3JU3A

Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from thermoplasma acidophilum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
AEKAVLIGEKEADITFVTWGSQKGPILDVIEDLKEEGISANLLYLKMFSPFPTEFVKNVLSSANLVIDVESNYTAQAAQMIKLYTGIDIKNKILKYNGRHMTEDEILKSAKEILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
molecule keywords Probable 2-oxoacid ferredoxin oxidoreductase, alpha chain
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ju3A00
1X7ZB 2G67A 1RP7A 2C3PA 2BEWB 3UK1A 2BEVB 2C3MA 3EXEB 3OOYA 3LQ4A 5HJEA 1UMBB 2UZAA 3AHEA 1X7XB 3LPLA 3AHFA 1NGSA 1UMCB 2QTAA 2QTCA 2O1SA 4KXVA 3UPTA 1OLXB 3M6LA 5EXEA 3L84A 5HGXA 3AHJA 2G28A 2BP7B 3KOMA 1X7WB 3AHIA 1V11B 3AHGA 1X7YB 3DV0B 1U5BB 3MOSA 1TKCA 1QS0B 1V1MB 5I5GA 1DTWB 3LQ2A 1NI4B 1OLSB 3AHCA 3DVAB 1OLUB 2BFBB 1W88B 3M34A 1TRKA 1B0PA 1V16B 4KXUA 1QGDA 2BFEB 1V1RB 1ITZA 1X80B 2IEAA 3M7IA 2OZLB 2BFDB 1UMDB 2C3YA 4KXYA 1R9JA 5HYVA 4C7VA 3EXHB 2BEUB 3EXG2 5HHTA 2J9FB 3DUFB 3EXIB 2O1XA 2C3UA 4XEUA 1GPUA 1KEKA 2BFFB 2G25A 5I5EA 5I51A 1TKAA 1IK6A 5C4IA 5I4IA 4KXXA 1WCIB 3AHHA 2C42A 4KXWA 1AY0A 2E6KA 3HYLA 3EXFB 2R8PA 1UM9B 2R8OA 3JU3A 5EXDA 2PDAA 1L8AA 2BFCB 4C7XA 1TKBA 3AI7A 3RIMA 3AHDA 3M49A 2C3OA 1W85B 2R5NA
chains in the Genus database with same CATH superfamily
2R4TA 1VJRA 3RS4A 2WLTA 5SZKB 1EBBA 3IUBA 4IJMA 3K35A 1GJRA 3FVWA 3QKRB 4H18A 2FRDA 1NW4A 2NO7A 3RG8A 3V8RA 2MYPA 4G8BA 5AQEA 3K72B 4AYTA 3P2KA 3H2KA 3OG9A 4GSYA 5FBVB 2PRKA 4A1OA 1WCYA 2OLKA 4U9HS 4B4UA 3QPVA 3MBKA 5F5LA 4RELA 4Q3EA 2E21A 1B23P 3DL2A 3PNKA 2IXEA 2IXDA 3EWIA 4HGQA 4YAIA 4IWYA 4HNTA 1C50A 1GRRA 5LOVB 1W19A 3GCDA 4ZK6A 2YXEA 1V5EA 3DO5A 3LPLA 4PRLA 3WK5A 2QTHA 3H5TA 2W6QA 4Q3LA 3MWDA 1TJ3A 3RPEA 3VH2A 3WRVA 4HVTA 2QUBA 4BE9A 3RCBA 4BGIA 1FFSA 4ZI2A 1U2DA 1WCV1 1L7EA 1SXGA 1ZOOA 4KDEA 3OKPA 3QPDA 1ZRHA 2FQQA 3GRAA 4OB6A 5KCMA 3JVIA 4LOIA 5KC8A 1V5FA 4DCUA 1JFSA 1FMFA 1T36B 3FNGA 2HT1A 4G1FA 4GMXA 4Q3OA 1NBIA 4WK6A 5TQ0A 4W9NC 1J8MF 2V7BA 4I4LA 2I2WA 2BD0A 4FEGA 5HWSA 1OLSA 1Y37A 4UKDA 1Z34A 4OKSA 3OSZA 2R8EA 5B2EA 1L5SA 2RH5A 1OV6A 2GJKA 1WZIA 1AE1A 5EJGA 2X41A 2QT0A 3H6GA 5G4KA 1BWPA 1GGVA 5HJ5A 1PJCA 1WUKS 1MABB 4J6FA 1HYBA 1L3IA 2VDQB 2B1JA 4JQCA 4TLBA 1AX9A 2FOLA 4QBTA 3NGLA 2ZU6A 1SU6A 3EW9A 2Q1TA 3P4YA 4PNZA 3T9BA 3GBPA 1VLZA 3FCAA 3WSVA 4NV3A 2ZXFA 3EVCA 2KX7A 4HV4A 3EULA 1U8ZA 3OD1A 3EGIA 5TNXA 4EF5A 3B38A 4HWPA 2MYTA 4OHVA 2VH1A 2W6NA 2W70A 1UBEA 1A5SB 2CNKA 4U7HA 3ZQ6A 1X80B 2ZIAA 2GYWA 3ROGA 2Q99A 3HDVA 3OZGA 4DS3A 3FZQA 1JQJC 4U9UA 5AJHA 2C2OA 3ICOA 3CCBA 3H5LA 3TJMA 4C0SA 1FTSA 2JFFA 5IH3A 4JKIA 5I45A 4ALLA 1AGNA 1UAGA 4MPRA 2E55A 3SEFA 3IT1A 3C3WA 1WKCA 3NT5A 1UODA 1Y42X 4LX8A 4XUEA 2AZ4A 3ZI7A 2ALJA 3THOA 2H7CA 4Q3AA 3TQRA 3SQLA 2H5EA 4Z3DA 1W87A 4KMRA 2HMSA 1QCCA 3IBTA 2GAIA 1E2HA 1QX4A 1N2BA 1KYTA 4QICA 2Y6VA 4R9SA 2O9JA 4AUEA 1QK3A 1H22A 3EARA 1KOLA 3T5DA 1G7RA 2HCTA 3HE3A 1P9OA 1QIKA 3SFTA 2CLEB 1CULC 3PNVA 3T99A 3OCXA 4HJXA 3I2GA 3LSYA 3U0VA 4FIDA 1PEAA 1HG0A 2F3UA 4GVPA 1R6AA 1EDZA 1O8CA 1V5GA 2VAWA 5J2TF 4BX9A 4BGDA 4X93A 1P19A 4OFWA 5DTJA 1O57A 3AFGA 4MDHA 1BMTA 3HBAA 4NYIR 4YCBA 3WGKA 3RC7A 3ZZ1A 4EBBA 1GAEO 5DNDA 5DVZA 3WYFA 1HOTA 3FLAA 2NO4A 3DH0A 3DHYA 5AW5A 3A25A 3ND6A 1O97C 3KJNA 3K0AB 3HCPA 4KI7A 3V00A 5JNSA 1H4SA 3C15C 3BH0A 1RYMA 1T15A 5JC8A 4XIFA 4QULA 2VP4A 2P2DA 1M7BA 3F4BA 1H93A 1UWVA 4WQMA 3H5NA 5JASA 1Q20A 2WHEA 4J29A 4OYYA 3DYIA 3O8BA 1SHLA 1ZMRA 1SUIA 2X1LA 5F9MA 4HB3A 1PGOA 1DARA 1HBJA 1WXXA 3RLFA 3SLKA 4CU5A 4NXMB 2CHVA 1UOEA 3SZGA 1F7UA 3H16A 5FXMA 3I0ZA 4H3VA 1K06A 3O7MA 3NBXX 4OSPA 3KE9A 4B3CA 3VSDA 1JKXA 4RK7A 4KDCA 4KR3A 4EMUA 4XUCA 3LQFA 4Y7CA 4I3FA 4K9PA 3K8QA 5AI6A 3THXB 3QA9A 2QJTA 1AOXA 1Z0DA 3ERCA 1WB4A 4P5EA 3ZS8A 1A77A 5AW9A 4RVFA 1JKJA 4OJMX 4P35A 4PZLA 4DA4A 2A5YB 1LUAA 1ORDA 2O2GA 1Y8CA 3VJMA 3ZD6A 3QLTA 4ZA2A 1FLDA 4BO8A 3W4IA 1R00A 5IXSA 4MMXB 4M0UA 1Y4DE 3CONA 4DLKA 1QMPA 4HEHA 1LPBB 3TGLA 4U0KA 3NAZA 4PVCA 2B7LA 3IUNA 4LSWA 4P22A 4CIWA 1KJYA 2CE2X 3D4IA 3BFJA 5LN1A 3DG9A 4UHHA 4MUFA 4C87A 1FF9A 3T35A 3RS9A 2GVNA 3O83A 3K9QO 1I1QB 1XEAA 1J0AA 3O03A 3TOSA 1J7KA 1P1JA 3SQMA 3U56A 1SZPA 4HFJA 3OIUA 3QYFA 4B3DA 2W4MA 1M67A 3DXZA 1X8KA 3AY7A 5K20A 1CCWA 5AVXA 3A27A 5ALMA 5KHAA 3GEGA 2G8NA 1YR7A 2YN0A 2JI4A 3HJUA 3TBFA 4EZEA 5AVVA 3H5VA 3GFRA 2HPVA 4TS4A 4WERA 3RS3A 3A6ZA 5BQ3A 4EARA 2W4IA 4EHKA 5FA6A 4HEJA 1IY0A 3PVZA 2B78A 4KX5A 2YZGA 1SOAA 2HA5A 5JQWA 1GKIA 1QHSA 2WKRA 2ZYTX 3OEEA 2ZRDA 1ZH8A 2IZ7A 4P54A 2HADA 3ORYA 1TC2A 4BVJA 4HGRA 3TS1A 3V2HA 5KYWA 1KZHA 3AV3A 1VE6A 3LBYA 1R8QA 2PBFA 3TDNA 1PJRA 2CDBA 3QOWA 3PVCA 1BMFD 5KJEA 5KTSA 1W36C 5FPKA 4IDAA 1T3HA 4UDYX 4I7EA 4QPCA 4IJQA 2Z2IA 4FD2A 3JSXA 1LA2A 4W1PA 5ECDA 4UEWA 2QIPA 2BW0A 3FVVA 3GRPA 3K0CC 3VYUB 3QFRA 2C5EA 3RNLA 3ZDYB 2WJ6A 3IMKA 1BE0A 1YS4A 4DMMA 3IRUA 4HNAB 2EG9A 2AMLA 3IVMA 3CKYA 4DR5B 1D2AA 3GNLA 4PLFA 5EIXA 4PONA 4GZLA 3FPJA 4TWJA 1LTHR 3OE4A 4HGZA 2J7PD 2VWHA 1UDWA 4XCVA 2GI4A 3EIEA 4KLZA 4OYHA 3FIUA 1EVJA 1RCFA 4R0VA 4DG9A 4RF3A 4DLWA 5JNUA 4JBWA 2II6A 3G2NA 2ADMA 1HSOA 2GCOB 2R00C 4PYMA 4OQEA 3A3PA 4BLOA 4LRXA 3EIFA 3GAMA 3VDNB 3Q7QA 3T4XA 1VP9A 1Q0PA 1R5BA 1SOUA 1ETUA 5IRCD 2A7XA 4MUKA 5A3QA 2XUDA 2P5TB 4GR9A 1SK9A 5HBGA 3HG7A 1YCFA 3AHFA 3F5FA 2H1FA 1MO5A 4F5YA 1E3QA 3BXFA 4II7A 4P3PA 5D7BA 3KOUA 5KSOA 3NBFA 1IQRA 4JJ6A 2CY0A 1FOEB 2PX0A 3HKBB 4GRAA 4AZ3B 4DMGA 5KSYA 5HRUA 5KC9A 3KLMX 5B1HA 2Y77A 5B7PA 2SKDA 4BWVA 2QRMA 2X6TA 3NWEA 2IT1A 1P9RA 4K88A 1SUDA 2VA8A 4A0HA 1FRZA 2IZ6A 3OC6A 4CWAA 5JXHA 5DX1A 1IM5A 3ON5A 4RJ2A 4Q1BA 4CLXA 1IG3A 1Z83A 4JIGA 2PSSA 5G0TA 1E6CA 1LZKA 2W2TA 5E95A 3UXMA 1DOAA 4DA7A 1M0EA 4IQ4A 2ZE7A 4CQLB 2WEKA 2OPBA 1O97D 4CI9A 3VYWA 3GARA 4DUGD 4EECA 4UVEA 5EMNA 3JAKA 4OU5A 2ZI3A 3TI9A 3WADA 1MG0A 3CF4G 3HRIA 3VDMA 4CMIA 3DMFA 4KU4A 1BIFA 2O8CA 2O4UX 3L4SO 3TXAA 3GAFA 3S44A 1YI0A 3ZC3A 3I9LA 5AJVB 5KYUA 1KU0A 2QVXX 3NDPA 3N7TA 2JAQA 2Q49A 3U3ZA 1E99A 1X1DA 1SRQA 2I76A 1QGZA 3CX6A 3PTAA 4BO3A 3DL7A 1M0TA 5C80A 5IT4A 1KBOA 4D97A 4ZVQA 4DJEC 3HV2A 4N76A 1S3IA 4BB0A 4CCYA 3QEBZ 4KE9A 5F2EA 4DGSA 2BFWA 5C32A 1XAIA 1T0IA 3JD0A 1E89A 1C30B 1EBUA 3A3NA 4GGOA 4TT8A 2HRRA 5KUTA 3NALA 3UV6A 4ZCTA 1E6WA 2O54A 3R0IA 3VXKA 5JJIA 1CJBA 1HYHA 2Q21A 1EDEA 2WSLA 5AVQA 4HJRA 2YWXA 5IAGA 3VGPA 1MQ9A 4X62B 3D6NB 3ILSA 3TFQA 4I5IA 2O2YA 3I6IA 4BAUA 2H2FA 3C3CA 3D3KA 1QNLA 5JALA 2BP7A 4DIKA 4F3TA 3HB7A 3H4TA 1AY0A 1E8DA 1JIJA 2G9UA 2WUGA 2B1RA 2D5BA 2Z2XA 2H2DA 3JPWA 4L08A 4Q1DA 5AKZA 4BQPA 5EIEA 1P5FA 3DOUA 1Q0SA 4ZHQA 3B36A 1L4LA 3GLFA 1PEDA 3IQXA 1MU0A 4I3GA 1OFGA 3ANSA 1KA9H 3EDQA 2P9JA 4CFZA 1E1NA 3NC1C 4R2JA 2X2OA 4Q18A 1YE5A 4EBFA 3KOYA 4ZT7A 5TXGA 5DN6D 2ZE8A 1OTXA 2FSPA 1C3OA 1VI2A 1SG9A 4M37A 1PI3A 3PL1A 4NPAA 4WDQA 3ZU6A 1R4AA 3QWAA 3UB3A 4Z3OA 4YIHA 2VK1A 1R0CA 2AZXA 2OGZA 2Y1WA 5KQRA 3ZX4A 2XW6A 4XLLA 3S2ZA 2AGVA 2I62A 1OXXK 3PGVA 1EUZA 4GG1A 4DANA 1U04A 2WAOA 3LX8A 1AKWA 1Z4PX 3O8LA 3P0IA 2PMDA 4YTEA 1UBMS 5AK6A 5EZYF 1L4MA 1W29A 2E5WA 3RIGA 3VR4H 3JQPA 3ILHA 1YCGA 1NBOA 2NYAA 4G0PA 1B42A 3A9UA 3KFLA 13PKA 2POQX 4AY5A 2QA5A 5JS6A 2PEYA 2AN5A 1GZSA 2Q8QA 4M88A 3W3ZB 1HQYE 4IIJB 3FPKA 5F3RA 5TQ2A 3KWJA 4DV3B 1N25A 1JU4A 3CV3A 3OHMA 4EYEA 1QQ5A 1NVBA 1U8TA 5IKOA 1EP9A 2E89A 2PV0A 1Y7HA 4WXYB 2O06A 4A0GA 1AHPA 3K70C 4PYJA 2FZVA 4PFJA 1YT5A 3I2JA 3W5HA 2ONYA 3DQQA 4FJ2A 3FG9A 3O90A 1J06A 3MB5A 4CKBB 2P6UA 1U0TA 1XD2A 2RARA 1T1EA 2UYGA 3IIJA 5L3RA 4R1UA 1CUDA 3MERA 1CRLA 3CLSD 2CNDA 1EWTA 1Q16A 2A1TS 2KHZA 2X77A 1LK7A 3CM0A 1YRLA 2DWCA 5NULA 4N01A 1CY8A 1KYXA 1XRSB 2CYBA 2LR0A 3DZDA 1CPYA 2AFHB 1U99A 1EX6A 2EGGA 1DKLA 2W2LA 2ZG6A 3GUZA 3VVCA 4D3FA 4RTQA 5LFAA 2K7FA 5DE3A 5C8YB 3USZA 3FYHA 1T25A 4E09A 1RRFA 4D3YA 5JY1A 1OLOA 5LDHA 3AUJB 4CM7A 1KZGB 2XGMA 3TLKA 1N9GA 2GXQA 5FJIA 1FSPA 4EZIA 4CG1A 1ZM7A 4ZAYA 5AOVA 4FOOA 1W6RA 3BGIA 3D7SA 1GGJA 4PFSA 1WEKA 3UW1A 3JATA 4M54A 4Z7OB 2QV7A 2P2NA 3A06A 1EPUA 3OZAA 4DWOA 4IDPA 1RYBA 3ZWYA 4H16A 3H2SA 4BMNA 4Y9DA 1JG6A 5FQOA 1X15A 2AJ8A 5E8JA 4XOIA 2OCPA 3N9IA 3SZUA 1CXZA 4LMPA 2FWNA 1NWHA 2EW1A 2X58A 2ZI9A 2QTTA 2RSLA 3AB8A 1EU1A 4TMZA 4N65A 1G5TA 1TL7C 2ZYUX 3S2YA 3SC2B 3AONB 3DMHA 4GPIB 5DW3A 1DRKA 2SKCA 1TEXA 1Q0UA 1E5XA 4DG8A 3BB4A 1ZUHA 2XJ4A 4EP1A 3ELYA 5DT2A 1E2KA 1JDVA 3AKYA 3LVQE 3SHQA 4FINA 4F9FA 4B6OA 4M9QA 3MT7A 4HWRA 3U2QA 2POCA 1CK4A 2J9FA 1DAHA 3L8CA 2D8AA 3H8SA 3ZHRA 2BVNA 4QGAA 2DG2A 5HJ7A 2E5FA 1E1QD 3PVSA 3VPHA 1W5TA 2BR4A 4EKGA 5J4HA 4JLKA 3YASA 2VUHB 2KI5A 3CE9A 5FIUA 3H9BA 3MGBA 1RJDA 2E4YA 5FAXA 4CGYA 2VSNA 2FVYA 2KM1A 2UVPA 1L8AA 3PL5A 4LE0A 4K46A 2OC9A 3OIFA 5K3SA 2LCQA 4MWEA 3ZYCA 4EDHA 4AQYB 5CNIA 4C1BA 1XSEA 4DLBA 1DIGA 2VNKA 4AF8A 5H7XA 3DCIA 1ECGA 3HNOA 3MB8A 4RL4A 5FA5A 1PW5A 4KXNA 5KOHB 1TF5A 4NDAA 1KAEA 3H2IA 1N8SA 2MR5A 5JECA 1HKUA 221PA 1GAQA 1GPDG 3I32A 3AEZA 1TVKA 3BWCA 3FTDA 3GLFE 3KJIA 1R0ZA 2AX3A 1T0PA 3KVYA 2ZQ5A 3F74A 2OLJA 2XMSA 1WEHA 3SHWA 4CLOA 3FBGA 1O6GA 1ZGJA 3WWCA 1KEEA 4N9WA 3AWDA 4GU5A 1LBQA 5L3VA 1JIKA 4ZOAA 4YR7A 4ZK2A 3G17A 1VE1A 1H0SA 4NNPA 1K5HA 4P7KA 2YINC 4EG5A 2IIBA 1WNFA 1NSYA 2VPYA 4OSOA 1XIVA 2DHQA 3AT1A 4TV8F 5JH7F 1UOPA 5K0BA 4WECA 3IURA 4WNYA 3F6YA 2FETA 1C8VB 4LYHA 4RKEA 3FZGA 1JT9A 4XH9B 1KETA 4UDNA 1CZLA 2G08A 4WGGA 5E9QA 4BNNA 2NXJA 5KWVA 1N6IA 3AETA 4LKOA 4JT9A 2IE8A 2Q7DA 4YWHA 5KTKA 3KZVA 3T7TA 4L0MA 1PK9A 3PICA 3TZEA 2I5PO 3LUHA 4PZ0A 3ZGOA 3H1GA 5ALLA 4I5GA 4NV1A 3ACBA 4MAFA 1UT8A 1IN5A 2EJVA 4Q9LA 1KPIA 4ZZ0A 1TPYA 3AKZA 3LO8A 4H7FA 4LXTA 2D6FA 1JJFA 1CV2A 1UDBA 2WAXA 3LBNA 4OJKA 1Z2AA 1KP3A 2ATCA 3PITA 1QIIA 2ZXEA 4JP2A 2RGXA 2QVLA 4PN3A 1K5DA 1YJ5A 2VP9A 4F92B 3NHJA 3WC4A 1QP7A 3PKJA 1ZIXA 1E7YA 2HF2A 3OZFA 2OXCA 5FI0B 2GAAA 4BU0A 4ALIA 2FLVA 2IUEA 3TRDA 3I5XA 1T5TA 1K98A 1QHIA 1S2DA 5CHYA 5DBGA 1S7CA 2Q41A 2H9AA 3F3SA 2VBFA 3H1BA 5AW2A 1WW8A 1QF7A 4IDGA 4G0OA 3A7DA 3P96A 2YFYA 4TTIA 5TQ0B 2SCUA 4CCSA 4RHEA 4RO0A 2COUA 2ZUWA 3KV1A 5EIHA 5K0FA 1UFOA 5CDFA 5LL6P 3M4ZA 2VUIB 4MUMA 3RS2A 3FWNA 2AYXA 5GM2A 3IO5A 1EP1B 2OB1A 3P19A 3K70B 2QRQA 1TX4B 3IAXA 4IDOA 1T6YA 3IAM1 3DD5A 1K6MA 2JZOA 3BMOB 2Z95A 1EUDA 1Y3HA 1Y4SA 2QPTA 3QUQA 3JD2A 2Z2ZA 1GGEA 3K8ZA 2DBZA 2BUCA 2YASA 3TVDA 3MW8A 3VHXA 2Q2NA 1NPDA 3AB7A 3GJ7A 1TO6A 5D87A 2IKQA 1X7GA 2EQBA 2QMZA 4WZBA 3WQQA 4LX0A 2M6SA 2RI0A 1PP4A 4NBUA 5IC5A 1JHMA 3ZK9A 1OYYA 4MMYB 1P0PA 2H4FA 1K27A 3AZQA 3ETNA 5HCIA 4HWGA 3SOPA 3Q88A 4XQ9A 3HO8A 3MS2A 3RVNA 1WSWA 2P6PA 3PA6A 1A3CA 1NQWA 1TJ4A 2SBTA 3U9SA 5K5EA 2Q9UA 5DM60 4NULA 1C5KA 4Q48A 4MCJA 2SICE 3MTAA 3CRW1 3IPRA 3RYHA 3B7PA 2H1IA 3PWSA 4CUKA 2JFXA 1Z39A 4NI5A 3R8CA 1YQEA 3DL0A 4R2WA 4EF4A 1Q6ZA 3IUMA 1U9YA 2RH9B 3IEMA 3AVXA 3OE5A 4OQ4A 1JHQA 2VRNA 1RZRA 2V65A 1QKJA 2CNOA 1AS2A 2OWEA 3P2IA 4BNVA 2VTEA 3HDTA 1O2DA 4UNQA 5KX5B 1MAAA 4Z1MD 5C51B 4MS3B 4C4RA 3WYDA 4K7JA 4C0QC 1WBBA 2NUPA 2VJKA 1OBFO 5E6SA 3VX3A 2IDKA 4R5HA 1P3DA 1YCDA 1HLPA 3O7WA 3OI7A 4FBGA 5IX8A 3F4LA 3BXZA 5IMSA 3VO8A 1T2DA 2PT9A 4ZHQB 3E18A 2K87A 5EG5A 3ZE7A 1PNQA 2BTQA 4ND6A 3IV7A 4KKXB 4YDSA 3VPDA 1RWVA 2XTZA 4C1NA 1E9EA 4DNPA 3LA6A 1WUJS 4I4TF 3AVQA 3QGMA 4M1ZA 4QNMA 4QXPA 5I7VA 2ONJA 4EQ6B 4P5DA 5AI9A 4ZI3A 4F5DA 1NMEA 3HGQA 2GFIA 4PYLA 5CDSA 4MVWA 1MKYA 2ZJ2A 1PBNA 3AR6A 3L7LA 4QELA 3BKXA 2XKAA 2P9YA 3O1JC 3W9YA 5JOQA 1I13A 4L85A 3W3AH 4FNAA 3RJTA 2HMUA 3ND5A 1FSZA 4XVCA 4R1TA 4HAXA 3VKUA 4CU2A 4ZDKA 1ESDA 5B12A 1DHRA 1TM2A 5C8VA 4JHXA 2VZEA 3PDIB 4K6KA 4QLAA 3K94A 1VRCA 2NV0A 4QDJA 1ZGBA 4PTLA 1DXQA 2VJPA 5E9JA 3ZHTA 3P32A 1YK1A 2P40A 3WK9A 2HJVA 1ESCA 1M6VA 2V7WA 4OFXA 3P9ZA 3EF3A 5GGXA 2VXBA 2K2QB 1KR2A 2O2EA 2QN2A 3AI1A 5IARA 4JSTA 3R7FA 3REQA 4D9EA 1YKFA 4KPYA 2OCLA 3KS9A 4B9EA 1OLXA 5KNDA 3JZDA 5HF8A 2H06A 4P83A 5AW6A 1CR1A 5KNCH 3LDGA 1JHPA 2IOFA 1MQSA 3IVGA 4XX1A 1WPQA 2C0QA 5KX5F 2BE7A 4GI1A 1P39A 3WFZA 1OPRA 4OOFA 2HQ1A 3QU9A 1E63A 4RF5A 4S12A 5EMKA 1ZD8A 1Z2NX 1U9CA 2FTKE 3S2IA 5TGDA 5HDBB 2HNBA 4PC2A 4AURA 4CM8A 5A1JA 5BWNA 1GSOA 3DAOA 4CMKA 4BXOA 1D09A 4DC1A 1U2PA 3L0OA 1KZ4A 1DQSA 3HFGA 1OKKA 3SR0A 3BXPA 3IMFA 1OJLA 3WQBA 4NFLA 2KBEA 1GNTA 2HH9A 1A5ZA 1GPUA 3H84A 1FNCA 3MILA 5LMNB 3RBVA 1V26A 3FDFA 3L6BA 4B2IA 3QE2A 2B69A 3HJBA 4JLWA 1TECE 1ONNA 1RQNA 2FW1A 1LPAB 1GTVA 2ID9A 4W5JA 4DM4A 1TM1E 3UB2A 1D07A 4TKZA 4EA9A 3M2TA 1PQWA 4AIIA 1FZTA 3D4OA 1T4DA 2H18A 4E2WA 1OY1A 1PUIA 3DBLA 3QKTA 3NHSA 4TV9B 3FUXA 1BKSB 2CBZA 1TOAA 2VYQA 1TUIA 3FYTA 3S5UA 2I6FA 3JYOA 4J0DA 4IUCS 1E92A 3L1JA 3IR6A 4UNSA 3F4KA 4QQKA 3B6MA 4MRAA 4AX8A 3LCJA 2JZCA 4R4JA 4FPXA 4AW9A 1JDNA 2ZJAA 2FR8A 4HLQB 3KOWA 2R62A 2VPZA 4M4SA 3P0RA 4JLUA 3ZWBA 2N46A 1OXBB 2EFJA 3JQ8A 4BZZA 3Q10A 4PG6A 1JFRA 3X1JA 4DPMA 2UZ1A 3A4VA 2JAXA 3DL4A 4HEQA 1BW9A 2FW6A 4XIIA 3U37A 4CKEA 5A0TA 1FFGA 4FS3A 1XMQB 1RNLA 3BGOS 3H17A 1Q91A 1BOFA 4MUBA 4N49A 3D0KA 4X54A 2B1GA 4YI3A 1CR0A 2XIQA 3MGKA 2QL5A 4JNKA 1Q95A 3W4JA 2VJBA 1F20A 3L0PA 3UAYA 2FHSA 4L76A 2W6ZA 3RRYA 1FW6A 2C5GA 2PMFA 5CNKA 3GT3A 1V5WA 3NASA 1QUFA 1ZNZA 4NL4H 4U6NA 5A0VA 1M5UA 3RW9A 1EQAA 2FEPA 2ZYAA 3K4QA 5CW1A 5M2QA 3CZPA 3RK0A 1R50A 5ED4A 3SHFA 4O63O 3RREA 5DNYB 1BA2A 1OLXB 2EIHA 5IXYA 1F9AA 1O77A 4R7TA 4A26A 1A04A 3GROA 1GCOA 1XHEA 3BL8A 1DUIA 1M83A 1L7OA 4NX2A 1JEEA 4QYIB 3HYSA 4U39A 4YRDA 3PUVA 3VPCA 4YJ2F 4NSNA 1UK6A 5KZMB 4DL9A 2YXNA 3KJEA 1RW4A 3UKOA 4D42A 5CB4B 4MQEA 1H9CA 1XI2A 1Z82A 1BEUB 4JGIA 4REMA 1P4GA 1PSZA 4LTNA 4UNNA 5BYJA 4QOJA 1Q22A 1U3DA 2VWPA 1DTWB 3SHVA 4XA8A 3GRZA 3ZU2A 5J5VA 2QUAA 3DXXA 1U3GA 4P2GA 1J42A 1UBTS 1FX1A 2C8KA 2XGSA 3UJ3X 2DT5A 4PX2A 2Q5EA 2QRUA 3VM6A 3IJ5A 1BEEA 1BHO1 2C59A 3I30X 4Y0NA 3TUIC 3ZKWA 3MYRA 5TIIA 3S81A 1JMKC 3FJYA 1XU9A 1WULS 1ORVA 1IRXA 1V71A 4YDRA 4JB8A 3HM9A 1DJOA 3WJ7A 1GEEA 1GSAA 2FQ1A 3FUUA 3LO5A 3ZCVA 5IF9A 1SO8A 3O4VA 3C1TA 2VZ8A 2XHZA 4FLEA 2QRZA 1UBSB 2UUBB 3UBMA 3TJRA 4RK6A 5KJ1A 5J63A 5JCOA 3PE3A 2EJTA 1YL7A 4HXYA 5MN6A 2RK4A 1XDZA 1IULA 4PVDA 1X13A 3BE4A 3AVPA 3PGLA 5KYKA 2OBFA 2P8JA 5TQJA 3UK2A 2CF6A 4G4IA 1Z8HA 2NU6A 3MCZA 4D81A 4EYGA 3HXQA 3FLMA 2JHPA 4UAVA 1HT2E 4BECA 2JHCA 3O9ZA 2OEPA 5AHWA 1IXRC 6LDHA 4KMSA 4R2MA 1TCAA 4UD6A 2I0FA 2RONA 2IH4A 4PYOA 2BMFA 1GZHB 3C4JA 4XVQA 3CH7A 4GBGA 4NCKA 4YJHB 5CFMA 1W88A 1R7RA 1MTZA 2ZLBA 4H7JA 4BNTA 5A7FA 1G0NA 1QANA 3BF8A 2XA2A 2H1RA 3K2BA 2R6JA 1IY9A 5FLYA 4TQUS 4E0BA 5I3ZA 4QO7A 3B6JA 5FTLA 1JQEA 4RX1A 5FBKA 2IZ1A 4RABA 5E1DA 5EMMA 2N47A 1M2GA 2WP0A 3DP7A 4C30A 1JHOA 4YRMA 3BB1A 1VB3A 4LF9B 2XUJA 3NQ41 1FS6A 1KOFA 2CXHA 4Q37A 1FQOA 1AB5A 4DWVA 4OP1A 1LK0A 9LDBA 3RADC 3IT0A 4RLHA 2VJOA 1PE0A 4KBGA 2OO5C 4C0HA 1X7DA 4NBLA 1IY1A 1X1TA 3ZLUA 3K09C 3CZAA 2AQHA 3O2JA 3ZLTA 1XPOA 4AG3A 1QE5A 5JSZA 4Q4LA 1Z29A 3LC7O 3LW7A 1FU4A 1RJWA 3CUYA 5D3KA 2C2MA 4Z5XA 2B2CA 3IELA 4UM8B 1NXXA 5FA8A 1B8VA 1XQXA 1D4FA 1KVQA 2BMEA 2G7ZA 3FYCA 3QF4B 4YXFA 4ARCA 1HNNA 2IELA 4UC0A 4RTMA 2GLXA 1ZXLA 1UOOA 3GD7A 2PUTA 2IU3A 1T34A 3KEMA 1LBIA 1MIOA 2AEMA 1R8SA 1Q0LA 4Y7DA 1V96A 3PZRA 1D2RA 4KQ6A 3GLIB 3L8FA 4UHBA 5JJ5A 2D7JA 2QT9A 4TSKA 3F9CA 3HY4A 1OH5A 4Q6WA 1OIVA 2NNLD 4CL3A 2R6GA 3IFSA 2QLNA 5CBKA 1O95D 2BSAA 3V8BA 4IDNA 3FFXA 3L6UA 5BW5A 1PV4A 2J85A 1Q7GA 3Q7TA 3ZEIA 2DQYA 3IEVA 1TFUA 5D3QA 3F0TA 3G7NA 4RCZA 4EMSA 1QFZA 3AKDA 3L93A 5BN1A 4DB4A 1MB2A 5L4SA 5D6OA 2PTGA 3LPAA 2G3YA 1E2NA 1JLLB 1RKVA 2H4WA 2ZT8A 3LT5A 1K92A 1GD1O 3BWXA 3R5XA 1C1HA 2CLMB 2OBNA 3UAVA 4F2GA 3WL3A 4CKWB 5TARA 4R2KA 3VH4A 3T0IA 2QX9A 4E5VA 5TMDA 5DHRA 3MMZA 3EXHC 1O08A 3BIOA 4Y2YA 1IDOA 1XZMA 2AMJA 1A88A 1WP4A 2PKXA 2P3LA 3JWIA 4TZTA 3R5JA 1TPZA 5EXTA 3AVVA 1KO4A 3I28A 4P7BA 4KQGA 2EL9A 3PDUA 4N3CA 3VU8A 2XI4A 1X6VA 4B3RB 1YI8A 4GKAA 3W1EA 1PS9A 3IE2A 2YDYA 1ZMTA 1Q2UA 2XUZA 3ZXYA 1NC1A 1CWUA 4ZEWA 2D2VA 4LOKA 4LS3A 1M1NA 3FNFA 3HKDA 3P27A 1I6LA 4BVAA 3KUCA 2EZ9A 4W5HA 5CLIA 1YZ3A 1KP2A 3H1EA 2C61A 3PGMA 3TL2A 3MCWA 3IQIX 3V7UA 5EQJB 4B4VA 4D8XA 1SK8A 4ZKEA 1BZYA 1UKEA 4PZDA 5EE1A 5HUHA 1U0JA 1PYOA 2CC2A 4IF6A 3ESDA 4UTZA 1V39A 3ZIAD 4Q3DA 2RHLA 4AN1A 4MHSA 2UVPB 1X7XA 2C03A 2Y4NA 3OD5A 3X1ZA 1E3MA 4QBKA 3G1TA 2D5CA 3EFOB 3CTPA 2COKA 1O0CA 1T36A 2JLVA 1V37A 4G3XA 1KI6A 4FGWA 4KFUA 2BBSA 2FP4A 3ANMA 3OMLA 3OFKA 1WMSA 4EGQA 2R8XA 5F1KA 2YWDA 4MYHA 5F2OA 3MT8A 5K1ZA 2QHXA 3WMWA 1TMYA 2EQAA 2HBQA 3VR1A 3T95A 3W5IA 3E4CA 4AIRA 4CEHB 1IPFA 1I4EB 2YFHA 3AUYA 3UH0A 2RCYA 3FWYA 3AEQB 2V7XA 4G09A 5BR7A 1KH3A 2VHTA 5FNVB 5LQSA 2QZJA 3PQ8A 3P0JA 3HKBA 4AZ3A 1N5KA 3A6KA 1QJ4A 4PQGA 3K6SA 5BN4A 4MYCA 4R3NA 1U11A 3Q2IA 4ZAGA 2F43B 5IEJA 2XNHA 4WSOA 3K2QA 4B7ZA 3IODA 1ECLA 2FUKA 1BN7A 2CHQA 4UTVA 4V02A 3K20A 2X0IA 2Q3BA 3RIEA 3C4QA 2AJLI 1EJBA 3R74A 4BNUA 5ALNA 1SXPA 2FFBA 2UXCB 1P7ZA 1ID8A 2LTAA 5DNWA 2HLPA 3ADDA 4UNIA 4YDHB 3RVRA 1L5FA 3VYVA 4TTRA 1E9CA 3IJRA 4L4ZA 5TPWA 3I37X 1VPWA 3HRKA 3OFNA 1D6SA 2IHYA 1CDDA 2CWWA 1M1YE 3LUDA 1LDMA 1RI1A 4PFQA 3CNBA 4DBVO 1L1QA 2W37A 3FVQA 3DDSA 4QDXA 4CFYA 3MNFA 2C2BA 2NW6A 3RSCA 3R44A 2NU8A 1GR1A 4CTKA 3BT7A 4LDRA 1C9YA 4I66A 4LDNA 1CU1A 1TQ2A 1Z6PA 3TVYA 2VYFA 4RK4A 1SC6A 1W5SA 4KIJA 1GL6A 3BSFA 3NBZC 4ZGBA 2IWRA 5HE9A 4GM4A 3V4RA 4O4LA 4WZAE 1TTHA 3N2NA 3QTTA 4Z4CA 5LDDC 3CBQA 2PUAA 2YFQA 4QTUB 2QY9A 3QNMA 4TL6A 4Z51A 2AA3A 4M9UA 3M6XA 3QG1A 1QB7A 2VLIA 4FMBB 4JJFA 2XE8A 4BBZA 3K32A 3ETLA 2EVWX 1N2CB 4EUFA 4RENA 1XZEA 2A9RA 5AVKA 1N6OA 3OX4A 1THGA 2NGRA 5A0FA 3VC3A 3ZCUA 1J8VA 3ZD8A 3CEAA 1CUBA 3CRVA 3BSYA 2VT2A 1P0FA 4XCQA 3T3MB 3PX7A 3IIMA 2DKFA 4MWDA 4C5BA 4FDTA 4UUAA 4DUZB 3RE1A 4O4JF 3DXYA 4UNPA 3P4XA 4TYWA 1ZGCA 3PE4A 1T8PA 2M1ZA 1FMTA 4TL8A 4EYOA 2AEFA 1KSHA 2WD7A 3TEJA 5KOJB 1XA3A 4KE7A 5KSPA 4Z4QA 2DUWA 1GZ3A 1KC3A 3H5IA 1U28A 5CP8A 4R31A 1E60A 1QONA 5ERGB 4RTOA 4MV3A 5EY5B 5LQAA 3NHYA 3LU1A 1GEGA 2NVOA 3PJRA 1DV1A 2FSUA 3KJZA 3F46A 5LXTF 5K7SA 1W5FA 2CHFA 5K03A 3A4YA 2VT7A 5KNBH 2Z3VA 3SBEA 3R7BA 1ODLA 2C7QA 2A5DA 1P6QA 2NACA 1QGUB 1OASA 4OXYA 4DYDA 2H2GA 3A6EA 4MA4A 1YUBA 4MS1A 1RBYA 1JNYA 1VKZA 3U7IA 3W6PA 5JVDF 3I9V6 5CLLA 5A4JA 3RRNA 1WHSB 1QHFA 4KQXA 3V4SA 1YRAA 1PCXA 3VVLA 3ZWCA 4U7WA 4B4KA 1F12A 4YACA 4Q47A 4Q6BA 1Q7RA 5AKYA 1RI5A 4YUWA 3Q8LA 1YK0A 3A9TA 5IYZF 2C7OA 1JHRA 3EQ6A 1T0JB 2Z9BA 1Z26A 3D1LA 3WRXC 3ZUPA 2JLUA 4P3KA 4QUJA 2ROQA 1TTTA 4JCCA 1CS4C 3HKEB 5CT9A 3V80A 2IHJA 3IP3A 3LNTA 1WMEA 1JA9A 5C4MA 2RAPA 3KQLA 1W1WA 2AQIA 1GU7A 4OH7A 2QNIA 5IAJA 2ZKLA 3EWAA 1BE1A 4ESOA 3T0FA 4E30A 1RADA 3ZJYA 1WX1A 3HPQA 1W34A 1XYGA 3DKIA 4JC0A 4LWZA 2BIFA 4C4PA 2GARA 3WWOA 3FOBA 2VYVD 1SKYB 1WXHA 2BEUA 3QVGB 3RU3A 3WYGA 1NQTA 5LIPA 3KKOA 1SZDA 5ECWA 3CW8X 2LKCA 1G3QA 2PD4A 1VL6A 3CVWA 3ROPA 4B4DA 3QPCA 1YKSA 3DLHA 3ZHBA 4R69A 2HCRA 2QBYB 3C16C 3PQDA 2WK1A 3VPSA 1MEOA 2OGSA 2OENG 3SVLA 3EIOA 4MW5A 2V7QA 5KYWB 4PM4A 3OWOA 4UDXX 1NF8A 4MZXA 4DYVA 1Z06A 3R1IA 4S1TA 5BSGA 4CM4A 1Y6QA 1N7HA 4PCUA 1NI3A 3OF3A 1KI4A 2PZBA 2TMDA 2HHLA 1B1CA 3ABIA 2ECFA 4FB4A 5JNTA 5IN4A 5G53C 5HCUA 4B6SA 1QS0A 4MGKR 3VO1A 3W6OA 4K26A 4BBAA 4FX5A 1BCRA 1YRWA 5LQCA 3VJLA 2I54A 5I9SA 5JRJA 4NHOA 3WDKA 2XF8A 5REQA 5ECYA 4B75A 4CHTA 2BHRA 4CF3A 2ZJ3A 1Z0UA 4IO1A 1N6LA 2C7VA 1GTL1 2FMFA 1D6JA 3RASA 2PO5A 4IGKA 4M6WA 2IHBA 4IG4A 1KDVA 2YIMA 5C1DA 2RC5A 1Y1LA 2P9ZA 1QU2A 2FQXA 1DAIA 2YVLA 2CLHB 1EUCB 3GGSA 1A7UA 3HO1A 1QNFA 1JJAA 3OZTA 3S7ZA 1SWVA 2HIHA 1PL7A 2ZPAA 4BQIA 3E3LA 2W0SA 3SC6A 3EZGA 4LIPD 5BV7A 1Q3TA 2EIXA 3KQSA 3HPRA 1JTFA 1ZGHA 3KQMA 2PX5A 1D8AA 5IWCA 1YBVA 3MINA 2CZCA 3X0DA 4B9AA 3DEHA 4ZEOA 3QE3A 5JY6A 3TO5A 4ETMA 1T13A 4KNYA 1X38A 4PSAA 1CRPA 3DZGA 4MGIR 4NZMA 1R4MA 4XLTA 4AS2A 3V42A 2J6CA 5K99A 1MC1A 2B34A 1M8KA 3A1EA 3Q2OA 1IRIA 1K66A 5DYYA 4ZJZA 4UVDA 1E7SA 1Y34E 4MVJA 3R0QA 4FUQA 1F7VA 1UJ4A 3BUSA 4M0CA 2ACKA 3BDVA 5IMBA 3ENVA 5COQA 3IHLA 4QFBA 2CYCA 3JVUA 3BYZA 1BMQA 5EEHA 3V5NA 1Z9BA 3G5MA 3HZRA 5TEWA 4WN3A 4XM0A 1R0XA 1THTA 1YBHA 2AFIA 1GFIA 1VCNA 1PJ8A 3C8MA 3DDHA 1ZEJA 3PDCA 1TKBA 4H6PA 4HQLA 4LBZA 3TQOA 4FJ0A 1GTZA 3VU0A 3U19A 1UKCA 4LYAA 4Q34A 1WZ2A 4MO2A 2PZEA 1KI3A 3M6VA 3WG9A 3MWLA 1RPTA 3G5LA 3V8PA 4PC6A 1SD2A 1E1KA 2VVTA 4ACAA 1AQJA 3ZV3A 4HNVA 4I55A 1B43A 5HGJA 3TTVA 3B1ZA 3KAPA 4NATA 1N6KA 2PMBA 2HXYA 3V6MA 2D5IA 2GYYA 2EFYA 4L6CA 2IQIA 2PPVA 1B0AA 1DBWA 2R86A 5E7MA 3TK1A 2DEUA 2FPIB 1DC5A 3BAFA 4LISA 1KSFX 1K88A 4ARVA 4BKRA 4BFZA 5JEDA 1O87A 4RY9A 4YAJA 3TCXB 4IFTA 4R05A 1HNZB 4HUQA 1NURA 2H3HA 4P34A 2NXWA 1RWQA 2XQFA 4U9IS 1TT5B 2VNJA 2DPLA 2BEKA 3P2OA 3EX7C 4GS5A 4NU5A 3W5UA 2WV7A 3GJQA 3IAEA 2I8AA 4B5LA 3H1FA 3OQJA 4O4IB 3SNHA 1AG9A 3DMRA 3HJHA 3PDJA 2EBHX 1EB9A 5J2TB 4RD3A 1M8JA 3VNVA 1O58A 3EDYA 2ZRQA 1X0XA 2FLKA 4CIDA 5EKXA 4Z54A 2NYVA 4OHFA 1RRGA 3L8YA 2QRJA 2LD4A 3F71A 3DKPA 4FP9A 4W6QA 3WZ2A 2HREA 4GL4A 4D1YA 3GIDA 2WF9A 4XWTA 1JG4A 3HN6A 3WMRA 2A1TR 4MRPA 4MITA 3TRHA 4ENRA 1DKNA 2BI4A 4GBMA 1C1DA 4OHPA 3M6AA 2C1EA 2X86A 3N86A 3CNOA 4OCZA 1J0CA 1NBAA 5I9BA 4CFSA 3EC2A 4CUZA 4ZCIA 1ZS9A 3I6BA 4OHMA 1A2KC 2VCEA 3G6KA 4GKVA 4MJLA 1T4CA 4RA9A 4TTPA 3I83A 4M0MA 1FTWA 2QTRA 3NVMB 4R1LA 1VHJA 3PFFA 2G7MC 2NUPB 4IYRA 2VRWA 4IGEA 1P7VA 2HZ7A 1O1YA 2R47A 2X1HA 5D85A 1GPWB 1HURA 1WSAA 3N5KA 4NMXB 4M98A 3U1VA 2X42A 2YICA 1FFBA 3SFZA 3W8DA 2QL9A 2CK3A 1QH9A 2V0CA 1GSHA 2AQ8A 1JB1A 2EEZA 2JFHA 2WDPA 3PPWA 1PFYA 2QYSA 4PZ9A 3G8DA 3U3JA 3UWDA 4EY3A 5A5DA 3PHBE 3A04A 4J16A 1KDPA 3K53A 3KL2A 2J9FB 2OCBA 4FU0A 10MHA 1RPZA 1KO7A 2BM1A 2PM8A 3EUWA 2PLAA 1J49A 1QDUA 1HL7A 1SXJC 1V95A 3WBFA 2O8FB 1DRVA 1DX4A 2AOUB 4C7OA 1IQPA 1SIOA 5G1PA 5BUZA 4E03A 1MEJA 1DBRA 3S1LA 4UOZA 3KE8A 4LV8B 3ZOKA 5J1TB 2W6JD 5DHTA 3S1AA 2ZBEA 1I9CA 2G07A 1RAEA 1F8FA 3TMKA 4JROA 3KQTA 4L22A 3HI4A 4I1RA 3V8VA 3Q8KA 2QNBA 3FYUC 1EAYA 4PIMA 2O0LA 5CVTA 1MH1A 2XWBF 2JK0A 3V2IA 1J00A 3B9BA 4MUHA 5EOVA 2BGWA 3PC2A 3GEEA 1FB5A 3KD2A 4D98A 1AUPA 5BQXA 1XU7A 1Y7PA 3DT6A 1TFRA 4FHZA 2WM2A 5EE5B 4KAFA 5EGSA 1OB2A 4FHCA 5IJ9A 5CVJA 1LS6A 1A4UA 3DV2A 4KEAA 4PQEA 5HIIA 2DY0A 4GPTA 2W11A 1XZNA 4YP7A 4A8HA 3TQQA 1NXPA 1J1ZA 2A9JA 1H9BA 1OT3A 3BKWA 1YE8A 3FA2A 4HMOA 5BRNA 2IIVA 1KQPA 4ZIRB 3ER8A 4W7IA 3N39C 2O6LA 3OZSA 4FYIA 4XR4A 3O0TA 1YZHA 1EFPA 1QVVA 1ZGZA 2NZJA 4MKRA 1SU7A 4Q3NA 4TYMA 4C06A 1V8ZA 3GJRA 4QHYA 4C6RA 2E9SA 2AWNA 2XB4A 2BKUA 1H42A 4HR7A 4BQFA 1AH2A 2CCKA 3C5EA 4J6EA 1P5ZB 3FPCA 1UBCA 5K3FB 2FMUA 2RGRA 3QBEA 4UVGA 3FF4A 4MCIA 3LBAA 3AKCA 1DU4A 1QIDA 1RLOA 1ULHA 2YHSA 3T9FA 2BP7B 4DLXA 5BSUA 3PQ6A 3ZGZA 1GRVA 2DECA 4G25A 4HB4A 4UHEA 4ZT3A 4OLJA 2PGDA 4IZ6A 1GUDA 3G7UA 1GARA 3PFGA 4EG8A 1GZVA 1RCUA 2O59A 1JTEA 1ZI9A 3PEUA 1T9HA 3P0EA 1VZ2A 3KCQA 4TT3A 2QMEA 4X90A 1L4YA 4NBKA 3G2PA 3F7MA 2HNAA 3FFAA 2B9VA 1DT5A 4GSKA 4CTMA 3DDNA 5T4FA 1N2JA 1SEPA 2D3TA 2YV3A 1R0WA 2YJTD 4OHRA 3PGXA 4KQWA 4ZYXA 3NTQA 3ADBA 3DMNA 4MEBA 1G21A 5I48A 4QX6A 2VJCA 2ZXUA 2Y9PB 3C39A 3P2EA 6REQA 3EWNA 1WXIA 3O3NB 1JIUA 4Q7JB 2EHJA 4Y9SA 2NVUB 3ZHQA 1Z6AA 3T06B 1HK7A 1GUYA 1U9IA 1QVRA 1BKYA 4O4HA 1NFRA 1CBUA 1NVUQ 3BJMA 1DC7A 3NORA 4LYYA 1C0KA 2WICA 4P3XA 4JT4A 1TADA 4XW2A 2FDXA 4EA6A 5L4LA 2WWGA 3BQ9A 3RHZA 2I7DA 2ZT6A 1E4OA 1GZ6A 1QFXA 3D3NA 3KPUA 4LW8A 5LQNA 2AXPA 1UPAA 4NU0A 1U8YA 3D0RA 5ER6A 1N7JA 1KY4A 3R23A 2ZI6A 4JVMA 3W06A 1QIFA 2AI1A 2Q4TA 3RVLA 3U0BA 4ZOQI 3E9RA 4TXHA 4ZOLF 4RTNA 3IX7A 2YVQA 4J1TA 4GI3A 4RORA 2R0QC 2J33A 2RFLA 2C7RA 1PDWA 3PEEA 4XFKA 3RS5A 1Q92A 4BPRA 1EVQA 4JB3A 1B73A 2AF4C 3AHHA 5F2NA 4JB0A 5AM1A 4RVHA 1VYVA 2FKAA 2W58A 2B20A 2C2ZA 2NTNA 4BLTA 5FPHA 2DJIA 3VMMA 1QHXA 4CMEA 5JFOA 1SFRA 3V4LA 2I7TA 1T5IA 3CF4A 4GLLA 3ODPA 4KV9A 4XYBA 3HCRA 4XQ0A 4X91A 2PBRA 3SX4A 4LJ9A 2IYFA 2X0DA 1ZRMA 2G0TA 1OAAA 3DQPA 4K03A 3HA7A 2BCGY 5FO0A 4MK4A 5BT9A 4UBKA 2OHOA 2B82A 2QTZA 1II8A 3SEZA 2V3CC 1WV1A 2DFNA 4LJ6A 2WMYA 4YMSA 4BMSA 4JDUA 2P3SA 3TPZA 2FUEA 2ZJ7A 4FGUA 1IN7A 2AFHE 3C97A 4K6CA 4X6LA 3CZ9A 4E5YA 1CUEA 2ZWAA 3BD7A 4IH1A 1G4UR 3BZWA 3SXJA 3ESZA 5C81A 2OV6A 3ZEAA 3TCKA 1J0DA 3HJRA 3SCZA 4ITUA 1NU8A 2IC5A 4KWHA 4M8KA 4XWWA 1NBMD 3CLSC 4WEQA 1ZK3A 2DFVA 2WINI 3K1YA 2G09A 4D0GA 1U3VA 5LQKA 2DE0X 1SXQA 1ODIA 4AWAA 5JZVA 3GL9A 3NHZA 1IN4A 2HWWA 1MVNA 1R9NA 4B48A 3L8ZA 1X9IA 2ZBDA 4ZYUA 2WD9A 5G2OA 3V4VB 1L5WA 4U5XA 3MF4A 5A5VA 1FP2A 1ZPDA 3PPYA 2OZKA 1KGDA 3V1LA 1G21B 2JVJA 1EUDB 1SB9A 1TZ2A 1I0ZA 2OORC 2KLHA 1CY6A 1GPMA 2OQIA 2P5SA 2IYSA 4U00A 3AIIA 4INPA 3UT5A 1HWYA 5IDXA 2V5UA 1ZUWA 1YIDA 1KU6A 3AM4A 1FDIA 1V8PA 3HSYA 2PWZA 1YVEI 1BVRA 3MS7A 4MVJD 4X63A 4F12A 4M9RA 3THYB 1P9WA 1SCKA 1PEKE 4G0VA 5DK4A 2HD4A 2FSIA 1E1QA 4FT4A 4JHLA 1HLFA 1MC8A 5H70A 1V1MB 2YHUA 4RJTA 5HTOA 5BNWA 1HDCA 2NXNA 2GM5A 3AEUB 4LJSA 3SQNA 1JKIA 1PLKA 8LDHA 2NZXA 3GGPA 3ND7A 1W88B 2HWUA 2PQMA 3DJYA 2CJPA 2G5CA 2DVMA 3DKVA 3MRTA 4GRIA 4OATA 4OREX 4PAMA 4W9NA 2QSZA 3W90A 3A4TA 2P0AA 3KJQA 2FPXA 3QX7A 3RSHA 1YAJA 1P4SA 4ZVOA 3OICA 3WWYA 1RRPA 2WR8A 1Z2OX 2ZRAA 4R8LA 3HKCB 3A1DA 4G8DA 4YJ3B 3J81k 2QZSA 3UVEA 2ZUBA 1GQSA 2QRGA 3R5TA 4NR0A 5HKLA 3QVMA 4FCTA 1LFAA 1UXIA 5A9TA 4TTQA 2BFDB 1SZCA 3EOBI 1FS4A 4DSAA 1PFUA 1VLJA 1IH8A 1Q14A 3GAZA 3IHKA 3KZ1E 4GP9A 2QD4A 4IKPA 4AMZA 4EPRA 2O3QA 1Y8RA 1R37A 2GVZC 4LZPA 5HYVA 1A4XA 4PHCA 4AMYA 3EY4A 4DQ0A 2ECKA 2WTEA 3NYQA 5IT5A 4GR5A 4QA9A 2CUTA 5IS2A 1N6NA 2C57A 2DULA 4UFOA 3ZY2A 5JCZA 4HOYA 4BDSA 1G64A 4R8MA 4CQNA 1JU9A 4LMRA 2EFCB 4L50A 4NOMA 4RFSA 4ZQBA 5DLYA 4BNJA 1FYXA 2QN7A 5E38A 3DLCA 3TLZA 2OD2A 3KAKA 3TQCA 1A4IA 2OBXA 3ZLVA 5AHOA 1W52X 3UXYA 3U4QA 3C3KA 3VR5D 2GD2A 2O52A 2WYVA 3BN3A 3FI0A 1UM9B 4ZGWA 1QDLB 3FBWA 1AURA 4EF6A 1QYVA 3NO4A 3EYWA 2VOEA 3OCJA 4EPWA 5H1YA 3RUFA 1RWBA 2XRYA 3P4UA 5I9TA 5J59A 3E53A 1JEAA 2BR3A 3MT0A 1LZLA 1MTOA 3EAGA 2CCGA 3GFOA 3DJFA 1QQ6A 2RBGA 4PW0A 3UA3A 4W5TA 3S68A 3K4HA 1S9DA 1A7JA 1IIBA 3B20A 4RSGA 4EJ6A 4L5AA 1HH4A 1DQPA 1PG0A 2H2WA 5C3UA 1XTKA 3K3PA 5U4XA 2EP5A 1GGMA 2RK3A 3EEQA 3D4PA 1JLLA 2O8FA 2AW3A 2XVZA 1Q0TA 3A3YA 3MCTA 1CJKC 5FL7D 1MB3A 1EX7A 4LZOA 4RVOA 1RXEA 4IHJA 4JLDA 1VJ0A 2QL7A 3WL4A 2Q1WA 2QVGA 2Z58A 3WI7A 1ORHA 1X7XB 2X9QA 2VATA 3H42B 3PHGA 4HLNA 1M1UA 4KUGA 3RTBA 3V1YA 4PGMA 3HVUA 1MH9A 1XAJA 1HUQA 4RH1A 3WO1A 4XM2A 3ZNQA 4Y6LA 3RQIA 3GEHA 3HCFA 5KMGB 1OPXA 4P8RA 2J5QA 4E12A 1DJMA 4U8GA 4EKYA 4IUBS 1AUVA 5FYQA 5LYYA 4PBSA 2F17A 1P2VA 3OU7A 4NBRA 4HVLA 3D02A 2CL0X 3KYJB 4QGHA 4ZO9A 3ZKAA 4DR7B 3MOIA 4J0QA 1RPAA 2XB8A 3I76A 3QPBA 5ALYA 1CUIA 3EVEA 1CEYA 4BTLA 5KYYA 3NJ4A 4B3HA 3NG1A 4DDMA 4WUTA 5K9ZA 3DZIA 5T7BA 5JARA 4NTZA 4Q9JA 4LYFA 5IBCA 1BYIA 1Q3KA 2NVBA 1N8NA 4DDWA 3O47A 4EGSA 1ZBQA 3C6KA 3IP6A 4NHEA 5THKA 2JJ2A 4KR6A 1SKQA 2PWBA 4LSZA 2ORED 3C3YA 3CLKA 1B93A 2VDMB 4YMUA 1H6DA 4F91B 2ZBGA 1ZJ6A 4LDPA 3KVRA 1UZAA 4C29A 1JXAA 3CVUA 2C5SA 4DB2A 2HMVA 4PTZA 1XMXA 3QPUA 4XTCS 5FWXB 1W581 2I7CA 3IPCA 1Y6RA 3F78A 2A9OA 1MFZA 3WSWA 2BGTA 2A5JA 4BO9A 2VNSA 1KEZA 1Q17A 3BJRA 3OZBA 4WAUA 2BZ1A 4LOLA 3CRRA 5JZMA 2JAHA 4KIUA 1JGTA 1LVGA 1I3KA 2MYUA 2A0UA 1B8OA 1BGXT 3IAHA 5FADA 3LWNA 1E2JA 4WLFA 5K8CA 4LE2A 3RVJA 3NP7A 1Y33E 2I9PA 4D9IA 1E6MA 1EX9A 4RH0A 1SAYA 4D80A 4LRTB 1SELA 2MIIA 4WWHA 3NEPX 4POOA 3AJ9A 3V6LA 3PQ7A 1LF5A 5KWSA 1YL6A 5E4TA 4HQNA 4AO6A 2C2YA 4YRPA 1OILA 4OK6A 16PKA 4I55B 4GKKB 3AH8A 3AYZB 2CKDA 3KUDA 1EGMB 1MZPA 1N3LA 4K9RA 3GRVA 4PEVA 4NBNA 1V9LA 5ILOA 4B3MB 2VJDA 3VPBA 5SZJA 1ZNXA 2OB2A 1OWLA 1H5UA 3ZU5A 1LJ8A 2VK8A 1Q12A 4DREA 4MJXA 1VG9B 3ZE9A 3KC2A 1OF1A 4D8WA 3KL4A 5BMOA 4WY8A 2BTQB 2BGNA 3JWPA 3N6VA 1GITA 2ZQZA 3SR4A 4DV5B 1WL8A 2D7DA 2P75A 4DRZA 1B15A 2YNMC 3DYVA 4M53A 3LW8A 2CLOB 1X9HA 3RF7A 4G4GA 2O6HA 4YAKA 1SXJA 1S3GA 3NUZA 3OCWA 5K3BA 1S7GA 1TLLA 2R8RA 3KZCA 4Y6QA 1G8FA 1C4WA 1PHRA 1Z7YA 1SHTX 2Z1NA 5TS2A 3FCXA 4DKXA 2C29D 1AU9A 1Y5NA 3EGXB 1F4LA 1H2XA 4DSTA 3RARA 1V4VA 4NNOA 4WV3A 1DLIA 2AE2A 4DZRA 5E2IA 5K0NA 5CCDA 2O0JA 2FR1A 3KK0A 2DUNA 2YH2A 4PZYA 4YJGB 3TIIA 2JFWA 3RBAA 3H2JA 3GOHA 4YMTA 5C35A 2JLAA 4BKQA 4YAFA 3MT9A 3ZTYA 2YRFA 3BRSA 2PVCA 3HA5A 4JJGA 2JGDA 2X5XA 1SHKA 1T2EA 4IKEA 4M9ZA 2DHRA 1IYZA 1XD8A 1ND5A 2AS0A 2ZQYA 4L1KA 3PPXA 5T8KC 3ZX5A 4B2YA 3NOVA 2C2XA 4E33A 1LDYA 2ZJBA 2Z6AA 3UOGA 2CLCX 2I7XA 4EVSA 4O1IA 4L5JA 1F2VA 4L9RA 1PV2A 2HDNB 4QPDA 2AOVA 4AJ1A 4PAQA 2JGIA 4PAWA 4QRHA 2VCYA 4U8HA 5EVJA 4RYDA 5HMMA 1TO1E 1YUNA 2J7PA 4I19A 4CM5A 4MVJG 4C08A 1PDVA 1LCIA 1T8TA 2YW9A 3WYNA 4CM8B 5KINB 2YWHA 3JPYA 1D4ZA 4IGIA 3SJ7A 1NVWQ 1ZUD1 4IW3B 4XAQA 3VU9A 5JBNA 1RKBA 1MJGM 2BELA 4XJSA 3G5TA 5I9LA 4ODIA 4L95C 2BKLA 4DJ5X 4IDHA 4UM9B 1W5EA 2H17A 3Q3JB 3G23A 2AD5A 1UT5A 3QP9A 5GTDA 1TAHA 5ICEA 1VE9A 1V1RB 2NSJA 1EKXA 3LX4A 4UJ3A 5CX4A 1MRSA 1M6VB 2RG1A 5EHGA 1U2RA 1D04A 3ZWWA 1NG9A 4YJ2A 2HUNA 3L4KA 5E2BA 3L40A 1GZ5A 5BWMA 3NI2A 3RYCB 1QTQA 3B2NA 1BKDR 2HF8A 2ODPA 2PA0A 5K8IA 4DZTA 4Z4FA 2GSWA 4KREA 5JRDS 4KQHA 2C84A 2ZP1A 4KI0A 2XUGA 3HCDA 2LCFA 1W73A 3WLTA 1Y8ZA 2QD2A 3UMYA 2WFAA 1CJTC 2C4WA 3HXKA 2ZJ5A 4A7PA 1I7DA 3TL3A 1DMRA 1Y9ZA 5FOWA 3BE5A 3F6CA 2W6ID 2J08A 4HN2A 3VNAA 3M81A 4TRMA 2R84A 4YALA 5CD1A 1FUKA 4L9SA 1YZFA 3PCRB 4RF2A 4E32A 4BXOB 3L43A 4CV3A 4Z0NA 4J2HA 2RB5A 1IQ0A 3PXBA 2QTBA 3PQ2A 2XQKA 1EVKA 4U6QA 2ZJOA 2DC1A 3RS0A 4NQZA 4X65B 4FR5A 2VYNA 1BW9B 2HRBA 4UNRA 5CT6A 3RG2A 2EKZA 2Q5HA 1TZKA 4FXPA 4OQQA 4NZNA 4UUPA 3X2EA 2YWRA 1VM6A 4HTAA 1U3FA 2R6HA 5CVCA 5IASA 1DRJA 1U7UA 3GFBA 2W2OA 3KDSE 5A7HA 4BQOA 2H08A 2A57A 3LP6A 1G2PA 1R10A 4HBZA 5SY9A 1GVNB 3COJA 1SZJG 3IAM6 2M1XA 3NHBA 4C0LA 3O3MB 3V48A 2JLYA 3OTIA 5FWNA 2GYVA 4M1SA 1TEZA 1W6UA 3VPXA 3CF6R 1FFXB 4EELA 1ESEA 4OBEA 1NVTA 1VHTA 1GNPA 3ZCPA 1IHXA 1KBQA 3GJTA 2H5IA 4WY5A 2O57A 1JHZA 2EZ4A 3PF8A 1M8GA 4QEZA 5E6UB 4D8TA 3HTXA 1AHIA 1MAWA 6Q21A 2ZI4A 3HYTA 1F8GA 2WJAA 4Y1RB 1YC5A 2XVMA 4X8OA 2ES4A 4N03A 3LDFA 2I78A 1A9XB 4PPGA 4QGGA 4YX9A 3DC7A 4MIYA 3Q5DA 3AVOA 3BTSA 3ZE6A 4DV6B 3D0QA 3HJCA 4PXAA 5C37A 2R7AA 5CM9C 5CVVA 3ZVLA 1JJ7A 1P75A 1PL8A 2BPOA 2QPOA 4NU8X 1UH5A 1FP4A 5AJYA 1IEWA 2P68A 3FCCA 4NS4A 5ALWA 3O94A 5DHSA 1YDWA 5AYVA 2DU8A 821PA 4RCVA 2CHUA 4QM6A 3UAXA 2YZ7A 3GNTA 2QTNA 2VPIA 4RU1A 1QKKA 1G5FA 2VZLA 4KXMA 5E1OA 4TMTA 1R0BA 1WB5A 2HFJA 3L0DA 3S70A 2NVWA 5P8WA 1VPEA 4HC4A 4MUYA 5ALQA 3S29A 2L17A 3G8YA 4IGAA 4CIXA 1J5EB 5KSZA 3FOEC 2JGJA 1JN0A 3ZJ5A 3TE7A 1N4DA 1D5WA 3THSA 4HYQA 4Q4JB 4BMDA 2EJCA 2A0XA 1FDVA 1USKA 2XDQA 3GLTA 4PZEA 5F1YA 1M2VB 4HDSB 2A9QA 4D7AA 1BH2A 2A59A 1UQRA 2P69A 2VQ3A 4K05A 4RADA 4F5ZA 1G18A 1RWKA 2C8JA 4L9WA 3W7BA 5JAZA 5KB3A 1U0EA 4ZRDA 3RBZA 1YS9A 3G2OA 3MJHA 4IDFA 4JXXA 1GDTA 3WKAA 4B3TB 3CW2A 4PSKA 2C20A 2J3HA 2YTZA 4LJAA 4KH1A 3H2BA 1JAZA 2ATVA 2VHJA 4KXUA 1X1AA 3Q2KA 5FOTA 5FWYB 5BN3B 2EGUA 3C7TA 1XD2B 1HYQA 2J3EA 2OECA 3ZWKA 2CFOA 5KVQA 1R5OA 2HR1A 1YHYA 5K6TA 3CNEA 3PQ4A 5GZ6A 4K5QA 3ZWMA 3ZXIA 1EP2B 1Z36A 2LUOA 1Y5LA 2PLFA 1D6MA 3MCAA 5JYBA 3H2HA 1U4SA 4WACA 1NVAA 2R751 3F90A 3FOFC 3P20A 1PX0A 4LYDA 1T1IA 1N9GB 5DM1A 3VTAA 3JQ7A 3BWMA 5K6RA 1H2AS 5KDOA 1A96A 4E6EA 4RMGA 2GPTA 1AT1A 3CSDA 1CRQA 1K8XB 2YC2C 1ABFA 3AEKA 4K86A 1DB3A 4D9MA 2JI7A 3LIPA 3SBXA 3UW3A 2JBAA 3N59A 4HKTA 4YS6A 1P1HA 4B0PA 2DR2A 4NJEA 2VDUE 1J2JA 5D7NA 1SQ6A 2X0EA 1KIMA 3OTWA 4AG5A 3PEYA 1KNQA 3WYAA 2I66A 2VJLA 3ER6A 4G5FA 4B81A 4D74A 5E4YA 3RVDA 1MV8A 3DTNA 4CLHA 3HL4A 1C0IA 4ZYLA 1W9HA 1XQ6A 1U5BA 3A0RB 4RK1A 5FR1A 1BC5A 2B4RO 3E8MA 3HEBA 3JZIA 1C7ZA 2GM9A 1NW7A 1ZMXA 1T4CB 2O8CB 4JX9A 4RHUA 3L4JA 3GVCA 2HK6A 1BDHA 1FY2A 1JXMA 1SEVA 3RC9A 5KI6A 1HO3A 4EPVA 1EJ0A 1EXVA 3JW8A 1D9XA 4IY1A 2HU8A 2FUG6 2HF9A 3F6RA 3Q8XB 5BSRA 2Q46A 3FNHA 5ES3A 4MVXA 5B1DA 1CUXA 4IUDS 3RV4A 2Z3ZA 3AV0B 4RA6A 3UWSA 4CIYA 3SF8B 4Q5IA 1FQKA 4A10A 4BNWA 3CLTC 4LDJA 2X2FA 3D3QA 3WR5A 1T1GA 1WZCA 1Z2CA 2HM7A 4EIWA 2P4SA 4R1QA 1E7QA 2JD0A 1LD3A 2B2XA 3K0CA 3FDXA 3ZHVA 1OAOA 3OZWA 1Q7BA 3ECAA 3ISJA 2R85A 1R9GA 3ACDA 2NO9A 3MBIA 2OA0A 1F1JA 2C82A 3OPMA 5AKEA 3TLGA 3B9PA 4KKVA 3I9JA 2PL5A 3MJTA 5LQMA 2FX5A 2PX8A 3EMVA 4K0RA 5AH0A 1G42A 3N0XA 1H2RS 3FYUB 2FHPA 5A3RA 1V1MA 4IIUA 1RMTA 2IIQA 2QTWB 3TKLA 4NARA 1ACLA 2YYZA 2DCMA 1FP1D 2NIPA 1U1IA 3FB1A 1L1RA 5AJXA 1S01A 5EP4A 5EZQA 3GI1A 4MRVA 5HGXA 2GASA 1CVRA 4HDOB 1RAFA 4BHTA 5FDFA 1J20A 1VBNA 2BFEA 3F3KA 4G01B 4D99A 5DYTA 5JC1A 4IMRA 4MVYA 1H8HD 1NMZA 1E9AA 2FOXA 2GD6A 4GWLA 4BN0A 1N75A 3R77A 2OZPA 4F11A 2TSYB 5A04A 3TD6A 4NJMB 4ZZ2A 5MHTA 3H4VA 3PUIA 3KXPA 2V59A 3BA1A 3TZBA 4G23A 3N2KB 3OCCA 4OP2A 3OMXA 3VC7A 4UBLA 4O3FA 2I3DA 4ZQHA 1PL6A 3G0GA 4Q3BA 2QRKA 1ZZEA 5LSAA 1E61A 4QXAA 3D3JA 2WTAA 3HHPA 4DVGA 4FYHA 1JHYA 4HP8A 3WIDA 3P9RA 2B4YA 1E6UA 4Z0PA 3RYIB 4EY6A 4UE3S 4C2BA 3I5MA 4BQRA 4HNHA 3EHDA 1CJCA 3D31A 4IIGA 4PHTA 3FZNA 3IMCA 1YKGA 2DTDA 4PRYA 1SUAA 2A1UB 2GZMA 4MUAA 4Z9BA 2Y76A 2GEFA 1B8PA 1R4MB 3KXLA 5DYWA 5HFNA 2LKDA 2DY1A 3QSGA 1QIMA 2K5UA 1MRNA 1S5PA 4Y0AA 4GOOD 4GHWA 1Z6TA 4G1MB 2JLSA 3QY0A 3THXA 4YBRA 4RNCA 4BYGA 1DTEA 3GLGA 4TWRA 3C3EA 3WMGA 5K05A 3SD7A 4RA6B 4N7MA 1ZQ1A 2ZIXA 3IDZA 5K45A 3DBVO 1SBZA 4IPTA 4LEIA 3AUTA 4ZCRA 1V7QA 3IUJA 1E2DA 1JDZA 1SXHA 1XU4A 3OO0A 4TTSA 4F71A 2XZLA 1N32B 1DQNA 4PLPA 2HJ9A 2ZAOA 3ZJVA 3COVA 2PJUA 2ZT7A 1SIBE 3GHYA 3EZXA 5HOQA 5JPCA 4DIBA 4XFDA 5BVGB 2C31A 4BGVA 1QGOA 2R1TB 2C7BA 2W2VA 4MW1A 2P2ZA 1J4AA 2VBIA 3VOTA 5G0UA 4BCBA 2FZCA 4Z2AA 1PWYE 2VDNB 1L7BA 3I64A 3DMGA 3ZWVA 2FQWA 2JEYA 3AQIA 4HI0E 5L95A 2HBYA 1I3NA 4RPHA 1TIPA 3W0LB 4E6PA 3RDPA 3OPYB 3AJ8A 1XZHA 2XVAA 4O4HB 5IJ9B 2ZIZA 4G67A 1KS9A 2ETXA 2BAGA 2AB0A 4CDRA 2DPYA 3CZMA 2M32A 4HL6A 3Q7EA 3KCNA 4PZPA 4C2TA 3ZYZA 2JGAA 3HBLA 4V1CI 1JZQA 2Y2UA 5A4IS 5GONB 3ST7A 1P2UA 3UT0A 4B6QA 3VZSA 2WKPA 4EVRA 2ODQA 4D9HA 1GZ7A 2X15A 1D2NA 3KHTA 2GFQA 4EDFA 1G5QA 3PR3A 4BTVA 1FNDA 3RTDA 1H5QA 3LK7A 1GYPA 1YB5A 2OKGA 2P5YA 2R00A 4W63A 5EE9A 3CX3A 5LBTA 2WJ3A 1WMDA 4JELA 2J9YB 5IUKC 1GT6A 1LPPA 2VKTA 5BXYA 3WKEA 5IG2A 3TNFA 1AQYA 3GZNA 1ZSNA 2EZUA 3LHSA 3OECA 3GA0A 3MTQA 1GN8A 4PCLA 3NOOA 5EJEA 1VIVA 2IEZA 3I23A 2G70A 3HV0A 3QFCA 4LQ4A 1M6YA 1RYZA 1HMPA 3CO0S 1CJUC 2WT8A 3AF3A 3LQYA 2ADFA 5E6UA 2JARA 5KTYA 1SUBA 4LZLA 3BDAA 4GUAA 3G0HA 3DMTC 1WY7A 5JI2E 1WABA 1A7KA 1E8MA 4UOQA 1WA5A 5HEKA 4BNIA 1CFJA 3AHCA 3FGNA 2Z6VA 3GDHA 2HMYB 3LG2A 3S2UA 1WPGA 1SOWA 3E2MA 4DOMA 2Q4BA 1OBHA 4U7TB 3WNQA 2ZS7A 3BRQA 5BNFA 2GBIA 4F1WA 1GU1A 1X8XA 2QENA 3DDWA 3QITA 2V0NA 2ZM5A 1UM8A 5A7GA 5INTA 4DLPA 3BSSA 2P2SA 4K9SA 4O33A 4B45A 1GCIA 3EOZA 4Q4AB 2OZLA 5CBPA 1V47A 3QVJA 2Q62A 4CODB 3AU8A 4TKVA 1PQPA 3GRFA 3A1WA 2H4HA 3UMCA 1T8WA 2J45A 3IP8A 3IL2A 1NVMB 2D8MA 4W9RA 5TMEA 5AW1A 3IIIA 2BEUB 3LD9A 3ZDXB 4DLSA 2GT1A 3L8EA 3JR7A 3AJAA 3P5SA 2IX9A 3ZE8A 1NX9A 2XOKA 1M6EX 4EG4A 2DPHA 5TS3A 5JBQA 4LJKA 5SZIA 3UM9A 1B76A 2Z8ZA 3TQFA 1KQFA 4EITA 3IILA 2PHZA 4OSEA 1VRVA 1J8QA 4OI2A 1GT91 4B79A 4LRWA 5FI3A 3N7UA 3U13A 2PK3A 1Z56C 2WZDA 4KQJA 4UQPA 4R0MA 1UMDA 4MW7A 3RJ5A 3ZVNA 3S1SA 3GNSA 2XHEA 3DE1X 1E0DA 3F9RA 2IUUA 1OAOC 4IILA 5CH5A 1M2NA 2J48A 1AK9A 2QSUA 4IXMA 4MW0A 2VDJA 3Q8WA 4V38A 1KAQA 1EDOA 5KTOA 1D0SA 2R87A 1X87A 2MSCB 2P2GA 3AJRA 2GRJA 1P9NA 4UPVA 4JKYA 5CGQB 3KYCB 1L5YA 1MEEA 1XMIA 3DCJA 1DJQA 3RC1A 3WVNA 2H4XA 5KPJA 2PA3A 4EJSB 2IA5A 3LWZA 2AUMA 3H8VA 3UFXA 1HL3A 5EYPA 4YCAA 2V7EA 5E7IA 3IQWA 4B3GA 2BKXA 1XDSA 3HH8A 1BTOA 1I1OA 3OOYA 4ZTBA 3ZWDA 4M60A 2B98A 2CMHA 5J3JA 1RTKA 2UZAA 4WCDA 4BJ3A 4I5EA 3GLHE 3VSBA 4GVLA 1RP1A 5HM6A 4C3UA 2AJDA 4R1MA 5K3FA 1E1CA 5CT8A 4CG0A 3C6XA 2F90A 4N0DA 1NM5C 4L51A 4YAGA 4OFZA 2FU5C 2I91A 1I4OA 1P4RA 1L7MA 1W4RA 3IP7A 2DGDA 4RIFA 4TKMA 2E4AA 2PVSA 1Y89A 4BCCA 4YAOA 5ADUS 3UPTA 1PNRA 3S0JA 5H4HA 4JR2A 4R51A 1NASA 4NH0A 5FTNA 1UADA 4QPZA 3NNNA 3TSOA 2BRUC 1WB9A 1D3AA 4WNIA 5AUOB 4KQ2A 3CLRC 3I6YA 2WWTA 2FPUA 1AJEA 4RMNA 4F7WA 3R75A 1WPRA 2JFVA 1GAJA 1T2FA 2NZYA 2ORWA 3SF8A 8ABPA 5ADVA 1FC0A 2X8LA 4KE8A 1LX6A 4PG4A 1P9LA 2HIAA 3NEYA 1D2MA 3G9XA 2JJQA 3MRXA 1NI4B 1KRHA 4C5AA 1ZEMA 1VJTA 1XP5A 2F55A 3LF1A 1W47A 2XYHA 4BLRA 1RI2A 1UEIA 2QAIA 1Z13A 2ZIGA 4JODA 2DUMA 1IY8A 3LC1O 4F60A 1VYTA 1USUA 3URKA 3G0DA 2Y1EA 1BMDA 4I1PA 3G68A 4CF4A 1JIVA 1EB8A 3M6MD 4TS9A 4BFVA 5IC6A 2C96A 1GPH1 3EBLA 3I6ZA 1NKVA 3VYRB 2D1FA 2P7HA 5FPQA 4JI3B 2J0QA 1AGYA 2AWOA 3TBHA 2BZGA 5EIOA 1MW9X 3G1WA 3K92A 3PR1A 3ND9A 2WMOB 3H9EO 3B6ZA 4AP6A 1J0XO 4URWR 4BO6A 2FFJA 3EK2A 8ADHA 3R7NA 1VLHA 4XKJA 3OCUA 2G9QA 1QYCA 3NHWA 4K9NA 1EFRA 1RXIA 1P3Y1 2B61A 2BTOA 4Y9UA 2I2AA 3BGDA 1YZNA 1XJCA 1M9NA 3C8HA 2XRFA 1L4UA 2XT6A 3L04A 1KIFA 3JQ9A 3PD7A 4PHGA 3K2IA 1U31A 3HR7A 1UCFA 2JHFA 3TCNA 3QTBA 2GCOA 1IXSB 1TKAA 2P6MA 3MS4A 2QG4A 1CQIB 1T3SA 1WCIB 2LWIA 2YWEA 3ZHXA 1U0HC 1T4MA 4L0CA 1JPNA 4MPDA 1KO1A 1DIHA 1FXWA 1QPGA 3WFIA 5T4EA 3TZCA 2FG6C 2PEZA 2H0QA 4C3OB 1VC2A 1EFVA 1W44A 2X8AA 3KBBA 1T5OA 4D92A 4ZYTA 2L2QA 4OK3A 2OR3A 1Y4ZA 1ZCAA 3CWZA 1CJMA 2GPAA 4DABA 1XRQA 5J5AA 5JT1A 4BNZA 3C8ZA 4F2DA 1OH7A 4BQSA 1PFVA 3FTFA 3T3GA 2QM3A 3D6HA 3OWXA 2VRCD 1U1EA 3DDCA 2B5VA 4G2NA 3ADKA 1QF6A 1F0YA 3MM4A 1N9KA 4H7IA 1G66A 1M2KA 1ONBA 2O3JA 4I4IA 3N2GA 3PI6A 2UZIR 2YZNA 4OL0A 4V0NA 3GPIA 5CM2Z 4BWFB 1ZCFA 4J0EA 1K9SA 2JJ1D 2O8NA 5MDHA 1A9ZA 1ZH6A 3MJCA 3ZZNA 1VL1A 2ZIXB 4KYVA 3EQ7A 2DJ5A 4NDNE 4P4NA 4OLFA 3T15A 3WJ1A 4TXMA 2W8BA 4BGUA 3I52A 1RFLA 4FDLA 5CIWA 4OMCA 4P84A 1HF3A 3GG2A 3R3XA 1LSOA 3VR2A 1SVLA 2C94A 2BOVA 1KK1A 4JBHA 1RU3A 4WOBA 3T1VA 4DSOA 5AKGA 4RVSA 1VMKA 2GWRA 4FN4A 1XZQA 4PLHA 1GGFA 2NSLA 4E2XA 1N5JA 3I8OA 1PHPA 1W93A 5HKKA 3DULA 1N7IA 1HSZA 4OB8A 4URVR 1NR5A 2QYOA 1H6BA 3FDZA 4G0NA 2QD5A 1DEOA 3A10A 4MVJM 3W79A 1LXCA 2P2YA 4N5IX 4QT0A 3SXPA 5KHLB 2WVHA 4AUNA 1EH5A 4E5MA 2XBMA 2PQ6A 4KYIB 3EMKA 3T41A 3O73A 4EMTA 5LZ4A 4REOA 4UXHA 3HGMA 4XJTA 3WGGA 2QUHA 2AXNA 1VSVA 3FOAA 4D8UA 3RLIA 5AKKA 3VX4A 4CEIB 3AHGA 3K0AA 3F97A 3PXEA 4AMVA 4CMEC 5JW6A 4P3NA 2WYWA 1LRJA 1YACA 1XLTC 1A9SA 1XZCA 1W76A 1IIRA 2ZYGA 1W49A 5AK5A 5FEUA 4BV3A 4RZUA 1DFGA 3MCVA 3MGAA 5C34B 1JUDA 4DMUB 1AUXA 3LWDA 1K8QA 3VHRA 4OLAA 4HMQA 3TXYA 1EM8A 4AKEA 4XYEA 4ZT5A 1YS7A 3LH5A 3O4GA 1STOA 3IMGA 4LV5B 5A6SB 3UHPA 3UK7A 4ZEMA 5DM4A 4B4OA 2XV1A 1HE2A 2HN9A 5DHAA 2BY4A 1PR2A 2IYWA 1JAXA 1SN7A 2JC3A 1VB5A 1Z5GA 2JNWA 3QJ5A 2G88A 2WM8A 3R3SA 3R6TA 4WN9B 1PK7A 4C7KA 1RHQA 4GL2A 1LEHA 1A9QA 2Q5QA 1TYAE 5FV4A 4RQAA 1E3DA 4OHWA 3X1YA 3CY6A 3URMA 2ZZMA 3GNQA 3AM3A 5LM3A 2XJ9A 4ZJPA 5AI8A 1QG0A 2ST1A 1PT7A 2ZEJA 5TMBA 3GYBA 1GKYA 4YT5A 2DLDA 2GCGA 2GF2A 4HAYA 4YRBA 4C0BA 1B14A 1DCFA 3I3OA 4YCDA 5T5QA 4B09A 5J2UA 4RE5A 2H1OA 2IPNA 3CT6A 1KZ9A 4R6XA 3HLKA 3MN1A 4EJ2A 2GO1A 1K0UA 2YZKA 3ZNOA 3N2GB 1BS2A 3OSUA 3GB9A 1E9SA 1EM6A 2QUZA 3P9PA 2IV2X 3RSLA 5IKXA 3FCEA 3U3XA 2XD9A 4H1HA 1FUYB 2ZRPA 2V5VA 1XCLA 4JL8A 2CN1A 3OPVA 2WUFA 3PXDA 5AUPB 2FMIA 1OV4A 2DLCX 5HK9A 2F59A 3VA7A 2AW5A 2YQ5A 4HVAA 3WLLA 1HA3A 3L77A 5LJLA 2PH7A 4ND5A 5HXAA 3R7WB 2HA7A 3V1NA 1Q1NA 2BFCB 4DMFA 4JC8A 1ZIYA 2ZSFA 3EXFA 5DJ5A 5DP2A 4OHXA 1NVDA 2PGIA 3BH6A 1JSRA 2JGEA 5GIPE 5TEVA 1D5CA 4HPWA 3P9NA 3JD3A 4LGCA 1EFTA 3H4MA 2G8LA 4INOA 4JBGA 3RYCA 2C7PA 1CS0B 2J5RA 4DIDA 4EX6A 4WCFA 3ZXUB 3ZLJA 1RC8A 5E6SB 4OAPA 1OLUA 4UZEA 1I8TA 2QXTA 2XZDA 1Q5PA 4XUGB 5HKOA 4ZT6A 1J5PA 2HSWA 4REQB 1KH1A 3L05A 5KNCA 1TD9A 5F9HA 3ZV4A 1SHJA 3K73O 3QLJA 3ZCSA 2PQ2A 3X44A 3LQ1A 1USGA 3OHSX 4NYMR 5CX1B 1B0ZA 1Y8RB 3OLWA 4TLCA 1F38A 3E22B 3VISA 5BV8A 1MIHA 1QO0A 1VSQA 1UXKA 2NUBA 2BUBA 4G5SA 4GZ5A 1KJ9A 1T5LA 4U5QA 1O0BA 4RSHA 5EP1A 5H81A 2ZJ8A 1ECFA 1P0QA 1KAMA 5DISB 3U7EB 4DLTA 5C1BA 4Y18A 1XXLA 2IXTA 1IZ7A 5JCPA 1QH8A 1U8AA 1RMQA 1CF4A 5J47A 3BMOA 3U80A 2WIBA 3CN7A 3PWTA 3Q5EA 4R3WA 3ROTA 1F6WA 2VPTA 4ALKA 2IHNA 5K4AA 1SVIA 2PX6A 2HK8A 1LTQA 2GJAA 4P4SA 1EXMA 1PAUA 3GO4A 1CB0A 1Q6YA 3DE2X 1TVEA 3Q9SA 5A2GA 3EE6A 3GCZA 3IP5A 4L5CA 3M5CA 3EQ8A 2NV2B 5LLSA 2ZWOA 4YAEA 3UMRA 4A8JB 1A5AB 4FYWA 3S7TA 3ZN2A 1TRHA 2GF9A 3AY6A 4M0DA 3TTSA 1KHTA 2XYPA 4IXWA 5BPHA 5SY4A 4FR2A 1U7XA 1ULUA 3M4NA 3M70A 3TOVA 4L0DA 1RHJA 2CVFA 2MINA 4U3JB 1OBCA 4IUYA 1E1CB 1VG8A 4D43A 1JJIA 3B1YA 4JY7A 3IPYA 4MGZR 3BMCB 4R5MA 4YPFA 3WICA 5KWJA 4KZPA 1ZAKA 4ND2A 3FVTA 1ZL0A 4PSVA 5C7OO 4WE3A 5LZ9A 3KVVA 1RKXA 2C1XA 3VSAA 1DKPA 2AC2A 1QG2A 3DVSX 5KO2A 2B83A 3MTGA 3BREA 3LLUA 3FUWA 3P0HA 4KR2A 2XUFA 1KH2A 1DWUA 3K96A 2O20A 2EBWA 2WFMA 5EESA 4CG2A 1KO8A 3A4MA 3OX1A 2C00A 2R6CA 4I5DA 1I14A 3C3XA 4M2LA 1VDMA 4JSRA 5FAKA 3KQNA 4ZODA 1VI5A 3KQYA 2X0FA 1YA8A 2G36A 2QKYA 1IVSA 2IYLD 3E58A 1G6OA 1TA9A 1QZUA 3G2QA 4JU9A 3QUBA 3RODA 4BNGA 2I6SA 3C2QA 4NIMA 1IEQA 5K6AC 1U0LA 2F8MA 2IOYA 2QY6A 1NY5A 1FUIA 3WP1B 4GXQA 2G1PA 1QTIA 2IXAA 2FSVA 3MVEA 4X45A 3NVKI 3FOCA 4N7RA 1IK6A 1HV8A 1ZR2A 2GKGA 3NM5A 1SCNE 3HR8A 1X86B 2JAPA 4R98A 3LKDA 1I3LA 4UM9D 2XTMA 3DNMA 3B5IA 3L5OA 5EXDA 1CY4A 4JK3A 2CD7A 4CQMB 2RC6A 4WY2A 5F52A 5H68A 4F84A 3D3EA 3D9QX 3Q0IA 1CYEA 2DWPA 3ISTA 4WK0B 5BQ5A 2CFCA 4HSGA 4ENWA 3U7JA 4NFSA 1NW5A 1XA4A 5ELMA 4PFKA 3M49A 2P27A 2QRVB 3OAAA 3G2IA 3KZOA 4I8XA 1XTSA 4M8IA 4Y30A 5FB3A 5DWVA 4HH0A 1JPUA 5F64A 4F45A 3IP9A 2DH5A 2Q1YA 4MS1B 4AP5A 6YASA 1CZOA 4H7PA 5LP6A 1M7GA 2CV1A 1XR3A 2RH8A 1XRMA 1JLRA 1L4HA 2ZI7A 3RSZA 3SLRA 4Z4EA 1JXQA 1CT9A 1HPLA 4KK4A 1CEEA 1AV7A 3QOXA 4XGNA 1X92A 3HJNA 1SA0A 3T3PB 2J67A 7MHTA 1L5KA 1VKJA 1MA0A 3PFIA 2R1VB 2PH1A 1DX9A 4YP5A 3K1AA