3JU3A

Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from thermoplasma acidophilum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'AEKAVLIGEKEADITFVTWGSQKGPILDVIEDLKEEGISANLLYLKMFSPFPTEFVKNVLSSANLVIDVESNYTAQAAQMIKLYTGIDIKNKILKYNGRHMTEDEILKSAKEILNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 2-oxoacid ferredoxin oxidoreductase, alpha chain
publication title Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ju3A00
2C42A 2O1SA 5HJEA 1X7ZB 3LQ2A 2BEWB 3UPTA 1ITZA 3AHHA 3AHIA 1TRKA 1IK6A 1TKAA 2J9FB 3KOMA 3M6LA 3EXHB 1OLXB 1R9JA 4C7VA 1V16B 4C7XA 3LPLA 1AY0A 2G67A 1UMBB 4XEUA 1X80B 2E6KA 3DUFB 1KEKA 5I5EA 1QGDA 1V1RB 3HYLA 2BFFB 2UZAA 1U5BB 3EXEB 3M49A 1OLUB 1WCIB 3AHGA 4KXWA 1UMCB 1GPUA 3AHEA 1V11B 1W85B 1W88B 3AHCA 5EXEA 4KXVA 5I4IA 2BFDB 5C4IA 1TKCA 2R8OA 3M7IA 2BFEB 3DV0B 2PDAA 3DVAB 3RIMA 5HYVA 3AHDA 1UMDB 1B0PA 3OOYA 2QTCA 2BP7B 5HGXA 3UK1A 2OZLB 3EXFB 3EXIB 2QTAA 1V1MB 2IEAA 2BFCB 3LQ4A 3AI7A 5I5GA 3AHJA 5EXDA 4KXUA 1X7YB 4KXYA 1RP7A 3M34A 1TKBA 5HHTA 2R5NA 2C3OA 2C3MA 1NI4B 1QS0B 1X7XB 1OLSB 2BEUB 2BEVB 3EXG2 2C3UA 2G28A 1X7WB 2O1XA 3JU3A 1DTWB 4KXXA 2G25A 3MOSA 1NGSA 2C3YA 1L8AA 3L84A 3AHFA 2R8PA 2C3PA 1UM9B 2BFBB 5I51A
chains in the Genus database with same CATH superfamily
4QFMA 4DQDA 1R18A 3M6WA 4P08A 2CVZA 3MPUA 2WBLC 1IHXA 1DX4A 2WIFA 3EA0A 1SGWA 2X4DA 2HLPA 4D4LA 5KPDA 3ORHA 5K3FA 1K06A 1T36A 4UD6A 1H8ED 1X1RA 1C7QA 2G40A 4DSOA 4YDRA 5AW5A 3RJZA 3A0RB 1XU7A 4KXQA 1GPBA 1K0FA 5JCJA 5DN6D 1ONSA 2FJPA 2DY0A 2VK4A 2ZR8A 4JI6B 3TEMA 5KNDD 2XB4A 5JJLA 2JAOA 3NIFB 4AZ0B 3W4JA 4EB3A 1G4UR 2EWWA 3KQYA 3ILXA 1QGYA 3PCXA 1L0BA 3T5DA 1A4IA 4G07A 1O97C 4WZ6A 2LUOA 1JIIA 7ABPA 1E9VA 2RGWA 3T3NA 4NBTA 2D7DA 3LC0A 2VDQB 2NU9A 3RLIA 4OB6A 5K3FB 4NRDA 1T36B 4DLRA 4JSRA 5JS6A 1GTRA 2BEJA 3PYMA 2ADFA 1LK0A 3DMFA 4KIJA 1LI5A 3KU4A 1R4MA 4YY3B 1UPCA 4D9EA 5TT0A 1EG2A 4Z9XA 3A1EA 4BO7A 4CUZA 2HT1A 1Y7TA 3QPWA 4RIFA 1VKJA 3B52X 3FCAA 4ZN6A 1LF0A 2O5EA 4AJIA 1HFEL 1G8HA 4FMDF 2OC9A 5KS2A 4E5YA 4ZQGA 4YV7A 2E89A 3FG9A 3IMGA 3WK4A 2GS9A 1NE2A 4ZI7A 1NVVR 3W2IA 4OJYA 2IK8A 2F1JA 3NFRA 1ZW6A 4OHZA 4GP9A 2AYYA 2R65A 1R4MB 3PNMA 2YQZA 3PX3A 1TM3E 2A3NA 4POAA 3SCZA 4PYQA 1VKNA 3BA1A 1K3FA 2B82A 1G8KA 5K4AA 4NQRA 3WYCA 5AM3A 4CM1A 2FQWA 1R4ZA 1UR5A 2ESRA 3AMVA 3QVOA 5IUNC 4FEEA 2WD8A 1R6BX 4NBRA 1I0LA 3RARA 3D6JA 4LFCB 2PS3A 2GN0A 3M6AA 4ZI7B 3PS9A 1PK9A 1N2IA 4AW9A 1O5TA 3HJNA 4ZYTA 2XWPA 1CDOA 3REGA 4ZO7A 1WCXA 4G41A 3ZH2A 3ET4A 3WAJA 1R8JA 2R6ZA 3P9QA 2FRDC 1I7DA 4FE3A 2IZ6A 2V7TA 1S2GA 1NNUA 4NV3A 1Y4UA 4XQ0A 2ZUUA 3WP1B 3G23A 3AI2A 3D7MA 2R97A 4FBLA 4M9QA 4X3OA 3CM0A 3DLIA 4XARA 5CA1A 4OQZA 3ZZ1A 3BUSA 1SIOA 4CJXA 2VRBA 4LTNA 4RSGA 3STYA 5C52B 4CRWB 3SHVA 3DFMA 3DHWC 3ZYZA 3FWYA 4XPZA 1A8QA 4XYLA 2FZVA 3K32A 4F93B 3CN7A 1B26A 1RXSA 1E18A 2QUAA 2FFQA 3LBAA 1WOMA 2CXRA 2ERXA 3T61A 3ZBPA 4NAVA 1KIFA 5CDUA 1L8AA 4C0LA 2OO7A 3DOUA 3NEJA 4RVSA 1XIVA 2ONCA 2WUEA 5CK4A 3FY4A 3U7IA 2A88A 5GJBA 1T2DA 3N58A 1ETUA 2BMDA 4N65A 4DC0A 5CA1B 1CVIA 3MWGA 4QA9A 3V1TC 2CFSA 2W9XA 1S3SA 4YYZA 3RS7A 1H8EA 3QE2A 4K5QA 4BVEA 1LTKA 3GFRA 4YDHB 4FX5A 1XDWA 4EG0A 4Z9YA 4OHYA 1N2OA 2WG2A 1N7IA 4MTLA 5BSHA 4O1HA 1J0DA 1EEHA 3FNBA 3IAFA 4BMNA 2WYWA 5DN6A 3OUTA 2O2CA 2X42A 3LVBA 5ALFA 5ALOA 5KNDA 1TADA 5E1MA 3ABSB 1GL6A 3C7AA 4GAEA 5CDHA 5K0CA 2PMEA 5FUQA 1T9DA 3H4IA 1FIUA 4K2AA 1FFSA 2HGSA 1TGYA 1GCGA 4IFIA 4BFXA 3IO5A 1GT91 3QEOA 4RK6A 4CDGA 2HJGA 4G26A 2WTUA 2Q5IA 1P2BA 3MLEA 5IC5A 1IYZA 4DDWA 3JASA 5KSWB 3IT0A 4WCDA 3VPAA 2D13A 1GNRA 1I4LD 4MKZA 2LCQA 3ROZA 1V6SA 2OPBA 4E4TA 1KZ6A 3DHVA 5K03A 1QOZA 2BFOA 3DOFA 1LDBA 2LKDA 4L0QA 3W6OA 3EQ7A 4QPCA 2VDPB 3ETCA 4D3YA 1MH9A 3CW9A 4WOBA 5J4HA 1AHHA 4PC6A 1HTBA 3LDAA 4ALJA 3EUFA 3LIIA 4BQNA 2D5LA 1E1KA 2BF7A 2OZEA 1WWKA 1XRSB 1C7RA 5HKKD 4XUEA 1WSAA 4M3NA 3IURA 5DLQC 2FPIA 2GPNA 1SZCA 3RVKA 4ZI7F 1NJGA 3JASB 1C1YA 2GNPA 1NC1A 4OGLA 1Z56C 4BQOA 3F8SA 1YBAA 5CDYA 1BVHA 1EGHA 5JFGA 3RDPA 1HE1C 5CVVA 2CWWA 1DCMA 2EKPA 3M5CA 1BHJA 1DBRA 1Q1QA 3RE1A 4B6JA 2Z1MA 3U3DA 4MQMA 2GPWA 2JJYA 1QH1B 3KZMA 5D3ZA 4MQ4A 2ZVQX 1G8AA 3QX8A 1P8AA 1XWFA 4ZDKA 1WO8A 1DGQA 1E1CA 2WP8J 4HNSA 2YL2A 4HUQA 4JASB 4WCFA 3UJNA 4YECA 5SYNA 3PXUA 3U4HA 4Q9LA 4KDEA 1HNXB 3R77A 2ZCVA 3GMDA 4WKBA 5DK4A 2YWGA 3M1YA 1E0JA 4PSKA 2WUGA 4BLRA 1RQNA 2ZRKA 1AQIA 5C7OO 4PANA 4C5CA 2AXQA 3H2SA 4LDRA 3O38A 3HRHA 5LIRA 3AVXA 4UPEA 1R0RE 4P4UA 5CA1F 4Y2PA 3UAZA 3ZWCA 2FWNA 3IAEA 3WK8A 4FDTA 4KC0A 4J3JA 1ZXXA 1I3CA 4QO7A 2AMFA 4OV6B 5F51A 1E1CB 2OBLA 4B3GA 4HUQB 2OUIA 3TKYA 4WCFB 5CR9A 3TQTA 4B82A 1ES9A 2LGJA 2G4LA 3OF2A 1D1QA 2VP5A 3E03A 5AW1A 2OQRA 1P1KA 4JLSA 4G89A 3SSAA 2RHDA 3P9PA 3THSA 3BEOA 3EYWA 1SD2A 2OV6A 1LJUA 3JAKA 4AN4A 1KTIA 4U6NA 4ZVMA 3MFQA 5DP1A 2YZNA 2I4MA 4OI1A 2CHGA 3U4QB 1GQQA 5G1PA 3U56A 5B4VA 5A3VA 3T7CA 4O1IA 1VFNA 2D1FA 4LF9B 4LWZA 2BRUA 3AR7A 4G1BA 4GZMA 3HWSA 4ZKDA 1BHO1 1JJAA 4PG7A 2BKEA 2PSJA 1BAPA 1K66A 5JTTA 1FPMA 4IJ6A 3RTAA 1E8MA 1UJ6A 1KORA 3E1KA 1E3TA 3JAKB 1CKEA 2EW1A 4HH0A 4MVJG 4QHTA 2GJAA 4YCBA 4C9BA 1ZNXA 2FSSA 4JKYA 4AUMA 2IOQA 3QPBA 3AB7A 4NESA 1CP3A 4XSHA 5EIOA 1MHTA 1IAQA 3KKZA 3CLUD 5DCWA 1KFCB 3ROXA 2WIBA 1HR0B 3VNRA 2ZQ5A 4K9PA 5KTRA 1Z0IA 1N1MA 2P2CA 4PCVA 1CJUC 1U9JA 2Y0DA 3JS5A 2FZLA 4NG5A 4OBEA 1ZG3A 3E3MA 5I9SA 3HYCA 3W90A 3IVCA 5AVWA 1RXVA 4UMEA 1N34B 1OQAA 2HHCA 3PHLA 4QXRA 2R00C 4DGSA 1ZD1A 1TW2A 2BFEA 3B60A 2DWQA 3DV2A 3F9CA 5HKKA 1G60A 5JYBA 2XQJA 2O8FA 4I36A 3HJAA 1QCYA 4D81A 2IVZA 1VJTA 1YR6A 2QD5A 3HXPA 3JR7A 4AJ1A 5CB6A 4EJ6A 3P2JA 1JLKA 1KY5A 3FF1A 3GLUA 5DSXA 3G59A 1II9A 3FHCB 3VU9A 4BKPA 1N8SA 4BMSA 2BKAA 1L4KA 1TIPA 2FKNA 2R44A 4PR3A 1S2NA 1WPXA 4RZ3A 3T41A 5C1OA 3FSJX 2BFEB 1P7YA 1KO5A 3DEKA 3M8KA 4PE5B 4PEVA 4CLXA 3GLFA 3OIUA 4K6GA 4PFKA 1G6KA 5IT0A 3SYLA 3NTOA 3DB1A 2O8FB 4TQGA 3QTTA 2PD3A 4FONA 4CV3A 3MK31 3H99A 4KAAA 4ZAVA 1E1DA 3KAPA 1ZCFA 2KW5A 3C85A 2WHPA 1R5OA 2H5IA 3KBOA 3ZJTA 2BEUA 2J3JA 3GMTA 4I55A 5KAPA 1HRKA 3ABQB 4UQLA 1AOXA 3ZVMA 3A4YA 3SQXA 1BDJA 3FMFA 1N0WA 3HI6A 2GA8A 1QRAA 1RXEA 1S96A 1L5LA 2TYSB 5J4KA 5K7SA 3GLFB 1O6ZA 2DOKA 4UKDA 4O5OA 1G17A 2MU1A 1U8EA 5EJFA 3LYHA 4DIMA 1UFOA 3G6KA 5EKSA 5HDBB 3OM9A 1WIWA 5JADA 1E8NA 1N57A 2GLUA 5DTEA 3JQQA 1D0VA 1SVMA 3T7IA 3RV3A 3PGVA 1G7SA 3LFHA 3H17A 4N5DA 3SEZA 3KX2A 5KTNA 4G25A 4LHYA 2JHPA 4KIGA 1TLFA 3R1IA 4WLVA 1XDSA 3MS4A 1U90A 3GEPA 1WPRA 3WS7A 2BEUB 3ZIUA 4I55B 4BDTA 3ROGA 3KXLA 4JMPA 1GKLA 5JDCC 2J3QA 3H2BA 2I8LA 4KWCA 5KTTA 3RHZA 2WF7A 2LPMA 2KYRA 2O20A 3VVCA 4L3WA 3LPAA 1DEXA 3C5HA 3IVXA 4RACA 1UWVA 4PLTA 3WMFA 2QPLA 4HNQA 1VXOA 1L7XA 5TQVA 3H9GA 4QLOA 1GQSA 2M98A 3L18A 2J08A 2XW6A 3OIVA 3BCUA 4L7QA 2IW1A 4MS4A 1GT6A 2F67A 1ZKDA 4JC0A 3U3RA 5JRZA 1EGMB 2O8CA 1T5HX 3HVIA 4UEQA 2ZI3A 2AR9A 1Y5IA 5JCXA 1IXYA 1J99A 4BNJA 3BRSA 4DFDA 1IQUA 1EHCA 1FBNA 2YCLA 5D3KA 4BKOA 3EPHA 5FOSA 1YZHA 4BX3A 4M1EA 3N2GA 4PRYA 1J25A 3OSUA 5JSUA 5LBTA 2P62A 4JT9A 2P4QA 5C81A 1EXWA 1XKXA 1MX9A 3LC7O 4JLDA 4M60A 3UMBA 3ZW8A 2QJWA 1Q91A 2JJMA 3H3JA 1QCDA 3DE7X 3HP1A 4RD1A 1L5VA 2R6DA 4E2XA 3DXZA 3FGOA 4XRRA 3T5PA 5BSFA 3Q41A 1JG7A 3L77A 4PBSA 2FMFA 3NKVA 2O8CB 3PFGA 3SVTA 3L9WA 4E32A 1ZEJA 4C4ZA 1FFCA 3PFWO 1FTYA 1IVYA 4QM6A 4W8GA 5JNLA 1CUJA 2HWWA 2JFWA 4DCUA 3QEAZ 2ZSHA 2Q0QA 2QEQA 4YS6A 1H22A 4NNPA 4YRAA 3N2GB 3K8OE 1V4VA 1YQEA 2AW5A 2YJTD 3OP4A 4LUCA 1XJ5A 2HRQA 4MRVA 1J2TA 4W9NC 5B1SA 1UK6A 2EG9A 2GZ3A 2M6SA 3GJXC 3OU2A 5EE0A 3CVWA 1DAIA 2I7TA 2RSLA 3M3PA 2A0WA 1G5QA 2YXLA 3PQDA 3W79A 1EWYA 3HA7A 4EJ0A 3WRWA 3M5DA 4OB8A 3HY6A 3CZQA 4IL5A 5ISMA 1H2ZA 4QLAA 2V54A 2IXFA 3GEHA 4OA5A 3GVXA 2P0YA 3K16A 3QI7A 3KV1A 4D0RA 4I2NA 3SI7A 5DWDA 1Z7BA 2C4KA 2EOAA 1RVDA 2YQ4A 2Z8XA 3UKDA 3LFUA 3KJEA 4K8RB 1HDGO 3KT0A 5FJIA 3LZ6A 3G9XA 1SHZA 1SZDA 2AEEA 2I2BA 5B4UA 5MFZA 1D09A 3CUWA 1ZW1A 3GJ8A 1Z9BA 2EQAA 3KJHA 3MT0A 1XD2A 4XVUA 3K0AB 1E9EA 3DEHA 4FBMA 1XVUA 1QDLB 4I55F 1X7XA 4PC3A 5AJHA 1QLWA 4JOQA 1RAIA 2Y2VA 1U8UA 3AKDA 4LYHA 4FSXA 4AM8A 4JXZA 2HWYA 5FBWB 3R74A 3B85A 1H2BA 4OFZA 4G0YA 5FA6A 1YONA 3L4EA 1UOQA 3ETNA 2GPSA 2QG9A 2ZM5A 4FLMA 3QI2A 2QUJA 3T12A 4G3XA 2V5AA 3FLAA 4G24A 2RGXA 1S2DA 3HUTA 1WXEA 3NAGA 4R2LA 5I7HA 2BI4A 4G2TA 3WMXA 1QFJA 1LDEA 1GTVA 3CCFA 2ZQYA 2WDPA 3VR0A 4E5UA 5BWCA 1V8OA 3ND5A 3TNYA 1UDRA 2RI0A 3DZDA 3LOQA 1XD2B 4OHPA 4D6XA 2GSWA 1E5TA 1X7XB 5MGNA 2ZRFA 4A0GA 3SVLA 3T38A 1GPKA 2CLEB 3AR9A 3ESZA 3S8YA 2Q50A 3QUSA 3Q5DA 3W8FA 1JSZA 2EIXA 2D5AA 3T3IA 5ALJA 4BDSA 2VSFA 3VNSA 2W5UA 1DTWB 1J56A 1ICIA 2Z5GA 1WTCA 2FWRA 3H13A 4DWWA 2NZ2A 3L6EA 2N9UA 2VF7A 3FYSA 4NBNA 2Z95A 4KG7A 5A7FA 2DKNA 3ADOA 4EUHA 2PHZA 2ZRHA 1JXMA 3IEUA 3SZUA 4EO9A 3LDHA 5ER9A 2VP6A 4EJ2A 5D1HA 1NXOA 1BKDR 1POXA 3DMHA 1ELOA 1DJNA 1TW3A 4GKBA 4MPRA 1Q0SA 3DKVA 4Q34A 4D8WA 4QUJA 4EG3A 2WOJA 5FQNA 3PQFA 3QFCA 4GM0A 4ZZ3A 3PHGA 1O0CA 4K9NA 2NZYA 4GP7A 2AJDA 2CZGA 3P2OA 4B09A 2AUTA 5K45A 3H3XA 2HI0A 1II8A 3ZY4A 1U3VA 4RHUA 1E1NA 4E5MA 2XCRB 2DFLA 1E32A 1T2UA 4CTOA 4O0MA 1KJIA 3HR8A 2QE6A 3OZDA 4KBYA 4Y2UA 1SOMA 1AD2A 4K6HA 3K0HA 4IUDS 4BB9A 2LVBA 3W3AD 1N8KA 3R9WA 3QEKA 3QHQA 1VXRA 2HMVA 1I4OA 4JODA 2HNAA 4Q4JA 1A4RA 4RHFA 2V0NA 2Z9CA 1F0PA 1GLNA 4C6TA 4IDBA 3VR1A 1A9RA 3BBPA 1BD4A 3OICA 1TAQA 3H65A 3CW2A 3ZVRA 3SU8A 2GT1A 4BO0A 2FR8C 3I28A 2QTBA 4FFLA 3AUFA 2IXEA 3H2IA 4UU7A 3GDHA 2QL7A 4BV8A 4ZCRA 1II8B 1LLFA 4D8XA 1QO0D 3UT6A 1VJ5A 1WOYA 1MKYA 3L7NA 2P65A 3U5ZB 1DMSA 2C4WA 1ZVMA 1UC9A 1J09A 2FYTA 5CIQA 2PXCA 4BO2A 3RW9A 1Z0ZA 4TV8F 2ZREA 4Q4JB 3GGCA 1KVTA 1QQ6A 4IV0A 1I2CA 3BZBA 2EJVA 4GOND 4C6TB 3CCBA 1PZHA 1E62A 4J2HA 2JCVA 3EHDA 4K81B 1L1FA 3KHUA 3PTAA 4MRSA 1PT6A 3QMVA 5HFJA 4M8LA 3J81A 1T10A 2DLDA 2ZI9A 4GSKA 1NYQA 2HJ9A 5FPSA 2ODEA 2GBIA 5MGBA 3VH2A 3ZGNA 3WWCA 4AKSA 5SZJA 4G4JA 1SG0A 4A2CA 1Q6ZA 1MZPA 1PJTA 3HBLA 4Y0AA 4F21A 3ABRB 4DUPA 5HRAA 3EGCA 1G8GA 1OLSA 1FU8A 1NLMA 1VE6A 3MXOA 5AM5A 1KE1A 3ZGZA 4RXMA 1F2TA 3J7AC 3U1BA 1RWKA 1I32A 3OE4A 1V5EA 3O2JA 4IEFB 3N3AC 3LI2A 2WW8A 4GOKA 4JYPA 1C8KA 3L8YA 1YVPA 2Q3HA 2JEYA 2WB4A 4FK8A 1RACA 3K1YA 2IY9A 5FAKA 1JYSA 1YFZA 3JPWA 2CC2A 1W75A 1GJRA 3C1TA 1ZOPA 1OLOA 2R9VA 3FOZA 1F2VA 2GO7A 2BFWA 4E7PA 3DJFA 1OZHA 2HLNA 4F2PA 1UC5B 1CETA 1RWXA 3K9FC 3E23A 1O94C 1OLSB 1R0CA 1OH6A 1F2TB 4P5EA 5EWJB 3S28A 1ISGA 4HEA6 4DB2A 4L74A 3W1EA 4EBBA 3TLGA 4XYMA 4S04A 3MBIA 2X2EA 1Q84A 2C4MA 4OM7A 5H3CA 1ULSA 3OQVA 1E0AA 4FQ7A 3ZXYA 4IUCS 1J0XO 4N5HX 1QOPB 5E7JA 3E3AA 3IQZA 1XMJA 4EDHA 5E1DA 1GM5A 2XE7A 1GKKA 4O25A 4XWTA 3V8NA 5JWRA 1YVEI 4DF3A 2EIHA 3N0XA 3M9LA 1Q16A 1GAQA 3ETJA 3IOYA 2WT9A 4GLBA 3PGKA 4OLJA 3HB4X 4JI2B 1F8FA 1UQUA 2HMTA 4EABA 1YU9A 5EIBC 4ACBA 4WZBE 3R5HA 4ZYUA 3G0BA 3GFOA 3GJ4A 1OBHA 1P6QA 1XR3A 3L1UA 3GLKA 1P81A 3IUNA 3GJ5A 4CV1A 3W3AA 1A71A 2VHWA 1Z68A 1Z4MA 3H8VA 2A92A 1K7EB 4H7JA 4YALA 5CLFA 5LPNA 1C4WA 1M34A 2VT3A 5EL0A 1H6AA 2XE4A 3R3WA 4F9TA 3EIHA 2ET6A 3K05A 3PUIA 1OJ7A 1KP2A 2BGLA 4JX9A 3LT1A 1UPFA 1QONA 3BWCA 3FA2A 1LPAB 3QOXA 4RYDA 5JAMA 2XMRA 3IAXA 1SOAA 3JYLA 3NUZA 4BN0A 4ZCTA 3KQKA 4H3KB 1QO0A 3EWNA 2CBGA 3NYRA 4ZO8A 4YCLA 3TJRA 4RJLA 2IRWA 1JFTA 4AS1A 2HBQA 3A31A 5CAEB 4WJLA 1OUMA 1Q7BA 2RHRA 3OCCA 2V9PA 4TYPA 5LWHA 4A0QA 4LJLA 2CHEA 4J43A 3L1JA 1M34B 4OHKA 4XZ3A 1E3DA 1LNQA 4QJ4A 1RYEA 1BEUB 1BGWA 2VQDA 4LVNA 1WCYA 3TL6A 3F5SA 1NFFA 4NEHB 4Q3BA 4NZMA 1S4QA 5FBKA 1OU4A 3QM1A 4UUOA 1BD3A 3ACDA 3Q2IA 1Z39A 3Q7QA 4HG2A 2PZMA 1V1MA 4W6ZA 5CH3A 4P22A 2CFCA 1NI3A 1HNZB 3WK6A 2XHEA 4FFWA 4CUJA 2Q8NA 2VAVA 3DLTA 4B3MB 1J8FA 2Y1XA 3WK5A 1HOTA 1YE3A 2MHCA 3LH5A 5EQFA 5F1OA 4D8YA 4Z1MD 4BKUA 2GXAA 3AKYA 1SB9A 4YO8A 2R6JA 3TCXB 4AKTA 5I3CA 1MEEA 2AYZA 4C7KA 1XC7A 2ADMA 1G7TA 5TGZA 2FN4A 2JBAA 1OIWA 4RY8A 3F7NA 4MW4A 4OLHA 2QQ0A 5D00A 5LBIA 3QY0A 4I5GA 1PN3A 1V7CA 4KYTA 1U04A 1KNXA 1BO6A 1V1MB 1Q3HA 3IPYA 4GXTA 3ZWAA 5CFQA 3G5MA 1UJMA 3KKEA 2VAPA 4PIPA 2BMJA 1Y7PA 2ON6A 2I54A 5K3BA 4IFTA 4HUTA 2CLKB 4XE5A 5E4FA 4TYWA 4PZCA 3IAS6 1RBZA 4Q7JB 4MJXA 4GL4A 4RL6A 2B7LA 3P9RA 3P9XA 4JVMA 5HFAA 4EFKA 3CS3A 3NOXA 4H7FA 1QVVA 3RI3A 1PBNA 3CPSA 3BD6A 3CONA 5HQJA 3R24A 2JBAB 2HIHA 2LTAA 3AP3A 3MJCA 3GEEA 3V8QA 2GJ9A 2I2FA 2JFHA 2TECE 5JSZA 4RABA 1OD6A 4XRGA 4DIFA 4RM2A 5IAOA 1PT9A 3FOBA 1V9CA 1FSFA 3RVJA 4B6SA 5LJIA 2DBVO 3K3PA 5HXAA 1QPGA 3AQIA 4LSGA 1L3IA 5B36A 1TCAA 2JGMA 2GAAA 4KN8A 4QTYA 3W5BA 2CNNA 2BC9A 3OLXA 1FFYA 1ZOOA 3ELDA 4J0QA 4NJOA 1HLDA 1EFCA 3CT4A 3CX7A 2FLVA 3FM9A 2ZSAA 1EFPA 4YROA 4D2IA 4W8HA 1QFXA 1X80A 4BQFA 5CUQA 4B0PA 4IIHA 3LL4A 2QT1A 4OMCA 4EECA 2Y1LA 5JSZB 1ITZA 4NFHA 2PA3A 4TOIA 3RAGA 4AX4A 5J47A 5IKEA 2FDXA 4QU0A 3P27A 1Z88A 1NUPA 4CEIA 3L7IA 2L19A 3ESDA 1XDUA 3O74A 2Y05A 2GCPA 3NEAA 4RSRA 4I1UA 4ZT2A 2J48A 5J5AA 2W42A 4MHOA 2DC1A 4XVQA 1OFTA 1EFPB 4J4TA 3UWOA 1W85A 4JT4A 3BXEA 2BUCA 1X80B 2E6KA 1F7VA 1SEPA 5A06A 5BWLA 1RJWA 3MTBA 4DA8A 1EUQA 1JAIA 1XP5A 2WUVA 1YR8A 2VNKA 4Z49A 4LF4B 3HVRA 5TVKA 1EXMA 3CWQA 3GCWA 2ATXA 2EHDA 1TVEA 4HS9A 2MSEB 5E6RA 4JQCA 1P72A 3W4KA 4B5LA 4UDYX 4CEIB 4I8IA 5EFOA 5LZ7A 4NYJQ 3SEQA 4NMXB 4QATA 1R50A 3FPFA 3IHLA 1DKUA 1SQSA 3BMOA 3RFCA 4Y6RA 3COWA 5LOVB 1V35A 2OQIA 1W85B 3ZEIA 3RIYA 2Z56A 2VPQA 4EFLA 4EG4A 1AQUA 2FEKA 4LQDA 3Q2KA 4OGWA 3RBXA 3TG2A 4WNCA 1DLIA 3WBJA 1KMHA 4KPEC 1X1EA 4U8HA 1BQ3A 4Z1MA 1IIBA 5E6RB 3UMGA 4M9ZA 1RLMA 3NATA 1LKZA 3PGMA 4WQMA 4YCMA 2FEPA 2I1VB 1Q20A 3BMOB 2ZETA 4GOLD 3NX4A 5IVIA 1IK4A 3KB1A 3WZ2A 3QLUA 1Q2UA 9GPBA 1Z5ZA 4L7VA 1C29B 4ZOCA 4KLCA 1P91A 4KV7A 1N1GA 1E2QA 3M4YA 5EE9A 3VO2A 4BOYA 5LZ9A 4U8GA 2GWHA 3CR7A 2ZSBA 5FTLA 1YRYE 1M6VA 4DZRA 5LQSA 5K4GA 2Q2WA 2JA2A 3EZ9A 1UOOA 4U02A 2Y68A 1RC0A 1ZLYA 4AULA 3ER8A 5D87A 2EP5A 3S27A 5JRDS 1TCVA 4LK2A 3SIPA 3WMEA 1WW3A 4R1UA 3RQIA 1MXHA 5BMOA 2UZ4A 3F6CA 1SU6A 5ERXA 1I1OA 1P80A 4D97A 1KARA 4ZHSA 5A4AA 3EVFA 4MR8A 4P92A 2CKMA 4K9KA 4BZXA 3FCSB 3ZGXA 1AGNA 3K8YA 1DHRA 1T0UA 2PWZA 1FUIA 1M6VB 2BBOA 5JFTA 2OCLA 4JFAA 4R1MA 3TPCA 4MUBA 4G23A 3H1GA 4R6XA 3EVGA 1NIJA 5EVCA 3BJRA 3OECA 2X0RA 4JB3A 3Q7EA 3I2GA 4M88A 4UZEA 2V0GA 2NU7A 3RAFC 2GILA 5REQA 1L5WA 3RREA 1O96A 1EWTA 2YS7A 4MR8B 1MORA 5EJAA 1EK0A 5C7LO 3FPAA 1DAFA 5K3EA 3FVWA 4LISA 4JBNA 5DP2A 2HXSA 3UJ9A 3FTEA 1GXSA 2PRJA 3QOWA 2OB1A 2W90A 3ZV7A 2Y0BA 1KAOA 1V5WA 3GJ0A 3JQRA 3LT4A 3PITA 1Z0UA 3DFKA 4X0EA 1XXHA 3WHPA 4A73A 4QODA 2C5AA 3RO7A 3KQLA 2DR0A 3ZBUA 3WLIA 4C29A 3QXCA 4FIZA 5ALLA 3NWJA 3ZDEA 1J1UA 2V3VA 2R7LA 2NU7B 3C6BA 4TXJA 4H7EA 5REQB 4FFDA 2C07A 2ZEJA 3OLVA 4AO8A 1O96B 1H5NA 3IELA 3KAKA 5H7XA 5LOVF 1OTXA 1Z5NA 5JAUA 1ZRMA 3TOZA 3THWA 1PF7E 5CB0A 1I14A 4MI1A 3KZVA 3G1UA 4Q9AA 1Z2DA 4DZTA 3AI1A 4ENPA 5BQFA 5D6NA 4FGJA 1PJ3A 1GXSB 3CUTA 4KIUA 1PJ2A 4M2LA 2GUGA 1A8SA 2QJRA 2WKWA 4IDQA 3WWPA 3ZGLA 5A6SA 2QUHA 2DGDA 1KGDA 1XXHB 2OBNA 2ZYAA 1VM6A 2EEZA 1YS7A 2V4UA 1BCSA 3G1TA 4TM8A 3WIDA 5K2MA 5E7IA 3PC7A 4FJ0A 4XYEA 1Z0KA 3I2JA 2WSLA 4OP3A 3T7JA 1NSTA 2ZJ5A 1GDTA 1RTTA 2EJWA 5HF5A 1KXZA 4F45A 3THWB 4RJJA 4EVSA 1GRCA 1NBAA 2OE2A 4GT1A 2H3EA 2G09A 1UDBA 3RK4A 4PG8A 4L4XA 1GL3A 1YS2X 1U5AA 3PUXA 1V8FA 1IWBB 3L7JA 4JB2A 5A6SB 1KMCA 1WD7A 1TCUA 3GVHA 1Q74A 4NOLA 4P1ZA 2OD7A 2GYUA 1ZMOA 3ELWA 1JIUA 4YAWA 3WY9A 3LHIA 1UQRA 1WNTA 2ZBPA 4BFZA 4R5HA 5E0OA 4AU1A 1FRVA 2G04A 2YHUA 3IEPA 3BQ9A 1DQSA 2GPTA 4GQBA 4I19A 1Z4NA 4DG5A 1VHLA 1YQGA 2GA9A 2VUSA 3IXQA 3Q6NA 4HB3A 1XTIA 2XMSA 4B83A 2WWHA 3SLGA 1BXZA 5K51A 2R0QC 2PL3A 3EIEA 4Z2AA 3VV3A 1CS0A 1DIRA 2JHAA 1K8RA 3JQFA 3Q3CA 3E48A 5I8WA 3FR8A 3GAZA 5KYNA 5AUPB 4KPUA 1NVAA 3W34A 2ONKA 2GAJA 2X13A 4HFMA 4LQCA 4OEHA 1ZDMA 3TEFA 3SDSA 3W2TA 1JIKA 4JENA 4Q3OA 4MKGA 3HU3A 1KO7A 1BE0A 2VHCA 4PS1A 2GD2A 3N8GA 2FUEA 4J9UE 1ZRNA 2J5XA 3IEXA 3D5QA 4J7AA 3K6KA 2NVUA 3QJGA 4Y7DA 1CS0B 1E7QA 1GV0A 1SCBA 2OV1A 4GSYA 4IFBA 3AVPA 4R2MA 5CU7A 2NMVA 1RT9A 3BMCA 4IXNA 4KPUB 5JI3E 5A5VA 5TB5A 2V9ZA 2VO1A 4IY1A 4IJMA 3OOSA 4QOEA 2ODAA 1VSUA 4LJKA 2AN4A 2VPWA 5EI5A 1R9MA 5LZ4A 2ZJ7A 2FWAA 2V7XA 3CE6A 2WYUA 4PONA 4GX5A 1CB7A 4ZU1X 2IWRA 1YK1A 3E53A 3SS9X 3TXYA 3EPLA 4N7JA 2W6QA 3LA8A 4HQ6A 3NETA 4D4MA 4H4DA 2Q49A 2QYHA 3BPSA 3GPDG 1NVDA 1G4AE 2YV1A 4UMDA 2ZRGA 2ATCA 2NVUB 3TDMA 3L7BA 2OCIA 4YDSA 2GAOA 5CJ2A 1AS0A 2CNOA 1XJ0A 4EA8A 5JBQA 4N5LA 3BMCB 2ZSFA 2ZBRA 2OA0A 4BFCA 3I6YA 1DEKA 2LBPA 4P5DA 3BMQA 2H7CA 2JGAA 5C4GB 4F2HA 5KU1A 2X5NA 4GVPA 2JZNA 3MTDA 3ONDA 4GBED 4NYJR 5I7RA 2CHVA 2JFVA 4G4GA 4OA8A 1APBA 3I1JA 2VT7A 1SXJE 1M66A 3AM3A 1RPJA 4QPPA 3U0BA 1TM2A 1D5CA 2JB9A 2P79A 2P0AA 3WNBA 1IVNA 3DYVA 1N2EA 1TYAE 3UOGA 1CR4A 3L40A 5DISB 1FFHA 2NZXA 5EY5B 1XMOB 2NT3A 5DHQA 2FJ0A 4S0ZA 3H2YA 4KO2S 4CE6A 4DCSA 1BEEA 1PQWA 3GEGA 4OU5A 2P2GA 1H0KA 2OR3A 3BMQB 3OTGA 4O6VA 5GONA 3SC4A 3V97A 1J21A 1B7GO 2Y1GA 1WBBA 4I1IA 4PAOA 3UUGA 2JIQA 1A5AB 4D7AA 2PE5A 4G6ZA 1H5UA 1B4DA 2ZE6A 3AFNA 1P77A 4WJKB 4ZO4A 3QOFA 3ZDFA 1YCGA 4BVFA 3Q1LA 1PG2A 4FGKA 1U5CA 3E7XA 1RWMA 1QHHA 2DHRA 4N7BA 4PU0A 3S4YA 1NM5A 1EE9A 3BGOS 2X8AA 4OSEA 3D3KA 1PR2A 4FC6A 3SF8A 1TO1E 2ZBUA 2BKVA 3KWMA 4FOSA 2TMDA 1MIHA 1Z5UA 2SICE 3OIFA 4PZEA 1OZ0A 5EXEA 1I6WA 5GONB 3TDKA 3SQOA 4DVGA 5LUAA 2VHTA 1FQJA 1HE2A 1UK8A 4H17A 4OKIA 2MWMA 1QKIA 2X9GA 4WEOA 3U61B 2OBXA 3FFXA 4HXFB 3DEZA 2R1VA 3R20A 5CK5A 1BDMA 4GBJA 5EE3A 3X2EA 4W5QA 5ICGA 3QX3A 1UM9A 1UFVA 1QG2A 2GJKA 3IJPA 1QH9A 3G0CA 1QHHB 2DECA 4P4SA 2OFWA 3K2EA 1X6VA 2NUAA 4DBLC 2X8LA 4FHDA 4D26A 2Q4BA 2VR1A 3F9RA 3ZE9A 3SF8B 1VE3A 5L51A 3H5IA 1MO3A 1G42A 1WR8A 2CZCA 1K5HA 4RDCA 2YVAA 5T4EA 3M1IA 3REQA 4UXHA 4BP3A 1QHFA 1ZD2P 2F4NA 3QYJA 4PX5A 3DDZX 4AS3A 4AMYA 2IHBA 1Z13A 3NVAA 4OHXA 4EELA 3OZGA 5HW0A 1WW8A 3E7PA 3ER6A 2R1VB 2M32A 2QAGC 1RRFA 4B3DA 1Q7TA 3G8CA 4HMQA 2NGRA 1NMZA 4RMHA 5AFSA 1T0IA 3C1AA 4DBVO 1LW6E 1FXUA 1T29A 4ZAWA 3GROA 2HHLA 5CG1A 3AF1A 4HGZA 3H42B 2J6HA 3D6MA 2V7UA 3D8UA 2D4HA 3REQB 1BDBA 1B2RA 1PWEA 5ESWA 5B7PA 2ENUA 3TBFA 4K03A 3WLKX 1XA4A 2VK2A 2V3WA 4KB5A 3RS3A 3O8QA 3ZY2A 3ZXSA 4QVIA 2GJ4A 1A7KA 1O9HA 5IBCA 5DWQA 1ZISA 1W581 1LUAA 5B3LA 1VPVA 3VKUA 1I2MA 3AVUA 1XL0A 5BQ3A 5LD2C 1XA3A 1L5GB 3FGZA 4RVHA 3PRYA 3KSBC 5JJBA 1LQUA 3HN7A 2CNDA 3IVRA 3RYTC 1D2RA 3U7FB 3AVWA 3RRBA 3E5NA 4P84A 1ZKMA 3NXKA 4GZ5A 1V3UA 3CE9A 2FSUA 4HEA1 4OSOA 3O8QB 3PUYA 3E0XA 1QWSA 1SBHA 1GRVA 1JTVA 3OX3A 2FPGA 4I1VA 5KX5F 1D2AA 1UM8A 1ZK3A 3DCJA 4LG1A 1J90A 1RD4A 3QVXA 3R7SA 2XUDA 3HYNA 4DL9A 5EZYA 4R54A 1H2FA 4FCWA 3EXG1 3QG5A 4DMCA 1H6BA 5LMUB 2V6JA 4RU1A 2FRVA 3K4HA 2I6UA 4JLMA 1C7ZA 2DPGA 3GFGA 3KVNA 4FT4A 4TN1A 1QGAA 4LSMA 3FB1A 1FTGA 3FCOA 3LBNA 4ERNA 3O3OB 3VZBA 2ZPAA 3M5WA 3MUNA 4YP1A 4B4KA 4IKPA 2O0JA 4XASA 1T8UA 3PNYA 4KWHA 3HKBA 1Q3KA 4UZFA 5K8LA 5DNDA 1T6BY 4GS5A 3TSWA 2C5SA 1PL7A 1QSGA 2FPGB 2QGNA 1N3BA 1PFVA 3BEDA 3QWFA 4CT4B 2QG6A 4DCOA 1ADGA 1U9IC 3BAZA 3KD3A 1TJNA 1UK7A 3Q1KA 4RLHA 5EZYB 2JGLA 1CR1A 2VA9A 2CNWD 4EHLA 3CUYA 1SU4A 3EQZA 2DY1A 4JLNA 5HKLA 6LDHA 3ER9A 1JI3A 1TPYA 1ZFNA 4LBZA 5K8IA 1PNRA 4Q03A 1UJ4A 4JOCA 4E2FA 1KWKA 1CK4A 3KL2A 2OZKA 3FZYA 5BUZA 3OETA 2VP3A 5TXGA 3HKBB 2BOVA 4L3VA 1Q0QA 1R0LA 1I2ZA 1F3LA 3EDQA 3PEFA 2VF2A 2ZRCA 4KOAA 5I8ZA 4MGIR 4RL4A 1W1UA 3BULA 3C74A 3G3EA 4B33A 5ALRA 5JSQA 1K7CA 3AVOA 1ESZA 2P6UA 1YAJA 3FGNA 2AOVA 4JA0A 3HGTA 3K0CA 5T4BA 1NF9A 5BNZA 2J07A 2J5RA 4GZ3A 5CB4A 4C2UA 1LVHA 2DQZA 5LFAA 3LFTA 1YQDA 2UZ1A 4EBFA 1EK2A 1XB2A 2PRIA 3G2LA 3LUCA 3LXRA 2H1HA 2ZIXA 1KP9A 1KJYA 1JVSA 2GN6A 2OZLB 5JO0A 1UZNA 2XNSA 2VQ3A 4XTRA 1RDFA 3ZZUA 1ZI6A 1CZUA 3N87A 3A9SA 1KA9H 4URVR 3GDGA 2R8ZA 3GEBA 1BJKA 2H7YA 1X86B 4TMYA 4DYDA 5ALVA 1Y89A 2CL0X 2RARA 3ADCA 1JEAA 1NNSA 2IYPA 4FMPA 1V8PA 4N7RA 1ODLA 2BFNA 3W5CA 4YRQA 5CB4B 4ZP1A 3SHOA 1EMDA 1RCTE 3B1JA 2B20A 2DBQA 3DTNA 4Y6QA 4TL6A 1YQTA 4PO1A 5DLPA 3GFFA 4DJEC 2ZIXB 4H7DA 1TM4E 4A36A 5ICFA 5JS8A 2R8YA 5EJEA 2ZBEA 5AOBA 4TSFD 5K6AA 4NEQA 1KMNA 2IKQA 2PKXA 1Q57A 1M6EX 3TR5A 3RPEA 4ZFNA 3AR2A 2WWTA 1Z2NX 3VR6H 1H2HA 1AV7A 4W7SA 1IN4A 1VMEA 5EIXA 4AJ9A 3LDGA 1T2NA 3DCYA 1NMEA 1T8WA 3L7MA 4J0CA 1E2HA 4KFCA 1G3UA 1J8MF 4MHTA 5A0TA 2RFLA 4AAYA 3I53A 2AZXA 2C58A 4MYTA 3VHLB 3H9UA 7ADHA 3HA5A 1PFKA 2BFDA 2HRZA 2QORA 2YHAA 3EEFA 3M6VA 4AY2A 1C9EA 3F6EX 4PBRA 4EPVA 2CW5A 1WTAA 2XDQA 3EQ6A 3SZLA 4WFQA 3WHKA 3HGMA 2R86A 2ASEA 2CJYA 4RH3A 5FWXA 5H02A 3DFIA 5TGTA 1LVGA 4ESOA 2CHFA 5HK9A 2UDPA 4ZT5A 5AUOB 3NEYA 4JBLA 4DQ0A 5C32A 2IXBA 1WM1A 1XLTA 2CXOA 3D2BA 4PHTA 4G37A 1JV2B 3MCUA 2BR3A 3FHTA 2NZUG 1I0IA 721PA 3HDVA 3A3KA 3PPWA 2RGRA 4ZYXA 4DNXA 1YZNA 2OV3A 4EW3A 3LDFA 3L92A 1U8AA 1SBZA 5I5EA 1NXVA 1DUSA 3C43A 3DTTA 4NL4H 5DHPA 5CFZA 4PSAA 4GDMA 4TZTA 4G65A 5FWXB 3SOZA 1KBOA 1Z18A 1ZD8A 1M3SA 4CDNA 1Q2XA 2B6HA 2PFGA 4EI7A 5IM4A 4DM3A 5B6PA 3TW0A 2CNWA 2XQFA 4KKXB 2FSHA 4RWZA 2HREA 2AJLI 2QL9A 1NJFA 3AUYA 3I5AA 5LB4A 1Y4ZA 1TJ4A 2C7RA 1CDZA 5AM1A 3MGGA 4S2EA 2MSCB 1A82A 5CYFA 1H65A 1OX4A 3PNVA 3CYFA 1T6XA 1PZFA 3ENZA 2P30A 4IQGA 4ALIA 3FFBA 3I12A 5AVYA 5KOIA 1DP4A 3VTFA 4DCGA 3M7IA 3OF3A 3X2SA 4ALMA 3MC1A 1GG5A 1R6DA 1GZ4A 1D6NA 1RZVA 4KRGA 3CTPA 3PUVA 2OB2A 3RASA 1XZMA 3G9ZA 5A62A 4MRMA 2ZIAA 5JDIA 5IVDA 1G6Q1 2MIIA 4OB7A 5IFLA 1GAWA 1PJCA 2B3DA 2I1WA 5EFZA 4ZEMA 4Z54A 1XOIA 3KLMX 1OX4B 1XVIA 3ZJ5A 2CCKA 3CUVA 4Q93A 5H59A 2OZVA 3TOCA 2OSVA 4R8KA 1DZ3A 2JLCA 4FI3C 2OCGA 2EKBA 4L08A 3V4SA 1UPTA 2DX7A 4MOWA 4IIYA 2ECQA 3F96A 4NAHA 1ZP6A 2JRLA 2QTZA 5I5GA 2KS6A 1JDSA 1F51E 1P45A 3DXXA 2C2XA 2ZU6A 5BT9A 3I61A 1IG3A 4MRMB 4WOKA 1X9IA 3CX8A 3ZOZA 1EYZA 1P0PA 1GITA 4FGWA 4PBTA 4EZBA 1QC5A 4OX9B 1N6OA 1ZMXA 1U2EA 5DZSA 3HSYA 4TSFA 2XMGA 4B81A 1A3CA 3I9LA 3ZQJA 1SVSA 1G8JA 3C7KA 3UC5A 1TZCA 3N76A 4R1PA 3NTQA 1ISJA 1HEIA 4CKEA 3BGVA 3HACA 1CJBA 2G28A 5AJYA 1YJAA 2WM9B 4GC9A 4O29A 4KE8A 2J31A 4RH1A 3T5TA 3TINA 3PSHA 4KHZA 4M8NE 4MWGA 2IS2A 1OWOA 4PINA 1Y8QA 4LXUA 1AO3A 3LE8A 4OHCA 3LZDA 1QC5B 2VP2A 3E18A 4NFSA 3PUHA 5DM2A 2F3SA 3VISA 3IALA 4N0DA 4Y9SA 2CWDA 2FI1A 5BVHA 4RQTA 4GZ6A 3ZWYA 1F4VA 2V03A 2EW2A 2P8JA 3SYNA 1O03A 5I7WA 1DTSA 3DSRA 4FNMA 4JC4A 1GZVA 4KUEA 4CKEB 4F4FA 1UBSB 3G0IA 1V96A 2VEOA 2GEUA 2VWHA 3L7YA 3F2VA 3IILA 4YCAA 4DCCA 5HKOA 4JI7B 4PPYA 1ANKA 2Q8PA 2ENWA 2O2JA 3CRZA 3A6GA 3W5AA 1Z73A 3QLJA 2H9AA 2ZBDA 2OCBA 3H8SA 5CM2Z 4KSYA 4XSVA 4M36A 5FBZA 4BNYA 5H81A 1EGQA 3P1JA 5BVHB 4EPYA 1JDPA 1PCXA 3H8JA 3CKYA 1NXSA 3NGMA 4D9MA 2ZGVA 5IM4F 1V7PC 1CU1A 3NEPX 4IH4A 3AUXA 3EIOA 1RJFA 4JX8A 4L5BA 5DTJA 1USWA 3M1AA 1R0WA 1U81A 4U00A 3J80A 1ORWA 1DQYA 4I1RA 3KEFA 4L9RA 3N6RA 3OZEA 1VCMA 2FPPA 2HA3A 1FC0A 3BZUA 1LJ8A 3BIFA 3HUDA 3IE2A 1Z8DA 3AP2A 3Q8WA 2X8BA 1GPH1 4KXWA 4NBUA 5H16A 2Z43A 3ZGOA 4BATA 4L4YA 3R76A 3WKBA 4BNXA 1IRXA 1X87A 3B70A 1KAHA 1O97D 3E3NA 1IOVA 1UC4B 3TAXA 3V2HA 1JSRA 2PSHA 4CMIA 2ZWMA 3IMEA 5CGQB 4AMVA 2WD7A 4ARVA 1V9SA 4FFPA 2H57A 1ZNWA 3P9KA 4P2BA 3GVPA 1VLZA 4G0WA 1IZ0A 1P3DA 1AKMA 1SVWA 2YV3A 5DWVA 5ENZA 1PFQA 1PWYE 2Q6TA 4YONB 4F3RA 4IGIA 4KQJA 1ZHFA 2BDEA 3ILHA 4L6CA 4KP7A 4OJTA 1KPHA 3U6KA 2FPPB 1RQRA 5FF9A 5HJ2A 1QF9A 2XT6A 3A36A 2SKEA 3L4BC 4HB4A 4BRZA 3TBHA 2ZW9A 3HB0A 1S01A 1C9MA 3EZ2A 2JCGA 3FMOB 4KQIA 4D0NA 5C8XA 4Z3OA 1LA2A 3OQ1A 2W2MA 4BP9A 4D8TA 3BJZA 5BMVA 3PEEA 3WL3A 3FTCA 4OQFA 4QLBA 3GP3A 1GRNA 3QBJA 3M70A 1L2TA 1KAGA 3T6KA 2WD7B 3WNQA 1HLFA 1UP7A 3HZRA 4M0CA 4QFDA 4BBAA 3I5XA 3TUIC 2I1LA 3F1KA 3NRJA 3QVLA 5ARCA 4LQ4A 4NBLA 3DE5X 1BX3A 4J1SA 3PF8A 2RHOA 4RNDB 4AP5A 4RTRA 1ONBA 1YBFA 4HQNA 3GA7A 1LX7A 3FSEA 2OBMA 4KQEA 4YBRA 1RIIA 4BU1A 2HB6A 3TLZA 2E4WA 3AKEA 4IIJF 1ONPA 4E70A 1P5HA 4KKVA 4QIHA 2OPHA 3PXXA 1MFPA 2C97A 2RIPA 1KVRA 5BMVB 3SJUA 3KR1A 5JXWA 3OLWA 2QI9F 2PJUA 1AMOA 3WQRA 1FFXA 3JQGB 4H3SA 4TKVA 1QZXA 3KZXA 4LZOA 3ZNPA 3IRVA 3L7DA 2GRUA 1G20E 1LBEA 3WLOA 4BJHB 3R5JA 3E9DA 1GA6A 2CLDX 1YDGA 3T3MB 3FYTA 3EXHA 3QSYA 2H51A 4XWKA 4R7TA 1KJZA 1TJPB 4KLAA 2KB0A 1TLLA 1QK4A 2VDOB 3NHKA 1W5TA 1JVNA 3EBPA 1HA3A 4QTUB 2YWCA 1T3TA 4EJFA 3L8DA 4G8BA 1H1TA 1SU8A 2XUFA 4KR7A 3UFBA 1KZ9A 4ROSA 1TB4A 2P2ZA 1ISMA 2G1KA 4GNKA 5FBQB 1WQ3A 5BVGA 5ALUA 2QYSA 3U9LA 1FFXB 4TKVB 4BU0A 2H7VA 2Q3EA 2XD9A 3QP9A 5IKPA 3EZ7A 1J0CA 2Q1YA 1TEHA 3L02A 4FYYA 1SN7A 3PDUA 3T52A 1HRDA 2X6QA 3EXHB 2QLTA 1EIWA 4EPWA 5HPYB 2NSDA 2A9QA 2CLHB 4C6HA 1BDIA 3F78A 2ZVJA 4JLKA 2JGFA 2P11A 2GZAA 3CGWA 3UPUA 3V7WA 3RVOA 5BVGB 4IDFA 1D1TA 4EUFA 4BYGA 4CV2A 2G83A 4NV1A 4O59O 2P2YA 2RCYA 3OFVA 2J45A 5AK4A 2GTHA 5DX8A 3U16A 3O84A 3N59A 4ZMSA 3C4VA 1H3FA 1S9DA 3H3FA 2D74A 2FWPA 4NATA 3PC3A 2XY4A 5DB4A 3ZHOA 4REMA 3B6ZA 3ZDAA 2VJAA 4GX2A 4Q37A 2DVMA 2WJYA 1KYIA 3AHGA 1U8FO 2ZWPA 4WT7A 4BAZA 3AFHA 5IZCA 3SZ3A 2Y1EA 1KY2A 3OEHD 1EJ0A 2JHFA 4CVNA 1WZ2A 2Z8ZA 2QU8A 1TC1A 1MAHA 1ZIXA 2EZTA 4W1SA 1YR3A 1JYFA 3R7BA 1W96A 4F3YA 3GWZA 1NW5A 5BPFA 3NDJA 2YVKA 2P68A 1ZUWA 2AZ4A 4GX0A 3SJZA 1H4QA 5A3JA 4S1OA 2QGZA 3DM5A 1PTJA 2JGNA 4GE0A 1NXQA 1JBEA 1JT2A 2VUTA 4MVJH 4AJJA 3DMDA 3ZDBA 2GF0A 1HFKA 2ZT5A 3IQHX 4Q66C 3F8TA 5A0VA 1YS1X 2V97A 3ZCSA 3A1SA 4O5AA 4OG2A 3TSZA 3M9XA 3WISA 2BJVA 2Y1OA 3GH3A 5GIPE 3N2EA 5YASA 1PX2A 1H8HD 1OXKB 2LE0A 3QJYA 1LLDA 1OREA 2P9JA 2W2VA 5C51B 1KAQA 3R6TA 4FR5A 4PCUA 2AFIA 2XTAA 4OI4A 1DDIA 1ISSA 1HV8A 4Y8VA 2ZYVX 4QUIA 1KZ1A 3GUVA 1T3GA 2C98A 3SR3A 4KFRA 3V6LA 5JIBA 1WDLA 1MC4A 5HRUA 1J2UA 4FN5A 3W06A 3WYFA 4QGFA 1W46A 4B6PA 5I9LA 5A2QA 3Q10A 2OY0A 4CEHA 3ZQUA 1GILA 3TLBA 5JO9A 2XKBA 2DBZA 4XD7D 5CD9A 4G81A 1USVA 3C39A 3NBAA 3DG9A 5FXMA 1ESEA 3HJRA 1OE0A 1I10A 1RQGA 3UB2A 2AFIB 3BE4A 3ESBA 1B1CA 2QN7A 2ZBQA 4I9UA 5K05A 4X62B 3VKGA 3OU6A 1U7DA 4S1PA 1BXKA 3VC7A 1JEYA 4QUGA 3B12A 4JROA 4D3FA 4YT8A 4GI5A 4MW9A 2L17A 2WAOA 3D7NA 1DKMA 5IJXA 2GYWA 5D5QA 1I94B 3VC1A 3HKDA 3JWHA 3NP9A 5EKUA 2QRNA 2HMYB 2WE8A 2ZG6A 4QWMA 4TMTA 2O1SA 2FXIA 1C30A 2ATEA 2O1WA 1OU0A 1EE1A 4WACA 5KSPA 1J2RA 3OCYA 4AS2A 2V0CA 5C0OE 4G97A 3G68A 1UJNA 4CTNA 2VJOA 1J7JA 4MWDA 4CIWA 1ULAA 4IIBA 4RELA 1DCFA 4LCBA 1S02A 2GZSA 1KMIY 4HN2A 1T1RA 2HFKA 2RDMA 1X14A 2CJXA 3KP1A 4BQQA 3TNJA 5B4TA 5BSEA 1JEYB 4HX5A 1KYZA 1FU4A 3VX4A 5BPHA 3SPXA 4MVYA 3NHMA 4BX9A 1XGKA 1J8YF 1AMNA 3HA2A 1VYHA 2CGEA 3HKDB 5E4YA 5G1OA 3V8VA 2B5OA 1WVGA 4EHHA 5JEDA 4Z8XA 3TXXA 3C98A 4LAFA 4RFVA 5D51S 5GMOA 1QOQB 1C30B 2WD9A 1OGJA 2HU5A 1MR3F 2XYGA 3CSDA 3RC2A 5F5XA 5AKLA 1IG0A 1JG4A 2I34A 1K5GA 2BCGY 1BC5A 3EAFA 3IQXA 4IS2A 1N2HA 1QV7A 3D4IA 1E96A 1SVUA 4KQMA 3RUDA 4H15A 4UC0A 3RWBA 3OEHA 5A71A 3ULKA 2IUEA 4H7IA 4O2BF 1Y98A 2WUFA 3SXJA 3P9IA 2IJGX 4RVGA 4YAEA 1M2NA 1W5EA 1ZCZA 1VMAA 3O8OA 2C5EA 3QW2A 2YMQA 1KBQA 5EE5B 4X7PA 5BR1A 1ORDA 4FYWA 1BE6A 4R05A 2FPWA 4ZCLA 4HYTA 1WULS 5LZ5A 4CM8A 1UDXA 2W43A 3MIIA 1AB5A 2HUPA 1ISRA 1QP8A 2I2DA 4B87A 4DTCA 5H80A 3M1LA 1YL6A 2PUHA 4Q4CA 1QYVA 4N3NA 1EFVA 1U11A 2YN0A 3Q8XB 4QOIA 4P83A 2XRYA 4N1AA 3HFRA 4RFSA 4L8WB 4HLNA 3IKMB 3DYBA 3L04A 1V3TA 4ZXFA 4ZTUB 1O95D 1QU3A 3R9IA 4BO4A 4I7EA 1MRZA 2MR6A 1HL3A 1VL5A 2NTNA 3EZFA 3SBEA 4BMYA 1GNVA 1E69A 1NMQA 1SK8A 4FFSA 4MCHA 1H8HA 4MPDA 3V4PB 3LLUA 3PFKA 1ULUA 4M0MA 5FR2A 5IJ0A 5JQWA 1NQXA 2X77A 2ZSIA 3HXKA 1NDUA 1E2PA 2JANA 1JZSA 3H5RA 4CM8B 3ZWDA 4D4KA 1HM5A 3UJDA 5DBIA 3WX0A 4AFNA 1N5IA 1NUQA 2CLLB 5DI3A 3PXBA 3PPYA 5J5CA 4YRPA 4D3DA 1EFVB 5SZHB 3DEYX 4RFSB 2R751 3CEHA 1DEOA 1PU2A 3QPAA 5JD5A 2VCEA 3ZE6A 3L0YA 2W71A 2E82A 3YASA 1Q5PA 2OYSA 4XD7A 5JOQA 1KRXA 3N0WA 2FMXA 4EG7A 5ALZA 2HK8A 2GYVA 4NWIA 5JHHB 2H2DA 4IUBS 4F5WA 3CF0A 4J94A 3U4IA 4ZYYA 5IJ0B 1NOJA 3BFXA 3EC1A 3HLTA 3QE4A 4AZWA 5L45A 4ZAZA 1OGIA 2RAVA 4KREA 5AJUA 5E6UA 2NM0A 4Y2TA 5DI3B 3A4LA 3DR3A 3MTGA 5CW2A 3LWNA 1E4YA 3W77A 4AVYA 6YASA 3GLFE 1GNTA 3BB1A 2XCLA 2GMWA 3VDRA 5EHQA 2P3OA 2OENG 3HJHA 5M04A 4TTVA 4C43A 2IV3A 3LUBA 1T1JA 2IYSA 1LTQA 4U7PB 3RF6A 3RB8A 4CKZA 3U7JA 3M3DA 3AJAA 5L3VA 4ZRNA 1SHKA 1EBFA 2JVJA 4FEGA 4JBXA 3TD6A 3OKCA 2G9VA 2XADA 3SIXA 1RAHA 4FU0A 1G5FA 5G3ZA 4KLNA 3BSSA 3AY3A 3TIGA 4KX3A 3W78A 7GPBA 2O8EB 2Q5QA 4D41A 4OXRA 3F0TA 3U0VA 1KF0A 2BDUA 4OMFG 1EZZA 5AW2A 3HMKA 3GEIA 5FLEX 4L5AA 4UHKA 4DV1B 2Q6KA 1ZICA 2JLUA 4ZVTA 2P6OA 1M0EA 1DBVO 1PZNA 3P5BA 4IYJA 5AVRA 2Y6UA 4G0UA 3FB4A 3GGSA 1IZZA 1MPXA 4Y1FA 3TZHA 5HJ7A 4OBXA 2YWFA 3IVMA 4LJ8A 1HQCA 1MU0A 2Q28A 4KO8A 1CRWG 4YIHA 3F5MA 1V11A 1GARA 3SFZA 1L3CA 1T91A 1YRBA 4M0KA 3BMNA 5DO9A 4ND6A 1NSFA 3L8GA 4ZCSA 1I6LA 2YZ2A 3SDZA 3UH0A 5EXSA 4AJOA 1WSDA 2EP7A 2HPZA 2GF2A 4IO1A 3OQBA 1NIPA 5HKBA 3DZIA 3P4XA 2ERYA 3PICA 4NXMB 1Z08A 2BISA 2I87A 4Q4DA 5FBVB 4US2R 3EOAI 5I9MA 4Z4GA 2H1CA 3MSCA 3P0EA 1HYQA 4CNQA 1OC4A 1G8PA 1X1CA 2BZ0A 1V11B 4NIMA 4QG7A 1G4HA 3DLCA 4AMUA 3PFNA 1BRMA 3DPSA 4ZODA 2Q1WA 3K72B 1OFUA 1IU9A 2QGFA 4PX3A 3TTWA 4MYRA 4YAKA 1KFEB 1H4TA 3IV7A 3X1YA 4PLCA 4F1JA 1X7WA 5D01A 3T8YA 1O95A 4JGBA 1KU0A 4OJMX 5KI6A 1UWKA 3UJBA 3AEYA 3DW3X 3KXKA 2C04A 4IIGA 1MVLA 4RF3A 4BNVA 1N9GA 1Z82A 3BRWD 1YIAA 1NUTA 4KZPA 2PWBA 1YIOA 1PK8A 3MTQA 1VE1A 5HE8A 1RM5A 2IXGA 2OVBA 3PUWA 3A14A 2VYVD 4PZLA 3QYPA 5A0FA 2AV6A 1B74A 3PX7A 3JVIA 3WBBA 4F9FA 4W7HA 1P0IA 2QN3A 1E9DA 2YDXA 4J03A 2HKIA 5DX0A 5CH5A 3WVNA 3ZE7A 2P40A 5HSGA 4P93A 5BUSA 5JFOA 1Z74A 2Q0XA 5LCXA 4WIAA 2IEBA 2QTMA 3SHQA 5BN3A 1JA1A 4RXTA 3T9DA 1R16A 1SQFA 4X9XA 5KWJA 1CF9A 1CUEA 3IODA 1N9GB 4GWKA 4ZV9A 1B8OA 4WY2A 2O3RA 4QBKA 5LQJA 4WDRA 5EXDA 2HXGA 4DV0B 2QRQA 3D4OA 1G9SA 5LLDA 1COWD 2X3FA 5HCNA 4ND3A 1Q0ZA 2EFGA 4QOJA 3NV9A 2H3HA 3GJZA 4FFVA 4QSMA 2R84A 4WTOA 3S2EA 1ADFA 4HDRA 4YNBA 1J9EA 3N2KA 1TD1A 2CMHA 1ULZA 5JZVA 3P4YA 1TVKA 4KFSA 4TLCA 5L4LA 1PAUA 4I66A 1XKQA 1DZIA 5BN3B 2PD4A 1IUOA 3RRNA 4XCVA 1JA9A 4R3NA 5KJFA 1IPFA 3I23A 3W6ZA 2JG3A 1JNXX 1QE5A 1OAOC 1PT7A 2HT6A 2WKQA 4ZJZA 1EVJA 2AGVA 4D4GA 1V16A 2A1TR 2ZZNA 3AYZB 5I7VA 1AF4A 2Y1KA 4FQ8A 4UDXX 4TRJA 5EPEA 3ZS9A 4C0HA 2E6UX 3VTAA 1R3UA 2D3TA 4J3FA 4KRFA 2JAUA 5E3IA 4ALKA 4HDRB 5AHOA 2NT4A 1PWHA 3UMMA 4E6PA 1OASA 1PGPA 5B55A 1TVKB 2XB2A 4GSLA 1YRQA 2J5BA 2WAYA 2XQVA 1D3AA 4BV2A 4EB6A 2V5UA 2ZSKA 3QUAA 1ZMBA 3NDPA 1XTRA 1VG0B 1C1XA 3LIPA 5L7YA 1IBRA 4DCMA 2GXSA 2BJWA 3GT7A 2VDNB 1W4CA 5DW0A 3P2KA 1XA0A 1XQWA 3T3EA 1Y9JA 4C7VA 1V16B 2HTFA 3UJ8A 1PP4A 3CLVA 3KXIA 1JX6A 4ZC8A 2IEZA 3R4VA 3UJAA 1V41E 3B3GA 3KYIB 1WVIA 5HTOA 3W5IA 5BWOA 5F2NA 4IJKA 2EF0A 3UW3A 3GIDA 5I9NA 5LU9A 1PYDA 1DWPA 2F8LA 1GDHA 3EVNA 3GI1A 1M2VB 4EB6B 2C0PA 4KTVE 4JU8A 5E9WA 3R40A 1C1XB 5C31A 5CCDA 1MRNA 1HZJA 4TXMA 3F9IA 1CQJA 3OTQA 4BP1A 4JUIA 4QECA 2IZ5A 5F33A 3KTAA 1VKOA 4F91B 4XGQA 2CE7A 3VOSA 3DZGA 4RPKA 5FRDA 3MT8A 4CG3A 2FK7A 3LF2A 1Z12A 5LXTF 2I3BA 1PHPA 1QBGA 1Q7EA 4Q6WA 1UP6A 1X1AA 3AHCA 3R09A 4IYRA 4GL2A 5COAA 1F8GA 4W82A 3BRWA 3BJMA 4HQOA 2WPNA 4WVFA 3UJPA 4DNFA 2RK6A 3LQFA 4LYAA 4W9NA 3BOSA 1CQJB 2VYVA 1NBMD 3PL1A 2Q1XA 3R44A 4X95A 4X6LA 4UE3S 4L4ZA 5IH3A 5GZ1A 3KTAB 1IZ8A 5J9FA 5CJPA 2GD0A 4N8SA 5JMTA 4UASA 2F90A 1AMUA 3LUPA 4V0ME 4ZEWA 3NBUA 5B58C 1K8XB 4EW1A 2MR5A 5C53B 1HQYE 3H1AA 2FEXA 2KPOA 4NNOA 1EHIA 4FWIB 1GPAA 2P4HX 1RWWA 2PIAA 3MOIA 4TMXA 4Z7QB 5C35A 3IKTA 3UMJA 2C84A 3CPEA 2JH8A 4YWJA 1GVHA 2JL1A 1POWA 1DWOA 4DR5B 4EFMA 4HVCA 2AFVA 2LKCA 4FNGA 1K8ZB 3H19A 1XEXA 5G1NA 4BZZA 2QMQA 3LBYA 1COWA 3P9CA 5HKAA 3WE7A 5IT9A 2JFBA 4M1KA 4MPPA 4MRPA 3A6KA 4GNRA 3WO0A 2I8AA 1R88A 3E8XA 4DB4A 3N7TA 2K87A 4JP3A 1WBJB 1NG9A 1MGPA 1CS4C 2GCGA 4EUSA 1JQ3A 5B12A 2QXYA 3B7PA 4KAXA 1HURA 4QJBA 4G2NA 5IAKA 1UKCA 1KXJA 4CM7A 5IKXA 4O02B 3QPUA 4XFKA 2IX9A 2OG2A 2W6PA 3IIEA 1XEXB 4OQYA 4ZRMA 1E5XA 4GMKA 2VCHA 1C1DA 3PTLA 4G1CA 3S2ZA 1WHTA 4HFRA 4RHTA 3ZWQA 4LYYA 4H3VA 3CB4A 2H54A 3EUEA 4PFJA 1WMDA 2NQ8A 3PD1A 1P3JA 2VTBA 4C88A 1Z83A 2CFTA 2WIJA 1QH0A 1W9MA 4ZI2A 5J4YA 3C3AA 4Q9DA 3EVCA 4FZJA 4KYIB 4BN4A 2ZI4A 3VR4H 3X3HA 2EJTA 1ZYUA 4H0FA 1TD9A 4HRAA 4LN1A 4AP9A 2KJQA 3ZHUA 1WS6A 3MQ2A 1WF6A 1F1JA 3IIJA 4G4IA 4PO8A 1YVDA 2E2WA 3F3KA 2RH9B 1C1DB 1WXIA 1GAEO 4DQXA 2ZSEA 3CHYA 2Q41A 4WH0A 4X94A 3QX7A 5F7OA 1N25A 5FQOA 1DG9A 3N9IA 3IJ5A 5J58A 4EEXA 2FZCA 1CBUA 3LPLA 4JLVA 4OHVA 2OO5C 2QVXX 2IYTA 2R60A 2WVAA 3NBFA 2J3MA 4RMIA 3GJQA 4CKWA 1ADYA 3DD1A 2PGAA 2RI6A 2ID4A 4E22A 1ZO8A 1B8VA 3UIEA 4AJLA 2DUMA 3Q15C 3TFOA 5F5LA 2IUFA 1K5DA 3W7VA 2N0SA 3I8OA 5EJ9A 2QR2A 3BDAA 3A8TA 1E6UA 3IBYA 1H1LA 4MGHA 3VKHA 1OMOA 1RHQA 2FW8A 4WLFA 1X38A 2ZI7A 2Z3WA 2D5CA 3BFPA 4PV7A 2VS1A 4O4LB 4UD2A 4J1TA 2RHLA 1TK9A 4EX6A 1ZHOA 3EMKA 3QUCA 1QVAA 1L7MA 3KCQA 3EC2A 2YXBA 2JJQA 1B3BA 2OFXA 3EWSA 3VU0A 4BE4A 3T94A 1JFSA 4CKWB 4LYDA 1GUAA 2FUG6 2GCNA 2X8WA 1VSTA 4A5SA 4XLTA 1NBMA 3HV2A 5H82A 4LFBB 1ESDA 4MAAA 2HNBA 5B1DA 3VH1A 3PLAE 1Q0RA 1DRJA 3WO1A 2I7DA 4G09A 1P1CA 2QRGA 1XHEA 3ORYA 3QE0A 1CULC 4EQ6A 1H1LB 1N5MA 5F2KA 4JGIA 4A0HA 3SIWA 4HD8A 1NQWA 1FMLA 1OGYA 4DR6B 1O1YA 4P4GA 2GDZA 1RFGE 3F71A 3S1AA 1XLVA 4A4DA 3L43A 2FX3A 2BT4A 1QPBA 3FLEA 4UAGA 2WYIA 3EF1A 4GPTA 4Y6OA 2GESA 2WWXA 3R7DA 4Z4QA 2CUNA 1NDQA 2YJ3A 4N9QA 3PE4A 1Y8ZA 1U1DA 2REXB 3OY2A 1OHHD 2OORC 1JDUA 1R4NB 2WE7A 4K0RA 2QN1A 2FPOA 5LA6B 1QE0A 2Y93A 3PNSA 1R10A 1XYVA 3FPHA 3GRKA 4EQ6B 1JLRA 2ZQZA 4OOEA 2X5KO 1SUCA 2WSYB 2YYSA 1NBIA 4QWWA 3NUGA 4X5OA 3MW8A 5AW7A 1FK8A 2XYPA 2PGIA 1BWRA 4KEAA 3DT9A 3S1AB 4X6UA 2VZ8A 5JQGA 1I7SB 1O6FA 2J9RA 1GZHB 3N70A 1VLJA 2VAXA 4UFNA 3LA6A 1J0AA 2NXJA 3GT3A 4YMGA 4B17A 4P8RA 1NNLA 4M0LA 4G01B 4HWPA 2AOXA 1EFLA 1JDNA 1T1SA 2ZUSA 5ERGB 4B9EA 2VG8A 3LWDA 4KFUA 4PN3A 1KVSA 1DC4A 2XIJA 1DWQA 1EH5A 4JJ4A 4AX8A 2CJPA 3DM9B 5GINE 4FD3A 2BZGA 5E7MA 4MKIA 4M8KA 2GM5A 4NBWA 2I1QA 5GJCA 2FMUA 2G25A 3E15A 4HXGA 2ZIUB 1G41A 2PGDA 3RSGA 3UMSA 4CZ2A 1C8VB 2YVUA 1E5DA 5EPOA 4LJ6A 2R8PA 1NU8A 2CXTA 3AL2A 1FFBA 2C4NA 3EGDA 4L4SA 2AN3A 3U17A 3ON5A 5BT8A 1YRLA 2A0YA 5I51A 3L7KA 3NP7A 3BL6A 4F8EA 3MVEA 4C0JA 3F8WA 4G0OA 4L75A 4F8YA 4S1WA 4MTCA 3BFKA 3LBHA 3I09A 3C7CB 2DTEA 5AVVA 3OMXA 2W6JD 5E8RA 1DIOB 3FNQA 4KIFA 4N0PA 4O4LF 4UHEA 3VAZA 5AXCA 4QGHA 5JZMA 3ICEA 1W9HA 4ZVSA 4ZHQA 4FJ1A 2PPVA 3HL4A 1B0UA 1NKVA 2XYQA 1B93A 3MEQA 4GUDA 3LCMA 4I1SA 1LBQA 2JVIA 5DNAA 5BSMA 1W4BA 2FGJA 2HWUA 1B15A 1K7FB 5J1TB 2AMJA 2CNLA 3C3DA 1JWAB 3EGDB 3UOWA 3B6JA 4D8VA 1BSVA 1G19A 1T9GR 2B1QA 4EKYA 2YFYA 3WQQA 3ZXUB 4XKJA 5HBRA 3UJ7A 1EFHA 1YR9A 4Q1CA 5D1NA 5T41A 1F6DA 2OG1A 1M76A 1PVVA 1C3XA 4AJKA 1N2SA 2VT2A 1U7UA 3HVHA 1ODTC 2CDRA 3N5CA 4WXRA 3DF9A 1KOFA 1MB2A 2PG3A 3BC1A 4DMHA 4F86A 4NCKA 4X7RA 1AQNA 9MHTA 4WV3A 5LQDA 4EM6A 2G9ZA 4ZHQB 3K4PA 5GM2A 4DQLA 1UBCA 2N1BA 4GOJA 4I1OA 4K05A 5I7EA 3Q98A 4UW9A 1G3RA 1U2TA 1UDCA 4M98A 1MO5A 1YS9A 4WA8A 4PFQA 2XZPA 4DS3A 1D2EA 1RZUA 4E5NA 2ZB3A 4NZNA 2GQ0A 4LXXA 1V71A 2VHJA 4GUAA 4RK4A 5AWFC 4F85A 2PEZA 4GKKB 1Z45A 1FTSA 4D9JA 4DEYA 2Q8QA 1CDDA 5GM1A 5LA6F 4K0KB 1DTEA 3OJ0A 3ITNA 5KAMA 1RM0A 5DNVA 1PJLA 2Z08A 2NU8A 1S1CA 1KOJA 3QV2A 5LQUA 2YYAA 3NHJA 3NHLA 5DYNA 3DKPA 1KFKB 3WLRA 4IIVA 4KQGA 4OK6A 1V25A 4MUXA 3X1KA 1SKAA 1CRQA 2HDWA 4Z99A 4EGJA 5I47A 1QB7A 2NO4A 1YS4A 2RJNA 2YN2A 1CY2A 4MDHA 4I81A 4XWYA 5FUVA 5BWMA 3VTKA 1ECJA 1LY1A 2C59A 2E37A 2ZB8A 1WDMA 5SY9A 4E4YA 3NV7A 4DHWA 3MHTA 1OHHA 1Q1NA 1HNWB 5KHLB 3MYYA 3T7SA 2Q07A 4N82A 4LECA 4UUMA 3WNZA 1KJJA 4B85A 3LGXA 2NU8B 2FHPA 1QQTA 4NHEA 1NONA 1R8YA 4V39A 3EARA 1K1EA 1OB5A 4Y2YA 4QBTA 3ESQA 2V6IA 3UY4A 1AKWA 1ABFA 1MW9X 4LJAA 1BE1A 3WB0A 4TLBA 2AG5A 1FXWA 1E3MA 4WD3A 1NXXA 2D1YA 1NI5A 4HGQA 2Q29A 3SEFA 3FR7A 3N07A 5I7OA 4N40A 4A82A 2JIDA 4X71A 2XT9A 3NHRA 4L9WA 4YT4A 2P3SA 1U7ZA 3RYHA 4YUYA 1HYEA 4MA5A 3UBMA 3DHNA 1O08A 2IXDA 4RKFA 4BX2A 4ZICA 5D3MA 3SQDA 1D7AA 4OAQA 1P2FA 2FVYA 2WV7A 3DUWA 4HLDA 2B1GA 5I6DA 1QLHA 4H7KA 3OTOB 3A7DA 3ESYA 1N2ZA 1IBCA 3GRVA 4HADA 1SHUX 4QO8A 3ETLA 4W5OA 1JHYA 1ZVKA 1ZJ6A 2NLOA 2D2XA 2DKOA 5MN6A 1DIHA 1G8YA 2YWBA 1VB5A 4G0MA 3CISA 3FZNA 4CMKA 4PGHA 3DW1X 4C4PA 2JI8A 1PT5A 4YUAA 1NN3A 5IK2D 2DERA 3JQ8A 3VYTB 1MOSA 3NM4A 3RYHB 4AD8A 3DL2A 1RLJA 4NNJA 1SCIA 1AK1A 2HBZA 1G8MA 4WOPA 5LM3A 5D3MB 3ZDRA 2O59A 2KBEA 2W6JA 3K09C 2XMCA 2LV8A 1VIVA 3GIWA 2GCEA 4MI3A 5DMXA 3V8RA 1NXPA 3VHQA 3TI7A 3M3HA 3PR1A 4KN9S 5GV8A 1BHQ1 4ZHQF 4MUMA 3U7GA 1KS2A 4DLWA 5KTMA 2X0IA 3NHBA 4MLDA 5SZIA 2WJPA 4PYNA 4CMJA 1KK0A 4N0EA 2YRXA 5BV2P 1A9QA 1USIA 1HDXA 4BJ5A 5DBHX 1W48A 2B1IA 2FE1A 3JQ8B 5BN4B 4YAIA 1I3MA 2JFQA 3LK6A 4MDEA 1OF1A 1P60A 2DFTA 2VXOA 1YB4A 3QHAA 3V46A 2WM8A 1PNVA 3VKFA 2AWNA 1DFHA 1NFRA 1Q17A 2PGOA 3DFFA 2YXDA 3KETA 2WAAA 4XDZA 1QWOA 3O8BA 1KYTA 3MTEA 3NW9A 3S81A 1IXSB 2VBCA 2ACVA 1FU7A 3NT5A 3MRXA 4JFRA 4B7UA 1JJBA 3QFSA 2NTEA 5TNXA 1FX0A 5JJKA 4O63O 3EWAA 1EP9A 1Z5OA 3KT6A 4CG2A 3JALA 3ZBQA 4F12A 1XTPA 1T8YA 1SD5A 2QL6A 3JSAA 1B23P 3G7UA 1MJHA 3OKAA 2B78A 4PC7A 1LSJA 3ZWWA 2AG1A 3CINA 1MT0A 1RMYA 1WEHA 2Y99A 4PQFA 5DIZA 5T8KC 1GGHA 2WTAA 2E4YA 2E4AA 2H7XA 2RJ3A 2XCSB 1CR0A 3DMTC 3I2IA 1W4ZA 2IPMA 3U7HB 3P9SA 1N2BA 2Q0HA 2Z2YA 1MX3A 1FX0B 2BI7A 4OY3A 4DPKA 4DV3B 3AZPA 4G5HA 1XDDA 4LXQA 5ES3A 3D7SA 3CT6A 3FYCA 3JALB 3TB6A 1YTUA 1O89A 4RE5A 5HEKA 2P5SA 5EHNA 2A0XA 5AXAA 2ZIZA 2CEKA 5GZ3A 3P2IA 4OUDA 3ABOB 4BVHA 5IT5A 3CUSA 1RHMA 2PUJA 3AOEA 2C2OA 1ISFA 2IX3A 1VJCA 4X8OA 4REOA 1MJFA 2VDKB 4AXBA 4B8WA 3JD4A 3SBXA 2IEAA 1FXWF 3Q7SA 4QG3A 3RAEC 4KH0A 2ZTSA 3GB9A 3TRIA 2AJTA 3H11A 5FPTA 4WN9A 1QHXA 2C8JA 5AI6A 3E3LA 3V7NA 4NPCA 4CFZA 2C2HA 1S89A 1Z8FA 1B42A 2WYVA 3JATA 1T8RA 1G3MA 2G7ZA 2FB9A 4OUDB 5KNBH 2C3OA 2VF5X 1ND6A 2Z4RA 3SM3A 3WKAA 1NP6A 2I6GA 2PZAA 1U8YA 3BSWA 1NOIA 1ZNYA 4MHSA 1D4ZA 3VRHA 1PGQA 3H5AA 1PUJA 5EHZA 1LDMA 5D8DA 2E21A 1JEQA 3NH6A 3OF5A 3TW4A 3V33A 1I4TD 2FPSA 3PU6A 3H11B 5IK2A 1GY8A 4HH3C 4WN9B 3TI9A 1T1IA 1U3CA 1CY6A 2YY7A 3H0CA 3BJIC 2ZTUA 4KQFA 3O0DA 5FOQA 1X70A 3JATB 2I78A 3BL5A 1P62B 3IQGX 4LE0A 2ZJ4A 2GN9A 1U1EA 2R62A 2FQ1A 3HP4A 3KQTA 5JD6A 1G59A 1QGED 3DAOA 4TLEA 1B8PA 1QJ4A 2BE9A 3JV7A 4HQLA 1L4UA 3A0UA 2BZ1A 1QIGA 3DP9A 2BCJQ 1T13A 5TJHA 3PXGA 5EGNA 3ROFA 2IPLA 5ITWA 1YOBA 3FMVA 1T2EA 3GN1A 3H5TA 1FXSA 3I8XA 1WUTA 1DXQA 4PHHA 4PSCA 2ZS9A 2GN1A 1G8FA 3CCCA 3MTAA 3NQ41 1P29A 1V3QE 4PPGA 4DMFA 5C5DA 1AS3A 1Z7WA 3C3BA 4HQ0A 5DBGA 1JRLA 1JKXA 1Q0HA 3G5LA 5SICE 2X7JA 3D6AA 1HC7A 3PGLA 4KYUA 4B75A 2FFJA 4AN1A 3FPCA 3DDUA 2WJIA 5FOXA 4FHEA 3GFSA 5KU7A 3F4BA 4C0QC 2P1RA 2ZIVB 2Q4EA 3TFQA 3FKJA 3S0JA 1QNFA 2C7PA 4HB2A 3CVUA 1JHMA 1RYFA 1T5SA 3GW8A 5F2OA 3CQ9A 4BMCA 2QXTA 4PZYA 2OFOA 4M9SA 4ZVVA 3RTCA 1IVSA 2C83A 4E14A 3UXYA 2W8BA 3BCHA 3O5AA 4C2BA 4Y9TA 3DNFA 4AG6A 1SD1A 2Y67A 3FCCA 1W73A 1BNCA 5J23A 1EX1A 4Q21A 3VJRA 1LV8A 1NU6A 1P18A 1E4EA 3GH1A 3VBCA 4Z53A 4UPDA 4JJGA 1NY6A 1Q0UA 2I0FA 3DAGA 3EODA 4I50A 2BM0A 1QIKA 2XBLA 3ILVA 2CNBA 2ZTLA 4U9HS 4WZAA 2HIGA 1UL1X 1HETA 4GGOA 2PTGA 1R4AA 2W93A 4LX0A 2D4AA 2W8BB 4W1RA 5JYDA 3BJEA 2PSDA 2WABA 3QW4B 3UANA 3IPRA 4AY5A 2I2WA 1VJ1A 4DIOA 3QFFA 3TCNA 4RKRA 3N2NA 4ITVA 3BD9A 2IS4A 4NCXA 1ZJJA 4H27A 1CY7A 1DO0A 1GWNA 1GNPA 1C1HA 1N3LA 3RVLA 4C1BA 3QOYA 2X4IA 4Y7CA 4JHXA 3CF4G 4XGKA 3N74A 4OGKA 1XN1A 2Q3DA 2R68A 3AIKA 1AT1A 2BELA 2FU5C 3H0EA 3UA3A 4BO1A 4I50B 5FD8A 2Z2XA 4WZAB 3QF7A 3ZCRA 4GKVA 3B9QA 4BAUA 3HDTA 3QFTA 4A0RA 3P20A 5G53C 1JBQA 2R1ZA 4OQXA 4QYIA 1PT8A 3AUAA 3O94A 2ZAIA 1S7CA 4W7IA 4BLWA 4CI9A 4YLEA 2W6OA 4U7GA 5KNCH 2X2FA 3Q7IA 2G9QA 2REQA 4IUYA 3SX0A 4X8LA 3RABA 2D59A 1M1YA 2FW0A 2OECA 1YZYA 2QP9X 1PL8A 5JYCA 3CNHA 1VECA 2O6LA 2Z3ZA 3C3KA 1GNQA 3DH0A 3RAPR 4Z4HA 3CVYA 5SZKB 2ZSJA 4KWEA 3OWOA 4ZGBA 4BLVA 2ZBVA 3AF3A 1K4YA 1T34A 3PC8C 4KMRA 2N1MA 1C0EA 1Q1AA 2J9FA 2NZWA 4TYMA 4G0VA 4QYIB 2PR7A 1AQYA 3PLRA 3N7AA 3PKIA 1DPGA 4FDAA 4C22A 5TPZD 3U7QA 1OPRA 4LC9A 2JEZA 1Y8CA 3BGDA 2RD2A 1PTKA 2REQB 2DQKA 5ALGA 1R8QA 4BFVA 1EDOA 1IY0A 1M1YB 2F48A 4OJQA 3ROMA 4B6GA 1SXGA 3JYPA 4YAFA 4EUKA 4DCJA 4FC7A 2PLAA 3G5TA 4P81A 1IN5A 4FE7A 4EENA 4GWLA 2ZE7A 4MR7B 4MWCA 4LXGA 5AJWA 2NSHA 5DYIA 4F4IA 4KO1S 4DYHA 3TW8A 2JI7A 2EF1A 3PA6A 5CXSA 4HATA 2J9FB 4F56A 4YAJA 2DFKB 5C9ZA 3JVDA 1Z5PA 2HQSA 2OT3B 4R8LA 4XB6B 1R0KA 1Z8HA 5DGXA 1TM5E 3K96A 3ZQKA 3U7QB 4AG5A 1B3RA 1Q7RA 2QRLA 2XCQA 2GBLC 4IJWA 4X6XA 1LS6A 2GFHA 5KQMA 2G1PA 1RWNA 1WW2A 5IEJA 1X7HA 4CW7A 4IDPA 3OWHA 2VSQA 2MYPA 4ITUA 4QSHA 2JLSA 1OR8A 4N3BA 3ZWNA 2EEPA 1ZWLA 1LNZA 5FWYB 3HM9A 2VYQA 1ZUIA 3FBTA 1G291 1SFRA 1T4DA 2BDTA 2VAWA 2QJFA 3TW8B 5JJIA 1PQPA 3P52A 4A26A 1R27A 4MDFA 2FPUA 3H6KA 4JMLA 2X3UA 1CZNA 4NJEA 3UOAB 4BNMA 1JWBB 2XCUA 4LVOA 1GU1A 1T9ZA 2ZB2A 4HO1X 3UGQA 3DVAA 4MMXB 4BNDA 5I45A 2R6HA 1BS1A 4NS4A 1H9BA 4TMVA 2CB0A 1WLYA 2O8DA 2PZKA 3WGLA 5DGTA 1FVFA 3E1SA 3NVDA 1BMFD 3RUCA 1TDJA 4BLUA 4BO9A 3JYNA 1A5BB 1MQ9A 1FP1D 1Y8AA 3H5OA 1HYGA 1H0SA 3A28A 4LZZA 4QU5A 5BQPA 1N6KA 1N3IA 1T2CA 1QP0A 1TKCA 5ILOA 4KK3A 4NJEB 2RGGA 2WU1A 3EDRA 3PWSA 3UAOA 4BNDB 3DVAB 3QITA 1V37A 4GEGA 1TIBA 1QX4A 2WDZA 4L9AA 3WR5A 3I2KA 4DY4A 4ZVOA 3D3JA 2I55A 2ORYA 2O8DB 3C8DA 4OIMA 4H6VA 1G21E 2XT0A 4XWGA 2X15A 5EZ5A 3IXLA 5JD3A 3AKCA 1GRRA 1YB7A 3MJVA 4MAMA 5FPPA 4YCSA 2GBFA 2JLAA 2WEKA 2XVZA 1MOZA 2ZJAA 1NWHA 4Z8YA 4PX9A 3TSOA 3N8NA 3AGQA 1U2DA 3RU3A 4E46A 4PO3X 3GPIA 4DG8A 4QDZA 3ROEA 3WLMA 2D8AA 4CDMA 1HZZC 1NPYA 2WVHA 4IGFA 3HABA 3BXXA 4IDCA 3PQ3A 4JGGA 3K4QA 1VKHA 4NMWA 2Q5FA 5CX4A 2HV9A 3UWSA 2PVPA 1L5FA 1T6NA 2IDZA 3OLYA 4DMUB 4CTMA 3W5JA 2IY7A 2K2WA 3C5VA 1Q0LA 3FUVA 4I5EA 4YMWA 3U3MA 3KSMA 1OH7A 4D99A 3GT4A 5FUYA 2ZJFA