3JU1A

Crystal structure of enoyl-coa hydratase/isomerase family protein
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
b'ATQNVVFQTLATASGKLVGVVTLNVEKALNALDLDMVRAMTVQLNLWKKDPLIACVVLDGSGEKAFCAGGDVRALYHASVAAKGQVTEVAKVFFEEEYRLDYLLHTYGKPVLVWGDGIVMGGGLGLMAGASHKVVTETSRIAMPEVTIGLYPDVGGSYFLNRMPGKMGLFLGLTAYHMNAADACYVGLADHYLNRDDKELMFDAMATLDWSDSPALNHQRLDTMINELSNQVDIPKGDSVLAESQEMIDRLMAGSLTDIVTRMSTLSTDEAWLSKACATMLAGSPISWHLAYIQTQLGTKLSLAQCFKWELTVSVNVCAKGDFCEGVRALLIDKDKQPKWQFADVQSVPNSVIEDILTSPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase family protein
publication title Crystal Structure of Enoyl-CoA Hydratase/Isomerase Family Protein
rcsb
source organism Shewanella oneidensis
molecule tags Lyase, isomerase
total genus 121
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16113 ECH_2 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ju1A00
3KTJA 4U0HA 5DU6A 3R0OA 1MJ3A 4JCSA 1XO6A 3OMEA 2VREA 3H0SA 3R6HA 4JYJA 4FN8A 3TT7A 5KDRB 5FIFA 4U19A 4WYOB 3T8BA 4ZDEA 4Q1IA 3KTIA 4ZDFA 1HNUA 4G2RA 4KNPA 3OC7A 1Q52A 5IKLB 3Q0GA 2NP9A 1XX4A 3IAVA 4FNBA 3T89A 1O8UA 2CE3A 4WZ8B 4EMLA 3H02A 2CBYA 1JXZA 5FUSA 4JOTA 3GF7A 3QWDA 2J5SA 3BEZA 5DU4A 5E0SH 3TLFA 4JJTA 4HNKA 3KTKA 3VIVA 3ZWAA 2A81A 3Q7HA 3QMJA 3MOYA 3JU1A 1HZDA 5DTWA 3HINA 3ZWBA 3TDCA 3QREA 2BZRA 3QXZA 3TRRA 4JFCA 4OMRA 3TVWA 5INIA 1FC7A 4QFEA 1TYFA 3K8XA 4ZDCA 3H0UA 4IZCA 1XNWA 2F6QA 2PG8A 4ZDDA 2J5II 1XNVA 5DZKA 3OT6A 4Z0MA 3PE8A 4JSBA 3MYBA 4IZDA 1EF8A 1UYSA 5C90A 1UYTA 3GKBA 2VSUA 3P85A 3U9TB 4U18A 3L3SA 3ZW9A 3K50A 3T3WA 3KTGA 2VSUF 1HNOA 3LKEA 5KJPA 4K3WA 3Q0JA 4RCNA 3V5EA 3MFMA 4JVTA 1RJMA 2J5GD 5G1RA 3GF3A 4NNQA 4FJWD 3M6NA 2F9IA 3RRVA 4B3JA 2ZQQA 5DKPA 3RSIA 3M6MA 4Q0GA 1RJNA 2F6IA 4HC8A 4U1AA 1X0UA 5DZKH 3R9QA 2ZQRA 2ZL2A 4K2NA 2ZL3A 3TT6A 3FF6A 3QXIA 2J5GA 1N6DA 2Q34A 1UIYA 1XNYA 1FC6A 3ST9A 3ZW8A 5INFA 3QKAA 2FBMA 4KWBA 3RSTA 2VX2A 4MI2A 4MOUA 1N6FA 5C9GA 3H0QA 1J7XA 5JBWA 4JCRA 1WZ8A 4NEKA 1SG4A 3G64A 1NZYA 1TG6A 3NJDA 3GMAA 4EMPA 4ZU2A 2QQ3A 2DEOA 2F9YA 5MGBA 1ON9A 1Y7OA 3V5IA 5DL1A 5G1SA 3DJAA 2EJ5A 3MT6A 4KD6A 4RYFA 4MXIA 4IZBA 4OG1A 3SWXA 5DTPA 4OLQA 4FZWA 5E0NX 3STAA 2C8TA 2ZL4A 2DUBA 4QIJA 5DUCA 3R9TA 1FCFA 3T8AA 1EY3A 4B3HA 2A7KA 1EF9A 2Q35A 1YG8A 4DI1A 1VRGA 4B3IA 4FNDA 3I47A 2WTBA 4EMMA 3HP0A 5DU8A 1WDMA 4F47A 3ZWCA 3LAOA 4FB8A 4YLHA 4L8KA 2HW5A 2Q2XA 2J5IA 1OD4A 4GM2A 3ISAA 4ASIA 2VSUC 1WDLA 4RYFH 4K29A 1UYRA 3PZKA 3WG5A 4FN7A 3KQFA 3QK8A 1YG6A 2J5IB 3T88A 5KDRA 3SLLA 1SZOA 4JCTA 1FC9A 4LK5A 2F9IB 3NJBA 3TV5A 3H0JA 4U0GA 3BF0A 4I42A 3U9RB 4JCQA 3DORA 3TVUA 3GLMA 1UYVA 3IB9A 3IBBA 2PBPA 1ON3A 1W2XA 2IEXA 2VSUE 4JYLA 4ELSA 5JBXA 2ZL0A 4L6WA 3H81A 1Q51A 4ELXA 2VSSA 4QIIA 3R9SA 4WCZA 3KTHA 2VSSF 3BPPA 2D3TA 1NZYB 1N6EA 5CTCA 3TZ3A 2F9YB 4GHNA 4ELWA 4U0GH 1PJHA 5DUFA 4JWVA 2PPYA 1DUBA 3P5MA 2A7SA 2X58A 3HE2A 5CTBA 5INGA 2FZSA 3QYRA 5G1QA 4FZWC 3HLN1 1DCIA 1OD2A 2UZFA 3N6RB 3PEAA 3P2LA 1WDKA 4ZDBA 3FDUA 4KPKA 3U9SB 3PGQA 2W3PA 2VSSE 1K32A 1PIXA 4I4ZA 4I52A 3Q1TA 5E0SA 2FW2A 2GTRA 1K39A 3HRXA 2X24A
chains in the Genus database with same CATH superfamily
3KTJA 4U0HA 5DU6A 3R0OA 1MJ3A 4JCSA 1XO6A 3OMEA 2VREA 3H0SA 3R6HA 4JYJA 4FN8A 3TT7A 5KDRB 5FIFA 4U19A 4WYOB 3T8BA 4ZDEA 4Q1IA 3KTIA 4ZDFA 1HNUA 4G2RA 4KNPA 3OC7A 1Q52A 5IKLB 3Q0GA 2NP9A 1XX4A 3IAVA 4FNBA 3T89A 1O8UA 2CE3A 4WZ8B 4EMLA 3H02A 2CBYA 1JXZA 5FUSA 4JOTA 3GF7A 3QWDA 2J5SA 3BEZA 5DU4A 5E0SH 3TLFA 4JJTA 4HNKA 3KTKA 3VIVA 3ZWAA 2A81A 3Q7HA 3QMJA 3MOYA 3JU1A 1HZDA 5DTWA 3HINA 3ZWBA 3TDCA 3QREA 2BZRA 3QXZA 4HDTA 3TRRA 4JFCA 4OMRA 3TVWA 5INIA 1FC7A 4QFEA 1TYFA 3K8XA 4ZDCA 3H0UA 4IZCA 1XNWA 2F6QA 2PG8A 4ZDDA 2J5II 1XNVA 5DZKA 3OT6A 4Z0MA 3PE8A 4JSBA 3MYBA 3BPTA 4IZDA 1EF8A 1UYSA 5C90A 1UYTA 3GKBA 2VSUA 3P85A 3U9TB 4U18A 3L3SA 3ZW9A 3K50A 3T3WA 3KTGA 2VSUF 1HNOA 4NARA 3LKEA 5KJPA 4K3WA 3Q0JA 4RCNA 3V5EA 3MFMA 4JVTA 1RJMA 2J5GD 4J2UA 5G1RA 3GF3A 4NNQA 4FJWD 3M6NA 2F9IA 3RRVA 4B3JA 2ZQQA 5DKPA 3RSIA 3M6MA 4Q0GA 1RJNA 2F6IA 4HC8A 4U1AA 1X0UA 5DZKH 3R9QA 2ZQRA 2ZL2A 4K2NA 2ZL3A 3TT6A 3FF6A 3QXIA 2J5GA 1N6DA 2Q34A 1UIYA 1XNYA 1FC6A 3ST9A 3ZW8A 5INFA 3QKAA 2FBMA 4KWBA 3RSTA 2VX2A 4MI2A 4MOUA 1N6FA 5C9GA 3H0QA 1J7XA 5JBWA 5HUQA 4JCRA 1WZ8A 4NEKA 1SG4A 3G64A 1NZYA 1TG6A 3NJDA 3GMAA 4EMPA 4ZU2A 2QQ3A 2DEOA 2F9YA 5MGBA 1ON9A 1Y7OA 3V5IA 5DL1A 5G1SA 3DJAA 2EJ5A 3MT6A 4KD6A 4RYFA 4MXIA 4IZBA 4OG1A 3SWXA 5DTPA 4OLQA 4FZWA 5E0NX 3STAA 2C8TA 2ZL4A 2DUBA 4QIJA 5DUCA 3R9TA 1FCFA 3T8AA 1EY3A 4B3HA 2A7KA 1EF9A 2Q35A 1YG8A 4DI1A 1VRGA 4B3IA 4FNDA 3I47A 2WTBA 4EMMA 3HP0A 5DU8A 1WDMA 4F47A 3ZWCA 3LAOA 4FB8A 4YLHA 4L8KA 2HW5A 2Q2XA 2J5IA 1OD4A 4GM2A 3ISAA 4ASIA 2VSUC 1WDLA 4RYFH 4K29A 1UYRA 3PZKA 3WG5A 4FN7A 3KQFA 3QK8A 1YG6A 2J5IB 3T88A 5KDRA 3SLLA 1SZOA 4JCTA 1FC9A 4LK5A 2F9IB 3NJBA 3TV5A 3H0JA 4U0GA 3BF0A 4I42A 3U9RB 4JCQA 3DORA 3TVUA 3GLMA 1UYVA 3IB9A 3IBBA 2PBPA 1ON3A 1W2XA 2IEXA 2VSUE 4JYLA 4ELSA 5JBXA 2ZL0A 4L6WA 3H81A 1Q51A 4ELXA 2VSSA 4QIIA 3R9SA 4WCZA 2YJGA 3KTHA 2VSSF 3BPPA 2D3TA 1NZYB 1N6EA 5CTCA 3TZ3A 2F9YB 4GHNA 4ELWA 4U0GH 1PJHA 5DUFA 4JWVA 2PPYA 1DUBA 3P5MA 2A7SA 2X58A 3HE2A 5CTBA 5INGA 2FZSA 3QYRA 5G1QA 4FZWC 3HLN1 1DCIA 1OD2A 2UZFA 3N6RB 3PEAA 3P2LA 1WDKA 4ZDBA 3FDUA 4KPKA 3U9SB 3PGQA 2W3PA 2VSSE 1K32A 1PIXA 4I4ZA 4I52A 3Q1TA 5E0SA 2FW2A 2GTRA 1K39A 3HRXA 2X24A
chains in the Genus database with same CATH topology
3KTJA 4U0HA 5DU6A 3R0OA 1MJ3A 4JCSA 1XO6A 3OMEA 2VREA 3H0SA 3R6HA 4JYJA 4FN8A 3TT7A 5KDRB 5FIFA 4U19A 4WYOB 3T8BA 4ZDEA 4Q1IA 3KTIA 4ZDFA 1HNUA 4G2RA 4KNPA 3OC7A 1Q52A 5IKLB 3Q0GA 2NP9A 1XX4A 3IAVA 4FNBA 3T89A 1O8UA 2CE3A 4WZ8B 4EMLA 3H02A 2CBYA 1JXZA 5FUSA 4JOTA 3GF7A 3QWDA 2J5SA 3BEZA 5DU4A 5E0SH 3TLFA 4JJTA 4HNKA 3KTKA 3VIVA 3ZWAA 2A81A 3Q7HA 3QMJA 3MOYA 3JU1A 1HZDA 5DTWA 3HINA 3ZWBA 3TDCA 3QREA 2BZRA 3QXZA 4HDTA 3TRRA 4JFCA 4OMRA 3TVWA 5INIA 1FC7A 4QFEA 1TYFA 3K8XA 4ZDCA 3H0UA 4IZCA 1XNWA 2F6QA 2PG8A 4ZDDA 2J5II 1XNVA 5DZKA 3OT6A 4Z0MA 3PE8A 4JSBA 3MYBA 3BPTA 4IZDA 1EF8A 1UYSA 5C90A 1UYTA 3GKBA 2VSUA 3P85A 3U9TB 4U18A 3L3SA 3ZW9A 3K50A 3T3WA 3KTGA 2VSUF 1HNOA 4NARA 3LKEA 5KJPA 4K3WA 3Q0JA 4RCNA 3V5EA 3MFMA 4JVTA 1RJMA 2J5GD 4J2UA 5G1RA 3GF3A 4NNQA 4FJWD 3M6NA 2F9IA 3RRVA 4B3JA 2ZQQA 5DKPA 3RSIA 3M6MA 4Q0GA 1RJNA 2F6IA 4HC8A 4U1AA 1X0UA 5DZKH 3R9QA 2ZQRA 2ZL2A 4K2NA 2ZL3A 3TT6A 3FF6A 3QXIA 2J5GA 1N6DA 2Q34A 1UIYA 1XNYA 1FC6A 3ST9A 3ZW8A 5INFA 3QKAA 2FBMA 4KWBA 3RSTA 2VX2A 4MI2A 4MOUA 1N6FA 5C9GA 3H0QA 1J7XA 5JBWA 5HUQA 4JCRA 1WZ8A 4NEKA 1SG4A 3G64A 1NZYA 1TG6A 3NJDA 3GMAA 4EMPA 4ZU2A 2QQ3A 2DEOA 2F9YA 5MGBA 1ON9A 1Y7OA 3V5IA 5DL1A 5G1SA 3DJAA 2EJ5A 3MT6A 4KD6A 4RYFA 4MXIA 4IZBA 4OG1A 3SWXA 5DTPA 4OLQA 4FZWA 5E0NX 3STAA 2C8TA 2ZL4A 2DUBA 4QIJA 5DUCA 3R9TA 1FCFA 3T8AA 1EY3A 4B3HA 2A7KA 1EF9A 2Q35A 1YG8A 4DI1A 1VRGA 4B3IA 4FNDA 3I47A 2WTBA 4EMMA 3HP0A 5DU8A 1WDMA 4F47A 3ZWCA 3LAOA 4FB8A 4YLHA 4L8KA 2HW5A 2Q2XA 2J5IA 1OD4A 4GM2A 3ISAA 4ASIA 2VSUC 1WDLA 4RYFH 4K29A 1UYRA 3PZKA 3WG5A 4FN7A 3KQFA 3QK8A 1YG6A 2J5IB 3T88A 5KDRA 3SLLA 1SZOA 4JCTA 1FC9A 4LK5A 2F9IB 3NJBA 3TV5A 3H0JA 4U0GA 3BF0A 4I42A 3U9RB 4JCQA 3DORA 3TVUA 3GLMA 1UYVA 3IB9A 3IBBA 2PBPA 1ON3A 1W2XA 2IEXA 2VSUE 4JYLA 4ELSA 5JBXA 2ZL0A 4L6WA 3H81A 1Q51A 4ELXA 2VSSA 4QIIA 3R9SA 4WCZA 2YJGA 3KTHA 2VSSF 3BPPA 2D3TA 1NZYB 1N6EA 5CTCA 3TZ3A 2F9YB 4GHNA 4ELWA 4U0GH 1PJHA 5DUFA 4JWVA 2PPYA 1DUBA 3P5MA 2A7SA 2X58A 3HE2A 5CTBA 5INGA 2FZSA 3QYRA 5G1QA 4FZWC 3HLN1 1DCIA 1OD2A 2UZFA 3N6RB 3PEAA 3P2LA 1WDKA 4ZDBA 3FDUA 4KPKA 3U9SB 3PGQA 2W3PA 2VSSE 1K32A 1PIXA 4I4ZA 4I52A 3Q1TA 5E0SA 2FW2A 2GTRA 1K39A 3HRXA 2X24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTJ A;  4U0H A;  5DU6 A;  3R0O A;  1MJ3 A;  4JCS A;  1XO6 A;  3OME A;  2VRE A;  3H0S A;  3R6H A;  4JYJ A;  4FN8 A;  3TT7 A;  5KDR B;  5FIF A;  4U19 A;  4WYO B;  3T8B A;  4ZDE A;  4Q1I A;  3KTI A;  4ZDF A;  1HNU A;  4G2R A;  4KNP A;  3OC7 A;  1Q52 A;  5IKL B;  3Q0G A;  2NP9 A;  1XX4 A;  3IAV A;  4FNB A;  3T89 A;  1O8U A;  2CE3 A;  4WZ8 B;  4EML A;  3H02 A;  2CBY A;  1JXZ A;  5FUS A;  4JOT A;  3GF7 A;  3QWD A;  2J5S A;  3BEZ A;  5DU4 A;  5E0S H;  3TLF A;  4JJT A;  4HNK A;  3KTK A;  3VIV A;  3ZWA A;  2A81 A;  3Q7H A;  3QMJ A;  3MOY A;  3JU1 A;  1HZD A;  5DTW A;  3HIN A;  3ZWB A;  3TDC A;  3QRE A;  2BZR A;  3QXZ A;  3TRR A;  4JFC A;  4OMR A;  3TVW A;  5INI A;  1FC7 A;  4QFE A;  1TYF A;  3K8X A;  4ZDC A;  3H0U A;  4IZC A;  1XNW A;  2F6Q A;  2PG8 A;  4ZDD A;  2J5I I;  1XNV A;  5DZK A;  3OT6 A;  4Z0M A;  3PE8 A;  4JSB A;  3MYB A;  4IZD A;  1EF8 A;  1UYS A;  5C90 A;  1UYT A;  3GKB A;  2VSU A;  3P85 A;  3U9T B;  4U18 A;  3L3S A;  3ZW9 A;  3K50 A;  3T3W A;  3KTG A;  2VSU F;  1HNO A;  3LKE A;  5KJP A;  4K3W A;  3Q0J A;  4RCN A;  3V5E A;  3MFM A;  4JVT A;  1RJM A;  2J5G D;  5G1R A;  3GF3 A;  4NNQ A;  4FJW D;  3M6N A;  2F9I A;  3RRV A;  4B3J A;  2ZQQ A;  5DKP A;  3RSI A;  3M6M A;  4Q0G A;  1RJN A;  2F6I A;  4HC8 A;  4U1A A;  1X0U A;  5DZK H;  3R9Q A;  2ZQR A;  2ZL2 A;  4K2N A;  2ZL3 A;  3TT6 A;  3FF6 A;  3QXI A;  2J5G A;  1N6D A;  2Q34 A;  1UIY A;  1XNY A;  1FC6 A;  3ST9 A;  3ZW8 A;  5INF A;  3QKA A;  2FBM A;  4KWB A;  3RST A;  2VX2 A;  4MI2 A;  4MOU A;  1N6F A;  5C9G A;  3H0Q A;  1J7X A;  5JBW A;  4JCR A;  1WZ8 A;  4NEK A;  1SG4 A;  3G64 A;  1NZY A;  1TG6 A;  3NJD A;  3GMA A;  4EMP A;  4ZU2 A;  2QQ3 A;  2DEO A;  2F9Y A;  5MGB A;  1ON9 A;  1Y7O A;  3V5I A;  5DL1 A;  5G1S A;  3DJA A;  2EJ5 A;  3MT6 A;  4KD6 A;  4RYF A;  4MXI A;  4IZB A;  4OG1 A;  3SWX A;  5DTP A;  4OLQ A;  4FZW A;  5E0N X;  3STA A;  2C8T A;  2ZL4 A;  2DUB A;  4QIJ A;  5DUC A;  3R9T A;  1FCF A;  3T8A A;  1EY3 A;  4B3H A;  2A7K A;  1EF9 A;  2Q35 A;  1YG8 A;  4DI1 A;  1VRG A;  4B3I A;  4FND A;  3I47 A;  2WTB A;  4EMM A;  3HP0 A;  5DU8 A;  1WDM A;  4F47 A;  3ZWC A;  3LAO A;  4FB8 A;  4YLH A;  4L8K A;  2HW5 A;  2Q2X A;  2J5I A;  1OD4 A;  4GM2 A;  3ISA A;  4ASI A;  2VSU C;  1WDL A;  4RYF H;  4K29 A;  1UYR A;  3PZK A;  3WG5 A;  4FN7 A;  3KQF A;  3QK8 A;  1YG6 A;  2J5I B;  3T88 A;  5KDR A;  3SLL A;  1SZO A;  4JCT A;  1FC9 A;  4LK5 A;  2F9I B;  3NJB A;  3TV5 A;  3H0J A;  4U0G A;  3BF0 A;  4I42 A;  3U9R B;  4JCQ A;  3DOR A;  3TVU A;  3GLM A;  1UYV A;  3IB9 A;  3IBB A;  2PBP A;  1ON3 A;  1W2X A;  2IEX A;  2VSU E;  4JYL A;  4ELS A;  5JBX A;  2ZL0 A;  4L6W A;  3H81 A;  1Q51 A;  4ELX A;  2VSS A;  4QII A;  3R9S A;  4WCZ A;  3KTH A;  2VSS F;  3BPP A;  2D3T A;  1NZY B;  1N6E A;  5CTC A;  3TZ3 A;  2F9Y B;  4GHN A;  4ELW A;  4U0G H;  1PJH A;  5DUF A;  4JWV A;  2PPY A;  1DUB A;  3P5M A;  2A7S A;  2X58 A;  3HE2 A;  5CTB A;  5ING A;  2FZS A;  3QYR A;  5G1Q A;  4FZW C;  3HLN 1;  1DCI A;  1OD2 A;  2UZF A;  3N6R B;  3PEA A;  3P2L A;  1WDK A;  4ZDB A;  3FDU A;  4KPK A;  3U9S B;  3PGQ A;  2W3P A;  2VSS E;  1K32 A;  1PIX A;  4I4Z A;  4I52 A;  3Q1T A;  5E0S A;  2FW2 A;  2GTR A;  1K39 A;  3HRX A;  2X24 A; 
#chains in the Genus database with same CATH topology
 3KTJ A;  4U0H A;  5DU6 A;  3R0O A;  1MJ3 A;  4JCS A;  1XO6 A;  3OME A;  2VRE A;  3H0S A;  3R6H A;  4JYJ A;  4FN8 A;  3TT7 A;  5KDR B;  5FIF A;  4U19 A;  4WYO B;  3T8B A;  4ZDE A;  4Q1I A;  3KTI A;  4ZDF A;  1HNU A;  4G2R A;  4KNP A;  3OC7 A;  1Q52 A;  5IKL B;  3Q0G A;  2NP9 A;  1XX4 A;  3IAV A;  4FNB A;  3T89 A;  1O8U A;  2CE3 A;  4WZ8 B;  4EML A;  3H02 A;  2CBY A;  1JXZ A;  5FUS A;  4JOT A;  3GF7 A;  3QWD A;  2J5S A;  3BEZ A;  5DU4 A;  5E0S H;  3TLF A;  4JJT A;  4HNK A;  3KTK A;  3VIV A;  3ZWA A;  2A81 A;  3Q7H A;  3QMJ A;  3MOY A;  3JU1 A;  1HZD A;  5DTW A;  3HIN A;  3ZWB A;  3TDC A;  3QRE A;  2BZR A;  3QXZ A;  4HDT A;  3TRR A;  4JFC A;  4OMR A;  3TVW A;  5INI A;  1FC7 A;  4QFE A;  1TYF A;  3K8X A;  4ZDC A;  3H0U A;  4IZC A;  1XNW A;  2F6Q A;  2PG8 A;  4ZDD A;  2J5I I;  1XNV A;  5DZK A;  3OT6 A;  4Z0M A;  3PE8 A;  4JSB A;  3MYB A;  3BPT A;  4IZD A;  1EF8 A;  1UYS A;  5C90 A;  1UYT A;  3GKB A;  2VSU A;  3P85 A;  3U9T B;  4U18 A;  3L3S A;  3ZW9 A;  3K50 A;  3T3W A;  3KTG A;  2VSU F;  1HNO A;  4NAR A;  3LKE A;  5KJP A;  4K3W A;  3Q0J A;  4RCN A;  3V5E A;  3MFM A;  4JVT A;  1RJM A;  2J5G D;  4J2U A;  5G1R A;  3GF3 A;  4NNQ A;  4FJW D;  3M6N A;  2F9I A;  3RRV A;  4B3J A;  2ZQQ A;  5DKP A;  3RSI A;  3M6M A;  4Q0G A;  1RJN A;  2F6I A;  4HC8 A;  4U1A A;  1X0U A;  5DZK H;  3R9Q A;  2ZQR A;  2ZL2 A;  4K2N A;  2ZL3 A;  3TT6 A;  3FF6 A;  3QXI A;  2J5G A;  1N6D A;  2Q34 A;  1UIY A;  1XNY A;  1FC6 A;  3ST9 A;  3ZW8 A;  5INF A;  3QKA A;  2FBM A;  4KWB A;  3RST A;  2VX2 A;  4MI2 A;  4MOU A;  1N6F A;  5C9G A;  3H0Q A;  1J7X A;  5JBW A;  5HUQ A;  4JCR A;  1WZ8 A;  4NEK A;  1SG4 A;  3G64 A;  1NZY A;  1TG6 A;  3NJD A;  3GMA A;  4EMP A;  4ZU2 A;  2QQ3 A;  2DEO A;  2F9Y A;  5MGB A;  1ON9 A;  1Y7O A;  3V5I A;  5DL1 A;  5G1S A;  3DJA A;  2EJ5 A;  3MT6 A;  4KD6 A;  4RYF A;  4MXI A;  4IZB A;  4OG1 A;  3SWX A;  5DTP A;  4OLQ A;  4FZW A;  5E0N X;  3STA A;  2C8T A;  2ZL4 A;  2DUB A;  4QIJ A;  5DUC A;  3R9T A;  1FCF A;  3T8A A;  1EY3 A;  4B3H A;  2A7K A;  1EF9 A;  2Q35 A;  1YG8 A;  4DI1 A;  1VRG A;  4B3I A;  4FND A;  3I47 A;  2WTB A;  4EMM A;  3HP0 A;  5DU8 A;  1WDM A;  4F47 A;  3ZWC A;  3LAO A;  4FB8 A;  4YLH A;  4L8K A;  2HW5 A;  2Q2X A;  2J5I A;  1OD4 A;  4GM2 A;  3ISA A;  4ASI A;  2VSU C;  1WDL A;  4RYF H;  4K29 A;  1UYR A;  3PZK A;  3WG5 A;  4FN7 A;  3KQF A;  3QK8 A;  1YG6 A;  2J5I B;  3T88 A;  5KDR A;  3SLL A;  1SZO A;  4JCT A;  1FC9 A;  4LK5 A;  2F9I B;  3NJB A;  3TV5 A;  3H0J A;  4U0G A;  3BF0 A;  4I42 A;  3U9R B;  4JCQ A;  3DOR A;  3TVU A;  3GLM A;  1UYV A;  3IB9 A;  3IBB A;  2PBP A;  1ON3 A;  1W2X A;  2IEX A;  2VSU E;  4JYL A;  4ELS A;  5JBX A;  2ZL0 A;  4L6W A;  3H81 A;  1Q51 A;  4ELX A;  2VSS A;  4QII A;  3R9S A;  4WCZ A;  2YJG A;  3KTH A;  2VSS F;  3BPP A;  2D3T A;  1NZY B;  1N6E A;  5CTC A;  3TZ3 A;  2F9Y B;  4GHN A;  4ELW A;  4U0G H;  1PJH A;  5DUF A;  4JWV A;  2PPY A;  1DUB A;  3P5M A;  2A7S A;  2X58 A;  3HE2 A;  5CTB A;  5ING A;  2FZS A;  3QYR A;  5G1Q A;  4FZW C;  3HLN 1;  1DCI A;  1OD2 A;  2UZF A;  3N6R B;  3PEA A;  3P2L A;  1WDK A;  4ZDB A;  3FDU A;  4KPK A;  3U9S B;  3PGQ A;  2W3P A;  2VSS E;  1K32 A;  1PIX A;  4I4Z A;  4I52 A;  3Q1T A;  5E0S A;  2FW2 A;  2GTR A;  1K39 A;  3HRX A;  2X24 A; 
#chains in the Genus database with same CATH homology
 3KTJ A;  4U0H A;  5DU6 A;  3R0O A;  1MJ3 A;  4JCS A;  1XO6 A;  3OME A;  2VRE A;  3H0S A;  3R6H A;  4JYJ A;  4FN8 A;  3TT7 A;  5KDR B;  5FIF A;  4U19 A;  4WYO B;  3T8B A;  4ZDE A;  4Q1I A;  3KTI A;  4ZDF A;  1HNU A;  4G2R A;  4KNP A;  3OC7 A;  1Q52 A;  5IKL B;  3Q0G A;  2NP9 A;  1XX4 A;  3IAV A;  4FNB A;  3T89 A;  1O8U A;  2CE3 A;  4WZ8 B;  4EML A;  3H02 A;  2CBY A;  1JXZ A;  5FUS A;  4JOT A;  3GF7 A;  3QWD A;  2J5S A;  3BEZ A;  5DU4 A;  5E0S H;  3TLF A;  4JJT A;  4HNK A;  3KTK A;  3VIV A;  3ZWA A;  2A81 A;  3Q7H A;  3QMJ A;  3MOY A;  3JU1 A;  1HZD A;  5DTW A;  3HIN A;  3ZWB A;  3TDC A;  3QRE A;  2BZR A;  3QXZ A;  4HDT A;  3TRR A;  4JFC A;  4OMR A;  3TVW A;  5INI A;  1FC7 A;  4QFE A;  1TYF A;  3K8X A;  4ZDC A;  3H0U A;  4IZC A;  1XNW A;  2F6Q A;  2PG8 A;  4ZDD A;  2J5I I;  1XNV A;  5DZK A;  3OT6 A;  4Z0M A;  3PE8 A;  4JSB A;  3MYB A;  3BPT A;  4IZD A;  1EF8 A;  1UYS A;  5C90 A;  1UYT A;  3GKB A;  2VSU A;  3P85 A;  3U9T B;  4U18 A;  3L3S A;  3ZW9 A;  3K50 A;  3T3W A;  3KTG A;  2VSU F;  1HNO A;  4NAR A;  3LKE A;  5KJP A;  4K3W A;  3Q0J A;  4RCN A;  3V5E A;  3MFM A;  4JVT A;  1RJM A;  2J5G D;  4J2U A;  5G1R A;  3GF3 A;  4NNQ A;  4FJW D;  3M6N A;  2F9I A;  3RRV A;  4B3J A;  2ZQQ A;  5DKP A;  3RSI A;  3M6M A;  4Q0G A;  1RJN A;  2F6I A;  4HC8 A;  4U1A A;  1X0U A;  5DZK H;  3R9Q A;  2ZQR A;  2ZL2 A;  4K2N A;  2ZL3 A;  3TT6 A;  3FF6 A;  3QXI A;  2J5G A;  1N6D A;  2Q34 A;  1UIY A;  1XNY A;  1FC6 A;  3ST9 A;  3ZW8 A;  5INF A;  3QKA A;  2FBM A;  4KWB A;  3RST A;  2VX2 A;  4MI2 A;  4MOU A;  1N6F A;  5C9G A;  3H0Q A;  1J7X A;  5JBW A;  5HUQ A;  4JCR A;  1WZ8 A;  4NEK A;  1SG4 A;  3G64 A;  1NZY A;  1TG6 A;  3NJD A;  3GMA A;  4EMP A;  4ZU2 A;  2QQ3 A;  2DEO A;  2F9Y A;  5MGB A;  1ON9 A;  1Y7O A;  3V5I A;  5DL1 A;  5G1S A;  3DJA A;  2EJ5 A;  3MT6 A;  4KD6 A;  4RYF A;  4MXI A;  4IZB A;  4OG1 A;  3SWX A;  5DTP A;  4OLQ A;  4FZW A;  5E0N X;  3STA A;  2C8T A;  2ZL4 A;  2DUB A;  4QIJ A;  5DUC A;  3R9T A;  1FCF A;  3T8A A;  1EY3 A;  4B3H A;  2A7K A;  1EF9 A;  2Q35 A;  1YG8 A;  4DI1 A;  1VRG A;  4B3I A;  4FND A;  3I47 A;  2WTB A;  4EMM A;  3HP0 A;  5DU8 A;  1WDM A;  4F47 A;  3ZWC A;  3LAO A;  4FB8 A;  4YLH A;  4L8K A;  2HW5 A;  2Q2X A;  2J5I A;  1OD4 A;  4GM2 A;  3ISA A;  4ASI A;  2VSU C;  1WDL A;  4RYF H;  4K29 A;  1UYR A;  3PZK A;  3WG5 A;  4FN7 A;  3KQF A;  3QK8 A;  1YG6 A;  2J5I B;  3T88 A;  5KDR A;  3SLL A;  1SZO A;  4JCT A;  1FC9 A;  4LK5 A;  2F9I B;  3NJB A;  3TV5 A;  3H0J A;  4U0G A;  3BF0 A;  4I42 A;  3U9R B;  4JCQ A;  3DOR A;  3TVU A;  3GLM A;  1UYV A;  3IB9 A;  3IBB A;  2PBP A;  1ON3 A;  1W2X A;  2IEX A;  2VSU E;  4JYL A;  4ELS A;  5JBX A;  2ZL0 A;  4L6W A;  3H81 A;  1Q51 A;  4ELX A;  2VSS A;  4QII A;  3R9S A;  4WCZ A;  2YJG A;  3KTH A;  2VSS F;  3BPP A;  2D3T A;  1NZY B;  1N6E A;  5CTC A;  3TZ3 A;  2F9Y B;  4GHN A;  4ELW A;  4U0G H;  1PJH A;  5DUF A;  4JWV A;  2PPY A;  1DUB A;  3P5M A;  2A7S A;  2X58 A;  3HE2 A;  5CTB A;  5ING A;  2FZS A;  3QYR A;  5G1Q A;  4FZW C;  3HLN 1;  1DCI A;  1OD2 A;  2UZF A;  3N6R B;  3PEA A;  3P2L A;  1WDK A;  4ZDB A;  3FDU A;  4KPK A;  3U9S B;  3PGQ A;  2W3P A;  2VSS E;  1K32 A;  1PIX A;  4I4Z A;  4I52 A;  3Q1T A;  5E0S A;  2FW2 A;  2GTR A;  1K39 A;  3HRX A;  2X24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...