3JUTA

Acidic fibroblast growth factor (fgf-1) complexed with gentisic acid
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
130
structure length
130
Chain Sequence
KKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Gentisic acid, a compound associated with plant defense and a metabolite of aspirin, heads a new class of in vivo fibroblast growth factor inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 33
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3jutA00
3FGMA 2Q3NB 3AH2A 1JT3A 4I2SA 4X3AA 4D8HA 1WBCA 2K4AB 4LO2C 3BRFA 1HCEA 1DJSB 2Z48A 3CA6A 4I3NA 2ZR1B 4GAFA 3P6JA 1EYLA 4A7YA 1L2HA 3ZXDA 2ERMA 5FNXA 1FMZA 1BARA 1T9FA 2HW9A 4J2XA 3IM5A 2HWAA 3AKFA 1I1BA 2YUGA 4J2SA 2D23A 3C9ZA 3UD7A 1BFCA 4I6IA 4OWLA 1S0DA 2VXTI 4J2KA 4OEGA 1UPSA 2Y9XE 1ISXA 4G1RA 2NZ9A 5HPZA 2ZQOA 2IHOA 1N4KA 3BAHA 4ISRA 2F2FA 3CA1A 1TWEA 1Q1UA 3WMVA 4ZFWB 3OJVA 2E4MC 1SR4A 3CQAA 1PUUB 2D22A 4G6MA 1OQLB 4GAIA 3O4OA 3O4DA 1IILA 4II0A 4I96A 3VSZA 1PZZA 1S0CA 3O4CA 3RTJB 2K8RA 2BFHA 1P63A 4Q91A 3CA3A 7I1BA 2VSAA 2WBCA 3WMUA 1JT7A 5BXPA 3ZC9A 3VWCA 1G9AA 4ZA3B 3PG0A 1FQ9A 4A7KA 2D7IA 4ENDA 5BXTA 1HWOB 1IOBA 1ITBA 2ESUA 3RSJA 1DQOA 4JKQA 4ZGRB 4QO3A 1NZKA 5BXSA 1Q04A 4IY9A 1WD3A 4EFQA 3AH1A 3V0AA 1HIBA 3CA4A 4I1BA 2QYIB 1FGAA 4XFSA 2L5XA 3FJEA 4CJMA 1HKNA 2X2TA 4H9WA 1RMLA 2P23A 1TFMB 4KEJA 1D0HA 3CRIA 5FZYA 4YOLA 3I2XA 1XHBA 2FFUA 3WINC 2P39A 4QKRA 1FV2A 2RSTA 3UDAA 4AN7B 3NJ5A 2Y9FA 1BFBA 4TLPA 2VSEA 3BRDA 4L4HA 1FWVA 1JLXA 4G9MA 8I1BA 3IAGC 3SNVA 1TIEA 2DREA 2LIQA 3Q7XA 1VCLA 1MD6A 4IYBA 3A21A 1FMMS 4KC3A 5JMCA 1AXMA 3AKIA 5FZZA 3KMVA 3O49A 4P0KA 2VLCA 2KLLA 6I1BA 5FNWA 1BASA 2ET2A 2Y9WC 4X39A 3NBNA 4LO2A 3RMXA 1IJTA 1NUNA 2X2SA 2NTDA 1A8DA 4USOA 4F34A 4L4IA 1DIWA 2NP0A 3QR5A 1WBAA 3P53A 1EV2A 3OJ2A 3V0BB 5BOWA 2HZ9A 1JY0A 1S0EA 4JP0A 2AAIB 4EFPA 2BEAA 3BAQA 3JUTA 3LTQA 1JQZA 1JT4A 4R6UB 1RY7A 2NYYA 3FJDA 4Q9PA 5F90A 2NVHA 3BA5A 2D24A 3IM7A 2DRZA 4J23B 3RTIB 4JPZA 4HR6C 3BAUA 1YF8B 31BIA 4ZFYB 2GO2A 3Q7YA 3UD8A 4USPA 3PMEA 1V6VA 1ISWA 4IZEA 4XFTA 4ZFUB 1SZ6B 4LO7B 1YBIA 3FFZA 1Z0HA 2E4MA 2GZBA 3I2AA 5F8SA 1XG6A 5G00A 3BX1C 1I1EA 4J2YA 4LO8B 2DS0A 2ZQNA 3VT1A 1CE7B 4EKXB 1XYFA 1JTCA 1YXWA 3PHZA 4FVVA 4JRAA 4I4UA 3H6QA 1BLDA 3CRGA 2MLLB 3NBCA 4X38A 3ZC8A 1G9CA 3BB2A 1MC9A 3QYDA 3H6RA 3FJJA 3UD9A 1W3AA 4LO0C 3WO2A 3CRHA 4HJJA 2Y9GA 3BAGA 4OUJA 2VUAA 2FDBM 3F62B 1TP0A 5D61A 1TTUA 4I37A 3FJHA 1QQLA 3AH4A 3FJIA 3CA0A 4GOYA 3FJ9A 3FJKA 3P6IA 3WA1A 5DUYA 1JT5A 3BTAA 1AVAC 5F8YA 3TC2A 2VXRA 4QKSA 1W3GA 5I1BA 1XZZA 1IT0A 2D7RA 3OBTA 4GOVA 2KI4A 2XOAA 3VEQA 1JLYA 3O3QA 5EC5A 2FGFA 1QQKA 1WD4A 2IWTB 5EG6C 2D20A 3WINA 4Z9WB 3T8SA 5JLVA 4X37A 3ZXGA 1FN0A 1T4QA 3V0BA 2FO1A 1DZCA 3S8KA 2WRYA 3N7MA 1EVTA 4Z8SB 3B9UA 1BLAA 4EB2B 2VU9A 3IIRA 1G9BA 1M2TB 3HOMA 1K5VA 2HWMA 2NM1A 4G9NA 3FJAA 3OGGA 4A7ZA 2UUSA 4ZBVB 4GP3A 2Z49A 3HBWA 3PUBA 4HA2A 4OWJA 4QD2B 3VT2A 1DFCA 4I4YA 1CVSA 1HWNB 5DSSB 3AZWA 4LO7C 3OGFA 4OWKA 4P6AA 3O44A 1ONKB 1QXMA 1RG8A 5DVHA 3JRRA 1ISYA 2BEBA 1RZOB 4I8MA 4JAWA 4I1EA 1DZDA 5B2HA 3A22A 4I4XA 1AF9A 4IY8A 1BFGA 3NBEA 4JKXB 4ZOTA 3V0AB 1K5UA 4KEKA 3IM6A 4JQ0A 1G82A 3O5WB 1G9DA 5EHAA 4QBCA 1J0SA 4D0TA 4QBVA 3N7LA 3OBRA 4I4RA 4LO1A 5BVPI 4LO1C 3Q7WA 3CAHA 2AXMA 3AZVA 4IZXA 3BA7A 3FUOA 1HWPB 1BFFA 3K1XA 4H04A 1KNMA 1IHKA 2RQ9A 2KI6B 3AJ6A 4DEPA 4ISQA 1M16A 21BIA 4I4VA 3N7KA 3CU1B 3FJCA 5BXRA 3MPPG 3H6SE 1R8NA 3RMYA 3MALA 4F83A 4GP0A 1II4A 5D62A 1ISVA 1YYNA 3AJ5A 2R9KB 1S0BA 4QALA 1V6UA 3BRGC 1DFQA 1FV3A 1TOOA 1Z2VA 1R8OA 2LIEA 4DCKC 4ZKTB 4EFRA 3FUQA 3ZX7A 1TWMA 2F2FC 3FJBA 1BA7A 4LO0A 1SR4C 3V79C 5FZUA 2J3PA 3LLPA 4LO3A 4LO3C 1V6XA 4I0YA 3N7JA 5BP5A 5BP5C 5E24E 2M49A 1F31A 1V6WA 4XKIA 9ILBA 3VUOA 1ILR1 3O4AA 1Q03A 3D7WB 3POKA 3WO4A 3S8JA 3HSMA 1FWUA 4OEFA 2K43A 1PC8B 4QD2C 1DLLA 1HWMB 1S0FA 1YTOA 3UJ0A 3W9TA 2F8XC 3HMYA 1AVUA 4I4OA 4QC4A 3NBDA 4P0LA 4Q9GA 3BAOA 1AFCA 2D1ZA 3UJ4A 4OW4A 5D63A 2QN4A 3O4BA 4DENA 1Z4SA 3OJMA 1S0GA 1AVWB 2I1BA 5GAQA 1IRAX 4PC4A 1IRPA 4I4SA 1ABRB 1PWAA 3VT0A 1HCDA 3CA5A 4IONA 3BA4A 2D44A 1E0OA 4I4PA 3AKHA 1DQGA 4I7IA 3VSFA 4G6JA 4IQPA 41BIA 2D43A 3I29B 2MC2A 3EF2A 4XFUA 2RG9B 3R4SA 4WBCA 4EEEB 2FFVA 2AFGA 4ZLBB 4OEEA 2MIBA 3H6RB 1S0LA 3F1RA 2AQZA 1AVXB 1W3FA 3N0KA 3A23A 3E8LC 2Q9XA 1PUMB 3HN1A 3ILAA 4AN6A 4D0ZA 4KEIA 1EPWA 5BQUA 1ISZA 5BQUC 5F8WA 5DZUA 3BADA 1GGPB 3FJ8A 4FGFA 4P0JA 4KBBA 2KKIA 3R4UA 3FJFA 2DRYA 3HALA 2KH2A 3A07A 4IHZA 3WO3A 4I4QA 3AKGA 3BAVA
chains in the Genus database with same CATH superfamily
3FGMA 2Q3NB 3AH2A 1JT3A 4I2SA 4X3AA 4D8HA 1WBCA 2K4AB 4LO2C 3BRFA 1HCEA 1DJSB 2Z48A 3CA6A 4I3NA 2ZR1B 4GAFA 3P6JA 1EYLA 4A7YA 1L2HA 3ZXDA 2ERMA 5FNXA 1FMZA 1BARA 1T9FA 2HW9A 4J2XA 3IM5A 2HWAA 3AKFA 1I1BA 2YUGA 4J2SA 2D23A 3C9ZA 3UD7A 1BFCA 4I6IA 4OWLA 1S0DA 2VXTI 4J2KA 4OEGA 1UPSA 2Y9XE 1ISXA 4G1RA 2NZ9A 5HPZA 2ZQOA 2IHOA 1N4KA 3BAHA 4ISRA 2F2FA 3CA1A 1TWEA 1Q1UA 3WMVA 4ZFWB 3OJVA 2E4MC 1SR4A 3CQAA 1PUUB 2D22A 4G6MA 1OQLB 4MZGB 4H75A 4GAIA 3O4OA 3O4DA 1IILA 4II0A 4I96A 3VSZA 1PZZA 1S0CA 3O4CA 3RTJB 2K8RA 2BFHA 1P63A 4Q91A 3CA3A 7I1BA 2VSAA 2WBCA 3WMUA 1JT7A 5BXPA 3ZC9A 3VWCA 1G9AA 4ZA3B 3PG0A 1FQ9A 4A7KA 2D7IA 4ENDA 5BXTA 1HWOB 1IOBA 1ITBA 2ESUA 3RSJA 1DQOA 4JKQA 4ZGRB 4QO3A 1NZKA 5BXSA 1Q04A 4IY9A 1WD3A 4EFQA 3AH1A 3V0AA 1HIBA 3CA4A 4I1BA 2QYIB 1FGAA 4XFSA 2L5XA 3FJEA 4CJMA 1HKNA 2X2TA 4H9WA 1RMLA 2P23A 1TFMB 4KEJA 1D0HA 3CRIA 5FZYA 4YOLA 3I2XA 1XHBA 2FFUA 3WINC 2P39A 4QKRA 1FV2A 2RSTA 3UDAA 4AN7B 3NJ5A 2Y9FA 1BFBA 4TLPA 2VSEA 3BRDA 4L4HA 1FWVA 1JLXA 4G9MA 8I1BA 3IAGC 3SNVA 1TIEA 2DREA 2LIQA 3Q7XA 1VCLA 1MD6A 4IYBA 3A21A 1FMMS 4KC3A 5JMCA 1AXMA 3AKIA 5FZZA 3KMVA 3O49A 4P0KA 2VLCA 2KLLA 6I1BA 5FNWA 1BASA 2ET2A 2Y9WC 4X39A 3NBNA 4LO2A 3RMXA 1IJTA 1NUNA 2X2SA 2NTDA 1A8DA 4USOA 4F34A 4L4IA 1DIWA 2NP0A 3QR5A 1WBAA 3P53A 1EV2A 3OJ2A 3V0BB 5BOWA 2HZ9A 1JY0A 1S0EA 4JP0A 2AAIB 4EFPA 2BEAA 3BAQA 3JUTA 3LTQA 1JQZA 1JT4A 4R6UB 1RY7A 2NYYA 3FJDA 4Q9PA 5F90A 2NVHA 3BA5A 2D24A 3IM7A 2DRZA 4J23B 3RTIB 4JPZA 4HR6C 3BAUA 1YF8B 31BIA 4ZFYB 2GO2A 3Q7YA 3UD8A 4USPA 3PMEA 1V6VA 1ISWA 4IZEA 4XFTA 4ZFUB 1SZ6B 4LO7B 1YBIA 3FFZA 1Z0HA 2E4MA 2GZBA 3I2AA 5F8SA 1XG6A 5G00A 3BX1C 1I1EA 4J2YA 4LO8B 2DS0A 2ZQNA 3VT1A 1CE7B 4EKXB 1XYFA 1JTCA 1YXWA 3PHZA 4FVVA 4JRAA 4I4UA 3H6QA 1BLDA 3CRGA 2MLLB 3NBCA 4X38A 3ZC8A 1G9CA 3BB2A 1MC9A 3QYDA 3H6RA 3FJJA 3UD9A 1W3AA 4LO0C 3WO2A 3CRHA 4HJJA 2Y9GA 3BAGA 4OUJA 2VUAA 2FDBM 3F62B 1TP0A 5D61A 1TTUA 4I37A 3FJHA 1QQLA 3AH4A 3FJIA 3CA0A 4GOYA 3FJ9A 3FJKA 3P6IA 3WA1A 5DUYA 1JT5A 3BTAA 1AVAC 5F8YA 3TC2A 2VXRA 4QKSA 1W3GA 5I1BA 1XZZA 1IT0A 2D7RA 3OBTA 4GOVA 2KI4A 2XOAA 3VEQA 1JLYA 3O3QA 5EC5A 2FGFA 1QQKA 1WD4A 2IWTB 5EG6C 2D20A 3WINA 4Z9WB 3T8SA 5JLVA 4X37A 3ZXGA 1FN0A 1T4QA 3V0BA 2FO1A 1DZCA 3S8KA 2WRYA 3N7MA 1EVTA 4Z8SB 3B9UA 1BLAA 4EB2B 2VU9A 3IIRA 1G9BA 1M2TB 3HOMA 1K5VA 2HWMA 2NM1A 4G9NA 3FJAA 3OGGA 4A7ZA 2UUSA 4ZBVB 4GP3A 2Z49A 3HBWA 3PUBA 4HA2A 4OWJA 4QD2B 3VT2A 1DFCA 4I4YA 1CVSA 1HWNB 5DSSB 3AZWA 4LO7C 3OGFA 4OWKA 4P6AA 4MZFB 3O44A 1ONKB 1QXMA 1RG8A 5DVHA 3JRRA 1ISYA 2BEBA 1RZOB 4I8MA 4JAWA 4I1EA 1DZDA 5B2HA 3A22A 4I4XA 1AF9A 4IY8A 1BFGA 3NBEA 4JKXB 4ZOTA 3V0AB 1K5UA 4KEKA 3IM6A 4JQ0A 1G82A 3O5WB 1G9DA 5EHAA 4QBCA 1J0SA 4D0TA 4QBVA 3N7LA 3OBRA 4I4RA 4LO1A 5BVPI 4LO1C 3Q7WA 3CAHA 2AXMA 3AZVA 4IZXA 3BA7A 3FUOA 1HWPB 1BFFA 3K1XA 4H04A 1KNMA 1IHKA 2RQ9A 2KI6B 3AJ6A 4DEPA 4UY4A 4ISQA 1M16A 21BIA 4I4VA 4MZHA 3N7KA 3CU1B 3FJCA 5BXRA 3MPPG 3H6SE 1R8NA 3RMYA 3MALA 4F83A 4GP0A 1II4A 5D62A 1ISVA 1YYNA 3AJ5A 2R9KB 1S0BA 4QALA 1V6UA 3BRGC 1DFQA 1FV3A 1TOOA 1Z2VA 1R8OA 2LIEA 4DCKC 4ZKTB 4EFRA 3FUQA 3ZX7A 1TWMA 2F2FC 3FJBA 1BA7A 4LO0A 1SR4C 3V79C 5FZUA 2J3PA 3LLPA 4LO3A 4LO3C 1V6XA 4I0YA 3N7JA 5BP5A 5BP5C 5E24E 2M49A 1F31A 1V6WA 4XKIA 9ILBA 3VUOA 1ILR1 3O4AA 1Q03A 3D7WB 3POKA 3WO4A 3S8JA 3HSMA 1FWUA 4OEFA 2K43A 1PC8B 4QD2C 1DLLA 1HWMB 1S0FA 1YTOA 3UJ0A 3W9TA 2F8XC 3HMYA 1AVUA 4I4OA 4QC4A 3NBDA 4P0LA 4Q9GA 3BAOA 1AFCA 2D1ZA 3UJ4A 4OW4A 5D63A 2QN4A 3O4BA 4DENA 1Z4SA 3OJMA 1S0GA 1AVWB 2I1BA 5GAQA 1IRAX 4PC4A 1IRPA 4I4SA 1ABRB 1PWAA 3VT0A 1HCDA 3CA5A 4IONA 3BA4A 2D44A 1E0OA 4I4PA 3AKHA 1DQGA 4I7IA 3VSFA 4G6JA 4IQPA 41BIA 2D43A 3I29B 2MC2A 3EF2A 4XFUA 2RG9B 3R4SA 4WBCA 4EEEB 2FFVA 2AFGA 4ZLBB 4OEEA 2MIBA 3H6RB 1S0LA 3F1RA 2AQZA 1AVXB 1W3FA 3N0KA 3A23A 3E8LC 2Q9XA 1PUMB 3HN1A 3ILAA 4AN6A 4D0ZA 4KEIA 1EPWA 5BQUA 1ISZA 5BQUC 5F8WA 5DZUA 3BADA 1GGPB 3FJ8A 4FGFA 4P0JA 4KBBA 2KKIA 3R4UA 3FJFA 2DRYA 3HALA 2KH2A 3A07A 4IHZA 2NS2A 3WO3A 4I4QA 3AKGA 3BAVA
chains in the Genus database with same CATH topology
3FGMA 2Q3NB 3AH2A 1JT3A 4I2SA 4X3AA 4D8HA 1WBCA 2K4AB 4LO2C 3BRFA 1HCEA 1DJSB 2Z48A 3CA6A 4I3NA 2ZR1B 4GAFA 3P6JA 1EYLA 4A7YA 1L2HA 3ZXDA 2ERMA 5FNXA 1FMZA 1BARA 1T9FA 2HW9A 4J2XA 3IM5A 2HWAA 3AKFA 1I1BA 2YUGA 4J2SA 2D23A 3C9ZA 3UD7A 1BFCA 4I6IA 4OWLA 1S0DA 2VXTI 4J2KA 4OEGA 1UPSA 2Y9XE 1ISXA 4G1RA 2NZ9A 5HPZA 2ZQOA 2IHOA 1N4KA 3BAHA 4ISRA 2F2FA 3CA1A 1TWEA 1Q1UA 3WMVA 4ZFWB 3OJVA 2E4MC 1SR4A 3CQAA 1PUUB 2D22A 4G6MA 1OQLB 4MZGB 4H75A 4GAIA 3O4OA 3O4DA 1IILA 4II0A 4I96A 3VSZA 1PZZA 1S0CA 3O4CA 3RTJB 2K8RA 2BFHA 1P63A 4Q91A 3CA3A 7I1BA 2VSAA 2WBCA 3WMUA 1JT7A 5BXPA 3ZC9A 3VWCA 1G9AA 4ZA3B 3PG0A 1FQ9A 4A7KA 2D7IA 4ENDA 5BXTA 1HWOB 1IOBA 1ITBA 2ESUA 3RSJA 1DQOA 4JKQA 4ZGRB 4QO3A 1NZKA 5BXSA 1Q04A 4IY9A 1WD3A 4EFQA 3AH1A 3V0AA 1HIBA 3CA4A 4I1BA 2QYIB 1FGAA 4XFSA 2L5XA 3FJEA 4CJMA 1HKNA 2X2TA 4H9WA 1RMLA 2P23A 1TFMB 4KEJA 1D0HA 3CRIA 5FZYA 4YOLA 3I2XA 1XHBA 2FFUA 3WINC 2P39A 4QKRA 1FV2A 2RSTA 3UDAA 4AN7B 3NJ5A 2Y9FA 1BFBA 4TLPA 2VSEA 3BRDA 4L4HA 1FWVA 1JLXA 4G9MA 8I1BA 3IAGC 3SNVA 1TIEA 2DREA 2LIQA 3Q7XA 1VCLA 1MD6A 4IYBA 3A21A 1FMMS 4KC3A 5JMCA 1AXMA 3AKIA 5FZZA 3KMVA 3O49A 4P0KA 2VLCA 2KLLA 6I1BA 5FNWA 1BASA 2ET2A 2Y9WC 4X39A 3NBNA 4LO2A 3RMXA 1IJTA 1NUNA 2X2SA 2NTDA 1A8DA 4USOA 4F34A 4L4IA 1DIWA 2NP0A 3QR5A 1WBAA 3P53A 1EV2A 3OJ2A 3V0BB 5BOWA 2HZ9A 1JY0A 1S0EA 4JP0A 2AAIB 4EFPA 2BEAA 3BAQA 3JUTA 3LTQA 1JQZA 1JT4A 4R6UB 1RY7A 2NYYA 3FJDA 4Q9PA 5F90A 2NVHA 3BA5A 2D24A 3IM7A 2DRZA 4J23B 3RTIB 4JPZA 4HR6C 3BAUA 1YF8B 31BIA 4ZFYB 2GO2A 3Q7YA 3UD8A 4USPA 3PMEA 1V6VA 1ISWA 4IZEA 4XFTA 4ZFUB 1SZ6B 4LO7B 1YBIA 3FFZA 1Z0HA 2E4MA 2GZBA 3I2AA 5F8SA 1XG6A 5G00A 3BX1C 1I1EA 4J2YA 4LO8B 2DS0A 2ZQNA 3VT1A 1CE7B 4EKXB 1XYFA 1JTCA 1YXWA 3PHZA 4FVVA 4JRAA 4I4UA 3H6QA 1BLDA 3CRGA 2MLLB 3NBCA 4X38A 3ZC8A 1G9CA 3BB2A 1MC9A 3QYDA 3H6RA 3FJJA 3UD9A 1W3AA 4LO0C 3WO2A 3CRHA 4HJJA 2Y9GA 3BAGA 4OUJA 2VUAA 2FDBM 3F62B 1TP0A 5D61A 1TTUA 4I37A 3FJHA 1QQLA 3AH4A 3FJIA 3CA0A 4GOYA 3FJ9A 3FJKA 3P6IA 3WA1A 5DUYA 1JT5A 3BTAA 1AVAC 5F8YA 3TC2A 2VXRA 4QKSA 1W3GA 5I1BA 1XZZA 1IT0A 2D7RA 3OBTA 4GOVA 2KI4A 2XOAA 3VEQA 1JLYA 3O3QA 5EC5A 2FGFA 1QQKA 1WD4A 2IWTB 5EG6C 2D20A 3WINA 4Z9WB 3T8SA 5JLVA 4X37A 3ZXGA 1FN0A 1T4QA 3V0BA 2FO1A 1DZCA 3S8KA 2WRYA 3N7MA 1EVTA 4Z8SB 3B9UA 1BLAA 4EB2B 2VU9A 3IIRA 1G9BA 1M2TB 3HOMA 1K5VA 2HWMA 2NM1A 4G9NA 3FJAA 3OGGA 4A7ZA 2UUSA 4ZBVB 4GP3A 2Z49A 3HBWA 3PUBA 4HA2A 4OWJA 4QD2B 3VT2A 1DFCA 4I4YA 1CVSA 1HWNB 5DSSB 3AZWA 4LO7C 3OGFA 4OWKA 4P6AA 4MZFB 3O44A 1ONKB 1QXMA 1RG8A 5DVHA 3JRRA 1ISYA 2BEBA 1RZOB 4I8MA 4JAWA 4I1EA 1DZDA 5B2HA 3A22A 4I4XA 1AF9A 4IY8A 1BFGA 3NBEA 4JKXB 4ZOTA 3V0AB 1K5UA 4KEKA 3IM6A 4JQ0A 1G82A 3O5WB 1G9DA 5EHAA 4QBCA 1J0SA 4D0TA 4QBVA 3N7LA 3OBRA 4I4RA 4LO1A 5BVPI 4LO1C 3Q7WA 3CAHA 2AXMA 3AZVA 4IZXA 3BA7A 3FUOA 1HWPB 1BFFA 3K1XA 4H04A 1KNMA 1IHKA 2RQ9A 2KI6B 3AJ6A 4DEPA 4UY4A 4ISQA 1M16A 21BIA 4I4VA 4MZHA 3N7KA 3CU1B 3FJCA 5BXRA 3MPPG 3H6SE 1R8NA 3RMYA 3MALA 4F83A 4GP0A 1II4A 5D62A 1ISVA 1YYNA 3AJ5A 2R9KB 1S0BA 4QALA 1V6UA 3BRGC 1DFQA 1FV3A 1TOOA 1Z2VA 1R8OA 2LIEA 4DCKC 4ZKTB 4EFRA 3FUQA 3ZX7A 1TWMA 2F2FC 3FJBA 1BA7A 4LO0A 1SR4C 3V79C 5FZUA 2J3PA 3LLPA 4LO3A 4LO3C 1V6XA 4I0YA 3N7JA 5BP5A 5BP5C 5E24E 2M49A 1F31A 1V6WA 4XKIA 9ILBA 3VUOA 1ILR1 3O4AA 1Q03A 3D7WB 3POKA 3WO4A 3S8JA 3HSMA 1FWUA 4OEFA 2K43A 1PC8B 4QD2C 1DLLA 1HWMB 1S0FA 1YTOA 3UJ0A 3W9TA 2F8XC 3HMYA 1AVUA 4I4OA 4QC4A 3NBDA 4P0LA 4Q9GA 3BAOA 1AFCA 2D1ZA 3UJ4A 4OW4A 5D63A 2QN4A 3O4BA 4DENA 1Z4SA 3OJMA 1S0GA 1AVWB 2I1BA 5GAQA 1IRAX 4PC4A 1IRPA 4I4SA 1ABRB 1PWAA 3VT0A 1HCDA 3CA5A 4IONA 3BA4A 2D44A 1E0OA 4I4PA 3AKHA 1DQGA 4I7IA 3VSFA 4G6JA 4IQPA 41BIA 2D43A 3I29B 2MC2A 3EF2A 4XFUA 2RG9B 3R4SA 4WBCA 4EEEB 2FFVA 2AFGA 4ZLBB 4OEEA 2MIBA 3H6RB 1S0LA 3F1RA 2AQZA 1AVXB 1W3FA 3N0KA 3A23A 3E8LC 2Q9XA 1PUMB 3HN1A 3ILAA 4AN6A 4D0ZA 4KEIA 1EPWA 5BQUA 1ISZA 5BQUC 5F8WA 5DZUA 3BADA 1GGPB 3FJ8A 4FGFA 4P0JA 4KBBA 2KKIA 3R4UA 3FJFA 2DRYA 3HALA 2KH2A 3A07A 4IHZA 2NS2A 3WO3A 4I4QA 3AKGA 3BAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGM A;  2Q3N B;  3AH2 A;  1JT3 A;  4I2S A;  4X3A A;  4D8H A;  1WBC A;  2K4A B;  4LO2 C;  3BRF A;  1HCE A;  1DJS B;  2Z48 A;  3CA6 A;  4I3N A;  2ZR1 B;  4GAF A;  3P6J A;  1EYL A;  4A7Y A;  1L2H A;  3ZXD A;  2ERM A;  5FNX A;  1FMZ A;  1BAR A;  1T9F A;  2HW9 A;  4J2X A;  3IM5 A;  2HWA A;  3AKF A;  1I1B A;  2YUG A;  4J2S A;  2D23 A;  3C9Z A;  3UD7 A;  1BFC A;  4I6I A;  4OWL A;  1S0D A;  2VXT I;  4J2K A;  4OEG A;  1UPS A;  2Y9X E;  1ISX A;  4G1R A;  2NZ9 A;  5HPZ A;  2ZQO A;  2IHO A;  1N4K A;  3BAH A;  4ISR A;  2F2F A;  3CA1 A;  1TWE A;  1Q1U A;  3WMV A;  4ZFW B;  3OJV A;  2E4M C;  1SR4 A;  3CQA A;  1PUU B;  2D22 A;  4G6M A;  1OQL B;  4GAI A;  3O4O A;  3O4D A;  1IIL A;  4II0 A;  4I96 A;  3VSZ A;  1PZZ A;  1S0C A;  3O4C A;  3RTJ B;  2K8R A;  2BFH A;  1P63 A;  4Q91 A;  3CA3 A;  7I1B A;  2VSA A;  2WBC A;  3WMU A;  1JT7 A;  5BXP A;  3ZC9 A;  3VWC A;  1G9A A;  4ZA3 B;  3PG0 A;  1FQ9 A;  4A7K A;  2D7I A;  4END A;  5BXT A;  1HWO B;  1IOB A;  1ITB A;  2ESU A;  3RSJ A;  1DQO A;  4JKQ A;  4ZGR B;  4QO3 A;  1NZK A;  5BXS A;  1Q04 A;  4IY9 A;  1WD3 A;  4EFQ A;  3AH1 A;  3V0A A;  1HIB A;  3CA4 A;  4I1B A;  2QYI B;  1FGA A;  4XFS A;  2L5X A;  3FJE A;  4CJM A;  1HKN A;  2X2T A;  4H9W A;  1RML A;  2P23 A;  1TFM B;  4KEJ A;  1D0H A;  3CRI A;  5FZY A;  4YOL A;  3I2X A;  1XHB A;  2FFU A;  3WIN C;  2P39 A;  4QKR A;  1FV2 A;  2RST A;  3UDA A;  4AN7 B;  3NJ5 A;  2Y9F A;  1BFB A;  4TLP A;  2VSE A;  3BRD A;  4L4H A;  1FWV A;  1JLX A;  4G9M A;  8I1B A;  3IAG C;  3SNV A;  1TIE A;  2DRE A;  2LIQ A;  3Q7X A;  1VCL A;  1MD6 A;  4IYB A;  3A21 A;  1FMM S;  4KC3 A;  5JMC A;  1AXM A;  3AKI A;  5FZZ A;  3KMV A;  3O49 A;  4P0K A;  2VLC A;  2KLL A;  6I1B A;  5FNW A;  1BAS A;  2ET2 A;  2Y9W C;  4X39 A;  3NBN A;  4LO2 A;  3RMX A;  1IJT A;  1NUN A;  2X2S A;  2NTD A;  1A8D A;  4USO A;  4F34 A;  4L4I A;  1DIW A;  2NP0 A;  3QR5 A;  1WBA A;  3P53 A;  1EV2 A;  3OJ2 A;  3V0B B;  5BOW A;  2HZ9 A;  1JY0 A;  1S0E A;  4JP0 A;  2AAI B;  4EFP A;  2BEA A;  3BAQ A;  3JUT A;  3LTQ A;  1JQZ A;  1JT4 A;  4R6U B;  1RY7 A;  2NYY A;  3FJD A;  4Q9P A;  5F90 A;  2NVH A;  3BA5 A;  2D24 A;  3IM7 A;  2DRZ A;  4J23 B;  3RTI B;  4JPZ A;  4HR6 C;  3BAU A;  1YF8 B;  31BI A;  4ZFY B;  2GO2 A;  3Q7Y A;  3UD8 A;  4USP A;  3PME A;  1V6V A;  1ISW A;  4IZE A;  4XFT A;  4ZFU B;  1SZ6 B;  4LO7 B;  1YBI A;  3FFZ A;  1Z0H A;  2E4M A;  2GZB A;  3I2A A;  5F8S A;  1XG6 A;  5G00 A;  3BX1 C;  1I1E A;  4J2Y A;  4LO8 B;  2DS0 A;  2ZQN A;  3VT1 A;  1CE7 B;  4EKX B;  1XYF A;  1JTC A;  1YXW A;  3PHZ A;  4FVV A;  4JRA A;  4I4U A;  3H6Q A;  1BLD A;  3CRG A;  2MLL B;  3NBC A;  4X38 A;  3ZC8 A;  1G9C A;  3BB2 A;  1MC9 A;  3QYD A;  3H6R A;  3FJJ A;  3UD9 A;  1W3A A;  4LO0 C;  3WO2 A;  3CRH A;  4HJJ A;  2Y9G A;  3BAG A;  4OUJ A;  2VUA A;  2FDB M;  3F62 B;  1TP0 A;  5D61 A;  1TTU A;  4I37 A;  3FJH A;  1QQL A;  3AH4 A;  3FJI A;  3CA0 A;  4GOY A;  3FJ9 A;  3FJK A;  3P6I A;  3WA1 A;  5DUY A;  1JT5 A;  3BTA A;  1AVA C;  5F8Y A;  3TC2 A;  2VXR A;  4QKS A;  1W3G A;  5I1B A;  1XZZ A;  1IT0 A;  2D7R A;  3OBT A;  4GOV A;  2KI4 A;  2XOA A;  3VEQ A;  1JLY A;  3O3Q A;  5EC5 A;  2FGF A;  1QQK A;  1WD4 A;  2IWT B;  5EG6 C;  2D20 A;  3WIN A;  4Z9W B;  3T8S A;  5JLV A;  4X37 A;  3ZXG A;  1FN0 A;  1T4Q A;  3V0B A;  2FO1 A;  1DZC A;  3S8K A;  2WRY A;  3N7M A;  1EVT A;  4Z8S B;  3B9U A;  1BLA A;  4EB2 B;  2VU9 A;  3IIR A;  1G9B A;  1M2T B;  3HOM A;  1K5V A;  2HWM A;  2NM1 A;  4G9N A;  3FJA A;  3OGG A;  4A7Z A;  2UUS A;  4ZBV B;  4GP3 A;  2Z49 A;  3HBW A;  3PUB A;  4HA2 A;  4OWJ A;  4QD2 B;  3VT2 A;  1DFC A;  4I4Y A;  1CVS A;  1HWN B;  5DSS B;  3AZW A;  4LO7 C;  3OGF A;  4OWK A;  4P6A A;  3O44 A;  1ONK B;  1QXM A;  1RG8 A;  5DVH A;  3JRR A;  1ISY A;  2BEB A;  1RZO B;  4I8M A;  4JAW A;  4I1E A;  1DZD A;  5B2H A;  3A22 A;  4I4X A;  1AF9 A;  4IY8 A;  1BFG A;  3NBE A;  4JKX B;  4ZOT A;  3V0A B;  1K5U A;  4KEK A;  3IM6 A;  4JQ0 A;  1G82 A;  3O5W B;  1G9D A;  5EHA A;  4QBC A;  1J0S A;  4D0T A;  4QBV A;  3N7L A;  3OBR A;  4I4R A;  4LO1 A;  5BVP I;  4LO1 C;  3Q7W A;  3CAH A;  2AXM A;  3AZV A;  4IZX A;  3BA7 A;  3FUO A;  1HWP B;  1BFF A;  3K1X A;  4H04 A;  1KNM A;  1IHK A;  2RQ9 A;  2KI6 B;  3AJ6 A;  4DEP A;  4ISQ A;  1M16 A;  21BI A;  4I4V A;  3N7K A;  3CU1 B;  3FJC A;  5BXR A;  3MPP G;  3H6S E;  1R8N A;  3RMY A;  3MAL A;  4F83 A;  4GP0 A;  1II4 A;  5D62 A;  1ISV A;  1YYN A;  3AJ5 A;  2R9K B;  1S0B A;  4QAL A;  1V6U A;  3BRG C;  1DFQ A;  1FV3 A;  1TOO A;  1Z2V A;  1R8O A;  2LIE A;  4DCK C;  4ZKT B;  4EFR A;  3FUQ A;  3ZX7 A;  1TWM A;  2F2F C;  3FJB A;  1BA7 A;  4LO0 A;  1SR4 C;  3V79 C;  5FZU A;  2J3P A;  3LLP A;  4LO3 A;  4LO3 C;  1V6X A;  4I0Y A;  3N7J A;  5BP5 A;  5BP5 C;  5E24 E;  2M49 A;  1F31 A;  1V6W A;  4XKI A;  9ILB A;  3VUO A;  1ILR 1;  3O4A A;  1Q03 A;  3D7W B;  3POK A;  3WO4 A;  3S8J A;  3HSM A;  1FWU A;  4OEF A;  2K43 A;  1PC8 B;  4QD2 C;  1DLL A;  1HWM B;  1S0F A;  1YTO A;  3UJ0 A;  3W9T A;  2F8X C;  3HMY A;  1AVU A;  4I4O A;  4QC4 A;  3NBD A;  4P0L A;  4Q9G A;  3BAO A;  1AFC A;  2D1Z A;  3UJ4 A;  4OW4 A;  5D63 A;  2QN4 A;  3O4B A;  4DEN A;  1Z4S A;  3OJM A;  1S0G A;  1AVW B;  2I1B A;  5GAQ A;  1IRA X;  4PC4 A;  1IRP A;  4I4S A;  1ABR B;  1PWA A;  3VT0 A;  1HCD A;  3CA5 A;  4ION A;  3BA4 A;  2D44 A;  1E0O A;  4I4P A;  3AKH A;  1DQG A;  4I7I A;  3VSF A;  4G6J A;  4IQP A;  41BI A;  2D43 A;  3I29 B;  2MC2 A;  3EF2 A;  4XFU A;  2RG9 B;  3R4S A;  4WBC A;  4EEE B;  2FFV A;  2AFG A;  4ZLB B;  4OEE A;  2MIB A;  3H6R B;  1S0L A;  3F1R A;  2AQZ A;  1AVX B;  1W3F A;  3N0K A;  3A23 A;  3E8L C;  2Q9X A;  1PUM B;  3HN1 A;  3ILA A;  4AN6 A;  4D0Z A;  4KEI A;  1EPW A;  5BQU A;  1ISZ A;  5BQU C;  5F8W A;  5DZU A;  3BAD A;  1GGP B;  3FJ8 A;  4FGF A;  4P0J A;  4KBB A;  2KKI A;  3R4U A;  3FJF A;  2DRY A;  3HAL A;  2KH2 A;  3A07 A;  4IHZ A;  3WO3 A;  4I4Q A;  3AKG A;  3BAV A; 
#chains in the Genus database with same CATH topology
 3FGM A;  2Q3N B;  3AH2 A;  1JT3 A;  4I2S A;  4X3A A;  4D8H A;  1WBC A;  2K4A B;  4LO2 C;  3BRF A;  1HCE A;  1DJS B;  2Z48 A;  3CA6 A;  4I3N A;  2ZR1 B;  4GAF A;  3P6J A;  1EYL A;  4A7Y A;  1L2H A;  3ZXD A;  2ERM A;  5FNX A;  1FMZ A;  1BAR A;  1T9F A;  2HW9 A;  4J2X A;  3IM5 A;  2HWA A;  3AKF A;  1I1B A;  2YUG A;  4J2S A;  2D23 A;  3C9Z A;  3UD7 A;  1BFC A;  4I6I A;  4OWL A;  1S0D A;  2VXT I;  4J2K A;  4OEG A;  1UPS A;  2Y9X E;  1ISX A;  4G1R A;  2NZ9 A;  5HPZ A;  2ZQO A;  2IHO A;  1N4K A;  3BAH A;  4ISR A;  2F2F A;  3CA1 A;  1TWE A;  1Q1U A;  3WMV A;  4ZFW B;  3OJV A;  2E4M C;  1SR4 A;  3CQA A;  1PUU B;  2D22 A;  4G6M A;  1OQL B;  4MZG B;  4H75 A;  4GAI A;  3O4O A;  3O4D A;  1IIL A;  4II0 A;  4I96 A;  3VSZ A;  1PZZ A;  1S0C A;  3O4C A;  3RTJ B;  2K8R A;  2BFH A;  1P63 A;  4Q91 A;  3CA3 A;  7I1B A;  2VSA A;  2WBC A;  3WMU A;  1JT7 A;  5BXP A;  3ZC9 A;  3VWC A;  1G9A A;  4ZA3 B;  3PG0 A;  1FQ9 A;  4A7K A;  2D7I A;  4END A;  5BXT A;  1HWO B;  1IOB A;  1ITB A;  2ESU A;  3RSJ A;  1DQO A;  4JKQ A;  4ZGR B;  4QO3 A;  1NZK A;  5BXS A;  1Q04 A;  4IY9 A;  1WD3 A;  4EFQ A;  3AH1 A;  3V0A A;  1HIB A;  3CA4 A;  4I1B A;  2QYI B;  1FGA A;  4XFS A;  2L5X A;  3FJE A;  4CJM A;  1HKN A;  2X2T A;  4H9W A;  1RML A;  2P23 A;  1TFM B;  4KEJ A;  1D0H A;  3CRI A;  5FZY A;  4YOL A;  3I2X A;  1XHB A;  2FFU A;  3WIN C;  2P39 A;  4QKR A;  1FV2 A;  2RST A;  3UDA A;  4AN7 B;  3NJ5 A;  2Y9F A;  1BFB A;  4TLP A;  2VSE A;  3BRD A;  4L4H A;  1FWV A;  1JLX A;  4G9M A;  8I1B A;  3IAG C;  3SNV A;  1TIE A;  2DRE A;  2LIQ A;  3Q7X A;  1VCL A;  1MD6 A;  4IYB A;  3A21 A;  1FMM S;  4KC3 A;  5JMC A;  1AXM A;  3AKI A;  5FZZ A;  3KMV A;  3O49 A;  4P0K A;  2VLC A;  2KLL A;  6I1B A;  5FNW A;  1BAS A;  2ET2 A;  2Y9W C;  4X39 A;  3NBN A;  4LO2 A;  3RMX A;  1IJT A;  1NUN A;  2X2S A;  2NTD A;  1A8D A;  4USO A;  4F34 A;  4L4I A;  1DIW A;  2NP0 A;  3QR5 A;  1WBA A;  3P53 A;  1EV2 A;  3OJ2 A;  3V0B B;  5BOW A;  2HZ9 A;  1JY0 A;  1S0E A;  4JP0 A;  2AAI B;  4EFP A;  2BEA A;  3BAQ A;  3JUT A;  3LTQ A;  1JQZ A;  1JT4 A;  4R6U B;  1RY7 A;  2NYY A;  3FJD A;  4Q9P A;  5F90 A;  2NVH A;  3BA5 A;  2D24 A;  3IM7 A;  2DRZ A;  4J23 B;  3RTI B;  4JPZ A;  4HR6 C;  3BAU A;  1YF8 B;  31BI A;  4ZFY B;  2GO2 A;  3Q7Y A;  3UD8 A;  4USP A;  3PME A;  1V6V A;  1ISW A;  4IZE A;  4XFT A;  4ZFU B;  1SZ6 B;  4LO7 B;  1YBI A;  3FFZ A;  1Z0H A;  2E4M A;  2GZB A;  3I2A A;  5F8S A;  1XG6 A;  5G00 A;  3BX1 C;  1I1E A;  4J2Y A;  4LO8 B;  2DS0 A;  2ZQN A;  3VT1 A;  1CE7 B;  4EKX B;  1XYF A;  1JTC A;  1YXW A;  3PHZ A;  4FVV A;  4JRA A;  4I4U A;  3H6Q A;  1BLD A;  3CRG A;  2MLL B;  3NBC A;  4X38 A;  3ZC8 A;  1G9C A;  3BB2 A;  1MC9 A;  3QYD A;  3H6R A;  3FJJ A;  3UD9 A;  1W3A A;  4LO0 C;  3WO2 A;  3CRH A;  4HJJ A;  2Y9G A;  3BAG A;  4OUJ A;  2VUA A;  2FDB M;  3F62 B;  1TP0 A;  5D61 A;  1TTU A;  4I37 A;  3FJH A;  1QQL A;  3AH4 A;  3FJI A;  3CA0 A;  4GOY A;  3FJ9 A;  3FJK A;  3P6I A;  3WA1 A;  5DUY A;  1JT5 A;  3BTA A;  1AVA C;  5F8Y A;  3TC2 A;  2VXR A;  4QKS A;  1W3G A;  5I1B A;  1XZZ A;  1IT0 A;  2D7R A;  3OBT A;  4GOV A;  2KI4 A;  2XOA A;  3VEQ A;  1JLY A;  3O3Q A;  5EC5 A;  2FGF A;  1QQK A;  1WD4 A;  2IWT B;  5EG6 C;  2D20 A;  3WIN A;  4Z9W B;  3T8S A;  5JLV A;  4X37 A;  3ZXG A;  1FN0 A;  1T4Q A;  3V0B A;  2FO1 A;  1DZC A;  3S8K A;  2WRY A;  3N7M A;  1EVT A;  4Z8S B;  3B9U A;  1BLA A;  4EB2 B;  2VU9 A;  3IIR A;  1G9B A;  1M2T B;  3HOM A;  1K5V A;  2HWM A;  2NM1 A;  4G9N A;  3FJA A;  3OGG A;  4A7Z A;  2UUS A;  4ZBV B;  4GP3 A;  2Z49 A;  3HBW A;  3PUB A;  4HA2 A;  4OWJ A;  4QD2 B;  3VT2 A;  1DFC A;  4I4Y A;  1CVS A;  1HWN B;  5DSS B;  3AZW A;  4LO7 C;  3OGF A;  4OWK A;  4P6A A;  4MZF B;  3O44 A;  1ONK B;  1QXM A;  1RG8 A;  5DVH A;  3JRR A;  1ISY A;  2BEB A;  1RZO B;  4I8M A;  4JAW A;  4I1E A;  1DZD A;  5B2H A;  3A22 A;  4I4X A;  1AF9 A;  4IY8 A;  1BFG A;  3NBE A;  4JKX B;  4ZOT A;  3V0A B;  1K5U A;  4KEK A;  3IM6 A;  4JQ0 A;  1G82 A;  3O5W B;  1G9D A;  5EHA A;  4QBC A;  1J0S A;  4D0T A;  4QBV A;  3N7L A;  3OBR A;  4I4R A;  4LO1 A;  5BVP I;  4LO1 C;  3Q7W A;  3CAH A;  2AXM A;  3AZV A;  4IZX A;  3BA7 A;  3FUO A;  1HWP B;  1BFF A;  3K1X A;  4H04 A;  1KNM A;  1IHK A;  2RQ9 A;  2KI6 B;  3AJ6 A;  4DEP A;  4UY4 A;  4ISQ A;  1M16 A;  21BI A;  4I4V A;  4MZH A;  3N7K A;  3CU1 B;  3FJC A;  5BXR A;  3MPP G;  3H6S E;  1R8N A;  3RMY A;  3MAL A;  4F83 A;  4GP0 A;  1II4 A;  5D62 A;  1ISV A;  1YYN A;  3AJ5 A;  2R9K B;  1S0B A;  4QAL A;  1V6U A;  3BRG C;  1DFQ A;  1FV3 A;  1TOO A;  1Z2V A;  1R8O A;  2LIE A;  4DCK C;  4ZKT B;  4EFR A;  3FUQ A;  3ZX7 A;  1TWM A;  2F2F C;  3FJB A;  1BA7 A;  4LO0 A;  1SR4 C;  3V79 C;  5FZU A;  2J3P A;  3LLP A;  4LO3 A;  4LO3 C;  1V6X A;  4I0Y A;  3N7J A;  5BP5 A;  5BP5 C;  5E24 E;  2M49 A;  1F31 A;  1V6W A;  4XKI A;  9ILB A;  3VUO A;  1ILR 1;  3O4A A;  1Q03 A;  3D7W B;  3POK A;  3WO4 A;  3S8J A;  3HSM A;  1FWU A;  4OEF A;  2K43 A;  1PC8 B;  4QD2 C;  1DLL A;  1HWM B;  1S0F A;  1YTO A;  3UJ0 A;  3W9T A;  2F8X C;  3HMY A;  1AVU A;  4I4O A;  4QC4 A;  3NBD A;  4P0L A;  4Q9G A;  3BAO A;  1AFC A;  2D1Z A;  3UJ4 A;  4OW4 A;  5D63 A;  2QN4 A;  3O4B A;  4DEN A;  1Z4S A;  3OJM A;  1S0G A;  1AVW B;  2I1B A;  5GAQ A;  1IRA X;  4PC4 A;  1IRP A;  4I4S A;  1ABR B;  1PWA A;  3VT0 A;  1HCD A;  3CA5 A;  4ION A;  3BA4 A;  2D44 A;  1E0O A;  4I4P A;  3AKH A;  1DQG A;  4I7I A;  3VSF A;  4G6J A;  4IQP A;  41BI A;  2D43 A;  3I29 B;  2MC2 A;  3EF2 A;  4XFU A;  2RG9 B;  3R4S A;  4WBC A;  4EEE B;  2FFV A;  2AFG A;  4ZLB B;  4OEE A;  2MIB A;  3H6R B;  1S0L A;  3F1R A;  2AQZ A;  1AVX B;  1W3F A;  3N0K A;  3A23 A;  3E8L C;  2Q9X A;  1PUM B;  3HN1 A;  3ILA A;  4AN6 A;  4D0Z A;  4KEI A;  1EPW A;  5BQU A;  1ISZ A;  5BQU C;  5F8W A;  5DZU A;  3BAD A;  1GGP B;  3FJ8 A;  4FGF A;  4P0J A;  4KBB A;  2KKI A;  3R4U A;  3FJF A;  2DRY A;  3HAL A;  2KH2 A;  3A07 A;  4IHZ A;  2NS2 A;  3WO3 A;  4I4Q A;  3AKG A;  3BAV A; 
#chains in the Genus database with same CATH homology
 3FGM A;  2Q3N B;  3AH2 A;  1JT3 A;  4I2S A;  4X3A A;  4D8H A;  1WBC A;  2K4A B;  4LO2 C;  3BRF A;  1HCE A;  1DJS B;  2Z48 A;  3CA6 A;  4I3N A;  2ZR1 B;  4GAF A;  3P6J A;  1EYL A;  4A7Y A;  1L2H A;  3ZXD A;  2ERM A;  5FNX A;  1FMZ A;  1BAR A;  1T9F A;  2HW9 A;  4J2X A;  3IM5 A;  2HWA A;  3AKF A;  1I1B A;  2YUG A;  4J2S A;  2D23 A;  3C9Z A;  3UD7 A;  1BFC A;  4I6I A;  4OWL A;  1S0D A;  2VXT I;  4J2K A;  4OEG A;  1UPS A;  2Y9X E;  1ISX A;  4G1R A;  2NZ9 A;  5HPZ A;  2ZQO A;  2IHO A;  1N4K A;  3BAH A;  4ISR A;  2F2F A;  3CA1 A;  1TWE A;  1Q1U A;  3WMV A;  4ZFW B;  3OJV A;  2E4M C;  1SR4 A;  3CQA A;  1PUU B;  2D22 A;  4G6M A;  1OQL B;  4MZG B;  4H75 A;  4GAI A;  3O4O A;  3O4D A;  1IIL A;  4II0 A;  4I96 A;  3VSZ A;  1PZZ A;  1S0C A;  3O4C A;  3RTJ B;  2K8R A;  2BFH A;  1P63 A;  4Q91 A;  3CA3 A;  7I1B A;  2VSA A;  2WBC A;  3WMU A;  1JT7 A;  5BXP A;  3ZC9 A;  3VWC A;  1G9A A;  4ZA3 B;  3PG0 A;  1FQ9 A;  4A7K A;  2D7I A;  4END A;  5BXT A;  1HWO B;  1IOB A;  1ITB A;  2ESU A;  3RSJ A;  1DQO A;  4JKQ A;  4ZGR B;  4QO3 A;  1NZK A;  5BXS A;  1Q04 A;  4IY9 A;  1WD3 A;  4EFQ A;  3AH1 A;  3V0A A;  1HIB A;  3CA4 A;  4I1B A;  2QYI B;  1FGA A;  4XFS A;  2L5X A;  3FJE A;  4CJM A;  1HKN A;  2X2T A;  4H9W A;  1RML A;  2P23 A;  1TFM B;  4KEJ A;  1D0H A;  3CRI A;  5FZY A;  4YOL A;  3I2X A;  1XHB A;  2FFU A;  3WIN C;  2P39 A;  4QKR A;  1FV2 A;  2RST A;  3UDA A;  4AN7 B;  3NJ5 A;  2Y9F A;  1BFB A;  4TLP A;  2VSE A;  3BRD A;  4L4H A;  1FWV A;  1JLX A;  4G9M A;  8I1B A;  3IAG C;  3SNV A;  1TIE A;  2DRE A;  2LIQ A;  3Q7X A;  1VCL A;  1MD6 A;  4IYB A;  3A21 A;  1FMM S;  4KC3 A;  5JMC A;  1AXM A;  3AKI A;  5FZZ A;  3KMV A;  3O49 A;  4P0K A;  2VLC A;  2KLL A;  6I1B A;  5FNW A;  1BAS A;  2ET2 A;  2Y9W C;  4X39 A;  3NBN A;  4LO2 A;  3RMX A;  1IJT A;  1NUN A;  2X2S A;  2NTD A;  1A8D A;  4USO A;  4F34 A;  4L4I A;  1DIW A;  2NP0 A;  3QR5 A;  1WBA A;  3P53 A;  1EV2 A;  3OJ2 A;  3V0B B;  5BOW A;  2HZ9 A;  1JY0 A;  1S0E A;  4JP0 A;  2AAI B;  4EFP A;  2BEA A;  3BAQ A;  3JUT A;  3LTQ A;  1JQZ A;  1JT4 A;  4R6U B;  1RY7 A;  2NYY A;  3FJD A;  4Q9P A;  5F90 A;  2NVH A;  3BA5 A;  2D24 A;  3IM7 A;  2DRZ A;  4J23 B;  3RTI B;  4JPZ A;  4HR6 C;  3BAU A;  1YF8 B;  31BI A;  4ZFY B;  2GO2 A;  3Q7Y A;  3UD8 A;  4USP A;  3PME A;  1V6V A;  1ISW A;  4IZE A;  4XFT A;  4ZFU B;  1SZ6 B;  4LO7 B;  1YBI A;  3FFZ A;  1Z0H A;  2E4M A;  2GZB A;  3I2A A;  5F8S A;  1XG6 A;  5G00 A;  3BX1 C;  1I1E A;  4J2Y A;  4LO8 B;  2DS0 A;  2ZQN A;  3VT1 A;  1CE7 B;  4EKX B;  1XYF A;  1JTC A;  1YXW A;  3PHZ A;  4FVV A;  4JRA A;  4I4U A;  3H6Q A;  1BLD A;  3CRG A;  2MLL B;  3NBC A;  4X38 A;  3ZC8 A;  1G9C A;  3BB2 A;  1MC9 A;  3QYD A;  3H6R A;  3FJJ A;  3UD9 A;  1W3A A;  4LO0 C;  3WO2 A;  3CRH A;  4HJJ A;  2Y9G A;  3BAG A;  4OUJ A;  2VUA A;  2FDB M;  3F62 B;  1TP0 A;  5D61 A;  1TTU A;  4I37 A;  3FJH A;  1QQL A;  3AH4 A;  3FJI A;  3CA0 A;  4GOY A;  3FJ9 A;  3FJK A;  3P6I A;  3WA1 A;  5DUY A;  1JT5 A;  3BTA A;  1AVA C;  5F8Y A;  3TC2 A;  2VXR A;  4QKS A;  1W3G A;  5I1B A;  1XZZ A;  1IT0 A;  2D7R A;  3OBT A;  4GOV A;  2KI4 A;  2XOA A;  3VEQ A;  1JLY A;  3O3Q A;  5EC5 A;  2FGF A;  1QQK A;  1WD4 A;  2IWT B;  5EG6 C;  2D20 A;  3WIN A;  4Z9W B;  3T8S A;  5JLV A;  4X37 A;  3ZXG A;  1FN0 A;  1T4Q A;  3V0B A;  2FO1 A;  1DZC A;  3S8K A;  2WRY A;  3N7M A;  1EVT A;  4Z8S B;  3B9U A;  1BLA A;  4EB2 B;  2VU9 A;  3IIR A;  1G9B A;  1M2T B;  3HOM A;  1K5V A;  2HWM A;  2NM1 A;  4G9N A;  3FJA A;  3OGG A;  4A7Z A;  2UUS A;  4ZBV B;  4GP3 A;  2Z49 A;  3HBW A;  3PUB A;  4HA2 A;  4OWJ A;  4QD2 B;  3VT2 A;  1DFC A;  4I4Y A;  1CVS A;  1HWN B;  5DSS B;  3AZW A;  4LO7 C;  3OGF A;  4OWK A;  4P6A A;  4MZF B;  3O44 A;  1ONK B;  1QXM A;  1RG8 A;  5DVH A;  3JRR A;  1ISY A;  2BEB A;  1RZO B;  4I8M A;  4JAW A;  4I1E A;  1DZD A;  5B2H A;  3A22 A;  4I4X A;  1AF9 A;  4IY8 A;  1BFG A;  3NBE A;  4JKX B;  4ZOT A;  3V0A B;  1K5U A;  4KEK A;  3IM6 A;  4JQ0 A;  1G82 A;  3O5W B;  1G9D A;  5EHA A;  4QBC A;  1J0S A;  4D0T A;  4QBV A;  3N7L A;  3OBR A;  4I4R A;  4LO1 A;  5BVP I;  4LO1 C;  3Q7W A;  3CAH A;  2AXM A;  3AZV A;  4IZX A;  3BA7 A;  3FUO A;  1HWP B;  1BFF A;  3K1X A;  4H04 A;  1KNM A;  1IHK A;  2RQ9 A;  2KI6 B;  3AJ6 A;  4DEP A;  4UY4 A;  4ISQ A;  1M16 A;  21BI A;  4I4V A;  4MZH A;  3N7K A;  3CU1 B;  3FJC A;  5BXR A;  3MPP G;  3H6S E;  1R8N A;  3RMY A;  3MAL A;  4F83 A;  4GP0 A;  1II4 A;  5D62 A;  1ISV A;  1YYN A;  3AJ5 A;  2R9K B;  1S0B A;  4QAL A;  1V6U A;  3BRG C;  1DFQ A;  1FV3 A;  1TOO A;  1Z2V A;  1R8O A;  2LIE A;  4DCK C;  4ZKT B;  4EFR A;  3FUQ A;  3ZX7 A;  1TWM A;  2F2F C;  3FJB A;  1BA7 A;  4LO0 A;  1SR4 C;  3V79 C;  5FZU A;  2J3P A;  3LLP A;  4LO3 A;  4LO3 C;  1V6X A;  4I0Y A;  3N7J A;  5BP5 A;  5BP5 C;  5E24 E;  2M49 A;  1F31 A;  1V6W A;  4XKI A;  9ILB A;  3VUO A;  1ILR 1;  3O4A A;  1Q03 A;  3D7W B;  3POK A;  3WO4 A;  3S8J A;  3HSM A;  1FWU A;  4OEF A;  2K43 A;  1PC8 B;  4QD2 C;  1DLL A;  1HWM B;  1S0F A;  1YTO A;  3UJ0 A;  3W9T A;  2F8X C;  3HMY A;  1AVU A;  4I4O A;  4QC4 A;  3NBD A;  4P0L A;  4Q9G A;  3BAO A;  1AFC A;  2D1Z A;  3UJ4 A;  4OW4 A;  5D63 A;  2QN4 A;  3O4B A;  4DEN A;  1Z4S A;  3OJM A;  1S0G A;  1AVW B;  2I1B A;  5GAQ A;  1IRA X;  4PC4 A;  1IRP A;  4I4S A;  1ABR B;  1PWA A;  3VT0 A;  1HCD A;  3CA5 A;  4ION A;  3BA4 A;  2D44 A;  1E0O A;  4I4P A;  3AKH A;  1DQG A;  4I7I A;  3VSF A;  4G6J A;  4IQP A;  41BI A;  2D43 A;  3I29 B;  2MC2 A;  3EF2 A;  4XFU A;  2RG9 B;  3R4S A;  4WBC A;  4EEE B;  2FFV A;  2AFG A;  4ZLB B;  4OEE A;  2MIB A;  3H6R B;  1S0L A;  3F1R A;  2AQZ A;  1AVX B;  1W3F A;  3N0K A;  3A23 A;  3E8L C;  2Q9X A;  1PUM B;  3HN1 A;  3ILA A;  4AN6 A;  4D0Z A;  4KEI A;  1EPW A;  5BQU A;  1ISZ A;  5BQU C;  5F8W A;  5DZU A;  3BAD A;  1GGP B;  3FJ8 A;  4FGF A;  4P0J A;  4KBB A;  2KKI A;  3R4U A;  3FJF A;  2DRY A;  3HAL A;  2KH2 A;  3A07 A;  4IHZ A;  2NS2 A;  3WO3 A;  4I4Q A;  3AKG A;  3BAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...