3JU3A

Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from thermoplasma acidophilum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
AEKAVLIGEKEADITFVTWGSQKGPILDVIEDLKEEGISANLLYLKMFSPFPTEFVKNVLSSANLVIDVESNYTAQAAQMIKLYTGIDIKNKILKYNGRHMTEDEILKSAKEILNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 2-oxoacid ferredoxin oxidoreductase, alpha chain
publication title Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 27
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ju3A00
1QS0B 2QTCA 3EXEB 3LQ4A 5I51A 1X7YB 2C3PA 3L84A 1L8AA 1X80B 1NGSA 2C3YA 3AHEA 5HJEA 3OOYA 3EXFB 2BFDB 1X7ZB 1RP7A 3AI7A 2UZAA 2R8OA 2R5NA 1UM9B 2BEVB 5EXEA 1UMBB 4XEUA 3EXHB 2PDAA 3DUFB 1TKBA 1NI4B 3DV0B 4C7VA 2OZLB 1X7XB 3DVAB 1OLXB 4KXWA 1V1RB 2QTAA 2G67A 3M6LA 3M49A 3MOSA 4C7XA 2J9FB 2BP7B 3HYLA 1KEKA 2BFEB 3AHGA 3AHJA 2C42A 5C4IA 1DTWB 3JU3A 2O1SA 5I4IA 1V11B 1R9JA 2E6KA 1U5BB 1UMDB 1TKCA 3LPLA 3RIMA 1ITZA 4KXUA 4KXYA 3UK1A 1V1MB 5HYVA 2IEAA 1W85B 2G28A 3UPTA 4KXXA 5I5GA 1QGDA 1X7WB 3AHHA 5HGXA 1OLSB 2C3MA 3AHFA 3M34A 1AY0A 1UMCB 5HHTA 3KOMA 3AHCA 3EXIB 3EXG2 2C3UA 2BEUB 1B0PA 1TKAA 5I5EA 2O1XA 2BFBB 2BEWB 5EXDA 2G25A 4KXVA 3AHIA 1WCIB 3M7IA 3AHDA 1OLUB 1TRKA 3LQ2A 2BFCB 2C3OA 1IK6A 1W88B 1GPUA 2R8PA 2BFFB 1V16B
chains in the Genus database with same CATH superfamily
4ZV9A 3ZXXA 3OWOA 5JS2A 4NMLA 3V4LA 2VOJA 3DUWA 2C98A 5CCXA 1E1RD 2X86A 3NHWA 4BB6A 4Z7JA 4I7EA 1SK9A 3STVA 3KS9A 2V7EA 4JUIA 3PHIA 3SBOA 5F1OA 2YJGA 3GRRA 1GZDA 4D3ZA 2ZS9A 2P4QA 4J76A 3AFHA 5HQTA 3LFHA 1R0KA 4RKWA 4IUDS 1AQ6A 1TJNA 3ELYA 4QWWA 4TLMB 1R4NB 3D7SA 5I7AA 1HDIA 5LWQA 4L6AA 1POXA 4B73A 2GCPA 3KHSA 4KNVA 2JW5A 1T1IA 3TRKA 3HKDB 5CVVA 4UCXA 4IMIB 5CT5A 1T4MA 1EE9A 1I2BA 3H2BA 4H18A 4Q18A 4AICA 1J1ZA 2M6LA 3FCYA 1BEEA 4LRQA 2CDCA 2B35A 5D5HA 3ZIDA 3ZUPA 1LDGA 5EWJB 1DMSA 3HDVA 3UJ7A 1SVMA 1VPTA 2ZUWA 3RVJA 1I32A 4C1BA 1W47A 2E9SA 5JD5A 4AKHA 5T4BA 1UODA 4UFPA 4TWBA 1BDMA 1NKTA 3IIMA 4BNIA 3MT8A 2GFHA 2VK1A 4BYMA 3KQHA 1WMSA 1N34B 3OH8A 2ZIVB 4NIMA 4RVCA 3RJZA 4YMUA 4ROTA 2YX1A 4W1PA 3SHFA 3TAXA 3RIGA 3RCBA 3U37A 3W2IA 3ZWVA 3O4RA 4RPGA 2OFXA 5E3IA 3RQIA 4Z49A 4DIBA 3VAZA 3AF5A 1B41A 1ISRA 3G2LA 3H9EO 2F62A 1FSZA 2FZKA 2ATEA 3AX6A 3CISA 4INOA 1XMQB 3HKDA 3DE0X 4OHUA 4P4SB 3W2HA 5KTYA 2CE7A 3MB5A 5JU6A 3C43A 4XTCS 1CYEA 1V3VA 3FW1A 4WV3A 2CL7X 3B5EA 1YB7A 3LI2A 3CM0A 3W5VA 1VM6A 3Q72A 2XB6A 1P2UA 3BWXA 3EB9A 4B44A 1N2SA 2NU9B 5CFMA 3ZKWA 1IY8A 4HDCA 3OCVA 2PKRA 5BUZA 1GRVA 4M1WA 3K31A 4BBZA 3EBPA 2P75A 1NBHA 2CWWA 4EJMA 2BR3A 4EB8A 1Q0TA 1P1CA 3DMTC 2WIAA 4AXBA 2X8AA 3ORRA 4BASA 3WO1A 5LQNA 4CTKA 3HXMA 3EXG2 2E89A 2GK3A 2JARA 3JPWA 4IH9A 1C9DB 3I92A 5GINE 1SA0B 2RK4A 2XCTB 1O6GA 4DNXA 2HHHB 2OZKA 2AN9A 2TMDA 1SKYB 3DVQX 2IXDA 3FDJA 1S3GA 3LHKA 4OOEA 1OE0A 3X1WA 5H9WA 5A4KA 4MUBA 3TRFA 1Y8RB 4H6XA 1K3UB 1B43A 5M29A 1PJ3A 1G9XA 4POOA 3IVAA 5BSWA 5EGSA 4D26A 2O0KA 3V8PA 4JJ4A 1W6UA 1PYGA 4G89A 1QHIA 5IAEA 1YBMA 2NU9A 2GB4A 4UHHA 5AVVA 4NMWA 2I7TA 3HN7A 3LVQE 2NQ2C 4H3HB 1HDCA 4A1FA 1EUCA 1FFEA 3IR6A 1C3LA 3C70A 2P2CA 3TN7A 1GGFA 4LXHA 2HB6A 3UN1A 4K0KB 2X5OA 5EUMA 4P0QB 2R8PA 4TTTS 2VNKA 2XRMA 2Y1DA 3SSNA 1M0WA 1TEVA 3LKBA 4G4GA 4LJ8A 2HIGA 1U0LA 4CR7A 2OK7A 4ZT5A 3GJQA 5T3UA 3Q9NA 4AJ9A 1I4WA 1Z5GA 1EVKA 5JSFA 1WKBA 1Y8RA 1PQUA 2CFRA 4P7FA 3OLWA 1IM5A 5SY9A 4AECA 3IEMA 3UKOA 1A0OA 3KHTA 3QWIA 4FMDF 2ZS8A 2C5SA 1YGYA 1UM8A 3AR3A 3PQ4A 4A2PA 1O0BA 3QNUA 4M53A 1LTHR 1QHHB 3ET5A 1BHSA 1VC2A 4XWGA 5E6SA 3W5CA 3SR3A 5AXAA 5KSZA 421PA 1QQ7A 3L9XA 4Z0TA 4L9WA 4PZLA 4XWTA 3GRUA 2P4SA 3AYXB 3EY9A 3K20A 3UH0A 1GKLA 3T1QA 1NVMB 2BKXA 1WEKA 4TLLB 1SU8A 4EY3A 3HI4A 2W2MA 3ZWNA 1PR3A 5FFFA 1KVRA 1V6AA 3K73O 1ZK0A 2XTJA 4QICA 3LW8A 4XE5A 3VDQA 3DG9A 4GDFA 3N59A 2FK7A 5DK4A 4ZOLB 4UJ3A 1YJ5A 4FD3A 3QOFA 4XJVA 2VEOA 3PV0A 1CTQA 2BI8A 1LRKA 3PIIA 5H16A 1OYYA 4I4TB 5JT1A 1NJ8A 1I2AA 3HXLA 1TO2E 2O1SA 4PLPA 3FPHA 2CFTA 4LOHA 3V55A 3OJFA 4TWRA 3SKYA 4B3GA 3U3OA 1JIJA 3AR6A 4NNPA 3TLJA 3OEWA 4A36A 1WG8A 3VC1A 1ZVKA 2HR1A 3LW7A 4EA8A 3WGIA 1TZCA 2B83A 2D8AA 2GK7A 2XCUA 1WNFA 1GRNA 3JZIA 3MJVA 5ALKA 3WR5A 1KP2A 2W48A 2WIKA 3QX9A 1VDMA 1L5HB 4NWIA 5JMWA 2HLPA 4N5HX 3K94A 3UTCA 3EQ7A 3FB1A 1RRKA 5T57A 1VE5A 3TR6A 2ID8A 4L4XA 2Z2YA 2J6BA 4KI0A 4M1OA 4ZOLA 2QU7A 2FR8A 1DOZA 1EU1A 1ZD2P 4RKQA 5AO9A 4KR9A 3RGGA 4BNXA 4EHFA 4O2LA 1QMPA 1WF6A 2AZDA 4ZZ0A 1VBKA 1UBLS 3AEUB 3D5TA 1L9KA 1RIIA 4FR5A 4I4TA 3JZMA 4KPGA 3RSLA 3WQQA 1EFVA 4FE7A 4EI8A 3CVJA 1ZXLA 4ZMSA 3VM6A 1DO8A 1QP7A 1RJEA 3RC8A 5A06A 2VUTA 2Z3ZA 1IBKB 2M2IA 3TZBA 4JYPA 4OU4A 1MAAA 3MTAA 4U6NA 4UHBA 4TWIA 4CCYB 5H4GA 2F1IA 2FPXA 4KCGA 4HNAB 3PF9A 3IOBA 1K86A 4IXNA 1OVMA 4U8GA 2QRPA 5EXDA 3I2IA 3DXXA 3DOEA 1SZDA 4CQMA 1XQ6A 1E2FA 3GJSA 4FYKA 4BECA 4OI0A 3ZI4A 3DZKA 4BO4A 1K5DA 4DJJA 2LIPA 4GXRA 3L4KA 2FUG1 1Y8CA 5AMXA 5JPCA 2B8WA 3OC6A 2M6RA 3BF7A 2GERA 5C52B 5IM4F 3C97A 3DXFA 1Z6PA 1ZICA 1P0IA 3AEUA 1H5NA 4MWBA 4LOAA 1XOIA 1A9XA 2K6GA 3E1SA 4GRDA 3ZQUA 5JIBA 4ZMBA 4M0PA 5B4TA 2E5LB 2O8DB 4NBRA 3T5PA 2ZW9A 1FDUA 3IIJA 4LMAA 5CJJA 4P3KA 2P9ZA 3P4UA 4GYJA 4KQKA 1FP2A 2XWQA 4P2BA 3WP1B 4P5PA 4JT8A 3FFAA 3G2QA 1BAPA 3K9BA 1PDWA 1PG2A 3ABIA 4Y9UA 1OROA 2ODNA 4MKRA 1PVDA 2CJYA 4PN3A 3I62A 1J4AA 4LGYA 2Y1EA 4M0EA 1BO6A 3ZHXA 4BVAA 3ZCQA 3TK1A 2RE8A 3QEAZ 4JAVC 4RY8A 2P5SA 4K28A 5G1PA 2QJRA 4NCHA 2W8BB 4XWWA 2IT1A 2PSJA 3TPFA 5I7RA 2FWNA 3UK7A 3M6VA 2DCUA 3SJUA 4XPZA 3GA0A 4OQ4A 2QT1A 3H11A 2PVSA 4GVXA 1JE1A 1T6ZA 3OFKA 1AXGA 1Z83A 2H4FA 3N2IA 2J0QA 3SKXA 1J9EA 1SKUA 1T8SA 4JD5A 5FUYA 2FPSA 2JANA 3NM4A 3HDYA 4HWSA 5KI6A 4XWKA 2G06A 5ALVA 4Q6BA 5ULLA 3STUA 4Q9AA 3ANTA 1SUPA 1W8IA 3QZUA 3WLOA 2VPYA 3N74A 1HY3A 2Q4TA 1CJMA 4I50A 4U2CA 5DM2A 1TT7A 5GADl 4Z9AA 3WA6A 2GPNA 4KQMA 1N3IA 1ZY2A 4NVRA 2XUGA 4X1IB 5D3ZA 4MW5A 3SN6A 1GAQA 1U11A 5HIIA 3CKYA 4AUMA 2VCHA 1WKCA 3O8RA 2W8BA 1ULHA 2QVCA 4WASA 1UQTA 4HX2A 3QJ5A 3N8IA 1RYNA 2VBIA 2AD5A 2UYCA 3J7AC 4MA5A 1XNHA 4MGKR 1K08A 1ZD5A 3H5OA 3K4PA 2O50A 5HJ5A 1USGA 3G59A 1CUHA 1K6XA 3NBUA 1FDTA 2JLXA 1HYBA 3CHYA 3ZE0B 2PTGA 3KR1A 1U9YA 5ER6A 3RFTA 2V7UA 4OFBA 3SR4A 5JCPA 2GEVA 3DNMA 1M1YE 4W63A 3T54A 1G21E 3GP3A 4HQ0A 2ZAIA 2PSEA 3WYNA 4W7SA 5DPMA 3NXSA 2FLWA 2MU1A 5KSYA 4PCUA 2JCSA 3M2PA 4KN6A 4RULA 4G1FA 5CJPA 4FGZA 1YVUA 4IUYA 2IDZA 4IO1A 3T5GA 3ZVKA 1DE0A 3EEFA 3IBCA 4BQNA 3HP1A 1NR5A 2A5JA 2ALJA 1DUVG 2X8LA 4JLMA 5E6RB 5KINB 2IH5A 1NYTA 2GCNA 4FILA 3S2ZA 4X65B 2X1HA 5LYYA 1LBSA 1UJCA 2G9VA 4CTMA 5B7GA 5CYPA 3PT5A 4EHIA 2YN4A 3MINB 4NZZA 1CU1A 2HJVA 3OIVA 4JDUA 2EOAA 2IHZA 2G5PA 3OHMA 4KN8A 3CINA 2BHTA 4J0JA 2R1VB 2VPTA 4WCFC 3RVBA 1TEZA 1JPJA 4IX9A 2EBFX 5DNVA 2E2WA 4PFQA 3C3AA 4FGJA 3V4PB 3FCUB 3EGDA 3LP5A 3UAYA 4IDOA 4X7RA 1RAFA 1S7GA 1JDNA 2ACEA 3P4YA 3LHFA 4QQFA 3W77A 1NUAA 1I1NA 1QGUB 4P35A 2QVBA 4YXWA 2C3PA 2WU0A 4OXKA 4JFAA 1JB1A 1K8QA 2PZAA 1QLJA 3AESA 4P81A 2AOXA 2NNWB 4E2XA 4ZI3A 3SSOA 4EVIA 4CT0A 3STTA 2IGBA 4PWYA 3CLKA 3AF1A 1UFVA 3VAAA 1ZM7A 2R60A 4MIKA 3NFRA 1N8TA 1SFRA 3QVSA 4OQEA 4RA6A 4REOA 4YJDA 3GZNA 3RROA 3WGOA 4LVNA 4O6VA 4DEYA 1JXAA 3BK2A 3IAAA 4JBGA 1W5SA 3ONDA 3U44B 4MDFA 4Q9LA 4ENWA 1CY4A 3L0PA 3JPYA 4JIMA 2AL7A 4MLCA 2IYUA 2R1VA 4TT3D 1NW5A 3ETNA 3HNOA 3ABRB 3I9LA 3OQIA 2G5GX 1JI0A 1XQVA 3IERA 2ZCVA 2Q0HA 4C88A 2VQFB 1O3YA 4UE2A 2GF2A 4C7JA 1Q11A 2KSQA 2VHEA 3MW8A 4YDSA 3EULA 1TM7E 2C9ZA 1JHUA 4X24A 2XWBF 4F3NA 5DLQC 4DNQA 4HF7A 4TRRA 2H16A 4FU0A 3C3XA 1NXSA 3AOEA 3RKSA 5KZMB 4F4IA 1IBRA 1SC3A 2KYRA 2WSMA 3N2KA 4IHJB 4PLFA 3FOZA 1D1QA 4YFYA 4G0WA 4K87A 3GEDA 521PA 4EL5A 5JAIA 1HC7A 2Q4OA 2NO0A 3RADC 5E1MA 3RASA 2Y66A 3U4QB 1RCFA 3ZDDA 4AJ2A 3OZEA 3BHMA 2UKDA 3RT9A 4M9UA 3VH2A 4ODIA 4DQLA 2VDPB 2PUTA 3EDQA 2PXHA 3PWKA 4C6TB 1GUFA 4KE9A 4YQEA 2QE6A 5TX7A 1XRLA 3WICA 2P3SA 1M75A 1M2KA 3LO8A 3WHKA 3L7LA 3WTCA 5JRZA 4OBXA 4RFSB 5GOZA 3OSZA 3U09A 4DV1B 4LFAB 1F0PA 2RDMA 3UT5A 1J2UA 2LP4Y 1HMYA 3NP9A 3MT9A 3P2EA 2XIJA 3WL8A 4QLBA 4DNPA 3OQPA 2A9FA 4BZZA 1PGNA 3QPDA 4N7RA 4OFWA 3FTFA 2WG1A 4ER5A 1W52X 4IWNA 5T3YA 3SIWA 4C21A 5LDHA 2V7GA 4UBLA 4KB5A 2E3JA 2VPQA 3P45A 1K63A 2G08A 4HR7A 4IHJA 2CJWB 2JDIA 4AJIA 5LLTA 1BMDA 1SIBE 2VHJA 5LP6B 1TRHA 3A4LA 4ZT3A 4BBAA 2IBMA 3IPLA 5UKDA 5JYDA 1IHDA 3H42B 1YUBA 3O4JA 3PEYA 4AK9A 1M6VB 3EXIB 5K0TA 3TH5A 4TN1A 1DOAA 3PWSA 4WJZA 5B7QA 4URHA 2QQEA 1J90A 2ZUBA 5TE9A 1SBIA 3DA8A 3QVJA 4PLWA 4V0KA 3E8SA 2N0SA 3VH1A 5I9LA 2GASA 4Y6LA 1H4SA 2VDOB 3EGCA 1CJKC 1Z0JA 1PD0A 1J33A 1PSZA 3C6ZA 3CLTC 4EDFA 1XQ9A 3PUIA 4RCZA 4TMXA 3GY0A 1U2DC 3Q7EA 4E5SA 1UP4A 3RE1A 2EYUA 4QOHA 1WY5A 3MGBA 3OM9A 3I2YX 3SYNA 4ND8B 2JA1A 3TOZA 3SU8A 3HVRA 4J29A 3CR7A 3ZLVA 1OTHA 3CMCO 3DVLA 3GJ5A 1PGJA 3NHZA 4DGQA 3IAXA 1R5BA 2V5VA 1UDBA 2WHYA 2ZVJA 1ADJA 3KP1A 4G81A 4Q16A 5LP6A 1B1AA 1PV2A 5JECA 4Q12A 4HZIA 4F1WA 4B84A 1KJNA 3QEOA 5JATA 4R69A 2BT4A 3A6FA 3EXIA 2QTCA 3GUZA 4JT2A 1IL0A 4W8OA 3R3JA 1U5BA 2Q9BA 1S9DA 3TSWA 3W5UA 4E15A 1A69A 2JGIA 1S02A 2YWRA 4KR0A 3SOZA 5JI2E 3PEFA 1IMOA 4M88A 2H57A 4YR7A 4WNAA 5BW6B 1YR6A 4EP1A 3T7IA 3GLHA 1R3UA 4WY2A 4C7BA 2R66A 1XVLA 3FPCA 3D3QA 1TA4A 2OCKA 1BU8A 2VI5A 3R24A 1PL8A 1O7JA 4U7TB 3ZIUA 4B7UA 4BMNA 5K7SA 3T4PA 2ZTVA 1JZSA 4CM5A 2HMTA 3DMNA 3I34X 1GGKA 4DAEA 5ADUS 3ZGZA 2FSVA 2GXSA 3LTNC 1H6CA 4E88A 1TKBA 4U02A 4ZCIA 1QWSA 1D7AA 3C15C 1YA4A 1KEPA 3LO5A 2CL0X 4U0JA 4W7IA 3AG6A 4ZANA 4YP6A 2RGBA 3GJ7A 1XKLA 1P4GA 5ERXA 4BCBA 2OZLB 2ORED 3QPVA 1FSGA 4YPVA 2WD8A 4PRKA 1P6XA 1KSFX 1VYTA 1N6LA 3MS2A 1Z18A 3OJWA 4OP1A 3RK0A 4AY5A 1W4ZA 3BWYA 4DMCA 1FNDA 1I36A 1XG5A 4WERA 4HWGA 4EGCB 5AVRA 3I4CA 2WFLA 4FYPA 1WD5A 3KXPA 2MR6A 3OMXA 2QR5A 1YFKA 1YR2A 2A7XA 4UHFA 3RS3A 2GDJA 5JO0A 3K0CC 4Q00A 4NPHA 3CSSA 4TZTA 3VO2A 2DOKA 2ZSDA 3ZLTA 1YKSA 4CMGA 4MQFB 4UEOA 4N7JA 2UAGA 1TLLA 1ZGZA 2CF5A 2CJPA 2CYCA 3GR6A 3R5SA 4FEYA 4FFPA 3TIXB 5F98A 3H1PA 4JP1A 1X7GA 4RL6A 3PT9A 3A3YA 4FEEA 1UK9A 3ZIAD 1JMVA 1CQJB 3UK1A 3LX8A 1GNPA 2XD4A 2OZLA 1ORIA 1OXVA 3CNQS 1Z4IA 2NVOA 2PSFA 2Y1XA 2C2MA 3Q7QA 3FVQA 1Q0HA 1OJLA 1RKUA 2A5FA 4JT9A 4KXXA 3QVWA 2J0UB 1NQOA 3E22B 3JSXA 4PAWA 1FSPA 1T4GA 1KIFA 1EK6A 5CBPA 3MMPA 1EJBA 1N5IA 4YECA 2D4AA 3U9LA 4DUZB 3AHFA 1SOVA 3H8WA 1E1CB 3KUKA 1NHGA 3MCUA 1DRJA 4YACA 4EY6A 3TFOA 5JZMA 3LLSA 5KKAA 4CT4B 4D02A 4TTVA 3E9ZA 2LCQA 3OJLA 3IT0A 3RF7A 5FWDA 3G6KA 1QIFA 3N6RA 2BZ1A 4WZAE 4WN9A 4IGKA 2OMEA 3LWZA 3QLEA 1JQLB 4YBRA 1ZGBA 3BEDA 5KDLA 4AULA 1MEEA 5K4HA 1PNTA 2WA2A 5DMXA 3V1TC 4MWCA 1SCUA 1WULS 2A1TS 2NGRA 2BOVA 4O4HB 4BLWA 4FYXA 4CE6A 3I9KA 4QYWA 1C1XB 1DPGA 4QDUA 4XCXA 3THXA 3MGAA 3E22A 4GKKB 2KBFA 2WHPB 3R5TA 1MTOA 4MB6A 2HF7A 4JEHA 3NYIA 2JF0A 1DBRA 2Z8XA 3A1TA 5BSKA 621PA 1QVRA 1Y3CE 1HLPA 3DC7A 1O5TA 1XV5A 2WTXA 1LTQA 4O4JF 1ABBA 1ODFA 1ZBDA 4YUAA 1ECGA 4ARAA 2GH1A 1B8PA 3D0RA 3I12A 1D0SA 3DOOA 3IP1A 5SYNA 1GOTA 3R74A 4RDHA 1EUQA 4B3CA 2Q7XA 3BJEA 4JROA 4EEKA 2G0NA 4I1VA 4US1R 5G1OA 1EAMA 3JQAD 3KKKA 4K6OA 1PR2A 1ZXBA 4HLNA 3NASA 4RD0A 4TM7A 4AJHA 2CDRA 1TIBA 2ZITA 3O3CA 4KBYA 1RM3A 4C3VA 1XNQB 2RAVA 3H0EA 1IEXA 2PS9A 2JD0A 3WLIA 2V9ZA 3BJIC 4GVPA 2ATCA 1Y3AA 3EWNA 3IV7A 2XWPA 1QQBA 4XVHA 3GRKA 4G84A 3EEIA 5H3CA 4AAYA 6ABPA 2C5GA 2IKQA 3IPXA 4GYWA 4MPRA 1YDHA 5IT0A 2H08A 4OK5A 3AGQA 1U0JA 2BM9A 3DWEX 3BIOA 4RVNA 4AJ1A 1Z5UA 3LXUX 2VC2B 3X1XA 4Q3BA 1MFPA 5JC1A 3L6CA 1KO4A 5JJIA 1DG3A 1E94E 3GMSA 4K9QA 1PL0A 2FEKA 5DT2A 4D4JA 3CN9A 1GPWB 3AR8A 1G98A 1SWWA 4CRWB 1W1UA 2E1RA 4S1PA 2QVZX 1P9LA 2QW8A 1X19A 1FFAA 3DULA 1XL0A 4ENVA 2NYRA 1CIJA 2IBTA 2R1TB 4PG5A 2AMVA 3IKTA 3N05A 3OY7A 2AZTA 3OF2A 3NTLA 3VSAA 3ZW7A 3VMMA 1PK8A 2VIIA 2XE6A 3MD9A 2ZPAA 4G63A 4HNHA 3A0RB 3UG7A 5ICGA 4YPOA 1TQ8A 2V3WA 2JVIA 5BYAA 4NE9A 2Q5OA 1LZKA 1E0KA 1QE0A 5A4IS 4OJTA 3DMYA 4HNQA 5A0TA 1SVUA 2GPYA 3OT5A 3O0TA 1G19A 2YJTD 4RKFA 2FPPB 4RESA 1RPJA 4BBJA 1NLZA 1PI3A 4Q9JA 4KN5A 1AMNA 1U1IA 1RC1A 1YZKA 2OLEA 3FNRA 3I05A 4L7QA 4EG0A 2UYQA 4YCMA 4H4EA 5U9CA 4ZI7B 3OZTA 4I3GA 3KLNA 3ETGA 5CCEA 3AR7A 2WUDA 4TS1A 1B16A 3KSMA 5BY2A 2GRJA 4JX8A 1ST2A 4DZZA 2DF8A 2X4LA 2G83A 1X2EA 1PG5A 2X0KA 5HW0A 3ZW9A 1NAHA 2R1TA 2JBAB 1DIOB 2ATIA 1ZWLA 2J1LA 2LW7A 4LXGA 5GV7A 1J09A 2IYXA 3NOXA 4LF9B 3D5QA 4JA2A 2HIAA 5BSMA 4Z86A 1GGJA 5HM8A 1BKSB 2G17A 1Z39A 1QIEA 1YCHA 1U1GA 1DVRA 4LWOA 2WF6A 4Q7MB 2WJHA 2BKLA 1VPVA 4OLHA 3IRVA 2GLUA 1FDWA 4XIYA 4ZQIA 1T5SA 4DG9A 1VXOA 1P77A 2PFSA 4Y2JA 5MFPA 2Z3VA 2ZK7A 4Y2RA 3O9ZA 2ZCJA 3A06A 3LGXA 4LFCB 2BHLA 5B1YA 1ICIA 2W6CX 3ZBPA 5EJAA 3D6VA 5EE3A 3I0MA 2C3OA 4AD8A 2WUGA 1CQIA 4HH4A 4TV9B 2GM4A 2FETA 1IUPA 2D1FA 4LYYA 4O4LF 4U3JB 4I1IA 5H5JA 4Y2PA 3REQA 1EFCA 5DGCA 3ONFA 1DWUA 2VUHB 4JSRA 3OX4A 3ZDZB 5T5QA 3SZRA 3M3PA 2FQ1A 5IJXA 5IVDA 4J0EA 1M1YB 5JS6A 2O1WA 3QEBZ 4FOPA 2BMEA 2WYWA 1G21B 3UGTA 3GFSA 2R6HA 5HBRA 3RSZA 1QFMA 1TC1A 2JLRA 1UBMS 2IIPA 4Z9XA 3JWHA 2QTVB 3LA6A 4DBLC 3GPLA 5DB4A 1J8YF 2HZ7A 2GBPA 4DXHA 3SWWA 1J1IA 3QFSA 1EESA 1MKYA 1Q0RA 2AG1A 2V5UA 3AJRA 1LTKA 4X1KB 3WKBA 2MYTA 4UNSA 4YAWA 3HDGA 4KZKA 4Q1BA 5EE0A 4UUPA 1T6XA 4N48A 2QQ0A 3W6ZA 1CUCA 1W2HA 4X91A 3VZCA 2DFKB 3C5WP 5EGNA 4O4IA 1QRAA 3Q5GA 5DP2A 2YVLA 2WU1A 5TC4A 2EZUA 4JB2A 4NJMB 3KWFA 2CBXA 1IOLA 1K1EA 3UJ6A 3L92A 1M1YA 1QDUA 2G0TA 3CUVA 3QYJA 4LHWA 1EXNA 4B9AA 1IRXA 3L8FA 2BEWA 1FRFS 2PA0A 3O4HA 4O2RA 1MB9A 4OJMX 3SSAA 1VBMA 3K4HA 5AOVA 2Q2NA 4D98A 1E8DA 1KMHA 1WE2A 3A05A 5HE9A 1PZNA 3K09C 3W5IA 1X1BA 4BKRA 4FMPA 3OZAA 1KEVA 2R4UA 4XGQA 4FOTA 3R5FA 2OQVA 3K0EA 1KY3A 3I6QA 5IBPA 1OH7A 2AUNA 1CDDA 2YXLA 3GBSA 4ZRDA 1JBQA 1MUUA 3A31A 5FTWA 4D79A 4YMSA 4DT1A 5KX5B 1WXQA 4PGGA 1QO0A 3DV9A 2CLIB 3INNA 4JUDX 2CDAA 5GM1A 2FR1A 3F67A 2I8AA 4MV3A 3VHLB 1A9OA 3IQEA 2NTVA 5ICMA 2CD7A 3DLAA 2O8VA 4CLDA 4ZT2A 2QRHA 1GD1O 2PBZA 4UHEA 3U56A 3WADA 1CZNA 5IFLA 2YFKA 3V7WA 2O8EA 2MINA 4XPIB 1F0KA 4C6RA 1OZ0A 2YZ2A 5EXSA 2FYTA 3EXFA 4OP2A 2G70A 1ZNWA 2WT9A 3GRVA 3A6EA 1RQ2A 3JYOA 5CVCA 4IIXA 5AW2A 1GCOA 3SS8A 4CZ2A 5HKAA 1XMSA 3RVKA 4C4OA 2P9HA 2V9CA 2VG8A 5DM60 5C7LO 4R5MA 2EF0A 4WFJA 3IP8A 4FFOA 4UMDA 1HLGA 1R0RE 4JHLA 4MGZR 4B48A 5KNBA 1J21A 5KX5A 1T8UA 3Q7PA 3MMXA 1QOQB 5EIHA 3NMUF 4BO8A 2XKAA 2ZWIA 1Z08A 5I7WA 3T0IA 2ZANA 3P9KA 2IUYA 3EBOA 1KI9A 3M1IA 5CH5A 3VNBA 4D99A 3TRIA 2CV1A 2ZUTA 2HU7A 1QK3A 2QD3A 2QRNA 3HQ4O 5SYMA 5TVKA 3W9YA 2ZCUA 2I9PA 3CRZA 1ARZA 2QSJA 4H4CA 4MUEA 4XPIA 3TLGB 4P22A 3O8BA 4DMLA 1D2HA 2DH6A 2ZRMA 1RI3A 4RPCA 3EBLA 3W06A 1JHYA 3FNEA 3PIDA 3ROPA 2EFYA 1Q1BA 2NAFA 5D7BA 3AUKA 3UB3A 3V1LA 3L1KA 3NEAA 3B9RA 3ZWCA 4BKOA 1UEXC 2GEJA 1XZEA 3MJHA 4I55F 1AXEA 1TZBA 2XVMA 3SQXA 2ZDGA 5CEJA 1NNLA 2VWGA 3VKVA 4XKJA 5ALYA 2LUOA 3WRVA 5AW9A 3K5HA 1NW4A 5HIAA 1Q17A 4MGIR 3V2HA 5EYPA 1NYLA 2A2ZA 1C30A 2OGZA 5FBVB 1OH6A 3MWGA 3RAFC 2IFTA 1U0NA 1R6XA 2XMZA 4KPFC 2E4YA 4MW9A 3EHDA 1IN1A 4JI7B 2V1XA 3JD3A 4M36A 2Q6TA 1QG2A 1RP1A 2RMKA 3QFCA 1GCAA 4HBZA 4N47A 3FCSB 3GRYA 4F96A 1B4DA 4IKPA 1M6YA 4FQ7A 1MHPA 1QXSA 2H06A 3JR7A 4KPUB 4GL2A 1AS3A 4G1VA 5JMOA 3HGMA 4RTRA 1X9IA 3I8SA 4RGQA 1IQRA 1QC5A 3EARA 1NBMD 4PZ0A 2IX9A 4O25A 4Y2TA 2I87A 5H4HA 2ZZKA 2XEXA 1CQWA 2HMUA 2I29A 2XBUA 3AIMA 2VSQA 4I5FA 4LNAA 4NS1A 5C34B 1YOVA 1WEHA 1T3GA 4NAVA 1U04A 2GWRA 3FY4A 3RIXA 4F2GA 1D1SA 3MSCA 2HU2A 3ZXUB 4D0RA 2AJBA 2DUWA 3DBHA 3VUEA 5J63A 5I4CA 4IAOA 3KQNA 1NU8A 3QKSA 2RBEA 2RC5A 1H05A 2X0IA 2YH2A 3BCUA 4HWTA 4P8RA 4YROA 5G4KA 2Q49A 5D7NA 3J80A 2QTRA 5K5EA 5I7UA 3H8JA 3IV9A 5IVIA 4OB6A 3RC7A 2AT1A 3EOZA 3I73A 3PLNA 4EF5A 4KLRA 4CG1A 1FNCA 4BN5A 1JI3A 4NNOA 2AUMA 5IFKA 2WTEA 4PTZA 4KPUA 3W8FA 3H6GA 3HCOA 3JTEA 1ZYUA 5C3MA 1UZAA 2JFYA 4W5TA 1II8B 1VL8A 4WLVA 3NT5A 1O0SA 2V0NA 4FMBB 4H35A 4JR0A 4J3NA 5HRCA 3FJOA 1KDTA 5B1IA 4Z51A 2VUIB 4Z9YA 1LS6A 5CH8A 2B37A 1KEUA 2C0PA 5ADVA 4JXZA 4XDGA 3MNFA 1TIPA 3BAZA 3FLAA 1UBCA 5JARA 3KKMA 1I5EA 1OLSB 2FX5A 1HZZC 1KTIA 4MYCA 4MS4A 4BJHB 4H0CA 1NZFA 2DHEA 1G6OA 2H8GA 3QVTA 1JHXA 3H2KA 3I2KA 3RSQA 1YL6A 1KO7A 3GJ4A 1MQ9A 3UHJA 3ANNA 2PX6A 5CDGA 3JAWB 4KG7A 2JVKA 3IS3A 3B78A 1JECA 2ZWPA 3VKGA 2BR5A 1JG6A 5JJCA 2R00C 4RKRA 3H75A 3MAAC 4XASA 4UHDA 3VSCA 2RGRA 1NNUA 3QBJA 4HMOA 3HC7A 4ILEA 4LYAA 4QKQA 1JT9A 1CG6A 1II8A 2BTEA 1KRHA 1EDEA 3C6XA 4YV1A 1QGOA 3HFSA 4GPEA 3ZDEA 1MEJA 1MN6A 1IDN1 3AETA 4FJ0A 2J85A 3PC8A 3WLMA 4D3FA 4D81A 4DIFA 5EJEA 1ZN7A 2OG2A 2FXVA 3IBTA 3G8CA 3O9MA 2IOFA 4K2AA 3ZS8A 1M5RA 1GAXA 1XZHA 1UPXA 1HG0A 4KIGA 1OLSA 3KZMA 3RAGA 1ELOA 3AH8A 2DWQA 3OZBA 3RBXA 1G6HA 5HQ3B 1ISIA 4B71A 3M4JA 4PF1A 1SUCA 1VP9A 2GGSA 4EF4A 3QPBA 1Q20A 4PFSA 2IBSA 5BPFA 2KQUA 3HA2A 1OXUA 2NSLA 2GBLC 2QPOA 2Q6VA 4MTLA 4ALNA 3UJBA 1N5DA 2HO5A 3QLUC 3SJAA 1E3WB 3OT4A 3RKUA 3WGNA 1XEFA 3RREA 5K0CA 1KK3A 3GJRA 4BMDA 2EX4A 3S1LA 1B1CA 3TFQA 1V1MA 3R5XA 3C1UA 1F9AA 3BJMA 2UUAB 2FFBA 4Q47A 2I4RA 4IJVA 1KYQA 5F78A 3L7BA 2C83A 1V4VA 1TYZA 5ALLA 1ZCZA 1AUVA 1M1NB 2FW1A 3VU8A 2F9FA 3JZAA 3Q7RA 2QKYA 2ZRFA 4LN1A 4UZSA 1U0HC 3IQZA 4WZAB 2QNIA 4IIGA 2C7PA 1JWBB 1U6KA 2JEOA 1NVXQ 1JEEA 1VZ2A 3LBIA 3P2OA 3DW3X 4FFBA 3IEUA 1FUUA 5GV8A 1EQ2A 3WSWA 3RVRA 5HQ3A 1WZ2A 5HCUA 3WKEA 2D4HA 4B7ZA 1NMXA 1KR2A 3F7OA 3FPGA 4KE7A 3HKBB 5CDUA 2VFAA 1Y6RA 3TF5A 4ASUA 3OMWA 1DC4A 5ARBA 7GPBA 1QFXA 3AM5A 3WWEA 1ZJ5A 3PGXA 2QTAA 1JG2A 1L4NA 2GA8A 3EZGA 3GNTA 5DE3A 1JU4A 5CBKA 1E3WA 1SNYA 3G89A 5FYDA 4PG4A 4M8SA 5TLSA 4GECA 1RPAA 4UE3S 5U1PA 3ENVA 2C9YA 4J75A 1WXGA 1FX1A 2R65A 4LI0A 2AQIA 2Q2OA 2OESA 2PWBA 4OQZA 1C7IA 4IWYA 5IKPA 1JG1A 1M1NA 3BIWA 3HMKA 2W8ZA 3CF4G 3RSGA 3Q3JB 4GXQA 1MCZA 3NW9A 4UNNA 4J0QA 1QU3A 4Z1MD 3PD0A 3JD2A 1L4HA 4EG6A 4RCYA 1JVBA 4G24A 4IIEA 3C3DA 1QVVA 1Y6GA 3GJTA 3TQRA 3KQKA 4V03A 4E3WA 3UPTA 3UKDA 2BUBA 4YB8A 3K32A 5F9MA 1K8ZB 1WQ3A 1WLSA 2CKDA 1L5ZA 3AZQA 3F90A 3NB0A 3QVKA 5I5GA 5B30A 4KMOA 4XSHA 4J7CA 3FKSA 2NXWA 4JK3A 1MG5A 3VYRB 3I5XA 1FSSA 4X8LA 1UAGA 4J49A 3FHLA 4E7PA 1QTQA 3EK2A 5D2CA 1UQRA 3A58B 3QVMA 4WNYA 5AVKA 4BNMA 2WNHA 3WYBA 3EN0A 2HTFA 4PC6A 1TAGA 2CHVA 4W5OA 3BMCA 1G8MA 5JMPA 3VPFA 4A82A 2MSWA 1QYVA 5CD9A 2WJVA 1Z7EA 1YH3A 2PFGA 4IXMA 5FX2A 1UBSB 3UYKA 4RTNA 4BQQA 5EMJA 1T5IA 3B1XA 2IRWA 3HRIA 3ZWDA 4OSPA 2YUIA 2VQDA 2OQ2A 3N07A 4ALIA 3N53A 1E3SA 5J1TB 4BVEA 1QZUA 2HK8A 2J3HA 4MWSA 4W1SA 4KMRA 4PR0A 5IW8A 3A6ZA 3P20A 3HVUA 1IXZA 4KXMA 4W9NC 5CLLA 4FONA 4EM6A 2PU5A 3RIHA 4BNGA 1WHTB 4ZHQF 2FV8A 3BDAA 4ZC1A 3LQ2A 5IAKA 5K0BA 1F2TB 2ZR8A 3HYNA 5A04A 2WFAA 4O5AA 2JK1A 2JZNA 2OCGA 1NULA 4ZCRA 2QM3A 1EX6A 2GF0A 3IUEA 2ZQ5A 2N9UA 5IANA 4YS6A 5EZYB 4UNQA 4MCIA 1TF5A 3P0IA 5J43A 1NRJB 1OWMA 2HMAA 2SECE 4L4SA 5JNWA 2R7AA 3ZU5A 2WE8A 1LK0A 4KFCA 3T4UA 3KL2A 3L82B 1OXTA 4S12A 2XUFA 1JP7A 3FF1A 1Z3CA 2DFPA 1VSVA 2YRWA 1ESNA 1R50A 3DKRA 1J70A 1PVVA 4LAFA 4LE1A 5EPEA 5EPUA 5JSYA 3FPBA 5TS2A 4HFRA 1B8VA 1W85A 4RDCA 3N7UA 4X94A 4JUBA 1QZZA 3RTEA 5ALDA 2OHFA 4EB3A 1LQTA 1FYFA 2ZE5A 1NBOA 2GT1A 2I54A 4Q01A 5CAEB 3RLIA 4HQLA 1FFWA 1T43A 2FH5B 1GL6A 2V4UA 3QPWA 3W9BA 2LE0A 3BS4A 1VRCA 4S3MA 4C22A 4DE5A 4ZIRB 1E6KA 3V8MA 2O2JA 5LOVA 2YYAA 3KKOA 4EABA 2K7FA 1ZJWA 4NYIR 3PPWA 5L7TA 1RWKA 3UGQA 3C1AA 4KLCA 4YONB 4L9SA 2XNCA 5EKSA 2Q3BA 1O9HA 3KAJA 3SBEA 1CIVA 5EZYA 3DBIA 1O94D 2LKCA 3FYUA 1G63A 4OHKA 3HXTA 1KIAA 1PFQA 1E8MA 4UMFA 1XRRA 2YMLA 4HB4A 4TX1A 4Z4HA 3SICE 1CUUA 4HYYA 3FDZA 1AX9A 3D8HA 3M6WA 2Q3DA 1E2DA 2AJCA 1AU9A 3NWOA 5G2OA 4DHWA 2Q62A 3MCTA 2A6PA 5CB4F 3BOSA 2C9BA 3ODPA 2JGEA 4G25A 4I3FA 3T38A 4X8HA 4ROSA 3R9WA 4K9DA 1G7CA 4UXJA 1G3MA 4WEOA 5FWNA 4XXHA 3CB2A 2VBFA 2OFFA 1JB9A 3RU7A 5CAEA 1QIHA 4AUNA 1OA1A 3CXUA 3ELUA 1IEQA 4ZIRA 1KBZA 3IESA 4GKJB 1DWQA 3WLTA 3E9QA 3ICCA 1ONNA 4KUHA 1SCIA 2J5XA 4EJ0A 3IAS1 1CE8B 1N8NA 4OATA 3S81A 2Z5LA 2QZJA 4L57A 3JTMA 4JVSB 1FFCA 2VPIA 4FNMA 1IY1A 1ECCA 1RJ9B 4O2AB 3ZN2A 1V6CA 4G4IA 5H83A 5JWOA 2AR0A 1MX9A 3B9BA 3O4IA 4R9VA 5JLJA 1NVDA 1WZUA 2ZS7A 4D4KA 1LRLA 4Z4EA 1CB0A 4GLFA 4OXXA 5IAJA 2XGOA 3NJ8A 1NUTA 1DCKA 1SQ0A 2HMVA 3PHHA 4H60A 4PR3A 3UJ3X 3E2MA 3WB9A 1AQJA 2WMDA 1PTJC 3OQ1A 2HQRA 5C8XA 4QPNA 1AY0A 4B5KA 2F1JA 1UMCB 2DQSA 3SDBA 1NQ5A 2QD5A 4RGYA 4YR9A 1YZYA 1H93A 3GMDA 3OTIA 5CXQA 4L4YA 3NBAA 4GI2A 4S2EA 1JZTA 5A3SA 4MV6A 2J0VA 3SC2B 2FZCA 4N0PA 4B2PA 3ICWA 5BNIA 5JR3A 2YTZA 1MW8X 5AKXA 1A2QA 4ZT4A 1CJTC 2W6JD 1HE3A 4KAFA 1ZCFA 1LPOA 3R3XA 2JFUA 4NQZA 1GQOA 2QBYB 2DY0A 4HNGA 3ZNNA 3RF6A 1OFTA 2ZIZA 3Q2OA 4G2TA 1APBA 4H3SA 4O2AA 4HNSA 2F8LA 3RTAA 4H7FA 3DOCA 5AJVB 3YASA 4F86A 3A1NA 2RC6A 1A1VA 4IVRA 3FNGA 4PIVA 3ER9A 5AHWA 3GROA 5ENDA 3BCHA 3K1YA 5HX7A 3FBGA 2P27A 2R84A 2FRXA 4KMMA 2P11A 3VPAA 1Y1KE 1SVSA 3AWIA 4H3KB 1JT2A 2VHYA 5AW4A 2PGAA 3DVSX 4NU6A 2COKA 1AV6A 1UMCA 2GD2A 4EQ6A 3L8EA 3AM3A 3MWEA 1JHRA 1W4RA 3QWBA 4GR5A 1QBKC 3DO5A 3QUBA 2HYDA 2J07A 1Z0IA 3DEHA 3GCZA 3GEBA 3HUTA 5IYZF 3SI7A 5JHHB 1XMPA 4EFDA 4ZREA 1P73A 4E4RA 3INRA 3WK5A 3G68A 3OZFA 4TVBA 3AKDA 1MZVA 2QDKA 3LY7A 5DGIA 1BXZA 2FWRA 1XJQA 2OYSA 3NAQA 1GTSA 2YCLA 4D0LB 3FH0A 2H2GA 2BAGA 3OWHA 3K5WA 4WKGA 2XB2A 4L4ZA 2BEKA 2BFAA 5D5PA 3SIRA 3BSSA 3R3UA 5KJCA 4ZO7A 1P17A 2R5NA 1WW8A 3CZPA 3URKA 2NP7A 1ZI9A 2E4ZA 2WYVA 3B60A 5K0ZA 1VLMA 2A0XA 2G5CA 2AX4A 3KSAC 1NVGA 1YQDA 3W8NA 4BAGA 4EO7A 4JC5A 2GD6A 1RQRA 1WB4A 1LX6A 1JDBC 4KDFA 4NRDA 3GFBA 2NUBA 2P7IA 1RW4A 2EEZA 3CZRA 1E7WA 1NBEA 5CRIA 1N9GB 1O96B 1JSLA 2DKNA 2JFWA 4X0EA 3RM3A 3IJEB 3O95A 3ROKA 3ZE8A 2B7CA 1ZUIA 4KZPA 4UUQA 4CIVA 4DCMA 5JDIC 1GGHA 1K6IA 3E4CA 1V4BA 3OZSA 2X9GA 2V6GA 1OFHA 2VF8A 1XTSA 5HCNA 1RD4A 2Q0XA 3TNDA 3FETA 3T3DA 1GPYA 2C42A 2QL7A 1R4MA 4OH7A 1Y5IA 1Z6AA 4YCDA 1VJGA 1UJBA 1E6WA 2Z83A 3IO3A 3DE4X 5JY6A 3WWZA 5TQ2B 2EV9A 3H0KA 1VA5A 4UUBA 1RJFA 2AF4C 2QJTA 3N5CA 2IHUA 2JFFA 2VVTA 2Z58A 3AXSA 3QTLA 3ZK7A 1GDTA 4KO4S 2YWBA 1RTTA 4Z7QB 1C1DA 3ZNOA 1K27A 1P31A 4XD7D 4LZNA 2OYRA 5L3SA 4GP7A 5HF6A 3VTAA 1N9GA 3TXAA 2A57A 3KOZA 1XFDA 4J90A 1EG2A 3I9NA 5ICSA 2GS9A 4MP6A 2BDTA 1DAFA 3EIHA 5EHXA 2Q1SA 3AHHA 4LC9A 4F2WA 1H9CA 2Y1FA 5ALTA 3OJCA 5K6RA 1OUMA 1KC3A 3GPDG 2IVFA 1XZMA 3CRQA 2DLCX 3U26A 3W05A 2ZYGA 3EFHA 4BUZA 3O84A 4C4SA 5T6BA 5DXFA 3FSGA 2C2HA 2JGDB 3G8DA 3LG2A 3N2GA 4EMBA 1QYCA 3D02A 3M0EA 1HLFA 1XA3A 2NX2A 3C4QA 1QGYA 4ZYYA 1E0DA 4FFWA 2QRGA 1MA0A 2YWDA 3OX2A 4RLSA 3S44A 3TQSA 5JJKA 4ALJA 3HXQA 5JG7A 2Q3CA 2NXEA 1JTVA 4RD2A 4TRNA 4CF7A 5EP3A 2EIHA 1OSNA 1XVVA 4KSYA 4BKMA 4Z4IA 1EVEA 2NO1A 3VYWA 3DAHA 3AHIA 4O4JB 4G1MB 2QD2A 3T4EA 1Z5WA 2O3SA 1JKJB 1OZAA 1P6UA 4RYLA 1RYHA 4LXYA 1LWNA 4NPAA 5DHFA 1KZYC 1L7MA 4YEDA 4KXNA 2C04A 2LD4A 5DHPA 3TXYA 3WKAA 4AJOA 3KPJA 1NPDA 3H5RA 4CU5A 3NTOA 4CM4B 4CMJA 1I51A 4AS1A 3D0OA 3UFBA 3FHTA 4HK4A 5L3QB 2JGDA 3EC2A 3DZ8A 2D1YA 3OOJA 1TUBA 3S5JA 3JQDA 5BWOA 5CFPA 1L8AA 1U8TA 4ZOBA 2R9VA 3Q8XB 1COWA 2NLOA 1EX1A 2O2SA 3M4YA 2PBRA 1AKWA 3EVDA 4R41A 4BNKA 4GUDA 1RC0A 2H5IA 2ZRDA 3D6FA 1SPXA 2I2CA 4I8XA 4KFTA 5AI9A 1DSSG 4HZUA 4QO7A 4GZ3A 3ZHRA 4EW1A 5J4LA 1EWQA 1Z29A 4BP3A 5EJFA 1FJ2A 2IYNA 3R0JA 4HGYA 3V42A 1C5KA 2UZ3A 2WWGA 2G7MC 5BV7A 2WP0A 4M54A 3HL0A 5FL7A 1VA4A 3ZU6A 3UF0A 1W6RA 4CR8A 4CM7A 3QVUA 4MVJF 1DL5A 2QTNA 2JGKA 3BXEA 3P0JA 1X1QA 4TZKA 4WY5A 4XUGB 5EKXA 5TEVA 3UC9A 4BMYA 4NTZA 2ZUEA 1XE3A 4LYGA 3IFSA 1GTG1 2C4HA 2FQWA 1VL5A 2N42A 4JLSA 4Q4AA 4B6EA 1Z6XA 1GAJA 4KXWA 2UXBB 1SBQA 3FLBA 1LLQA 1VSBA 1SHLA 4GU5A 4DUYB 2CZGA 1BWSA 1XJ5A 3ABQB 3HP7A 4GAEA 4DKXA 2CK3A 4GOJA 3CEMA 1NLFA 3JQFC 4ZA2A 3U39A 1JKMA 1XU7A 5BW4A 3K05A 1K66A 1O6ZA 1WIWA 2W6ZA 1ACMA 4H3VA 2XDAA 1HRKA 5TARA 1ZG3A 2J59A 1E3IA 2A5YB 2O48X 3AONB 4G5SA 1ZOIA 4LC1A 1PX2A 5DX8A 4HDOB 2OCAA 3I04A 1YAJA 3ANXA 3EZ6A 3FX2A 1JDZA 1G5HA 4WXHA 1PJ2A 1R6TA 2BFCA 3GRPA 3PF8A 1K8RA 2AJ8A 3RH0A 3FPLA 3ZY4A 4B80A 2OO7A 4AP6A 1K3TA 3LPLA 5FB3A 4U7HA 1ECJA 1PQYA 2O07A 4UZFA 3RBVA 1P1KA 3PRJA 5K0LA 3SXJA 2RD2A 2XMCA 5B1HA 5GZ1A 4HQRA 4IY1A 4AY3A 4I4CA 2X0RA 4EGSA 4UD2A 2ZFUA 3AEKA 3GUVA 4M8IA 3HV2A 1W34A 3FOAA 1FP4B 1A7JA 3FCAA 5MGNA 4Q39A 3SCZA 1XWIA 1QGED 2EL7A 4C4ZA 2W58A 2WTNA 4RV4A 3QENA 3SPXA 4GR9A 3QTBA 1MO6A 3DE6X 4M8LA 2UYOA 2HSEA 4MYDA 4PBSA 2MSDB 1M76A 3C3EA 3FHOA 1D2RA 2VF4X 3O03A 4KXFB 3PLAE 1CT9A 3NNNA 3RUEA 5DWVA 1ZNXA 3N8GA 1G20E 1VLLA 5ALUA 2H7VA 1ACLA 1JSCA 1MO4A 3RHSA 8ABPA 1X7XA 5DGHA 1Z6TA 2GMWA 3KC2A 3VPGA 1S0UA 1V5FA 2NYUA 1E9FA 1I3OA 2CNWA 3DZGA 5H80A 5KTPA 5A9RA 3CUSA 2XZOA 1EWKA 3EF0A 4ADSG 1UBRS 3G0IA 3GQBB 3RHZA 2XT6A 1IZ8A 5COAA 2EW8A 2Q4EA 2YQ5A 3TM5A 3K0SA 1CV2A 1K7CA 3AY6A 3JQ6A 2VSNA 4MPPA 3W3AD 4DXDA 2V96A 4ESEA 1A77A 2KM1A 3CYFA 4GNRA 4RANA 3SC4A 3BL6A 5LZ2A 2ZSJA 1IG0A 5FLXA 4PEVA 2AC4A 2Q45A 1SD2A 1RAAA 4PLTA 3W6OA 4JGGA 3WWCA 3ZGYA 3IR7A 1Z0UA 2BFOA 1JDVA 2YKGA 2GNOA 4R7GA 3L6UA 3HY6A 1RXYA 2Q1YA 1T9KA 1Y89A 2BKEA 3R23A 4D45A 2MWMA 2HV8A 2REQB 3ETEA 4XIJA 2ODAA 3OSUA 5BMOA 2G40A 3IUNA 4JNKA 3C3JA 4QJBA 3UHFA 2VYND 5HNKA 1MNAA 1KH2A 5ICEA 1IJKA 4ZT7A 1QVZA 2QT9A 4C78A 1VE1A 2UYHA 2B3DA 1A27A 3BFPA 3U3XA 3HWWA 1SKQA 2REOA 5LZ4A 1J00A 2ATVA 2YJ6A 3BQ9A 5LPNA 1OAKA 2H2DA 3SZGA 3VNRA 4HB2A 5CB8A 3GQBA 4KXQA 3ADKA 1KQ3A 3NS7A 4U00A 3MTJA 1M8PA 4GOKA 5F12A 4R54A 4G0QA 4FWBA 3NR2A 3RQSA 1ZITA 2WHRA 2JAWA 5F9HA 2D74A 3D3KA 1M66A 3ZHQA 4M49A 3IE2A 3B1VA 1XDDA 5AW7A 1S2NA 3IT1A 3ULKA 1OREA 2R8RA 4Z3DA 4DDVA 2DWOA 5DTJA 4OHMA 2RGXA 3VBCA 3AVXA 4PZZA 5IDVA 4W82A 1BN6A 3PQ2A 4V0ME 3SEFA 3ZGOA 4A3SA 4HT3B 4TYYA 4J03A 2VZ9A 1PR1A 2VCYA 2PQMA 1Q2UA 2N47A 1V8OA 3PZRA 4P4LA 4ARIA 1IZ0A 1HK7A 1Q19A 1ZH6A 4KQHA 2CSXA 2OD7A 3DVRX 4GT1A 3R41A 4CN9A 1MJHA 4PS0A 1Z6ZA 1YAHA 4C0WA 3K0FA 1DIAA 4GMDA 2VDUE 4OQMA 3HL4A 4RJJA 4I1UA 3E9RA 1NPTO 3KR0A 4E70A 5KJEA 3INGA 1Z4JA 3JVVA 2CNOA 5HILA 2ZYRA 2NXCA 4YLYA 4ZODA 4HUQB 1DQPA 3G7UA 3JWJA 4G5YA 4D3YA 1B26A 2WMNB 1MX3A 2XNHA 2IXEA 4B33A 2P7HA 3LY9A 1KAGA 3QMWA 2CUZA 3QP9A 1EGHA 4UU1A 5EN4A 1UJ4A 3G82C 2JH9A 3ZWOA 3ROQA 1QO9A 3C8MA 2DU8A 3PYLA 3TTSA 2P2LA 5LA6A 3IA2A 2HT1A 4QG3A 2J67A 3VJMA 2RJOA 1PWXA 5AKYA 2Y1GA 2XVZA 1NW8A 2BF7A 1N2EA 4ZO6A 5EEGA 4G8DA 4K03A 4JOBA 1K88A 1NNI1 5IMBA 2I55A 4P34A 3IKJA 3I4FA 1SRRA 1DADA 3CZ9A 5JS8A 3AVUA 2PT9A 4OG2A 2ODQA 4LG1A 1K89A 3WBBA 5EZQA 4CV0A 3TZLA 2ZJFA 4HEA6 4ETNA 2FRDA 1BS1A 4PFJA 2XB4A 3UAGA 1FJGB 1RYMA 1JEQA 1FB5A 4QXPA 3ZJTA 1ZNQO 2AFIE 2HCJB 1G5FA 3BMNB 2Y1WA 3DDZX 3PXAA 5IN5A 3NV9A 3T1NA 3UA4A 4B9EA 4DLPA 7ABPA 1CY0A 4B7CA 4JIGA 3OUZA 1B8UA 5C3UA 4TUYF 4U7DA 4X6LA 2V6JA 4WAUA 3ZI0A 1FQKA 3ZWPA 3GN1A 1ORDA 4QBGB 4TKMA 1NVKA 1QQ5A 2DG2A 2R7LA 4KOAA 1SG9A 2WWXA 4QQ8A 4RSMA 4B7AA 5KYUA 1K6MA 1U7XA 2SCUB 1Q1ZA 3Q0IA 3T3PB 4RJLA 3CVXA 3DNPA 3I0ZA 4ID9A 4NATA 4LSMA 4NHEA 2CMDA 3TLCA 1XDUA 4MVWA 3MTQA 2YW9A 1U8ZA 2VJMB 5JOQA 2OXEA 4LQDA 4QTZA 2DLNA 4R3UC 5EKTA 5KQMA 4GMXA 2P30A 2YWEA 3R3SA 4HD8A 5DM4A 5DV9A 5CR9A 4B75A 5IT5A 3OT1B 3COYA 2VAWA 4MVJM 4RKYA 4JFRA 3UMYA 1P0CA 3HM2A 2X4DA 4MXDA 1RXVA 3NHPA 2PUFA 2W0MA 3UK6A 1PGOA 1UM9B 5HKBA 2OA0A 4EY4A 3BKXA 4KWIA 2O2HA 2H51A 3J81k 5EINA 2FSFA 5B1SA 4IDPA 3HMQA 1Y4UA 1BVYF 4OL0A 3DZIA 4RF4A 4EB6A 3AJ9A 5JFTA 2ASEA 2HK9A 2GUWA 3KZVA 3OE1A 2CY0A 4MRMA 3MTBA 4WINA 4BLRA 4NSNA 2V9PA 1T4DA 2Q1TA 4FWIB 3L1VA 4GVLA 4R2XA 1NVFA 1L1QA 1N5JA 2BISA 2QGZA 3KQTA 3TMKA 3OQNA 2IYPA 3ZEIA 3HJNA 4S1NA 1KH1A 3VHRA 2QVXX 2VJMA 4F9EA 2X77A 4IJ6A 4YMVA 1XMOB 3C98A 1B2RA 2QG6A 4PQGA 4JY7A 4HTFB 8AT1A 2GZRA 1XSEA 2EBHX 3B5IA 2CE2X 4YLEA 4YA6A 4DBLE 5TMDA 3UJDA 7ADHA 3Q8KA 3A7DA 1L8QA 3AEYA 5KTSA 1Q14A 4UVHA 5TDHA 3D6AA 4F4CA 1ZR4A 2HMYB 2VJLA 4F2HA 1ZCJA 1UM9A 3NIDB 1E66A 1UF9A 2XRFA 5TVGA 3MTEA 3JD1A 2V0GA 2I80A 1YQXA 3MCVA 5CDFA 3ZCRA 3CG4A 2ZJ6A 3QMPA 2OBFA 3LKVA 3AR5A 4JLDA 4R1UA 3V1NA 3H5WA 4QNMA 4TXJA 1JFSA 1HX7A 3M82A 2BGTA 4J3FA 5FLKA 3WMGA 1CUEA 1FNMA 4JENA 2HJHA 1CHDA 1RBMA 3KOYA 3MD0A 4G5HA 4P4TA 3GLFE 4ZDWA 1TU3A 4K26A 4JZKA 2YV4A 4BS9A 4D0SA 3D8NA 1M0TA 3QGMA 4M0CA 4WCFB 4WVFA 4BFZA 1OZFA 1QGDA 3KUUA 3IA7A 4O59O 4BJ3A 4QZVA 4CEHA 4OGWA 4QT0A 3CNNA 3MF4A 3GGGA 2JZCA 3CZQA 2JBHA 5TQJA 4JT4A 2A9JA 4PANA 2Q9CA 1T3SA 2PL3A 4KQ1A 4MVJE 3RVSA 3DWFA 1R1DA 1T0HB 3KYJB 3E05A 3I0NA 3E82A 1YD7A 1MRZA 2XAAA 3A1WA 3GWGA 1E6CA 3UB4A 1AZSC 2VHTA 1WF3A 3BWBA 1I1OA 4E31A 3KXDA 3OIFA 2J3JA 4ZKEA 3SOPA 3JAMA 1JJVA 2BC9A 3I64A 4FR2A 4ON9A 4GPIB 5JXWA 3GZJA 5SZIA 2PLWA 3K96A 4IO0A 3ZZ0A 1UDAA 5KB3A 1EXDA 3PNLA 3OHPA 3VU3A 1MC5A 3B3JA 4INAA 4QEZA 4AMUA 1Z16A 4WDQA 1IU9A 3TDNA 3D2BA 1PIWA 4LVOA 1EX7A 1ZU5A 1IBLB 1Y5MA 2AMYA 3PXEA 5JASA 3KXIA 1Z33A 3VVBA 3ZE9A 1Q84A 2CLSA 4QRHA 4YO7A 1UBHS 2A0WA 2NVWA 1HTBA 2G4VA 1E9BA 3QUCA 1RM5A 2KS6A 3AY3A 4XDHA 1ATIA 4D41A 3D2AA 1IN8A 3WE7A 1CDEA 2HMSA 1FFHA 2ZJ4A 3LCUA 1J24A 1DC3A 1RM4A 1Q7EA 1SU4A 3LDHA 3PX3A 4L8WB 4YGXB 3T9CA 4C0JA 5HJEA 4U5XA 4LBVA 5GIPE 1NF8A 4CFZA 2VAPA 4J6EA 4MB0A 3AJEA 2QUHA 4LDZA 4RD6A 4LJLA 2PSDA 4BE4A 4EH1A 4M0FA 1N2OA 3WGKA 4DHEA 1NUQA 1X1TA 2P41A 2WZCA 3F9IA 2ERYA 4LDQA 4AG5A 1TMKA 1H0RA 1NHWA 1Q1EA 1QH1A 1QQ6A 4MVJD 4ZYTA 1AKYA 1P5JA 4KO3S 1EK0A 1KDVA 3ZXYA 1F7UA 1OYOA 4JJKA 1NN5A 2WHEA 4Y9SA 2DPMA 1G5QA 1BFUA 4PX2A 4IQFA 1QX3A 1ZGAA 3RHTA 4IZ6A 3H1FA 4AKTA 4HVAA 1QDEA 3EPHA 2A3NA 3B5JA 4FLEA 4NAHA 2GJ4A 4A8TA 4PG8A 1PJQA 4YRIA 3MELA 4KMSA 1Z0SA 2CVZA 3H4VA 4MRRA 4MYSA 3OIYA 4IIJA 3MBOA 2C88A 4C01A 1R0XA 3VAYA 1YZLA 2VTVA 4IXDA 2IYLD 1SKBA 4K6FA 3CKMA 1H4VB 3USES 2GN6A 4JC4A 2AR9A 3AB7A 4BN4A 4BNZA 1E3MA 3ZU3A 4KGDA 5CLHA 4EW3A 1CEYA 1C80A 1UZUA 2AXPA 5HBGA 2YXPX 4NFSA 4XTRA 1PWEA 3KELA 1JR3E 1CUZA 1ITZA 2JGLA 4FC6A 3VX3A 1ZKDA 4IVQA 1NJ1A 2AZ4A 3GEIA 3RSSA 3SMVA 1E9SA 1K7YA 2FW0A 4CMEA 5HKKA 5L6LB 5CB6A 4HB0A 1QPZA 4DJEC 3AINA 3ND5A 5AXCA 1JAZA 3EEYA 3FYTA 3ONNA 1BZYA 3GV0A 3D6TB 2HOQA 1DX6A 3U40A 1NVEA 2QTWB 5CTAA 1ANKA 1AQIA 1H2HA 4IVNA 2ZAYA 2GCOA 1XZFA 3HFGA 3K4QA 4FIZA 4ZHSA 2D54A 1AZWA 1S4MA 2RHRA 1E18A 1GTVA 2FSIA 1VLHA 2OQRA 3CZCA 3KJXA 5KQRA 3A3KA 4DDWA 1EYZA 3DH0A 3DP9A 3BXZA 4V0LA 4DY6A 2CLEB 4GKVA 2LR0A 4K9LA 2EFDB 1U7HA 2WZBA 1JRLA 2FF7A 2WM3A 3Q9SA 1KJ9A 4KKVA 3WRYC 2BFBB 1O4WA 3L1UA 4M9QA 4UQLA 5GTDA 2D06A 4M99A 4DQ0A 1ZXXA 2EX0A 5IARA 4DQDA 5J47A 4LNUA 5ADHA 1ACJA 1RXUA 1WCIB 3TRHA 1QCYA 3T7AA 1PFGA 3VR4A 4II3A 4M2LA 4HRYA 4I1OA 3V2IA 1WZEA 2ZT8A 2IUUA 5I8WA 2FW9A 4MV8A 1NKVA 1LQUA 3PQ3A 1H2WA 3WLJA 3QE0A 2AHOA 1C9JA 2B21A 1CVIA 3BPSA 4I9FA 1JLSA 3KTAB 4BCDA 2QXYA 4EITA 3LUJA 4KH0A 4WBNA 2VHUA 2NZVG 1UXGA 3I72A 1VMIA 2ZT6A 4MQ4A 1L8OA 4MWDA 4P98A 4L51A 4TM8A 4V2IA 3HU1A 2DYKA 3L4JA 3UJ8A 4B3SB 3BWVA 3PDJA 3EXG1 5AHRA 3ZK8A 5KYYA 2R97A 5DTEA 3V6MA 4LOIA 1JLMA 5AI5A 5E7IA 5DIZA 5DW0A 1G8HA 2CLFB 2XYVA 4DYDA 4IV0A 1Q2XA 1FPMA 2PUAA 3KDAA 3ADBA 1M34A 1SHUX 4LV6A 4PYLA 4HVLA 3AM1A 2P79A 4YJHB 5AXBA 1G20B 4ALKA 3QE3A 2P1RA 1JMYA 3I6MA 2KI5A 4Y7DA 5L9AA 4UTOA 1GWNA 1OPXA 2FA9A 3PUWA 2GN8A 5LP1A 5CB4B 4KAXA 2XQFA 3HU5A 2GM3A 3N0XA 5KDDA 1ONBA 4MKXA 4E94A 4XWAA 2AOTB 4FFDA 5BQ3A 3U4DA 3AR9A 2AOUB 1NQAO 3NWPA 2QXTA 4ETIA 1BU5A 5J2TA 3SQDA 1DZIA 3SJBA 4BWGA 1QYWA 4QUKA 4AS2A 3HYLA 2AMJA 2FXIA 2H7YA 2I6XA 3UWKA 5CNJA 4TYNA 2DLDA 1B00A 4MR9A 2AK3A 1U2RA 8MHTA 4IHKA 2P65A 5ANRB 6CHYA 3CS3A 4AZ0B 4GPD1 2QM0A 4MH0R 4OGKA 3EWIA 4H7KA 4DIUA 2VLIA 5IKMA 3L7JA 4RH0A 5FI3A 4RIHA 5IG2A 1NURA 3PJGA 3QXHA 2WD7B 5AYVA 4CODB 2HADA 3WBFA 3PNMA 3WK4A 1GPMA 2XOKD 4JBNA 1C0IA 2ET6A 1GPDG 4RYDA 2FHPA 3EQZA 5DF1A 1BH6A 1WY7A 4ZVTA 5IC5A 2PKXA 3S3TA 4QVIA 1Y9JA 4OUKX 1CR4A 1GTZA 4HZGA 4UTVA 5EJ4A 4Q9HA 1V3UA 4OXNA 1GSIA 1LY1A 1GN9A 1NVVQ 1UKZA 2GSWA 5H3HA 2QY9A 3ZHYA 1GZ7A 2ZIXB 5TJ9A 2QMZA 1U5AA 2NP6A 3A6HA 3CTMA 3GN2A 3MLBA 1OIWA 4TL6A 4LOKA 2FJPA 4CG0A 4OA8A 1JHAA 1XRSB 2O14A 1IVYA 4MUMA 4WK2B 1CF2O 2QTLA 1C3OB 2JJ1D 2PUEA 3G5MA 5ENZA 1IXRC 5GQSA 3R3ZA 4S1VA 4Y6QA 2QM8A 4JP5A 2Q5CA 3UV6A 4K9MA 2FZGA 3KX2A 2KX7A 3CVVA 3ELDA 4MARA 1XNGA 3BICA 3AQ4A 2O2XA 3H5TA 3MWYW 4GKBA 3CNHA 4H1TA 3T5DA 3BRWD 4HQOA 4UFOA 1EE2A 4YVFA 3BZBA 16PKA 4YRSA 1ZHOA 3UCXA 2WR8A 4MA4A 5IPFA 2XA2A 5EEHA 4RZHA 4Q3EA 2JAOA 3O0DA 4Q4JB 3T5BA 1OLUB 4L73A 1BRMA 1II9A 4PLYA 3THWA 2EFEB 4HH3C 1O97C 5CVJA 3TZCA 3B52X 1GCUA 3QX3A 3FIUA 4N03A 4NG5A 5IAOA 1XTKA 3G6WA 4OIFA 4WESA 4EI7A 5IHPA 4J7UA 5IC6A 3HP4A 1U7PA 4HDSB 4MWGA 4PPQA 4W1RA 1ISJA 5EJ6A 3HR8A 2II6A 3V46A 3R7LA 2BBSA 3PHLA 4N3CA 1C3OA 4EPTA 1W5BA 2XMQA 4ZQFA 3B51X 3IX7A 3PYXA 1NXVA 1ZHHA 2OE2A 3ED5A 4QOJA 4TMWA 2B2NA 4CFSA 3WB2A 4MI1A 1Z7WA 2WWHA 4FDUA 1XJ0A 4CUZA 5FUQA 3OCUA 1NIPA 1RHKA 3I58A 3PL1A 4QG7A 4DR6B 1KETA 4EBFA 5LWHA 1FUKA 5D3KA 4R8RA 3H13A 4LA4A 4NZPA 2LIVA 3ZU2A 1GUAA 1YMVA 5MHTA 3QF4B 3CUEF 2IY8A 4Q4JA 1XZAA 2X76A 3B36A 1K4KA 1OLUA 4ENSA 1ZLYA 1HNZB 4BIIA 1E92A 3FCCA 4JH0A 3BTVA 1JEOA 2FSGA 4IINA 4ERXA 3MIZA 4HRAA 1XDBA 3RYCA 2HRRA 4XARA 4F04A 4L76A 3H8SA 1RR6A 2PY6A 3ZJ4A 2BCEA 4HDSA 2AFIB 3NO4A 2BEUA 2FEPA 3WX0A 3HV0A 4LJ9A 1RMYA 3JALB 1X9GA 3EQ6A 3OPMA 3NUQA 3NDPA 1Y63A 3QYPA 2OWEA 4TT8A 3QNWA 1E2BA 3CURA 4ND5A 2VJNA 2GXQA 1GQQA 1OBFO 1OI2A 1J8DA 1M1ZA 3H9BA 3OY2A 2PJRA 3GJ6A 2C9OA 3EG9A 3L7NA 3UK0A 5FWXB 2PZGA 3PEEA 4CN8A 4Q3AA 3SQNA 2YHBA 4J8PA 1ZGHA 1OH8A 4HXFB 1B14A 1FRVA 3ZZMA 2KWIA 3ZHZA 4B83A 1YMUA 3PVZA 1G6Q1 1RKQA 4KQXA 1WBJB 3LHDA 3GNQA 3KSUA 4YK7A 4J07A 1ENOA 1OTXA 4YPFA 4FKMA 3ENQA 1L7PA 3DMRA 1DKPA 1V1JA 4L28A 1QWOA 5CURA 3WLLA 5A9SB 4JV5B 1YFZA 2G28A 4G0ZA 3SNKA 4B8YA 2VPPA 2AN4A 1GGVA 1E1YA 5FBQB 3TB6A 1EXVA 3UPDA 4EK9A 4LHSA 4BNLA 2I67A 1V47A 3DQZA 4N0QA 5TPZD 4DLKA 3M6FA 1R16A 1X1CA 2V4MA 1WM1A 3DAPA 5FNVF 3IULA 2C3MA 3GFVA 4DUGD 4A91A 1JIKA 4BNFA 3PQEA 3PUJA 5LZ8A 2H31A 2XHZA 4Z7NB 1DJPA 3L5OA 4TWJA 4XQEA 4YH1A 5THKA 8OHMA 3C8HA 5FWXA 1YSCA 1E20A 1SEVA 1ZVMA 2R11A 5E7QA 2VYVD 2IE0A 3GJZA 4EJSA 1D2EA 1G3RA 1RKBA 1VGRA 2CEKA 3WLNA 3PC2A 2H9YA 4CHTA 4M0KA 4F85A 2UXDB 5GP1A 5LN1A 3FMGA 3CX4A 3W1WA 3REOA 4ARUA 4F3CA 5M7EA 1JH8A 4NU0A 3CLVA 3U7RA 5FLYA 3KAPA 5IUNC 2VTBB 2JIPA 2OCBA 5GGXA 3DD5A 1AXRA 3DVAA 3LDFA 3OKAA 3ST7A 4TTJA 4FKBA 3T7KA 1OKKD 4Y6OA 1YUNA 4DN6A 3TDMA 1GZ6A 2Q5JA 3LX4A 2MMGA 3OQOA 5FQNA 3GGCA 1YZHA 3UNXA 4Q4LA 2DZDA 2PRSA 1DRWA 1F06A 3AVQA 3FZYA 5ER9A 5JWHA 3PWZA 5M5BA 3BE8A 5TGTA 2OY0A 2WF8A 2YQ4A 1VCNA 4CDMA 2GZ2A 1DAPA 1V96A 3L3BA 3LIIA 4TT3A 4NCBA 4LQ4A 1E3JA 4QQRA 3L8GA 5ARDA 3U48A 1PNRA 3NM5A 1GPUA 2WTUA 4RZXA 1S2IA 5CM2Z 1J5XA 1ONOA 1VIMA 4N9QA 4A6DA 3MG9A 2ZSUA 1LVGA 1PQ4A 3OEED 1PF7E 2PRIA 3MRSA 2ZXEA 4LJSA 3NONA 3TLXA 3V9AA 4B3DA 4F0JA 4IS2A 3LP6A 2RIPA 1VL6A 4QGHA 2VLBA 4GP6A 2V7QD 2FZ5A 3VMFA 3U17A 5D51S 3QSGA 5F21A 3A3PA 5KNLA 3F49S 4NOKA 5BVHB 4DR7B 2VJKA 2A88A 5DHUA 3DDHA 4ZQCB 4JI0B 1U9CA 4YMIA 4A2CA 4D4GA 4GPZA 5BYBA 1BCSB 1SXPA 1BC5A 3OE7D 4XEUA 4C0AC 3NNSA 5GOTA 1JBKA 1TT5A 1ECBA 4HAIA 4EEXA 2ZBEA 4GR4A 4TQGA 5MF6A 2V03A 1IJBA 5DKFA 1LKZA 3ANYB 4M7PA 3ZDBA 3KQQA 3FCOA 4G3XA 2YYZA 3AUYA 2HC9A 1H6AA 1P74A 5E1DA 3RB8A 2PE5A 3DHEA 2QUAA 3N2NA 1LPSA 5DXAA 3LY5A 3RKRA 5CLQA 2G0AA 1HFEL 4EOGA 3TLZA 5LVAA 2GTIA 4HEQA 4U8HA 1ORRA 3RUCA 3WS7A 1VCMA 1YL5A 2XQKA 4KNWA 4D9HA 2XAUA 4YAKA 1G9SA 5HUHA 4DRXB 1GZSA 5E0OA 4WI1A 9LDTA 4IG9A 2FR8C 3VDMA 1EBBA 3IAEA 5IMSA 5TS3A 1MO2A 3AVVA 3KKPA 4D3SA 1YRBA 4KYVA 4UEQA 3VOAA 7REQB 1UP6A 3R7WA 3GRCA 4UDNA 3EIEA 5HF8A 4XGRA 1WHSA 1FUEA 3UWMA 1CUWA 1GIAA 4X20B 2W93A 4MWZA 2HPHA 1U3WA 4LSZA 1LD3A 5FADA 4EPXA 2ZUFA 1KJJA 1J0BA 3UY4A 2CDNA 3ODGA 4QBFA 1Y9EA 4JC0A 4ZYVA 5LD2B 5SV2A 3TLYA 4EQZA 3OMLA 1KYYA 1PEDA 4R1TA 5TGZA 4B2YA 3GLIE 1B42A 1Q1QA 3DM9B 4FYVA 4IFIA 5B2ZA 4R2WA 2BFNA 2C5HA 3CRVA 2PMKA 3L7AA 5LSAA 2JIZA 1L7BA 4YRCA 3BD8A 4I5DA 3Q88A 3COSA 5AOBA 2O06A 4DRXA 1E0AA 2O5EA 1FU4A 2X0DA 1H2AS 1IVNA 5MDHA 1EFPA 2PZFA 4DAOA 1P1IA 4MJ3A 4KX5A 3FFXA 3IUBA 3OF3A 4MROA 5PGMA 1TOAA 3TDKA 1OX6A 1UBNA 2ZSIA 4BFTA 4M6WB 5HQJA 4R5HA 1OMOA 4KTVE 5H0IA 1A4XA 1MX1A 5F5NA 1F4PA 4G9EA 1DKLA 5KC9A 1BEZA 3V2UA 4M9SA 4GSKA 3HB7A 1ZH0A 4CMAA 3EPJA 4KQCA 1K6EA 3CVYA 2IHBA 3BH0A 5GZ6A 2QLTA 5IWCA 2EXXA 3LX6A 3ZNPA 4EJ2A 1XHEA 4B31A 5L7YA 4ZYUA 3V4VB 2AV6A 1FRNA 5IDXA 3EDOA 1N0IA 5H59A 1SC4A 3ZY6A 3NUZA 1I14A 4F93B 1JA1A 5EE1A 2VWQA 4YJ3F 4QEKA 3FPKA 1X7YB 5FT9A 3E53A 2FUG6 1UXIA 4PIPA 1T8WA 3D0KA 1E7QA 5ESWA 5FNZA 5FPHA 7AT1A 5ITZB 1HEIA 2RK3A 2WKSA 4KPEC 1RMTA 2XNJA 5BOVA 4M6WA 4ZGWA 1F2UB 2X5NA 2Y2UA 2W6ID 1S8FA 2DHRA 4RFVA 1A5SB 1G5IA 1U8FO 3FHCB 1OWPA 2OORA 2VQ3A 1GARA 3AU8A 4BGEA 3FNQA 4EYGA 4A0GA 4B32A 4EO4A 2PM8A 1SBYA 2WM8A 4NDNE 4CKCA 4F12A 1BJTA 3O93A 1YI1A 1MPTA 1Y3BE 4KVZA 1FXUA 3IILA 4B3HA 4CL0A 3CZAA 4OHYA 1H2BA 1ONSA 1RHMA 1SBTA 3BCRA 4TMVA 2DQZA 3OPXA 1SEPA 3ZHTA 3K3PA 4RJTA 5KCZA 2DFLA 3WMFA 1HE1C 1EGQA 2V7TA 4MMXB 1GZVA 3WNDA 1NBIA 4NCNA 3ZIAA 1WCWA 5EMLA 3EZXA 3ZD6A 4Y0VA 1LBTA 2L82A 1OIXA 2QZ4A 1X7YA 2G07A 3PIRA 4IKEA 3T9AA 3RWBA 3FFTA 3KK0A 3UXMA 5C8YF 4V1CI 3B2NA 2V7WA 3UK2A 1J9GA 1S6YA 3V7NA 1TCCA 2EKZA 2XW6A 2CHQA 4KIJA 4NV0A 1N6KA 1RIFA 4FHFA 1P4HA 5ALHA 4UEWA 2A4MA 4NFHA 2YUTA 1DIGA 3KJZA 2EEPA 3O8OB 4QYSA 3T1VA 1QK5A 1F0YA 3QY9A 1YQTA 3GBVA 4M9CA 4NENB 4WLUA 3V3TA 2WQ7A 2P1ZA 3I53A 1VYVA 3MCAA 4ND7A 4DDTA 2TRSB 1W48A 2CLDX 1XTZA 3PRHA 5LQCA 1WL8A 4M9XA 3P1JA 1MO5A 3Q4GA 4OM8A 1G6KA 1XQYA 2KHZA 4LJYA 3EZYA 5EIOA 2MSLA 2O0LA 2YWCA 4D42A 2B78A 1ZU4A 1Z75A 3L06A 5DTRA 2WY2D 2BR4A 2E1PA 4FHCA 5G40A 4HH0A 2ZATA 4R2LA 5IM4A 5BNWA 4TGLA 5AM2A 1QGZA 4BPRA 3R3WA 2QN3A 1EJ0A 3VKFA 4DWWA 5BV8A 3RFCA 3O75A 1T26A 2GOYA 2Z04A 3F6BX 3R44A 4ZO4A 5BN5A 5CA1B 2ZULA 4WD3A 5JQGB 1T34A 2I6TA 1KZHA 1YBHA 2EJTA 1E1QD 3NALA 1P6QA 4B87A 3UPUA 1P1FA 1J2YA 1GR1A 1UQUA 3O8OA 5E2IA 1MRSA 1WNTA 1WXEA 3DLCA 4WZZA 1SVWA 2XECA 1SZCA 4OKNA 1BW9B 1Z74A 3BD6A 3I61A 2FY8A 2PH1A 1FXWF 3CT6A 1WD7A 5FPSA 5DP1A 1LVHA 2NUPB 3I23A 2BIFA 3M5WA 1TNDA 2D7CA 2PJDA 1H23A 1CRWG 2I3AA 2PR7A 2X40A 4OVKA 4P3OA 1NN1A 3NRJA 4YMGA 2JFQA 5KWEA 2GPJA 3AI1A 4YWHA 4BO0A 3SC3A 1NY5A 1NMSA 2HWXA 1C7RA 1CPYA 4PTYA 2IIVA 2QE7D 4L50A 1D4OA 3B20A 2GD1O 4GLJA 4C14A 3QG1A 5BW8A 4JC8A 1SHZA 1DAKA 5TJHA 5JQGA 1CCWA 1ICEA 2XI4A 2Z4RA 1V16B 3DTVD 1RI2A 2OP1A 3A2NA 5AH0A 4LXQA 4HLUA 5CT8A 1OX4A 5LCXA 5J2UB 1NRXA 2WUEA 2VDWA 3L04A 2GZSA 3S5UA 2DXIA 3GC6A 4F21A 4AG6A 3AOEC 3HUFA 1E64A 1DQYA 2EHJA 5FBHA 3VHXB 2OHVA 1XDGA 2PV0A 2CNNA 3KB2A 4GX1A 3IQWA 3PHGA 5DWQA 5IUKC 6REQB 2C9MA 2XXAA 3L1HA 3W6PA 3D6JA 4HWKA 2XNDD 4OMUA 4U9HS 5LU9A 2IJGX 5F1KA 5DDIP 1YR7A 1OI7A 5L3ZA 3TQIA 3KUCA 2RI0A 2RK6A 1P7WA 2D5CA 3WQBA 1JIVA 1CUFA 2YHUA 2C2KA 4DTIA 2IEBA 2Q46A 1UDWA 2QIOA 3BT7A 2ECOA 2VT3A 4ZICA 2YN0A 2ZIEA 1M72A 3P71T 2FWJA 4ID3A 3U9TA 5KKNB 2NQTA 1JJ7A 1AHPA 4RJIA 1I01A 4WFIA 1MC1A 4FHZA 5CH3A 2YR0A 1SOUA 1RZ3A 4YJ2F 2P69A 1AA6A 3KFXA 4JI3B 1ZM2A 4NDZA 3B6KA 3K2BA 3M8KA 1PZXA 2NZYA 4ZZIA 5FDFA 4ZVQA 4MV7A 1GU0A 1LK7A 3IEXA 1G5TA 3MOSA 4KO1S 1XXHA 3VHXA 1TQDA 3MJTA 5FWYA 4BKQA 3SF8B 4Q1FA 2FMHA 4DS3A 2IYQA 2TECE 2XQJA 1G18A 2FN4A 5AHKA 5DNAA 3ZYCA 1CNMA 4QATA 3V34A 5AVUA 1DINA 4E22A 4NZNA 2XZTA 3Q1LA 3VPXA 4Q4CA 3CONA 3F3YA 1KFBB 1E3DA 2L17A 4OYHA 3LBNA 2YQZA 5A7GA 4AJ4A 2J6CA 1DJNA 1I6MA 1YQ9A 1OIVA 3GA5A 4FEAA 4JJ7A 4AJJA 1N2XA 4EG8A 1SVKA 3B13B 3S27A 4BO6A 1E79D 3L01A 3HKCA 4RF3A 3TQCA 1A3CA 4EG4A 3RRFA 2C8JA 1Y81A 2PMEA 5CXXA 1B8NA 2ACWA 2PR2A 4NONA 3LT0A 3OU7A 4FQ5A 3ROGA 2IX3A 1A76A 5EP2A 1TCVA 3SS9X 3IEVA 2J6IA 1EP2B 1RRPA 2VJPA 1HDOA 4UDXX 4PS1A 2XKBA 3PQ8A 3ROFA 3TS1A 3Q6IA 3DT9A 2FCAA 3DTYA 1J8VA 4RIIA 2BFDA 4UPEA 2BM0A 5AUPB 2BSXA 3S2FA 2B6NA 3TBHA 1U3DA 5LP6C 3QOWA 1VE3A 3RODA 1OY1A 2H4ZA 1C1HA 4FDVA 4G5QA 2VHVA 4UULA 4OB8A 4N5IX 1M0EA 1PFVA 1XX6A 2PMCA 3EXHA 3GF4A 3ZD8A 2CZCA 4DTCA 3QIAA 1HYGA 4UTRA 2J9YB 4LV5B 3U7GA 1JH9A 2VHZA 1HFJA 2Z8YM 1KAOA 1MC4A 1P0PA 4MO9A 3R6GA 4BNTA 4ZEWA 4O2BB 4F9GA 1JLKA 1WB9A 3A6PC 3G0BA 2CUKA 4BC0A 4XB2A 2OILA 3QPCA 2QP9X 4UM9D 4NAUA 4OI1A 4JNCA 3IEPA 1XU4A 3NOVA 4IHAA 1FYEA 3AHDA 2JAHA 1R5JA 2ZJ3A 1XNJA 3OU6A 4EECA 3EW9A 1IEVA 1MTZA 1NBAA 3WJ7A 1XCJA 2O3JA 2FI1A 3M83A 2FSVC 2W4MA 1Z5NA 2G7ZA 2L42A 5ALSA 4PGMA 1OC2A 1LJ8A 1QP8A 2ZI4A 3WGMA 4A0HA 2A1TR 3AERB 4Q37A 2TMKA 3IPAA 4RENA 3Q3GE 2W2NA 1G7SA 2FPMA 2OBMA 3OPYI 4XI9A 2C3YA 5HIMA 3EGVA 3GUCA 3VR3D 2I2AA 4AQ7A 4Q24A 1PT7A 3ZC3A 1NJ6A 4YRLA 4BO7A 1O8BA 4EW2A 1KI3A 2QZPA 4XA8A 3TINA 2AC2A 3DKIA 1Z36A 5B7PA 2ZJYA 3UATA 4ENUA 2ZTSA 4DZRA 1GDDA 1QYDA 2OP0A 1QHSA 4UNPA 5CMLA 1GPH1 1C4WA 4CDRA 2I6QA 2YV2A 3GGJA 4YP1A 1AKEA 1EM8A 1DUIA 1ULZA 1VE9A 2WPDD 1U0GA 5F2NA 2ECQA 4N01A 4WECA 2Z6AA 1ZJZA 1QANA 3DBVO 3E8XA 4MZDA 5TT1A 3R3VA 1GSAA 2ZTUA 1TA9A 1PWHA 4IFEA 1I7SB 1NX6A 2JFNA 3OX3A 1U2TA 2FJ0A 1HL3A 3BORA 5IZ4A 4CIXA 4REMA 3SX0A 3M49A 4E07A 4AS3A 3C6BA 4BNJA 3W6UA 4M9RA 2QYOA 2BCGY 2Q5EA 3GDFA 5E9AA 3E9CA 3RI3A 5FTLA 3AFIA 4EELA 1JW9B 3SXUB 3LZDA 3X1ZA 3A6JA 4R2MA 2XTZA 2CNDA 3VZDA 3E5MA 3ZUGA 5I45A 1JEJA 4EATA 1PTKA 1W9HA 3BWMA 4E5NA 4EVQA 4OQPA 3NT2A 1GUYA 1E2NA 4EZBA 3K6SB 1AQNA 4RZ2A 1FDRA 1NG9A 2WOOA 3EMVA 3JWGA 4DMUB 3AVPA 3B1FA 4LF7B 4PHTA 4INPA 4AY2A 4TKLA 1YASA 1SQGA 3UW3A 5IXJA 3JYQA 1XYYA 4G1UC 1Z8HA 1ZZEA 3VR2A 3ZZ1A 1H8EA 3OQJA 4FI3C 3BHJA 3OZUA 1NUSA 2RHGB 4YJKA 4YXFA 5KPJA 4KJXA 2SBTA 3D6NB 1XFAA 1FU7A 3RSCA 1Z13A 1AN0A 1HDXA 2H2WA 3ZD7A 1CULC 1S2OA 3CEJA 1RXSA 1ZNZA 4EKGA 2NU6A 4CCSA 3DFFA 4JMLA 2EF1A 5IH3A 3A70A 4U7WA 1GTMA 13PKA 4PC3A 3EW7A 4FYYA 2QLJA 1BXGB 1VL2A 3DUFA 4KWTA 3WIDA 3WWPA 4MUNA 1SBNE 3L41A 1FX0B 3QXGA 2WFMA