3JUKA

The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
265
Chain Sequence
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTSYTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIGNEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEEGVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKRKRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose pyrophosphorylase (GalU)
publication title Structural basis for the reaction mechanism of UDP-glucose pyrophosphorylase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 85
structure length 265
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.9: UTP--glucose-1-phosphate uridylyltransferase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3jukA00
5FTSA 5C1LA 2RITA 2OI6A 3USRA 1H5SB 1OMZA 3I0DA 5EJZA 4Y62A 1ZJPA 4AYLA 5IDSA 1O7OA 2APCA 2E8BA 2RJ6A 1VH3A 2WEEA 4KC4A 2VSIA 5CQMX 2YC3A 2OEGA 1ZJ0A 5CMHA 3U2XA 1H5SC 1G93A 1LL0A 1WSZA 5C48A 1R7TA 1ZJOA 2WE9A 3I0EA 3I0JA 4Y6NA 4CJ8A 3I0FA 1NQIB 2CU2A 1EYRA 2JCOA 4AAWA 4UEGA 5C38A 2RJ9A 4KT7A 3PNNA 2A8WA 2Y4LA 1NF5B 1O0RA 5C1HA 2RJ5A 4FRMA 1HM8A 2VXMA 1E5KA 1PZTA 1H5TB 1WT2A 1XZ6A 2O1GA 4FRQA 3O3PA 4D11A 2I5EA 4KPXA 1JVGA 3SXEA 2Y6PA 3RMWA 4EEOA 5FV9A 2X5SA 4FRBA 1LZJA 2UX8A 4Y64A 2JCKA 1FR9A 3ZLKA 3HL3A 5FU8A 4B4GA 1Z90A 1H7HA 1ZIZA 5C4BA 4ARWA 1R82A 5C8RA 4KC2A 3I0KA 3ST8A 1VPAA 1FXOA 3DJ4A 2FYDB 3I0GA 2BO4A 1LL3A 4FCEA 1ZI3A 1H4DA 2O1HA 3K8EA 1ZJ1A 5C1GA 3OGZA 3OH0A 4NANA 2X60A 1S4NA 2XWNA 3CGXA 4HO0A 3SXGA 2O1FA 3V0OA 2D7IA 1QGSA 2V0HA 4GBPA 4BMAA 2AE7A 1HV9A 4DDZA 1H5SD 1XHBA 4Y9XA 3R2WA 1R81A 4FQWA 4EVWA 4FRDA 2ZU8A 4CVHA 2AM3A 2VSHA 1NKHB 1JYKA 1JV3A 1JV1A 3V0PA 1WT1A 4NAIA 2WVKA 4JD0A 4R7PA 1H3MA 1G0RA 2I5KA 4K6RA 4B2XA 3PKPA 1H7TA 2D0JA 2ZU9A 1V84A 1GWWA 1H7FA 2FFUA 2W0WA 3OH2A 3V91A 2VXLA 4KXOA 5J49A 1GX4A 1TW5A 4NALA 2ICYA 3OC9A 2AESA 4B3UA 4ECMA 1ZJ2A 4HO6A 3U2VA 2FY7A 2I7BA 3Q4SA 3ZGGA 1WT3A 2X65A 2YQCA 2FYBA 1H7EA 1FR8A 1VZUA 1WVCA 1H7QA 3CKOA 2YQJA 1WT0A 1JVDA 1ZI5A 3V90A 2VS4A 4D11C 1K4VA 2RJ1A 4NAKA 1TW1A 3U0YA 3T7MA 3T7NA 3CKJA 4MYBA 5DDTA 4Y6UA 4FRHA 4G3PA 5FUHA 2V0IA 3U2UA 1NHEB 3ZF8A 5CMGX 4KNXA 2VS5A 1LL2A 3E25A 2Y4MA 5I1FA 4Y7TA 5C4FA 3IOHA 1LZ7A 4EE5A 2ZU7A 1OQMB 4LW3A 1W57A 5C3AA 1S4PA 1GWVA 1S4OA 4Y7GA 2P72A 3K8DA 5FTVA 3KIAA 4HG6A 2AECA 2BO7A 2FYAA 3FWWA 3N9WA 1HJLA 4B42A 3U2WA 2BO6A 1ZI4A 4AYJA 1H5RA 2PGVA 4ZDQA 2X5ZA 3CKNA 1G23A 3I0HA 4KNRA 5CQLX 4D0TA 2PX7A 2MZBA 2WGZA 1R7XA 4B4MA 5JQQA 3POLA 2V0KA 3V0NA 1SS9A 3R3IA 5C36A 2WVLA 3SX3A 2XWMA 1G8OA 1GQCA 3EE5A 2WAWA 1ZCYA 1QGQA 4YS8A 4FREA 4HO4A 4M2BA 3SXAA 2W0VA 5EJ1A 4HCQA 4KC1A 5EIYA 1ON6A 1ZDGA 4L41C 2Z87A 2YQHA 4AC3A 2RIZA 5C3BA 4CJCA 2JCLA 3PKQA 2E3DA 3CKVA 2QGIA 3U0XA 2QKXA 2YC5A 4BQHA 3NGWA 1R7YA 1FZWA 2DPWA 4P02A 1G9RA 4XWIA 4M2AA 4EE3A 1O23B 3V0LA 4HOCA 5CQPA 2OI7A 5L6SA 2OEFA 1QWJA 2AM5A 4D48A 1G3LA 1VGTA 4B4BA 1ON8A 4P00A 1VGWA 5L6VA 3ZGFA 4EEMA 5CMIA 3RMVA 1W77A 3BRKX 3F1YA 4Y63A 2PA4A 3U2TA 1G2VA 2D7RA 2Y4JA 1VICA 3SX8A 3I0IX 1VZXA 1ZCVA 2YESA 3BCVA 2JCJA 2VFZA 1FG5N 4FRAA 4DE7A 1V82A 5CMJA 4Y7VA 1H7GA 1R80A 1ZHJA 4KPZA 2RIXA 2V0LA 2FFVA 1YP3A 2BO8A 4M28A 4HO8A 1R7VA 1TVYA 1IINA 4KRVA 4CJBA 3QVBA 4Y7UA 3SX7A 3D5NA 4J18A 1FO8A 3DUVA 1ZI1A 4ASJA 1ZCUA 1FGXA 2RJ0A 1O7QA 2GGOA 3IOJA 2YCMA 4C2SA 1YROB 3SXBA 5CMFX 2ICXA 5CQNX 5AJOA 5DDVA 3SXDA 1I52A 3I0CA 2V0JA 2Q4JA 2Y4KA 1HM9A 1MP3A 1YP4A 2XMEA 1MC3A 2NXVA 3SXCA 2AH9A 4G3SA 4FCUA 2P6WA 4DECA 5C49A 1H4CA 4LW6A 2OI5A 1INJA 2WVMA 3GUEA 1YP2A 1EZIA 1TZFA 4HO2A 1LZ0A 1LVWA 3T7OA 1QG8A 3DK5A 1PZYB 4FRPA 2RJ8A 5IDTA 3OH1A 3SPTA 1FGGA 1FO9A 2AM4A 2PGYA 3FOQA 1FWYA 1VGZA 3JUKA 3OH3A 1R7UA 4HO9A 3Q80A 2VD4A 4G87A 1KWSA 1VZTA 3OKRA 3V8YA 3OAMA 3V0QA 1INIA 1G95A 1VGUA 4HO3A 4IRQA 3I0LA 4E1KA 3JUJA 3ZLLA 2P73A 3TQDA 3OH4A 2XWLA 1JYLA 1H7LA 5C47A 4IRPA 1V83A 2FYCB 1GQ9A 1LZIA 3LW6A 4FROA 1G97A 1VM8A 5FYEA 1FOAA 3USQA 1H5SA 4EEAA 1G1LA 4MNDA 4HO5A 2A8UA 2GGQA 1MP4A 2RJ7A 3JTJA 4FRLA 3SX5A 1GX0A 1ZJ3A 4M4KA 5HS2A 5C3DA 1OMXA 4G3QA 5AJPA 5AJNA 4B2WA 3V0MA 4Y7FA 3TZTA 5C4CA 2Z86A 4JISA 1HJJA 1H4EA 1NMMB 3D98A 1W55A 1FRWA 1ZDFA 3IOIA 3Q7UA 5IFYA 1H5RB 5C4DA 4ASYA 1HM0A 1H5TA 2AGDA 2RIYA 3CU0A 5FU0A 1ZCTA 2VS3A 4EE4A 3E26A 1VH1A 3CKQA 4EEGA 2YQSA 5CQOA 4KQLA 1NWGB 3V8ZA 3D8VA 2QH5A 4B5BA 2XMHA 1IIMA 2RJ4A 1MP5A 5BXCA 3F1CA 2Y7AA 4D0ZA 1FXJA 1GA8A 3RSBA 5C4EA
chains in the Genus database with same CATH superfamily
5FTSA 5C1LA 2RITA 2C0NA 2OI6A 3USRA 1H5SB 1OMZA 3I0DA 5EJZA 4Y62A 1ZJPA 4AYLA 5IDSA 1O7OA 2APCA 2E8BA 2RJ6A 1VH3A 2WEEA 4KC4A 2VSIA 5CQMX 2YC3A 2OEGA 1ZJ0A 5CMHA 3U2XA 1H5SC 1G93A 1LL0A 1WSZA 5C48A 1R7TA 1ZJOA 2WE9A 3I0EA 3I0JA 4Y6NA 4CJ8A 3I0FA 1NQIB 2CU2A 1EYRA 2JCOA 4AAWA 4UEGA 5C38A 2RJ9A 4KT7A 3PNNA 2A8WA 2Y4LA 1NF5B 1O0RA 5C1HA 2RJ5A 4FRMA 1HM8A 2VXMA 1E5KA 1PZTA 1H5TB 1WT2A 1XZ6A 2O1GA 4FRQA 3O3PA 4D11A 2I5EA 4KPXA 1JVGA 3SXEA 2Y6PA 3RMWA 4EEOA 5FV9A 2X5SA 4FRBA 2VK9A 1LZJA 2UX8A 4Y64A 2JCKA 1FR9A 3ZLKA 3HL3A 5FU8A 4B4GA 1Z90A 1H7HA 1ZIZA 5C4BA 4ARWA 1R82A 5C8RA 4KC2A 3I0KA 3ST8A 1VPAA 1FXOA 3DJ4A 2FYDB 3I0GA 2BO4A 1LL3A 4FCEA 1ZI3A 1H4DA 2O1HA 3K8EA 1ZJ1A 5C1GA 3OGZA 3OH0A 4NANA 2X60A 1S4NA 2XWNA 3CGXA 4HO0A 3SXGA 2O1FA 3V0OA 2D7IA 1QGSA 2V0HA 4GBPA 4BMAA 2AE7A 4MIXA 1HV9A 4DDZA 1H5SD 1XHBA 4Y9XA 3R2WA 1R81A 4FQWA 4EVWA 4FRDA 2ZU8A 4CVHA 2AM3A 2VSHA 1NKHB 1JYKA 1JV3A 1JV1A 3V0PA 1WT1A 4NAIA 2WVKA 4JD0A 4R7PA 1H3MA 1G0RA 2I5KA 4K6RA 4B2XA 3PKPA 1H7TA 2D0JA 2ZU9A 1V84A 1GWWA 1H7FA 2FFUA 2W0WA 3OH2A 3V91A 2VXLA 4KXOA 5J49A 1GX4A 1TW5A 4NALA 2ICYA 3OC9A 2AESA 4B3UA 4ECMA 1ZJ2A 4HO6A 5D92A 3U2VA 2FY7A 2I7BA 3Q4SA 3ZGGA 1WT3A 2X65A 2YQCA 2FYBA 1H7EA 1FR8A 1VZUA 1WVCA 1H7QA 3CKOA 2YQJA 1WT0A 1JVDA 1ZI5A 3V90A 2VS4A 4D11C 1K4VA 2RJ1A 4NAKA 1TW1A 3U0YA 3T7MA 3T7NA 3CKJA 4MYBA 5DDTA 4Y6UA 4FRHA 4G3PA 5FUHA 2V0IA 3U2UA 1NHEB 3ZF8A 5CMGX 4KNXA 2VS5A 1LL2A 3E25A 2Y4MA 5I1FA 4Y7TA 5C4FA 3IOHA 1LZ7A 4EE5A 2ZU7A 1OQMB 4LW3A 1W57A 5C3AA 1S4PA 1GWVA 1S4OA 4Y7GA 2P72A 3K8DA 5FTVA 3KIAA 4HG6A 2AECA 2BO7A 2FYAA 3FWWA 3N9WA 1HJLA 4O6NA 4B42A 3U2WA 2BO6A 1ZI4A 4AYJA 1H5RA 2PGVA 4ZDQA 2X5ZA 3CKNA 1G23A 3I0HA 4KNRA 5CQLX 4D0TA 2PX7A 2MZBA 2WGZA 1R7XA 4B4MA 5JQQA 3POLA 2V0KA 3V0NA 1SS9A 3R3IA 5C36A 2WVLA 3SX3A 2XWMA 1G8OA 1GQCA 3EE5A 2WAWA 1ZCYA 1QGQA 4YS8A 4FREA 4HO4A 4M2BA 3SXAA 2W0VA 5EJ1A 4HCQA 4KC1A 5EIYA 1ON6A 1ZDGA 4L41C 2Z87A 2YQHA 4AC3A 2RIZA 5C3BA 4CJCA 2JCLA 3PKQA 2E3DA 3CKVA 2QGIA 3U0XA 2QKXA 2YC5A 4BQHA 3NGWA 1R7YA 1FZWA 2DPWA 4P02A 1G9RA 4XWIA 4M2AA 4FIXA 4EE3A 1O23B 3V0LA 4HOCA 5CQPA 2OI7A 5L6SA 2OEFA 1QWJA 2AM5A 4D48A 1G3LA 1VGTA 4B4BA 1ON8A 4P00A 1VGWA 5L6VA 3ZGFA 4EEMA 5CMIA 3RMVA 1W77A 3BRKX 3F1YA 4Y63A 2PA4A 3U2TA 1G2VA 2D7RA 2Y4JA 1VICA 3SX8A 3I0IX 1VZXA 1ZCVA 2YESA 3BCVA 2JCJA 2VFZA 1FG5N 4FRAA 4DE7A 1V82A 5CMJA 4Q7CA 4Y7VA 1H7GA 1R80A 1ZHJA 4KPZA 2RIXA 2V0LA 2FFVA 1YP3A 2BO8A 4M28A 4HO8A 1R7VA 1TVYA 1IINA 4KRVA 4CJBA 3QVBA 4Y7UA 3SX7A 3D5NA 4J18A 1FO8A 3DUVA 1ZI1A 4ASJA 1ZCUA 1FGXA 2RJ0A 1O7QA 2GGOA 3IOJA 2YCMA 4C2SA 1YROB 3SXBA 5CMFX 5D91A 2ICXA 5CQNX 5AJOA 5DDVA 3SXDA 1I52A 3I0CA 2V0JA 2Q4JA 2Y4KA 1HM9A 1MP3A 1YP4A 2XMEA 1MC3A 2NXVA 3SXCA 2AH9A 4G3SA 4FCUA 2P6WA 4DECA 2J0AA 5C49A 1H4CA 4LW6A 2OI5A 1INJA 2WVMA 3GUEA 1YP2A 1EZIA 1TZFA 4HO2A 1LZ0A 1LVWA 3T7OA 1QG8A 3DK5A 1PZYB 4FRPA 2RJ8A 5IDTA 3OH1A 3SPTA 1FGGA 1FO9A 2AM4A 2PGYA 3FOQA 1FWYA 1VGZA 3JUKA 3OH3A 1R7UA 4HO9A 3Q80A 2VD4A 4G87A 1KWSA 1VZTA 3OKRA 3V8YA 3OAMA 3V0QA 1INIA 1G95A 1VGUA 4HO3A 4IRQA 3I0LA 4E1KA 3JUJA 3ZLLA 2P73A 3TQDA 3OH4A 2XWLA 1JYLA 1H7LA 5C47A 4IRPA 1V83A 2FYCB 1GQ9A 1LZIA 3LW6A 4FROA 1G97A 1VM8A 5FYEA 1FOAA 3USQA 1H5SA 4EEAA 1G1LA 4MNDA 2J0BA 4HO5A 2A8UA 2GGQA 1MP4A 2RJ7A 3JTJA 4FRLA 3SX5A 1GX0A 1ZJ3A 4M4KA 5HS2A 5C3DA 1OMXA 4G3QA 4FIYA 5AJPA 5AJNA 4B2WA 3V0MA 4Y7FA 3TZTA 5C4CA 2Z86A 4JISA 1HJJA 1H4EA 1NMMB 3D98A 1W55A 1FRWA 1ZDFA 3IOIA 3Q7UA 5IFYA 1H5RB 5C4DA 4O6MA 4ASYA 1HM0A 1H5TA 2AGDA 2RIYA 3CU0A 5FU0A 1ZCTA 2VS3A 4EE4A 3E26A 1VH1A 3CKQA 4EEGA 2YQSA 5CQOA 4KQLA 1NWGB 3V8ZA 3D8VA 2QH5A 4B5BA 2XMHA 1IIMA 2RJ4A 1MP5A 5BXCA 3F1CA 2Y7AA 4D0ZA 1FXJA 1GA8A 3RSBA 5C4EA
chains in the Genus database with same CATH topology
5FTSA 5C1LA 2RITA 2C0NA 2OI6A 3USRA 1H5SB 1OMZA 3I0DA 5EJZA 4Y62A 1ZJPA 4AYLA 5IDSA 1O7OA 2APCA 2E8BA 2RJ6A 1VH3A 2WEEA 4KC4A 2VSIA 5CQMX 2YC3A 2OEGA 1ZJ0A 5CMHA 3U2XA 1H5SC 1G93A 1LL0A 1WSZA 5C48A 1R7TA 1ZJOA 2WE9A 3I0EA 3I0JA 4Y6NA 4CJ8A 3I0FA 1NQIB 2CU2A 1EYRA 2JCOA 4AAWA 4UEGA 5C38A 2RJ9A 4KT7A 3PNNA 2A8WA 2Y4LA 1NF5B 1O0RA 5C1HA 2RJ5A 4FRMA 1HM8A 2VXMA 1E5KA 1PZTA 1H5TB 1WT2A 1XZ6A 2O1GA 4FRQA 3O3PA 4D11A 2I5EA 4KPXA 1JVGA 3SXEA 2Y6PA 3RMWA 4EEOA 5FV9A 2X5SA 4FRBA 2VK9A 1LZJA 2UX8A 4Y64A 2JCKA 1FR9A 3ZLKA 3HL3A 5FU8A 4B4GA 1Z90A 1H7HA 1ZIZA 5C4BA 4ARWA 1R82A 5C8RA 4KC2A 3I0KA 3ST8A 1VPAA 1FXOA 3DJ4A 2FYDB 3I0GA 2BO4A 1LL3A 4FCEA 1ZI3A 1H4DA 2O1HA 3K8EA 1ZJ1A 5C1GA 3OGZA 3OH0A 4NANA 2X60A 1S4NA 2XWNA 3CGXA 4HO0A 3SXGA 2O1FA 3V0OA 2D7IA 1QGSA 2V0HA 4GBPA 4BMAA 2AE7A 4MIXA 1HV9A 4DDZA 1H5SD 1XHBA 4Y9XA 3R2WA 1R81A 4FQWA 4EVWA 4FRDA 2ZU8A 4CVHA 2AM3A 2VSHA 1NKHB 1JYKA 1JV3A 1JV1A 3V0PA 1WT1A 4NAIA 2WVKA 4JD0A 4R7PA 1H3MA 1G0RA 2I5KA 4K6RA 4B2XA 3PKPA 1H7TA 2D0JA 2ZU9A 1V84A 1GWWA 1H7FA 2FFUA 2W0WA 3OH2A 3V91A 2VXLA 4KXOA 5J49A 1GX4A 1TW5A 4NALA 2ICYA 3OC9A 2AESA 4B3UA 4ECMA 1ZJ2A 4HO6A 5D92A 3U2VA 2FY7A 2I7BA 3Q4SA 3ZGGA 1WT3A 2X65A 2YQCA 2FYBA 1H7EA 1FR8A 1VZUA 1WVCA 1H7QA 3CKOA 2YQJA 1WT0A 1JVDA 1ZI5A 3V90A 2VS4A 4D11C 1K4VA 2RJ1A 4NAKA 1TW1A 3U0YA 3T7MA 3T7NA 3CKJA 4MYBA 5DDTA 4Y6UA 4FRHA 4G3PA 5FUHA 2V0IA 3U2UA 1NHEB 3ZF8A 5CMGX 4KNXA 2VS5A 1LL2A 3E25A 2Y4MA 5I1FA 4Y7TA 5C4FA 3IOHA 1LZ7A 4EE5A 2ZU7A 1OQMB 4LW3A 1W57A 5C3AA 1S4PA 1GWVA 1S4OA 4Y7GA 2P72A 3K8DA 5FTVA 3KIAA 4HG6A 2AECA 2BO7A 2FYAA 3FWWA 3N9WA 1HJLA 4O6NA 4B42A 3U2WA 2BO6A 1ZI4A 4AYJA 1H5RA 2PGVA 4ZDQA 2X5ZA 3CKNA 1G23A 3I0HA 4KNRA 5CQLX 4D0TA 2PX7A 2MZBA 2WGZA 1R7XA 4B4MA 5JQQA 3POLA 2V0KA 3V0NA 1SS9A 3R3IA 5C36A 2WVLA 3SX3A 2XWMA 1G8OA 1GQCA 3EE5A 2WAWA 1ZCYA 1QGQA 4YS8A 4FREA 4HO4A 4M2BA 3SXAA 2W0VA 5EJ1A 4HCQA 4KC1A 5EIYA 1ON6A 1ZDGA 4L41C 2Z87A 2YQHA 4AC3A 2RIZA 5C3BA 4CJCA 2JCLA 3PKQA 2E3DA 3CKVA 2QGIA 3U0XA 2QKXA 2YC5A 4BQHA 3NGWA 1R7YA 1FZWA 2DPWA 4P02A 1G9RA 4XWIA 4M2AA 4FIXA 4EE3A 1O23B 3V0LA 4HOCA 5CQPA 2OI7A 5L6SA 2OEFA 1QWJA 2AM5A 4D48A 1G3LA 1VGTA 4B4BA 1ON8A 4P00A 1VGWA 5L6VA 3ZGFA 4EEMA 5CMIA 3RMVA 1W77A 3BRKX 3F1YA 4Y63A 2PA4A 3U2TA 1G2VA 2D7RA 2Y4JA 1VICA 3SX8A 3I0IX 1VZXA 1ZCVA 2YESA 3BCVA 2JCJA 2VFZA 1FG5N 4FRAA 4DE7A 1V82A 5CMJA 4Q7CA 4Y7VA 1H7GA 1R80A 1ZHJA 4KPZA 2RIXA 2V0LA 2FFVA 1YP3A 2BO8A 4M28A 4HO8A 1R7VA 1TVYA 1IINA 4KRVA 4CJBA 3QVBA 4Y7UA 3SX7A 3D5NA 4J18A 1FO8A 3DUVA 1ZI1A 4ASJA 1ZCUA 1FGXA 2RJ0A 1O7QA 2GGOA 3IOJA 2YCMA 4C2SA 1YROB 3SXBA 5CMFX 5D91A 2ICXA 5CQNX 5AJOA 5DDVA 3SXDA 1I52A 3I0CA 2V0JA 2Q4JA 2Y4KA 1HM9A 1MP3A 1YP4A 2XMEA 1MC3A 2NXVA 3SXCA 2AH9A 4G3SA 4FCUA 2P6WA 4DECA 2J0AA 5C49A 1H4CA 4LW6A 2OI5A 1INJA 2WVMA 3GUEA 1YP2A 1EZIA 1TZFA 4HO2A 1LZ0A 1LVWA 3T7OA 1QG8A 3DK5A 1PZYB 4FRPA 2RJ8A 5IDTA 3OH1A 3SPTA 1FGGA 1FO9A 2AM4A 2PGYA 3FOQA 1FWYA 1VGZA 3JUKA 3OH3A 1R7UA 4HO9A 3Q80A 2VD4A 4G87A 1KWSA 1VZTA 3OKRA 3V8YA 3OAMA 3V0QA 1INIA 1G95A 1VGUA 4HO3A 4IRQA 3I0LA 4E1KA 3JUJA 3ZLLA 2P73A 3TQDA 3OH4A 2XWLA 1JYLA 1H7LA 5C47A 4IRPA 1V83A 2FYCB 1GQ9A 1LZIA 3LW6A 4FROA 1G97A 1VM8A 5FYEA 1FOAA 3USQA 1H5SA 4EEAA 1G1LA 4MNDA 2J0BA 4HO5A 2A8UA 2GGQA 1MP4A 2RJ7A 3JTJA 4FRLA 3SX5A 1GX0A 1ZJ3A 4M4KA 5HS2A 5C3DA 1OMXA 4G3QA 4FIYA 5AJPA 5AJNA 4B2WA 3V0MA 4Y7FA 3TZTA 5C4CA 2Z86A 4JISA 1HJJA 1H4EA 1NMMB 3D98A 1W55A 1FRWA 1ZDFA 3IOIA 3Q7UA 5IFYA 1H5RB 5C4DA 4O6MA 4ASYA 1HM0A 1H5TA 2AGDA 2RIYA 3CU0A 5FU0A 1ZCTA 2VS3A 4EE4A 3E26A 1VH1A 3CKQA 4EEGA 2YQSA 5CQOA 4KQLA 1NWGB 3V8ZA 3D8VA 2QH5A 4B5BA 2XMHA 1IIMA 2RJ4A 1MP5A 5BXCA 3F1CA 2Y7AA 4D0ZA 1FXJA 1GA8A 3RSBA 5C4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTS A;  5C1L A;  2RIT A;  2OI6 A;  3USR A;  1H5S B;  1OMZ A;  3I0D A;  5EJZ A;  4Y62 A;  1ZJP A;  4AYL A;  5IDS A;  1O7O A;  2APC A;  2E8B A;  2RJ6 A;  1VH3 A;  2WEE A;  4KC4 A;  2VSI A;  5CQM X;  2YC3 A;  2OEG A;  1ZJ0 A;  5CMH A;  3U2X A;  1H5S C;  1G93 A;  1LL0 A;  1WSZ A;  5C48 A;  1R7T A;  1ZJO A;  2WE9 A;  3I0E A;  3I0J A;  4Y6N A;  4CJ8 A;  3I0F A;  1NQI B;  2CU2 A;  1EYR A;  2JCO A;  4AAW A;  4UEG A;  5C38 A;  2RJ9 A;  4KT7 A;  3PNN A;  2A8W A;  2Y4L A;  1NF5 B;  1O0R A;  5C1H A;  2RJ5 A;  4FRM A;  1HM8 A;  2VXM A;  1E5K A;  1PZT A;  1H5T B;  1WT2 A;  1XZ6 A;  2O1G A;  4FRQ A;  3O3P A;  4D11 A;  2I5E A;  4KPX A;  1JVG A;  3SXE A;  2Y6P A;  3RMW A;  4EEO A;  5FV9 A;  2X5S A;  4FRB A;  1LZJ A;  2UX8 A;  4Y64 A;  2JCK A;  1FR9 A;  3ZLK A;  3HL3 A;  5FU8 A;  4B4G A;  1Z90 A;  1H7H A;  1ZIZ A;  5C4B A;  4ARW A;  1R82 A;  5C8R A;  4KC2 A;  3I0K A;  3ST8 A;  1VPA A;  1FXO A;  3DJ4 A;  2FYD B;  3I0G A;  2BO4 A;  1LL3 A;  4FCE A;  1ZI3 A;  1H4D A;  2O1H A;  3K8E A;  1ZJ1 A;  5C1G A;  3OGZ A;  3OH0 A;  4NAN A;  2X60 A;  1S4N A;  2XWN A;  3CGX A;  4HO0 A;  3SXG A;  2O1F A;  3V0O A;  2D7I A;  1QGS A;  2V0H A;  4GBP A;  4BMA A;  2AE7 A;  1HV9 A;  4DDZ A;  1H5S D;  1XHB A;  4Y9X A;  3R2W A;  1R81 A;  4FQW A;  4EVW A;  4FRD A;  2ZU8 A;  4CVH A;  2AM3 A;  2VSH A;  1NKH B;  1JYK A;  1JV3 A;  1JV1 A;  3V0P A;  1WT1 A;  4NAI A;  2WVK A;  4JD0 A;  4R7P A;  1H3M A;  1G0R A;  2I5K A;  4K6R A;  4B2X A;  3PKP A;  1H7T A;  2D0J A;  2ZU9 A;  1V84 A;  1GWW A;  1H7F A;  2FFU A;  2W0W A;  3OH2 A;  3V91 A;  2VXL A;  4KXO A;  5J49 A;  1GX4 A;  1TW5 A;  4NAL A;  2ICY A;  3OC9 A;  2AES A;  4B3U A;  4ECM A;  1ZJ2 A;  4HO6 A;  3U2V A;  2FY7 A;  2I7B A;  3Q4S A;  3ZGG A;  1WT3 A;  2X65 A;  2YQC A;  2FYB A;  1H7E A;  1FR8 A;  1VZU A;  1WVC A;  1H7Q A;  3CKO A;  2YQJ A;  1WT0 A;  1JVD A;  1ZI5 A;  3V90 A;  2VS4 A;  4D11 C;  1K4V A;  2RJ1 A;  4NAK A;  1TW1 A;  3U0Y A;  3T7M A;  3T7N A;  3CKJ A;  4MYB A;  5DDT A;  4Y6U A;  4FRH A;  4G3P A;  5FUH A;  2V0I A;  3U2U A;  1NHE B;  3ZF8 A;  5CMG X;  4KNX A;  2VS5 A;  1LL2 A;  3E25 A;  2Y4M A;  5I1F A;  4Y7T A;  5C4F A;  3IOH A;  1LZ7 A;  4EE5 A;  2ZU7 A;  1OQM B;  4LW3 A;  1W57 A;  5C3A A;  1S4P A;  1GWV A;  1S4O A;  4Y7G A;  2P72 A;  3K8D A;  5FTV A;  3KIA A;  4HG6 A;  2AEC A;  2BO7 A;  2FYA A;  3FWW A;  3N9W A;  1HJL A;  4B42 A;  3U2W A;  2BO6 A;  1ZI4 A;  4AYJ A;  1H5R A;  2PGV A;  4ZDQ A;  2X5Z A;  3CKN A;  1G23 A;  3I0H A;  4KNR A;  5CQL X;  4D0T A;  2PX7 A;  2MZB A;  2WGZ A;  1R7X A;  4B4M A;  5JQQ A;  3POL A;  2V0K A;  3V0N A;  1SS9 A;  3R3I A;  5C36 A;  2WVL A;  3SX3 A;  2XWM A;  1G8O A;  1GQC A;  3EE5 A;  2WAW A;  1ZCY A;  1QGQ A;  4YS8 A;  4FRE A;  4HO4 A;  4M2B A;  3SXA A;  2W0V A;  5EJ1 A;  4HCQ A;  4KC1 A;  5EIY A;  1ON6 A;  1ZDG A;  4L41 C;  2Z87 A;  2YQH A;  4AC3 A;  2RIZ A;  5C3B A;  4CJC A;  2JCL A;  3PKQ A;  2E3D A;  3CKV A;  2QGI A;  3U0X A;  2QKX A;  2YC5 A;  4BQH A;  3NGW A;  1R7Y A;  1FZW A;  2DPW A;  4P02 A;  1G9R A;  4XWI A;  4M2A A;  4EE3 A;  1O23 B;  3V0L A;  4HOC A;  5CQP A;  2OI7 A;  5L6S A;  2OEF A;  1QWJ A;  2AM5 A;  4D48 A;  1G3L A;  1VGT A;  4B4B A;  1ON8 A;  4P00 A;  1VGW A;  5L6V A;  3ZGF A;  4EEM A;  5CMI A;  3RMV A;  1W77 A;  3BRK X;  3F1Y A;  4Y63 A;  2PA4 A;  3U2T A;  1G2V A;  2D7R A;  2Y4J A;  1VIC A;  3SX8 A;  3I0I X;  1VZX A;  1ZCV A;  2YES A;  3BCV A;  2JCJ A;  2VFZ A;  1FG5 N;  4FRA A;  4DE7 A;  1V82 A;  5CMJ A;  4Y7V A;  1H7G A;  1R80 A;  1ZHJ A;  4KPZ A;  2RIX A;  2V0L A;  2FFV A;  1YP3 A;  2BO8 A;  4M28 A;  4HO8 A;  1R7V A;  1TVY A;  1IIN A;  4KRV A;  4CJB A;  3QVB A;  4Y7U A;  3SX7 A;  3D5N A;  4J18 A;  1FO8 A;  3DUV A;  1ZI1 A;  4ASJ A;  1ZCU A;  1FGX A;  2RJ0 A;  1O7Q A;  2GGO A;  3IOJ A;  2YCM A;  4C2S A;  1YRO B;  3SXB A;  5CMF X;  2ICX A;  5CQN X;  5AJO A;  5DDV A;  3SXD A;  1I52 A;  3I0C A;  2V0J A;  2Q4J A;  2Y4K A;  1HM9 A;  1MP3 A;  1YP4 A;  2XME A;  1MC3 A;  2NXV A;  3SXC A;  2AH9 A;  4G3S A;  4FCU A;  2P6W A;  4DEC A;  5C49 A;  1H4C A;  4LW6 A;  2OI5 A;  1INJ A;  2WVM A;  3GUE A;  1YP2 A;  1EZI A;  1TZF A;  4HO2 A;  1LZ0 A;  1LVW A;  3T7O A;  1QG8 A;  3DK5 A;  1PZY B;  4FRP A;  2RJ8 A;  5IDT A;  3OH1 A;  3SPT A;  1FGG A;  1FO9 A;  2AM4 A;  2PGY A;  3FOQ A;  1FWY A;  1VGZ A;  3JUK A;  3OH3 A;  1R7U A;  4HO9 A;  3Q80 A;  2VD4 A;  4G87 A;  1KWS A;  1VZT A;  3OKR A;  3V8Y A;  3OAM A;  3V0Q A;  1INI A;  1G95 A;  1VGU A;  4HO3 A;  4IRQ A;  3I0L A;  4E1K A;  3JUJ A;  3ZLL A;  2P73 A;  3TQD A;  3OH4 A;  2XWL A;  1JYL A;  1H7L A;  5C47 A;  4IRP A;  1V83 A;  2FYC B;  1GQ9 A;  1LZI A;  3LW6 A;  4FRO A;  1G97 A;  1VM8 A;  5FYE A;  1FOA A;  3USQ A;  1H5S A;  4EEA A;  1G1L A;  4MND A;  4HO5 A;  2A8U A;  2GGQ A;  1MP4 A;  2RJ7 A;  3JTJ A;  4FRL A;  3SX5 A;  1GX0 A;  1ZJ3 A;  4M4K A;  5HS2 A;  5C3D A;  1OMX A;  4G3Q A;  5AJP A;  5AJN A;  4B2W A;  3V0M A;  4Y7F A;  3TZT A;  5C4C A;  2Z86 A;  4JIS A;  1HJJ A;  1H4E A;  1NMM B;  3D98 A;  1W55 A;  1FRW A;  1ZDF A;  3IOI A;  3Q7U A;  5IFY A;  1H5R B;  5C4D A;  4ASY A;  1HM0 A;  1H5T A;  2AGD A;  2RIY A;  3CU0 A;  5FU0 A;  1ZCT A;  2VS3 A;  4EE4 A;  3E26 A;  1VH1 A;  3CKQ A;  4EEG A;  2YQS A;  5CQO A;  4KQL A;  1NWG B;  3V8Z A;  3D8V A;  2QH5 A;  4B5B A;  2XMH A;  1IIM A;  2RJ4 A;  1MP5 A;  5BXC A;  3F1C A;  2Y7A A;  4D0Z A;  1FXJ A;  1GA8 A;  3RSB A;  5C4E A; 
#chains in the Genus database with same CATH topology
 5FTS A;  5C1L A;  2RIT A;  2C0N A;  2OI6 A;  3USR A;  1H5S B;  1OMZ A;  3I0D A;  5EJZ A;  4Y62 A;  1ZJP A;  4AYL A;  5IDS A;  1O7O A;  2APC A;  2E8B A;  2RJ6 A;  1VH3 A;  2WEE A;  4KC4 A;  2VSI A;  5CQM X;  2YC3 A;  2OEG A;  1ZJ0 A;  5CMH A;  3U2X A;  1H5S C;  1G93 A;  1LL0 A;  1WSZ A;  5C48 A;  1R7T A;  1ZJO A;  2WE9 A;  3I0E A;  3I0J A;  4Y6N A;  4CJ8 A;  3I0F A;  1NQI B;  2CU2 A;  1EYR A;  2JCO A;  4AAW A;  4UEG A;  5C38 A;  2RJ9 A;  4KT7 A;  3PNN A;  2A8W A;  2Y4L A;  1NF5 B;  1O0R A;  5C1H A;  2RJ5 A;  4FRM A;  1HM8 A;  2VXM A;  1E5K A;  1PZT A;  1H5T B;  1WT2 A;  1XZ6 A;  2O1G A;  4FRQ A;  3O3P A;  4D11 A;  2I5E A;  4KPX A;  1JVG A;  3SXE A;  2Y6P A;  3RMW A;  4EEO A;  5FV9 A;  2X5S A;  4FRB A;  2VK9 A;  1LZJ A;  2UX8 A;  4Y64 A;  2JCK A;  1FR9 A;  3ZLK A;  3HL3 A;  5FU8 A;  4B4G A;  1Z90 A;  1H7H A;  1ZIZ A;  5C4B A;  4ARW A;  1R82 A;  5C8R A;  4KC2 A;  3I0K A;  3ST8 A;  1VPA A;  1FXO A;  3DJ4 A;  2FYD B;  3I0G A;  2BO4 A;  1LL3 A;  4FCE A;  1ZI3 A;  1H4D A;  2O1H A;  3K8E A;  1ZJ1 A;  5C1G A;  3OGZ A;  3OH0 A;  4NAN A;  2X60 A;  1S4N A;  2XWN A;  3CGX A;  4HO0 A;  3SXG A;  2O1F A;  3V0O A;  2D7I A;  1QGS A;  2V0H A;  4GBP A;  4BMA A;  2AE7 A;  4MIX A;  1HV9 A;  4DDZ A;  1H5S D;  1XHB A;  4Y9X A;  3R2W A;  1R81 A;  4FQW A;  4EVW A;  4FRD A;  2ZU8 A;  4CVH A;  2AM3 A;  2VSH A;  1NKH B;  1JYK A;  1JV3 A;  1JV1 A;  3V0P A;  1WT1 A;  4NAI A;  2WVK A;  4JD0 A;  4R7P A;  1H3M A;  1G0R A;  2I5K A;  4K6R A;  4B2X A;  3PKP A;  1H7T A;  2D0J A;  2ZU9 A;  1V84 A;  1GWW A;  1H7F A;  2FFU A;  2W0W A;  3OH2 A;  3V91 A;  2VXL A;  4KXO A;  5J49 A;  1GX4 A;  1TW5 A;  4NAL A;  2ICY A;  3OC9 A;  2AES A;  4B3U A;  4ECM A;  1ZJ2 A;  4HO6 A;  5D92 A;  3U2V A;  2FY7 A;  2I7B A;  3Q4S A;  3ZGG A;  1WT3 A;  2X65 A;  2YQC A;  2FYB A;  1H7E A;  1FR8 A;  1VZU A;  1WVC A;  1H7Q A;  3CKO A;  2YQJ A;  1WT0 A;  1JVD A;  1ZI5 A;  3V90 A;  2VS4 A;  4D11 C;  1K4V A;  2RJ1 A;  4NAK A;  1TW1 A;  3U0Y A;  3T7M A;  3T7N A;  3CKJ A;  4MYB A;  5DDT A;  4Y6U A;  4FRH A;  4G3P A;  5FUH A;  2V0I A;  3U2U A;  1NHE B;  3ZF8 A;  5CMG X;  4KNX A;  2VS5 A;  1LL2 A;  3E25 A;  2Y4M A;  5I1F A;  4Y7T A;  5C4F A;  3IOH A;  1LZ7 A;  4EE5 A;  2ZU7 A;  1OQM B;  4LW3 A;  1W57 A;  5C3A A;  1S4P A;  1GWV A;  1S4O A;  4Y7G A;  2P72 A;  3K8D A;  5FTV A;  3KIA A;  4HG6 A;  2AEC A;  2BO7 A;  2FYA A;  3FWW A;  3N9W A;  1HJL A;  4O6N A;  4B42 A;  3U2W A;  2BO6 A;  1ZI4 A;  4AYJ A;  1H5R A;  2PGV A;  4ZDQ A;  2X5Z A;  3CKN A;  1G23 A;  3I0H A;  4KNR A;  5CQL X;  4D0T A;  2PX7 A;  2MZB A;  2WGZ A;  1R7X A;  4B4M A;  5JQQ A;  3POL A;  2V0K A;  3V0N A;  1SS9 A;  3R3I A;  5C36 A;  2WVL A;  3SX3 A;  2XWM A;  1G8O A;  1GQC A;  3EE5 A;  2WAW A;  1ZCY A;  1QGQ A;  4YS8 A;  4FRE A;  4HO4 A;  4M2B A;  3SXA A;  2W0V A;  5EJ1 A;  4HCQ A;  4KC1 A;  5EIY A;  1ON6 A;  1ZDG A;  4L41 C;  2Z87 A;  2YQH A;  4AC3 A;  2RIZ A;  5C3B A;  4CJC A;  2JCL A;  3PKQ A;  2E3D A;  3CKV A;  2QGI A;  3U0X A;  2QKX A;  2YC5 A;  4BQH A;  3NGW A;  1R7Y A;  1FZW A;  2DPW A;  4P02 A;  1G9R A;  4XWI A;  4M2A A;  4FIX A;  4EE3 A;  1O23 B;  3V0L A;  4HOC A;  5CQP A;  2OI7 A;  5L6S A;  2OEF A;  1QWJ A;  2AM5 A;  4D48 A;  1G3L A;  1VGT A;  4B4B A;  1ON8 A;  4P00 A;  1VGW A;  5L6V A;  3ZGF A;  4EEM A;  5CMI A;  3RMV A;  1W77 A;  3BRK X;  3F1Y A;  4Y63 A;  2PA4 A;  3U2T A;  1G2V A;  2D7R A;  2Y4J A;  1VIC A;  3SX8 A;  3I0I X;  1VZX A;  1ZCV A;  2YES A;  3BCV A;  2JCJ A;  2VFZ A;  1FG5 N;  4FRA A;  4DE7 A;  1V82 A;  5CMJ A;  4Q7C A;  4Y7V A;  1H7G A;  1R80 A;  1ZHJ A;  4KPZ A;  2RIX A;  2V0L A;  2FFV A;  1YP3 A;  2BO8 A;  4M28 A;  4HO8 A;  1R7V A;  1TVY A;  1IIN A;  4KRV A;  4CJB A;  3QVB A;  4Y7U A;  3SX7 A;  3D5N A;  4J18 A;  1FO8 A;  3DUV A;  1ZI1 A;  4ASJ A;  1ZCU A;  1FGX A;  2RJ0 A;  1O7Q A;  2GGO A;  3IOJ A;  2YCM A;  4C2S A;  1YRO B;  3SXB A;  5CMF X;  5D91 A;  2ICX A;  5CQN X;  5AJO A;  5DDV A;  3SXD A;  1I52 A;  3I0C A;  2V0J A;  2Q4J A;  2Y4K A;  1HM9 A;  1MP3 A;  1YP4 A;  2XME A;  1MC3 A;  2NXV A;  3SXC A;  2AH9 A;  4G3S A;  4FCU A;  2P6W A;  4DEC A;  2J0A A;  5C49 A;  1H4C A;  4LW6 A;  2OI5 A;  1INJ A;  2WVM A;  3GUE A;  1YP2 A;  1EZI A;  1TZF A;  4HO2 A;  1LZ0 A;  1LVW A;  3T7O A;  1QG8 A;  3DK5 A;  1PZY B;  4FRP A;  2RJ8 A;  5IDT A;  3OH1 A;  3SPT A;  1FGG A;  1FO9 A;  2AM4 A;  2PGY A;  3FOQ A;  1FWY A;  1VGZ A;  3JUK A;  3OH3 A;  1R7U A;  4HO9 A;  3Q80 A;  2VD4 A;  4G87 A;  1KWS A;  1VZT A;  3OKR A;  3V8Y A;  3OAM A;  3V0Q A;  1INI A;  1G95 A;  1VGU A;  4HO3 A;  4IRQ A;  3I0L A;  4E1K A;  3JUJ A;  3ZLL A;  2P73 A;  3TQD A;  3OH4 A;  2XWL A;  1JYL A;  1H7L A;  5C47 A;  4IRP A;  1V83 A;  2FYC B;  1GQ9 A;  1LZI A;  3LW6 A;  4FRO A;  1G97 A;  1VM8 A;  5FYE A;  1FOA A;  3USQ A;  1H5S A;  4EEA A;  1G1L A;  4MND A;  2J0B A;  4HO5 A;  2A8U A;  2GGQ A;  1MP4 A;  2RJ7 A;  3JTJ A;  4FRL A;  3SX5 A;  1GX0 A;  1ZJ3 A;  4M4K A;  5HS2 A;  5C3D A;  1OMX A;  4G3Q A;  4FIY A;  5AJP A;  5AJN A;  4B2W A;  3V0M A;  4Y7F A;  3TZT A;  5C4C A;  2Z86 A;  4JIS A;  1HJJ A;  1H4E A;  1NMM B;  3D98 A;  1W55 A;  1FRW A;  1ZDF A;  3IOI A;  3Q7U A;  5IFY A;  1H5R B;  5C4D A;  4O6M A;  4ASY A;  1HM0 A;  1H5T A;  2AGD A;  2RIY A;  3CU0 A;  5FU0 A;  1ZCT A;  2VS3 A;  4EE4 A;  3E26 A;  1VH1 A;  3CKQ A;  4EEG A;  2YQS A;  5CQO A;  4KQL A;  1NWG B;  3V8Z A;  3D8V A;  2QH5 A;  4B5B A;  2XMH A;  1IIM A;  2RJ4 A;  1MP5 A;  5BXC A;  3F1C A;  2Y7A A;  4D0Z A;  1FXJ A;  1GA8 A;  3RSB A;  5C4E A; 
#chains in the Genus database with same CATH homology
 5FTS A;  5C1L A;  2RIT A;  2C0N A;  2OI6 A;  3USR A;  1H5S B;  1OMZ A;  3I0D A;  5EJZ A;  4Y62 A;  1ZJP A;  4AYL A;  5IDS A;  1O7O A;  2APC A;  2E8B A;  2RJ6 A;  1VH3 A;  2WEE A;  4KC4 A;  2VSI A;  5CQM X;  2YC3 A;  2OEG A;  1ZJ0 A;  5CMH A;  3U2X A;  1H5S C;  1G93 A;  1LL0 A;  1WSZ A;  5C48 A;  1R7T A;  1ZJO A;  2WE9 A;  3I0E A;  3I0J A;  4Y6N A;  4CJ8 A;  3I0F A;  1NQI B;  2CU2 A;  1EYR A;  2JCO A;  4AAW A;  4UEG A;  5C38 A;  2RJ9 A;  4KT7 A;  3PNN A;  2A8W A;  2Y4L A;  1NF5 B;  1O0R A;  5C1H A;  2RJ5 A;  4FRM A;  1HM8 A;  2VXM A;  1E5K A;  1PZT A;  1H5T B;  1WT2 A;  1XZ6 A;  2O1G A;  4FRQ A;  3O3P A;  4D11 A;  2I5E A;  4KPX A;  1JVG A;  3SXE A;  2Y6P A;  3RMW A;  4EEO A;  5FV9 A;  2X5S A;  4FRB A;  2VK9 A;  1LZJ A;  2UX8 A;  4Y64 A;  2JCK A;  1FR9 A;  3ZLK A;  3HL3 A;  5FU8 A;  4B4G A;  1Z90 A;  1H7H A;  1ZIZ A;  5C4B A;  4ARW A;  1R82 A;  5C8R A;  4KC2 A;  3I0K A;  3ST8 A;  1VPA A;  1FXO A;  3DJ4 A;  2FYD B;  3I0G A;  2BO4 A;  1LL3 A;  4FCE A;  1ZI3 A;  1H4D A;  2O1H A;  3K8E A;  1ZJ1 A;  5C1G A;  3OGZ A;  3OH0 A;  4NAN A;  2X60 A;  1S4N A;  2XWN A;  3CGX A;  4HO0 A;  3SXG A;  2O1F A;  3V0O A;  2D7I A;  1QGS A;  2V0H A;  4GBP A;  4BMA A;  2AE7 A;  4MIX A;  1HV9 A;  4DDZ A;  1H5S D;  1XHB A;  4Y9X A;  3R2W A;  1R81 A;  4FQW A;  4EVW A;  4FRD A;  2ZU8 A;  4CVH A;  2AM3 A;  2VSH A;  1NKH B;  1JYK A;  1JV3 A;  1JV1 A;  3V0P A;  1WT1 A;  4NAI A;  2WVK A;  4JD0 A;  4R7P A;  1H3M A;  1G0R A;  2I5K A;  4K6R A;  4B2X A;  3PKP A;  1H7T A;  2D0J A;  2ZU9 A;  1V84 A;  1GWW A;  1H7F A;  2FFU A;  2W0W A;  3OH2 A;  3V91 A;  2VXL A;  4KXO A;  5J49 A;  1GX4 A;  1TW5 A;  4NAL A;  2ICY A;  3OC9 A;  2AES A;  4B3U A;  4ECM A;  1ZJ2 A;  4HO6 A;  5D92 A;  3U2V A;  2FY7 A;  2I7B A;  3Q4S A;  3ZGG A;  1WT3 A;  2X65 A;  2YQC A;  2FYB A;  1H7E A;  1FR8 A;  1VZU A;  1WVC A;  1H7Q A;  3CKO A;  2YQJ A;  1WT0 A;  1JVD A;  1ZI5 A;  3V90 A;  2VS4 A;  4D11 C;  1K4V A;  2RJ1 A;  4NAK A;  1TW1 A;  3U0Y A;  3T7M A;  3T7N A;  3CKJ A;  4MYB A;  5DDT A;  4Y6U A;  4FRH A;  4G3P A;  5FUH A;  2V0I A;  3U2U A;  1NHE B;  3ZF8 A;  5CMG X;  4KNX A;  2VS5 A;  1LL2 A;  3E25 A;  2Y4M A;  5I1F A;  4Y7T A;  5C4F A;  3IOH A;  1LZ7 A;  4EE5 A;  2ZU7 A;  1OQM B;  4LW3 A;  1W57 A;  5C3A A;  1S4P A;  1GWV A;  1S4O A;  4Y7G A;  2P72 A;  3K8D A;  5FTV A;  3KIA A;  4HG6 A;  2AEC A;  2BO7 A;  2FYA A;  3FWW A;  3N9W A;  1HJL A;  4O6N A;  4B42 A;  3U2W A;  2BO6 A;  1ZI4 A;  4AYJ A;  1H5R A;  2PGV A;  4ZDQ A;  2X5Z A;  3CKN A;  1G23 A;  3I0H A;  4KNR A;  5CQL X;  4D0T A;  2PX7 A;  2MZB A;  2WGZ A;  1R7X A;  4B4M A;  5JQQ A;  3POL A;  2V0K A;  3V0N A;  1SS9 A;  3R3I A;  5C36 A;  2WVL A;  3SX3 A;  2XWM A;  1G8O A;  1GQC A;  3EE5 A;  2WAW A;  1ZCY A;  1QGQ A;  4YS8 A;  4FRE A;  4HO4 A;  4M2B A;  3SXA A;  2W0V A;  5EJ1 A;  4HCQ A;  4KC1 A;  5EIY A;  1ON6 A;  1ZDG A;  4L41 C;  2Z87 A;  2YQH A;  4AC3 A;  2RIZ A;  5C3B A;  4CJC A;  2JCL A;  3PKQ A;  2E3D A;  3CKV A;  2QGI A;  3U0X A;  2QKX A;  2YC5 A;  4BQH A;  3NGW A;  1R7Y A;  1FZW A;  2DPW A;  4P02 A;  1G9R A;  4XWI A;  4M2A A;  4FIX A;  4EE3 A;  1O23 B;  3V0L A;  4HOC A;  5CQP A;  2OI7 A;  5L6S A;  2OEF A;  1QWJ A;  2AM5 A;  4D48 A;  1G3L A;  1VGT A;  4B4B A;  1ON8 A;  4P00 A;  1VGW A;  5L6V A;  3ZGF A;  4EEM A;  5CMI A;  3RMV A;  1W77 A;  3BRK X;  3F1Y A;  4Y63 A;  2PA4 A;  3U2T A;  1G2V A;  2D7R A;  2Y4J A;  1VIC A;  3SX8 A;  3I0I X;  1VZX A;  1ZCV A;  2YES A;  3BCV A;  2JCJ A;  2VFZ A;  1FG5 N;  4FRA A;  4DE7 A;  1V82 A;  5CMJ A;  4Q7C A;  4Y7V A;  1H7G A;  1R80 A;  1ZHJ A;  4KPZ A;  2RIX A;  2V0L A;  2FFV A;  1YP3 A;  2BO8 A;  4M28 A;  4HO8 A;  1R7V A;  1TVY A;  1IIN A;  4KRV A;  4CJB A;  3QVB A;  4Y7U A;  3SX7 A;  3D5N A;  4J18 A;  1FO8 A;  3DUV A;  1ZI1 A;  4ASJ A;  1ZCU A;  1FGX A;  2RJ0 A;  1O7Q A;  2GGO A;  3IOJ A;  2YCM A;  4C2S A;  1YRO B;  3SXB A;  5CMF X;  5D91 A;  2ICX A;  5CQN X;  5AJO A;  5DDV A;  3SXD A;  1I52 A;  3I0C A;  2V0J A;  2Q4J A;  2Y4K A;  1HM9 A;  1MP3 A;  1YP4 A;  2XME A;  1MC3 A;  2NXV A;  3SXC A;  2AH9 A;  4G3S A;  4FCU A;  2P6W A;  4DEC A;  2J0A A;  5C49 A;  1H4C A;  4LW6 A;  2OI5 A;  1INJ A;  2WVM A;  3GUE A;  1YP2 A;  1EZI A;  1TZF A;  4HO2 A;  1LZ0 A;  1LVW A;  3T7O A;  1QG8 A;  3DK5 A;  1PZY B;  4FRP A;  2RJ8 A;  5IDT A;  3OH1 A;  3SPT A;  1FGG A;  1FO9 A;  2AM4 A;  2PGY A;  3FOQ A;  1FWY A;  1VGZ A;  3JUK A;  3OH3 A;  1R7U A;  4HO9 A;  3Q80 A;  2VD4 A;  4G87 A;  1KWS A;  1VZT A;  3OKR A;  3V8Y A;  3OAM A;  3V0Q A;  1INI A;  1G95 A;  1VGU A;  4HO3 A;  4IRQ A;  3I0L A;  4E1K A;  3JUJ A;  3ZLL A;  2P73 A;  3TQD A;  3OH4 A;  2XWL A;  1JYL A;  1H7L A;  5C47 A;  4IRP A;  1V83 A;  2FYC B;  1GQ9 A;  1LZI A;  3LW6 A;  4FRO A;  1G97 A;  1VM8 A;  5FYE A;  1FOA A;  3USQ A;  1H5S A;  4EEA A;  1G1L A;  4MND A;  2J0B A;  4HO5 A;  2A8U A;  2GGQ A;  1MP4 A;  2RJ7 A;  3JTJ A;  4FRL A;  3SX5 A;  1GX0 A;  1ZJ3 A;  4M4K A;  5HS2 A;  5C3D A;  1OMX A;  4G3Q A;  4FIY A;  5AJP A;  5AJN A;  4B2W A;  3V0M A;  4Y7F A;  3TZT A;  5C4C A;  2Z86 A;  4JIS A;  1HJJ A;  1H4E A;  1NMM B;  3D98 A;  1W55 A;  1FRW A;  1ZDF A;  3IOI A;  3Q7U A;  5IFY A;  1H5R B;  5C4D A;  4O6M A;  4ASY A;  1HM0 A;  1H5T A;  2AGD A;  2RIY A;  3CU0 A;  5FU0 A;  1ZCT A;  2VS3 A;  4EE4 A;  3E26 A;  1VH1 A;  3CKQ A;  4EEG A;  2YQS A;  5CQO A;  4KQL A;  1NWG B;  3V8Z A;  3D8V A;  2QH5 A;  4B5B A;  2XMH A;  1IIM A;  2RJ4 A;  1MP5 A;  5BXC A;  3F1C A;  2Y7A A;  4D0Z A;  1FXJ A;  1GA8 A;  3RSB A;  5C4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...