosepticum
molecule tags Dna binding protein
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13356 Arm-DNA-bind_3 Arm DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.390 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3ju0A00
3JTZA 3RMPA 3JU0A
chains in the Genus database with same CATH superfamily
2CT1A 4R2PA 2YTEA 2VQFE 2KOUA 2E5LE 4L8NA 1IBKE 2V86A 1EKZA 3EPKA 2GHFA 3AUZA 3MSWA 1YYKA 2YTGA 4R8OA 4ZYGA 4LFAE 2V88A 1I94E 2EN2A 2JP9A 4WSPA 2K4VA 2FGGA 2EM4A 2JXPA 1G2FC 1ZBQA 2ENHA 2EPMX 2UUBE 2UXBE 5A69A 2EM3A 4LF7E 1WHNA 2EM5A 2LMZA 2GPIA 4DV0E 2EOSA 2RQLA 3KWRA 4Q28A 2EOZA 2EM7A 4DR5E 2B7TA 2YTIA 1N36E 2IHR1 2M1SA 2EMIA 4BC7A 2EMBA 3LMLA 2YTDA 4OX9E 4LFBE 2DLQA 2YRMA 2N3GA 2L6MA 4JYAE 2R1FA 4YY3E 4DV3E 5IT9C 4F9CB 4M9VC 1AAYA 4MLQA 1DQ3A 1XMOE 1HNXE 1A1FA 4X9JA 4X65E 4NXNE 4WSGA 4IJDA 3ADIA 2V85A 3UK3C 4DV6E 2UXDE 3EQ1A 2EZ6A 3VHTB 2LCEA 4RHBB 2EMKA 5A2QC 1EH7A 4R2EA 2JR1A 2EMXA 2V8QB 2YTJA 4WXCA 1N32E 3HPZA 3DJWA 3T1YE 1ZAAC 2EOOA 2EQ3A 2CPNA 3F6HA 2CTDA 1MGTA 4JI7E 1BBOA 1GZ6A 2EOQA 2EN1A 1X48A 1A1JA 1YUJA 4R2RA 5AE3A 4KZSA 1DI2A 2ADRA 4J8ZA 2EOMA 1A1LA 3C4TA 4LF9E 3J7Yp 5KL7A 4ZYDA 4GKKE 4JV5E 2EPKX 5A6JA 2BBGA 2RSMA 2VF1A 1P47A 1UN6B 2JYAA 2ENCA 2WBUA 4DUZE 1DGCA 4DKKA 1IQOA 4B3TE 3MHHC 4GEQB 4B3SE 4K0KE 2RTXA 3AV0A 2VQEE 2RS6A 2ZM6E 5KL4A 3JAMC 5F3WA 4WPYA 4YHHE 2HGHA 1X49A 2D9HA 2R76A 2MDGA 2UU9E 1PDAA 2JOXA 3EPHA 1YSAC 1JK2A 4O4KA 2MKNA 3P1XA 2B3TB 1X6FA 2HJJA 4WYQB 4AQYE 2HHHE 3JTZA 5AASA 3T1HE 1EH6A 2LJHA 5LMUE 3IWCA 2EMZA 1WHQA 1SFEA 3BF2A 1RMDA 1F2IG 2M9AA 2L2KB 2EN8A 1RC7A 2F4VE 5AC4A 4HTGA 2BB8A 2EPZA 2B9DA 2EQ0A 2LE2A 2EN7A 2JY9A 2M7QA 5IWAE 2EPAA 2B7VA 1JK1A 4BBYA 1EH8A 1WJPA 1YYWA 2EPLX 2EPRA 4FK5C 3OTOE 4JI0E 3VYXA 2J7JA 2JVAA 2UUCE 1X5WA 2YRHA 3THNA 4GZNC 4KHPE 2EM9A 1AH5A 3VYYA 2ODRC 5KL3A 2LV2A 2DIXA 1XMQE 5KL5A 2EMHA 2NUFA 2YWQA 4R2SA 1G2DC 2DLKA 2Q8UA 2YU8A 4F2JC 2YU5A 2EM6A 4DV5E 3HQ1A 2YTPA 1T38A 2HC5A 3FIGA 2F8BA 4DV1E 1IMUA 2NABA 3QG5C 4X8WA 4R03A 1A1KA 3BIDA 2L3JA 1X47A 1A1HA 2YSPA 2EOYA 4M0VA 2YZTA 2V83A 1T39A 1A1IA 3IWDA 1IBLE 3HPSA 1LLMC 4BMJA 1N33E 2ODRD 4NZVA 1STUA 4JI2E 1IQSA 4JI1E 2YT4A 1B69A 3HXLA 5AC5A 3ZOQB 1O0WA 3KZYA 3ADLA 3DF6A 5KL2A 2DRPA 2UUAE 1SR9A 1PJSA 1ZU1A 1FJGE 4JI4E 2EOHA 1FKAE 2EE8A 2N3HA 2EJ4A 4NXME 4X66E 5FLXC 3HTXA 4N4RB 2ELYA 4TUGA 4O43A 4JI6E 2EOJA 5CFFE 2DMYA 3EPJA 2L8TA 2N8XA 3RMPA 1UBDC 1PJTA 4ZYEA 3C6KA 4DV7E 1HNWE 5A6BD 3J80C 3ADJA 2LO3A 4JI3E 4M2ZA 4IS1C 5IXMB 4MLVA 5BR8E 2WBTA 4Q35B 2VRDA 5LMNE 2MC6A 4BHCA 4DR1E 1A1GA 4LU9A 1YZ9A 1T4LB 2I13A 4DV4E 3ADGA 3C6MA 2DGCA 4DV2E 2A25A 2EORA 2RSIA 1UILA 2EPPA 4RH8A 2YRKA 2JPAA 4L5NC 2L2NA 3ECRA 1QU6A 2LRSA 3KZZA 2EWLA 4X64E 1Z1BA 2DSYA 2EOXA 2EMAA 1X6HA 2EPNA 3F6GA 4WX9A 2WBSA 3K6QA 2EN3A 1ZBTA 1NEIA 4HEIA 4LF5E 1GQEA 2LT7A 1BBGA 4P7DA 2EN4A 4LF6E 1X3CA 3BBGA 1PKPA 4BHBA 1XNQE 4WXDA 2M4IA 5A6AA 2LUPB 3IWBA 2G7HA 2RPCA 2EM0A 2FV4B 4M30A 4ZYHA 1T4NA 4DMIA 2L33A 1YFHA 2RS7A 2LUQA 5KL6A 3THOB 2JOBA 4NHRA 2LTSA 5AE1A 2YTFA 2E1MA 3H09A 5DNYA 1RQ0A 2EMFA 4F6MA 2V89A 3EPLA 3BGHA 1TF3A 4LF8E 4O24A 5IV8B 4X62E 2V87A 2LJUA 2EP3A 5LL6R 1J26A 2YPNA 2MDRA 2WCC3 4JI8E 4DUYE 3J81C 1X6EA 4DR7E 2ELZA 2VE7C 1YYOA 1T4OA 1N3GA 5A6KA 2L3CA 2EL5A 2JWOA 1NCSA 5TSEA 4R2AA 2PRTA 5A6BA 1HNZE 2YTOA 2H36X 2NA2A 1BB8A 2MC5A 2DB2A 2EOFA 2LTRA 2WZOA 4DR2E 4B3RE 4R2QA 2EN6A 2EMWA 1YUIA 2EL4A 2L92A 2EPUA 1IBME 2NUEA 3J7AG 2MKDA 1UHZA 2YTNA 2EM2A 1KJKA 4DR6E 2L2MA 2DMIA 1GTKA 5LLQA 4BCAA 5AE2A 4LF4E 2LVHA 1WRJA 1YPNA 1L4SA 4B3ME 4KWYA 1MEYC 4P78A 1KYQA 1TF6A 3C4BA 1J5EE 3LLHA 2EPCA 5ADZA 1WXRA 4WFTA 3L00A 4R2CA 4BS9A 1ZR9A 3TQMA 1XNRE 3MHSC 1HR0E 3OMLA 2UXCE 2EL6A 2I9IA 2EMGA 4F9BB 4F54A 2EQ1A 2K7IA 2YTQA 4F9AB 2FTXB 4I8OA 2NUGA 4DR4E 3JU0A 2EPOA 2EPXA 2EMYA 3VK6A 2LBSB 2EM8A 1N34E 4LTYA 2KONA 2GLIA 3M99B 4O5GA 4BC9A 4R2DA 5T6JA 4GKJE 2EOEA 2CSHA 2EMLA 2ENAA 2KHXA 4F6NA 4DR3E 2E72A 2YSOA 4JI5E 4LFCE 4OOGC 1TN9A 1QNTA 2EOIA 1PJQA 4TUIA 2EMCA
chains in the Genus database with same CATH topology
3FIGA 2LTSA 2F8BA 4DV1E 2VQFE 1X48A 2KOUA 4L8NA 5AE1A 2V86A 1IBKE 2E1MA 2E5LE 4X8WA 5AE3A 3H09A 5DNYA 1RQ0A 1EKZA 4R03A 3AUZA 3MSWA 4KZSA 1YYKA 2V89A 1DI2A 4R8OA 2L3JA 4LF8E 1X47A 4LFAE 4J8ZA 4X62E 2V87A 5LL6R 2V88A 1J26A 1I94E 4M0VA 2YZTA 2MDRA 3C4TA 4JI8E 4DUYE 4LF9E 4WSPA 3J81C 3J7Yp 2K4VA 2V83A 2FGGA 4DR7E 3IWDA 1IBLE 4GKKE 3HPSA 4JV5E 4BMJA 2RSMA 2VE7C 2ODRD 1N33E 1YYOA 2VF1A 1ZBQA 1T4OA 4DUZE 2UUBE 2L3CA 1STUA 2UXBE 2JWOA 4JI2E 4JI1E 1WHNA 2YT4A 4DKKA 1GZ6A 3HXLA 2LMZA 3ZOQB 4LF7E 1O0WA 4B3TE 4GEQB 4B3SE 4DV0E 3ADLA 4K0KE 2RTXA 3DF6A 3AV0A 2VQEE 2RS6A 2ZM6E 2UUAE 3JAMC 1SR9A 5F3WA 4WPYA 1HNZE 2H36X 1FJGE 4YHHE 1FKAE 1X49A 2N3HA 2NA2A 4NXME 4X66E 3KWRA 2MC5A 2UU9E 2DB2A 4Q28A 2JOXA 5FLXC 2LTRA 2WZOA 3HTXA 4DR2E 4B3RE 4TUGA 3P1XA 2B3TB 4DR5E 4JI6E 4WYQB 2HHHE 4AQYE 5CFFE 3JTZA 2DMYA 2L92A 5AASA 2L8TA 2B7TA 2LJHA 3T1HE 1UHZA 1N36E 1IBME 3RMPA 3J7AG 4DR6E 2L2MA 5LMUE 2IHR1 2M1SA 4DV7E 3IWCA 4BC7A 1HNWE 1WHQA 4BCAA 3J80C 5AE2A 3LMLA 4OX9E 4LFBE 4LF4E 3ADJA 2L2KB 2N3GA 2L6MA 1RC7A 4JI3E 4M2ZA 2F4VE 4JYAE 4B3ME 5BR8E 4YY3E 4P78A 5LMNE 2MC6A 4DV3E 3C4BA 4DR1E 1J5EE 3LLHA 4LU9A 1YZ9A 5ADZA 2B9DA 1WXRA 4WFTA 5IT9C 1T4LB 2LE2A 4F9CB 4BS9A 4DV4E 3ADGA 2JY9A 2M7QA 5IWAE 1XNRE 4DV2E 2B7VA 1HR0E 3OMLA 2UXCE 1DQ3A 1XMOE 1UILA 1HNXE 4BBYA 4L5NC 2L2NA 4F9BB 1YYWA 1QU6A 4F54A 2LRSA 4X65E 4NXNE 2NUEA 4F9AB 3OTOE 4JI0E 3ADIA 2FTXB 2EWLA 4X64E 2V85A 4DV6E 2DSYA 3VYXA 3F6GA 4I8OA 2UXDE 2JVAA 2UUCE 2NUGA 4DR4E 3JU0A 3K6QA 1N34E 3VK6A 2LBSB 4LTYA 2KONA 4KHPE 2EZ6A 4BC9A 1ZBTA 5T6JA 4GKJE 4LF5E 5A2QC 1GQEA 2KHXA 3VYYA 2JR1A 2ODRC 4P7DA 4LF6E 2DIXA 2V8QB 1XMQE 4DR3E 1PKPA 4JI5E 2NUFA 1N32E 1XNQE 3HPZA 2M4IA 4LFCE 4OOGC 3DJWA 3T1YE 2LUPB 2CPNA 3IWBA 2G7HA 3F6HA 2FV4B 4M30A 1T4NA 4DMIA 2L33A 4TUIA 2RS7A 4DV5E 2LUQA 3HQ1A 4JI7E 4JI4E 2JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTZ A;  3RMP A;  3JU0 A; 
#chains in the Genus database with same CATH topology
 2CT1 A;  4R2P A;  2YTE A;  2VQF E;  2KOU A;  2E5L E;  4L8N A;  1IBK E;  2V86 A;  1EKZ A;  3EPK A;  2GHF A;  3AUZ A;  3MSW A;  1YYK A;  2YTG A;  4R8O A;  4ZYG A;  4LFA E;  2V88 A;  1I94 E;  2EN2 A;  2JP9 A;  4WSP A;  2K4V A;  2FGG A;  2EM4 A;  2JXP A;  1G2F C;  1ZBQ A;  2ENH A;  2EPM X;  2UUB E;  2UXB E;  5A69 A;  2EM3 A;  4LF7 E;  1WHN A;  2EM5 A;  2LMZ A;  2GPI A;  4DV0 E;  2EOS A;  2RQL A;  3KWR A;  4Q28 A;  2EOZ A;  2EM7 A;  4DR5 E;  2B7T A;  2YTI A;  1N36 E;  2IHR 1;  2M1S A;  2EMI A;  4BC7 A;  2EMB A;  3LML A;  2YTD A;  4OX9 E;  4LFB E;  2DLQ A;  2YRM A;  2N3G A;  2L6M A;  4JYA E;  2R1F A;  4YY3 E;  4DV3 E;  5IT9 C;  4F9C B;  4M9V C;  1AAY A;  4MLQ A;  1DQ3 A;  1XMO E;  1HNX E;  1A1F A;  4X9J A;  4X65 E;  4NXN E;  4WSG A;  4IJD A;  3ADI A;  2V85 A;  3UK3 C;  4DV6 E;  2UXD E;  3EQ1 A;  2EZ6 A;  3VHT B;  2LCE A;  4RHB B;  2EMK A;  5A2Q C;  1EH7 A;  4R2E A;  2JR1 A;  2EMX A;  2V8Q B;  2YTJ A;  4WXC A;  1N32 E;  3HPZ A;  3DJW A;  3T1Y E;  1ZAA C;  2EOO A;  2EQ3 A;  2CPN A;  3F6H A;  2CTD A;  1MGT A;  4JI7 E;  1BBO A;  1GZ6 A;  2EOQ A;  2EN1 A;  1X48 A;  1A1J A;  1YUJ A;  4R2R A;  5AE3 A;  4KZS A;  1DI2 A;  2ADR A;  4J8Z A;  2EOM A;  1A1L A;  3C4T A;  4LF9 E;  3J7Y p;  5KL7 A;  4ZYD A;  4GKK E;  4JV5 E;  2EPK X;  5A6J A;  2BBG A;  2RSM A;  2VF1 A;  1P47 A;  1UN6 B;  2JYA A;  2ENC A;  2WBU A;  4DUZ E;  1DGC A;  4DKK A;  1IQO A;  4B3T E;  3MHH C;  4GEQ B;  4B3S E;  4K0K E;  2RTX A;  3AV0 A;  2VQE E;  2RS6 A;  2ZM6 E;  5KL4 A;  3JAM C;  5F3W A;  4WPY A;  4YHH E;  2HGH A;  1X49 A;  2D9H A;  2R76 A;  2MDG A;  2UU9 E;  1PDA A;  2JOX A;  3EPH A;  1YSA C;  1JK2 A;  4O4K A;  2MKN A;  3P1X A;  2B3T B;  1X6F A;  2HJJ A;  4WYQ B;  4AQY E;  2HHH E;  3JTZ A;  5AAS A;  3T1H E;  1EH6 A;  2LJH A;  5LMU E;  3IWC A;  2EMZ A;  1WHQ A;  1SFE A;  3BF2 A;  1RMD A;  1F2I G;  2M9A A;  2L2K B;  2EN8 A;  1RC7 A;  2F4V E;  5AC4 A;  4HTG A;  2BB8 A;  2EPZ A;  2B9D A;  2EQ0 A;  2LE2 A;  2EN7 A;  2JY9 A;  2M7Q A;  5IWA E;  2EPA A;  2B7V A;  1JK1 A;  4BBY A;  1EH8 A;  1WJP A;  1YYW A;  2EPL X;  2EPR A;  4FK5 C;  3OTO E;  4JI0 E;  3VYX A;  2J7J A;  2JVA A;  2UUC E;  1X5W A;  2YRH A;  3THN A;  4GZN C;  4KHP E;  2EM9 A;  1AH5 A;  3VYY A;  2ODR C;  5KL3 A;  2LV2 A;  2DIX A;  1XMQ E;  5KL5 A;  2EMH A;  2NUF A;  2YWQ A;  4R2S A;  1G2D C;  2DLK A;  2Q8U A;  2YU8 A;  4F2J C;  2YU5 A;  2EM6 A;  4DV5 E;  3HQ1 A;  2YTP A;  1T38 A;  2HC5 A;  3FIG A;  2F8B A;  4DV1 E;  1IMU A;  2NAB A;  3QG5 C;  4X8W A;  4R03 A;  1A1K A;  3BID A;  2L3J A;  1X47 A;  1A1H A;  2YSP A;  2EOY A;  4M0V A;  2YZT A;  2V83 A;  1T39 A;  1A1I A;  3IWD A;  1IBL E;  3HPS A;  1LLM C;  4BMJ A;  1N33 E;  2ODR D;  4NZV A;  1STU A;  4JI2 E;  1IQS A;  4JI1 E;  2YT4 A;  1B69 A;  3HXL A;  5AC5 A;  3ZOQ B;  1O0W A;  3KZY A;  3ADL A;  3DF6 A;  5KL2 A;  2DRP A;  2UUA E;  1SR9 A;  1PJS A;  1ZU1 A;  1FJG E;  4JI4 E;  2EOH A;  1FKA E;  2EE8 A;  2N3H A;  2EJ4 A;  4NXM E;  4X66 E;  5FLX C;  3HTX A;  4N4R B;  2ELY A;  4TUG A;  4O43 A;  4JI6 E;  2EOJ A;  5CFF E;  2DMY A;  3EPJ A;  2L8T A;  2N8X A;  3RMP A;  1UBD C;  1PJT A;  4ZYE A;  3C6K A;  4DV7 E;  1HNW E;  5A6B D;  3J80 C;  3ADJ A;  2LO3 A;  4JI3 E;  4M2Z A;  4IS1 C;  5IXM B;  4MLV A;  5BR8 E;  2WBT A;  4Q35 B;  2VRD A;  5LMN E;  2MC6 A;  4BHC A;  4DR1 E;  1A1G A;  4LU9 A;  1YZ9 A;  1T4L B;  2I13 A;  4DV4 E;  3ADG A;  3C6M A;  2DGC A;  4DV2 E;  2A25 A;  2EOR A;  2RSI A;  1UIL A;  2EPP A;  4RH8 A;  2YRK A;  2JPA A;  4L5N C;  2L2N A;  3ECR A;  1QU6 A;  2LRS A;  3KZZ A;  2EWL A;  4X64 E;  1Z1B A;  2DSY A;  2EOX A;  2EMA A;  1X6H A;  2EPN A;  3F6G A;  4WX9 A;  2WBS A;  3K6Q A;  2EN3 A;  1ZBT A;  1NEI A;  4HEI A;  4LF5 E;  1GQE A;  2LT7 A;  1BBG A;  4P7D A;  2EN4 A;  4LF6 E;  1X3C A;  3BBG A;  1PKP A;  4BHB A;  1XNQ E;  4WXD A;  2M4I A;  5A6A A;  2LUP B;  3IWB A;  2G7H A;  2RPC A;  2EM0 A;  2FV4 B;  4M30 A;  4ZYH A;  1T4N A;  4DMI A;  2L33 A;  1YFH A;  2RS7 A;  2LUQ A;  5KL6 A;  3THO B;  2JOB A;  4NHR A;  2LTS A;  5AE1 A;  2YTF A;  2E1M A;  3H09 A;  5DNY A;  1RQ0 A;  2EMF A;  4F6M A;  2V89 A;  3EPL A;  3BGH A;  1TF3 A;  4LF8 E;  4O24 A;  5IV8 B;  4X62 E;  2V87 A;  2LJU A;  2EP3 A;  5LL6 R;  1J26 A;  2YPN A;  2MDR A;  2WCC 3;  4JI8 E;  4DUY E;  3J81 C;  1X6E A;  4DR7 E;  2ELZ A;  2VE7 C;  1YYO A;  1T4O A;  1N3G A;  5A6K A;  2L3C A;  2EL5 A;  2JWO A;  1NCS A;  5TSE A;  4R2A A;  2PRT A;  5A6B A;  1HNZ E;  2YTO A;  2H36 X;  2NA2 A;  1BB8 A;  2MC5 A;  2DB2 A;  2EOF A;  2LTR A;  2WZO A;  4DR2 E;  4B3R E;  4R2Q A;  2EN6 A;  2EMW A;  1YUI A;  2EL4 A;  2L92 A;  2EPU A;  1IBM E;  2NUE A;  3J7A G;  2MKD A;  1UHZ A;  2YTN A;  2EM2 A;  1KJK A;  4DR6 E;  2L2M A;  2DMI A;  1GTK A;  5LLQ A;  4BCA A;  5AE2 A;  4LF4 E;  2LVH A;  1WRJ A;  1YPN A;  1L4S A;  4B3M E;  4KWY A;  1MEY C;  4P78 A;  1KYQ A;  1TF6 A;  3C4B A;  1J5E E;  3LLH A;  2EPC A;  5ADZ A;  1WXR A;  4WFT A;  3L00 A;  4R2C A;  4BS9 A;  1ZR9 A;  3TQM A;  1XNR E;  3MHS C;  1HR0 E;  3OML A;  2UXC E;  2EL6 A;  2I9I A;  2EMG A;  4F9B B;  4F54 A;  2EQ1 A;  2K7I A;  2YTQ A;  4F9A B;  2FTX B;  4I8O A;  2NUG A;  4DR4 E;  3JU0 A;  2EPO A;  2EPX A;  2EMY A;  3VK6 A;  2LBS B;  2EM8 A;  1N34 E;  4LTY A;  2KON A;  2GLI A;  3M99 B;  4O5G A;  4BC9 A;  4R2D A;  5T6J A;  4GKJ E;  2EOE A;  2CSH A;  2EML A;  2ENA A;  2KHX A;  4F6N A;  4DR3 E;  2E72 A;  2YSO A;  4JI5 E;  4LFC E;  4OOG C;  1TN9 A;  1QNT A;  2EOI A;  1PJQ A;  4TUI A;  2EMC A; 
#chains in the Genus database with same CATH homology
 3FIG A;  2LTS A;  2F8B A;  4DV1 E;  2VQF E;  1X48 A;  2KOU A;  4L8N A;  5AE1 A;  2V86 A;  1IBK E;  2E1M A;  2E5L E;  4X8W A;  5AE3 A;  3H09 A;  5DNY A;  1RQ0 A;  1EKZ A;  4R03 A;  3AUZ A;  3MSW A;  4KZS A;  1YYK A;  2V89 A;  1DI2 A;  4R8O A;  2L3J A;  4LF8 E;  1X47 A;  4LFA E;  4J8Z A;  4X62 E;  2V87 A;  5LL6 R;  2V88 A;  1J26 A;  1I94 E;  4M0V A;  2YZT A;  2MDR A;  3C4T A;  4JI8 E;  4DUY E;  4LF9 E;  4WSP A;  3J81 C;  3J7Y p;  2K4V A;  2V83 A;  2FGG A;  4DR7 E;  3IWD A;  1IBL E;  4GKK E;  3HPS A;  4JV5 E;  4BMJ A;  2RSM A;  2VE7 C;  2ODR D;  1N33 E;  1YYO A;  2VF1 A;  1ZBQ A;  1T4O A;  4DUZ E;  2UUB E;  2L3C A;  1STU A;  2UXB E;  2JWO A;  4JI2 E;  4JI1 E;  1WHN A;  2YT4 A;  4DKK A;  1GZ6 A;  3HXL A;  2LMZ A;  3ZOQ B;  4LF7 E;  1O0W A;  4B3T E;  4GEQ B;  4B3S E;  4DV0 E;  3ADL A;  4K0K E;  2RTX A;  3DF6 A;  3AV0 A;  2VQE E;  2RS6 A;  2ZM6 E;  2UUA E;  3JAM C;  1SR9 A;  5F3W A;  4WPY A;  1HNZ E;  2H36 X;  1FJG E;  4YHH E;  1FKA E;  1X49 A;  2N3H A;  2NA2 A;  4NXM E;  4X66 E;  3KWR A;  2MC5 A;  2UU9 E;  2DB2 A;  4Q28 A;  2JOX A;  5FLX C;  2LTR A;  2WZO A;  3HTX A;  4DR2 E;  4B3R E;  4TUG A;  3P1X A;  2B3T B;  4DR5 E;  4JI6 E;  4WYQ B;  2HHH E;  4AQY E;  5CFF E;  3JTZ A;  2DMY A;  2L92 A;  5AAS A;  2L8T A;  2B7T A;  2LJH A;  3T1H E;  1UHZ A;  1N36 E;  1IBM E;  3RMP A;  3J7A G;  4DR6 E;  2L2M A;  5LMU E;  2IHR 1;  2M1S A;  4DV7 E;  3IWC A;  4BC7 A;  1HNW E;  1WHQ A;  4BCA A;  3J80 C;  5AE2 A;  3LML A;  4OX9 E;  4LFB E;  4LF4 E;  3ADJ A;  2L2K B;  2N3G A;  2L6M A;  1RC7 A;  4JI3 E;  4M2Z A;  2F4V E;  4JYA E;  4B3M E;  5BR8 E;  4YY3 E;  4P78 A;  5LMN E;  2MC6 A;  4DV3 E;  3C4B A;  4DR1 E;  1J5E E;  3LLH A;  4LU9 A;  1YZ9 A;  5ADZ A;  2B9D A;  1WXR A;  4WFT A;  5IT9 C;  1T4L B;  2LE2 A;  4F9C B;  4BS9 A;  4DV4 E;  3ADG A;  2JY9 A;  2M7Q A;  5IWA E;  1XNR E;  4DV2 E;  2B7V A;  1HR0 E;  3OML A;  2UXC E;  1DQ3 A;  1XMO E;  1UIL A;  1HNX E;  4BBY A;  4L5N C;  2L2N A;  4F9B B;  1YYW A;  1QU6 A;  4F54 A;  2LRS A;  4X65 E;  4NXN E;  2NUE A;  4F9A B;  3OTO E;  4JI0 E;  3ADI A;  2FTX B;  2EWL A;  4X64 E;  2V85 A;  4DV6 E;  2DSY A;  3VYX A;  3F6G A;  4I8O A;  2UXD E;  2JVA A;  2UUC E;  2NUG A;  4DR4 E;  3JU0 A;  3K6Q A;  1N34 E;  3VK6 A;  2LBS B;  4LTY A;  2KON A;  4KHP E;  2EZ6 A;  4BC9 A;  1ZBT A;  5T6J A;  4GKJ E;  4LF5 E;  5A2Q C;  1GQE A;  2KHX A;  3VYY A;  2JR1 A;  2ODR C;  4P7D A;  4LF6 E;  2DIX A;  2V8Q B;  1XMQ E;  4DR3 E;  1PKP A;  4JI5 E;  2NUF A;  1N32 E;  1XNQ E;  3HPZ A;  2M4I A;  4LFC E;  4OOG C;  3DJW A;  3T1Y E;  2LUP B;  2CPN A;  3IWB A;  2G7H A;  3F6H A;  2FV4 B;  4M30 A;  1T4N A;  4DMI A;  2L33 A;  4TUI A;  2RS7 A;  4DV5 E;  2LUQ A;  3HQ1 A;  4JI7 E;  4JI4 E;  2JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...