3JUYA

Crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
233
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCQASGYRFSHFTVHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGEWGWDDSPYDNYYMDVWGKGTTVIVSEIVLTQAPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B3 single chain variant HIV-1 antibody
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of a 3B3 variant-A broadly neutralizing HIV-1 scFv antibody.
pubmed doi rcsb
total genus 51
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA01
2JB6B 3SJVE 5CHNB 3W9DB 5HHOE 3P0YL 4KVNH 5MEPB 4LP5A 2A9ML 5JW5B 3LMJL 3IDYB 5DVMA 1RULH 4DJMA 3VFMB 4JM2D 4DUVA 4H1LG 3TJEL 5CBEA 4DN4H 5L88H 4YH6A 3K46A 2GJZB 1UCBH 3WO3B 4OZIB 1INQB 1C08A 3C60D 3QUZC 3QUYD 3S96A 4YNYB 2ZCHH 5FYKE 4QHKJ 5ICZA 4Y4KA 4MDJB 3CSBA 1S5IL 4PJCE 4ZD3H 1AHWA 4WUUA 2WQRA 4Z7UE 5C7XL 1I8KB 3UTQA 3SE3A 3JV6B 4YBQD 1UYWL 1YMME 1QFUL 3KPQB 4I9WD 3ZE0E 2XT1B 3O9WB 2F5AH 4H8WC 2DJ4A 4JHBA 2EYRA 5D1ZB 2ZWLT 1HKLH 4TUKL 1OW0C 2ADGB 5FV1L 4GG6F 1A5FL 2Z0BA 2P4AB 2DMCA 3RDTC 3V0VA 3BZFB 2YMXH 5E2VL 3UMTA 2G75B 3DO3A 1T7YA 5T1LB 5D2NA 1XR9B 5DMKB 3TBWA 5L9DH 3LKQB 4KJYA 2EH7H 1HHKB 1FFNA 1UM4H 4K55A 4XWOC 3RY5A 1ZT1A 2R1XB 3OAUH 3DVGB 2VLME 3VFSA 3QQ3B 4U1NB 2BVQB 5FGCB 4L8DA 5BOZG 3OWEA 3SE9L 4NQEE 4DGIH 1BD2E 4P3DB 2ZSVB 5FO9B 1YY8A 4OM1L 2GIYA 1IKNA 3EYQC 3ES6B 1GHFL 1M7XA 4ISVA 4X5XB 2KZ1B 4EIGB 1A9EA 4LLVA 4NO0A 3V5HB 5D72L 3ZTJG 3GMPA 1D6VH 2R0ZL 3SKUD 3WO4B 1N59A 4LLQA 3UPRA 4EI5B 1A47A 1QD0A 5DMIL 4RMVA 1HOCB 3MC0A 1H9VA 1U95B 2D0GA 3FL7A 2H32A 4XX1G 1KIQB 5JIHA 5AZEL 4ORZC 5H35B 2ZUUA 3LZFL 4OGAC 5ERWA 3BUYA 3ELAT 5KVDL 2WBJA 3CMOH 3ZE2E 1MCCA 2LABA 1MCHA 3OKMA 3TPUB 1TLKA 3L3OB 5L7XH 2DLHA 1HYSD 1MIEH 2OMNA 3OL2A 4B7IA 1TQCB 3TO4C 4EEEA 1PYWA 3W0WD 3LIZL 1DUZB 2AJUL 5DJXA 4X8JA 1BWMA 4LU5H 3MZGB 4KDVA 5KSAB 5D8JH 1NANH 2WZPD 4WW1B 3N06B 4ZQKB 1FDLL 2PCPA 1WZLA 2PO6D 4KY1L 3U9UA 4S1DD 2FX9H 4K3JH 4P2QE 4HLZH 5DEGA 3MRRA 3IJYA 2D7OA 1RIUL 4CW1B 4X80H 1ZXQA 1PJ9A 4N0UE 1KCUH 4XP5H 3L1OH 2ADIA 4IIQC 4I18A 4FRWA 1BD2A 1F90L 4WI2A 5GS0L 4TSBH 1YEIL 3MO1B 4PV9B 3L3KA 1B2WH 4WDIB 4R7NB 1U92B 3EOAA 2X09A 5E2TH 3TT1L 2YA2A 1ZVSB 4WI8A 4A6YH 1NC2B 1MAKA 4QF1A 2JE8A 4YR6B 1DANU 2ESVA 4MA3B 3QO1A 1D6EA 1T3FA 5EUOF 1EEYA 2X4QB 2NY7H 3MRGA 3ARDC 5JPNA 3SJVA 3FQRB 1LO5A 4XAKE 5FUCC 5KSBB 5B4MC 2HKFH 4D0DA 4R7DB 5IW3A 4JQVA 4Z76A 4LKCA 3V0AC 3M17B 5IKCB 2Q76B 5DD0L 4RIRB 5FYKD 2XPGB 2EYTA 1P84K 2W60A 5DJZB 1VPOL 3WHE0 4B41A 5IFHL 2DMKA 2H8PB 1IAII 4F15B 3O8XD 3MRNB 3O4LB 2KDGA 5IJKA 5J8OA 4L8BA 4JHAL 4ZUUB 4HLZG 3E6HB 4KK9C 2DS4A 2ILLA 3H9YA 3LN5B 4MHHG 3MRCA 4MQTB 2NXZD 3E6FB 5TDNB 2R4RH 3OXSA 4CADB 3KLHD 4WUUE 4Z0XB 5EU3A 2NLJA 5JA9A 1T83A 4PRPD 1SMAA 3HRPA 1QKZL 4HUWA 4GAJH 3W2DH 4IRJC 3IDJA 3AMLA 1A4KB 3AS2A 5DJCA 1MCEA 1DBJH 5FGSA 1TQBB 3CH1A 3QUYC 1RUQL 4DN3H 4Z7OF 1YA5A 4HV8B 3PWNB 4R2GB 4A6YB 1YEEH 2E8ZA 5DK2B 1LE9A 3TZVA 1CVSC 3D25B 4FQXA 3L6FA 5FUOL 2YPKB 1KCLA 1CG9B 4ONHB 4AH2B 3OJMB 4O58H 4YPGA 5HJ3A 2HMID 1I85A 3QEQD 4L4TE 4JPWH 5FKAA 2IC2A 2IANE 4KKAC 2BVYA 4JQVC 2FGWH 4R96A 3HLAB 1HZHL 4LCIL 5D1ZC 2ICEA 3FQWA 3T2QA 3WFDH 3KS0H 4YHYC 3BKML 3LKPB 5BMFL 2PF6A 2D0FA 4JY5H 3DNKA 3DMMA 4G8IA 1WF5A 4RGNC 4Z7VA 3T77B 3VW3L 2FWOB 1MVUB 2PXYB 2F5AL 2V17H 5I1CH 4YHMH 3MJ6A 3LEXA 4FTVD 4HFUH 5EC2A 2HJLB 4KVCL 1JVKA 1URLA 3MOAL 1NGXA 3ZHKA 4QY8A 1HE7A 5DLML 1YJDC 2GI7A 3BH8A 4TNWF 5DO2C 2F58L 2ZUSA 3TBWB 5F7NC 1EUUA 1MRFL 3CH8A 1P6FA 4HFWB 4L5FH 5C09D 5ICYA 1K3IA 3IETB 4G7VH 1F3DH 3TA3D 3HPJB 2VN4A 5ETUA 2CLZB 5HYEA 2DDQL 4AIZA 3ZTNL 1F6AA 4LU5L 2K7PA 5M95B 2YSSB 3HN3A 3CX5K 1KTDB 3V5KA 4F7CB 5E8EB 3F62A 5DJAA 3ZT7A 4JHWL 2Z4QA 3L3DB 4PJ8A 3UYPA 3EJZC 5GRJH 1RJYB 1INDL 1KB5A 4XPAL 3WIFA 4TRPL 4G9FB 3DHJA 4KQ4H 4PGBB 3M8OH 4QEGA 2AI0L 3VRIA 4M61B 3P73B 3UP1A 1MVFA 3MRPB 3EO0A 3MXVH 4U4BA 1G7JB 4Y7MA 1AKJB 1D5BB 5CD5D 3JTSA 5EZIL 3OJVC 3ULVE 4YFEA 3LQAC 1Z2KA 4WTWA 1XGPB 2CO7B 2CGRL 2D0HA 3WEXB 4NKOA 3DRTB 2YPVL 1G7HB 1ZHNB 4M48L 4PJBF 4ZS6C 1P7KB 5D7IF 3RNQB 1CN4A 1J86A 2IANA 4OZIE 2FO1A 3U82B 1QBBA 3QJHA 4U1HA 2EDRA 5CEXA 2VTFA 2FECI 3DYOA 3O3AB 1MCBA 1JV5B 4YHZH 1KB5L 3NAAH 1CDHA 3FT2B 3IDGB 3ULUF 4OCNC 5JIIA 1QA9B 4QXTB 4M6OL 2NY5C 1KIRA 2X89D 4H0IA 3LB6C 1REIA 2R2EB 4G9FE 2EC8A 5KSVB 1F6FB 1FBIL 4V2BA 1YEHL 1NDMA 1VFOA 2Y7QA 1MJ7L 4RGNE 3VU2A 3EOBB 2XNAA 3CZFB 5FECA 1GXEA 1QNZL 5K93A 3CVHB 2EE3A 3L5XH 5IM7B 1NL0H 4TUJA 4PS4H 4JHAH 4KXZH 4N90E 1HXYA 1MY7A 4HBCH 2C4XA 5KVFL 4RMSA 4L8CA 2P7TB 4PD4J 4LVOC 4YFLI 4PRDA 3TM6A 3QQ4A 2UUDK 4CVWA 1SY6A 2OK0H 1I7TA 3HB3C 3M8OL 1JNJA 3GI8H 3MX0A 1RIHH 2F5BL 5FGRA 1U8PB 3NCFB 3NACH 1OW0A 2FIKA 1NCTA 2NR6C 3QH3B 2C4FT 3ARED 2NY1B 5D72H 5T1KD 4JVPA 2VO5A 2JIXD 1S7TA 3DLQR 5CHNA 1NAKL 1NPUA 4OZGA 4E9LA 3KXFB 3QDJB 2X4OB 3BJ91 3LKNB 4C56E 4TSCL 5ID1B 1CDCA 1Q9LA 4FQIH 2YD2A 5F89B 2UVFA 5I1CL 3UJIH 1AHWC 1JF1A 3LRGA 1SJEA 5LAXA 1A6TA 1TJGL 4BFIA 1IM3A 4KAQH 4XC1H 5DJZA 1CGXA 1CLYL 2IBZY 4HULB 1HSBA 1IGTA 5I8OH 1KENH 3QCUL 4K07A 5HI3C 1J88A 4ZS7H 1UEMA 1KJ3L 3SDAA 4WUUB 2OL3H 4NZTH 3N85L 5BMFH 4HCRA 1B0RA 1ZT4A 2A6DA 1QFWH 5D9SA 5C09E 1RZ8B 5IBTH 3GSVA 5HI5D 4PJ9B 1CXKA 1I9RL 4KQ3H 5DD3H 1FVCB 2D2OA 5F70A 4UU9A 4YAQA 4LNRA 3STBA 1J0ZA 5JNYA 4KZEL 3BZEA 5KZCD 2ADGA 5DA0B 5HYSB 1MAML 2IPTH 3C5ZA 1RUQH 3HZYA 1ZGLP 4MWFB 3MROB 1IGMH 3L5WA 2V2TB 4AM0B 4A6YA 4UBDC 2APFA 3R0MA 3UEZA 1FYTA 4RA3A 5EZIH 4AT6A 4EI6A 4FQLH 4Y4HB 1D5MA 5FYLH 3T0WA 3ARGC 2IPUG 5D1ZD 3OXRA 3D85A 4JGJA 2O5ZL 2HN7A 3VI3F 4Z8FH 4NUGL 4OD1H 4XCNA 3B9KA 2R2BA 1MCLA 3UROR 5GRJL 3QQ9D 1FH5H 1S7UB 2R0LL 4NFCA 1AFVH 3X12A 4X98A 4M00A 2ENSA 3C6LC 3O2DL 4JKMA 5IQ7L 1ZT7A 1WIOA 3E3QE 4URTB 4F80A 2QQLH 3I85A 4NC0B 5HHME 5KJRL 1FL6A 3GSRA 3D39A 1UACL 1I1CA 4WNQA 3VXQB 1CLZL 2GUOA 5DR5L 25C8L 1O0VA 1WWBX 4R97B 5FYKU 3RVUD 5EBGA 5I15H 1ETZA 3UZVB 3U7WL 1H3WM 3O3BA 1N6QL 5F72S 4A2LA 5HDBE 12E8L 4YHML 2V2WA 3RWHA 4G6KL 1QLRA 32C2B 2X4PA 3TBVA 1QSZA 2HYMA 3AM8C 4NZTL 1KIQA 1QFWL 1CU4L 1IGFH 5ERWB 1AKJD 2GJ6D 2W38A 4ZUVB 1UGNA 5D1ZA 4NYLA 3HAEH 2ZOLA 1ZHKB 4U31A 4ZDHA 4NC1E 4ZFZB 3ARSA 5LQBH 2RFXA 1AXSB 3CJJA 1IJ9A 5IBLC 1BVZA 4ZOEA 3PWVB 4X6BB 4WHCA 1A7BA 2GKIA 3G5VB 3V6OE 3C6SA 4MD0A 1RZKC 3RWEB 3HC4L 4KTEH 4HCRL 1EX0A 1MJJA 4I9WE 4MA8H 4U7MA 3AS3A 4MNQA 4GO6B 3MRDB 4NQDA 1PG7H 3I50L 2DL2A 4G9FA 4F9PA 4CU8A 5FUZL 4PJXE 1Y0LA 1DVFB 1OAKH 1OAZL 5J57B 3MRPA 4L4VD 5EBLA 5I1EL 4P46D 4HWUA 4RA0C 5F9DC 1UG9A 1X7QA 3S6CA 2BOCA 4MB3A 2MCPL 1B4RA 1F4AA 4HUXA 3GMPB 5BQ7B 1IC7H 4JDVA 4APQD 2QKIB 4HKBA 2YK1H 3IU4L 2Q86A 1A7RL 2KL6A 4UTAL 3FAXA 4QNPF 3RVXD 1AI1L 3WHE1 3EOYG 4DW2L 2IAMB 1SEQL 3EOAB 4XCEA 1PGRB 4B7LA 2VB5A 1CE1L 3O3AA 2DL9A 3D39E 4XZUA 3ROOA 1MPAL 4PJBB 5KN5B 5D7LD 1JPFA 3MRHB 3QAZC 5GZOC 4PB9L 1EK3A 5TF1L 3BQUD 3HRZA 4XNQB 3QCTH 4NSKA 4MLIA 3G6AB 3CVIL 1YEGH 4K3GA 4XPGH 1S9VB 3U30C 4W70A 3LEVL 2X40A 3HUJE 4I2XB 3S7GA 2Q76A 4YXHH 2C1PB 5T3XL 4PGEB 3EOBA 4X8JB 3HUJB 4I2XE 3ARDA 4JLRB 3T0BA 1M7IA 1U8LA 1JCKA 4HKXA 1E4JA 1KG0A 2YUWA 5EZJA 3GJFH 3O6KL 3WIFB 1E6OL 1X5YA 4OQTL 5IQ9B 4I5BB 4KVCH 1N3NB 3T0EE 5DEGB 1NBYB 4LSRH 5TF0A 3T3MF 4GSDH 2LTQB 1AIFA 1ZEAH 3G6JE 4M9OA 2ED9A 2F54B 4I0PB 5E7BA 1WT5A 2VC2H 3EZJB 4PJCB 4Y5VA 2ZCLH 3IFPB 4ZMAT 4WUUD 1NCNA 4U1LA 3FN0H 4JFFB 5JOFA 2R0KH 4YUEL 1BFSA 4IRJB 3C2AH 4ETQB 4NNPL 2I5YL 5IQ7H 3MXVL 2JF1A 4OLZH 2HT3D 3ULVC 3QJHB 3CH1B 4U1HB 2FO4A 4HZLB 3R1GH 4JDZA 3CCHB 2AW2A 3DIFA 3D1MC 1DBML 5F6IC 5L2KA 3RL1A 4YXLH 5T3ZH 3MGTB 1S5HA 1YPZF 4EXKA 1FAIL 1NMCB 2AXJA 3HI1B 2Q20A 3QIUD 4B0MM 3RPIA 2DM4A 4WTXA 3RNKB 3UTPE 5C9KA 3OPZL 4D8PA 5ALCH 3VH8B 2ZG2A 1BZ7A 3CFBA 3ARFA 1I1YA 4MJIA 3V52H 3RWGA 2FHFA 1KEMH 2Y7QB 5FKAB 2EYTB 4KJPC 4Z77A 5ACZB 4HC1L 1FV1B 1KN2L 3K8MA 3GBMH 4MCZA 1EO7A 1NCBL 1OB1A 1LK2A 4DK6A 1T6WA 1HXYB 3MLWL 1FQ9C 2VZUA 1SJHB 2BSRB 3FJTA 5LGHL 5HHVL 3GJFB 5GJSL 1ORQA 4DCQA 4ETYA 2HWZL 5FDWB 3SDCD 5F88B 1OM3L 3MRLA 1HYRC 1WIUA 4FZEL 3DX9B 3P0GB 4Y4KD 5F3HA 2A9NL 2V9TA 1L0QA 3AUVA 4ZODA 5DUML 1UADC 2DIBA 2HFEB 3OKNA 2C3XA 3C60A 4P2RB 3KYNB 3SKJH 4IIQB 5B3JE 3QDJE 2C3WA 3S88L 3HA0A 4G80B 3U2SB 2CKBH 2H3NB 1F90H 5C1MB 2I9LB 1SEBB 1N0LA 1VB9A 4Q6IB 1JI1A 1E6JH 3W11C 3O11A 1OT2A 2HN7B 5DTFB 4F7CA 4S2SB 3AU1B 4PTUA 4P0DA 5C0BE 5D1XC 2VUYA 4RMUA 4UT7H 1AO7B 5D2NC 1V7NL 3MUY1 4X9IA 4JFDA 1LVEA 5C0RL 2X4NB 4X4MA 1FL6B 1WUNT 5T33H 1U36A 2VUOA 1KIUA 4OI8A 1GYAA 2XG4A 1A7PL 4X6CE 4PJXA 3V5DB 3SE4A 1ZANH 2BSSB 4RAVB 2O61A 2NX5D 2GITB 5HYJD 2WWKT 2J6EA 3QEGH 4OZFH 2QHRL 4BFGA 5TFSH 3N1MC 2RBLA 4PJGF 1UZ6F 2A38A 5E56A 1CE1H 3HTLX 3LEXB 4TULL 4O5LL 1N7MH 3UTTE 5EO0B 2NY0B 5DMJB 1F4YL 3WMSA 4QRUB 5K9JH 3PGCB 1RK0B 5C0DB 5LQBL 1IT9H 3BIBX 4XB7A 4N0RA 1BOYA 2G9HA 1G7IA 1EFXA 4J12A 3S37L 3EFDH 1RUPL 4KTDH 1F8TH 5E1AB 4OZHB 3RWJA 4JAMB 1VFBA 3H3KA 1YZZA 2Z31B 1JFQH 1TETH 3GMLB 4KKLC 2GSGB 4R2GC 4NQDB 3GHEL 3HR5B 1KTDA 5I1IH 3ULUC 3WS6A 1HEZB 4JO3H 5DVLA 2X70B 2P43B 2F54E 5ADOL 1OCWH 1FGVH 4X98B 1S3KH 3ZO0A 4Q2ZA 3KJ6H 3LKOA 2FDBP 1FORL 3QIWC 4H1LA 5CJXA 3WJJA 5I1AB 4D9QD 1QBLH 2MTPA 3P73A 3KPSE 2H26A 4OUUA 4C58B 5F9JB 4YHLL 5IR1B 3TV3L 2FB4H 2VLJD 4NN5B 4ZO8A 5I1DA 5EB9A 3TIDA 1FNLA 2DAVA 4OGZA 1H15B 1R5IA 4DAGH 3IXTB 2LFGA 1MRCH 3BMVA 1GJIA 3JUZA 1TENA 3ILPA 2XG5A 3U1SL 5BS0E 3RWCA 4YHOL 3BO8B 1S7TB 1M05A 1DQLH 4FXLA 4BSVB 1KNOA 4HIXH 4HKZA 1J8HA 3HAEA 1KXQE 4Y4FA 1XCQB 1K4DA 5L8JB 4GXUN 4NBZB 1ZA6B 1YYML 1A6UH 3SKMB 3KYOA 4AG4L 3B2UD 3ZT5A 5DR5H 3ARDB 3MLPA 4MD0B 5B38G 2OXGA 2OR9L 4C57C 1MJJB 5CJQH 2CKBB 4LFHG 3VFVB 3QG6B 4XAKD 3S3SA 1N6QH 3W81A 1FZKA 3CZFA 5A2FA 4ZXBA 5E7FA 3S88H 2FBOJ 1T0PB 1JGEB 4TSBL 3MUGA 4P23D 4J3SA 1JE6A 5GISH 4OV5B 5ITFB 2HMIC 2VXTH 1BAFL 1FFRA 2HT2D 5C0CD 3LDBC 3TCLB 2XI9A 3TNNA 1AH1A 2EIBA 5I19L 3ARXA 4QT5A 2QKIA 1FPTL 3KLAA 4L3ED 3JUYA 1N5AB 4U0RB 3O6FD 4JZJB 1RZGA 4NNPH 1ZSDA 3O2WH 3W82A 4CVZA 2DBJA 4RGND 1FSKC 1YUHA 2DYPB 4H1LH 2FIKB 4GQ9H 1IEAA 4NWUL 3PXJA 1ES0A 3EZ8A 1Q0YH 4HBQA 5F7KC 2C5DC 3MRMB 3GZKA 1EJOH 2IQ9H 3QUMA 4IM8A 5LKNA 1I4FA 2XQYG 5EOCH 2J3SA 4FMFA 1RUML 3PWLB 3VE0B 3MUJA 4UOJA 3VXTB 3SDDA 1S9VA 3BGAA 4HGWB 2IH1B 3N1PC 4L3CB 1IARB 4MS8C 2R2BB 3OAYK 3OG4B 3FFDB 4XXCC 4P2OC 1IM3B 4NM4L 3TH2T 4OV6F 5DYOB 3MJ8B 2EDXA 3VI4E 2F74B 3GSWA 1KIPA 1T66D 1PZUB 1MJUL 1NC4A 3VW3H 1IGTB 1EHAA 5DUPL 4IRZH 1P7QD 4PP2B 4EDWL 5FYJL 3JV0A 5A43C 5D5ME 4LOUC 2EE2A 4X4ME 5HHVH 1CFQB 2X05A 4WV1C 1DJSA 1HILB 4LL9A 1S9WA 4U7SA 1KPUB 3REVB 4QRPD 2AABH 4OZ4A 3P9MB 2EYSA 2VR5A 4FZEH 5C08E 4U6XA 4UU9B 4YAQB 1GGIL 3V7AG 4QRTB 2HFEA 3OKNB 2OI9C 4BK5A 2YEZB 4R9HA 2YXMA 3ZKQD 4JN1H 2X9YA 2ZUQB 3ALWA 4AMKL 1ZEAL 5INDB 1BZQK 1S7WB 3ZTNH 5F3BA 5HHNB 5C0EA 1NH6A 5HD8C 1I3RB 3L95A 1V3KA 3TFKD 1QKZH 3EO1A 3MNWA 3QUXB 5EPMA 1C5BL 1CF8H 4V2CB 2MMXA 2N7BA 3I02A 3C6SB 5D7LA 4OD2A 1OAUL 2A77L 4EUPB 2AXFA 1HI6A 4JO2L 5CZVH 2EDQA 5C2BH 1OARL 4JFYB 4JR9H 5HPMA 1NAMH 3ZZ1A 5BRZB 2NY2C 2CRYA 2ZNXA 3HE7C 3SKNA 2DQJH 3EJJX 4QOKB 3RDTB 4KKBD 3RWGB 4M7LL 2EC9T 3EYUL 2BVTA 1FV1A 1X6NA 3KNBA 3KJ6L 5MERB 3QUKA 3GMMA 1PY9A 1I7RA 2R0KL 4JY6B 4PJAE 1EHLH 1SY6L 4O58L 2AQ1A 3F6IA 5FYJU 5J6HA 5GGRB 1T2XA 3UBXG 4G6JH 4CVXA 4NRXB 2ITDA 1H8OA 3QI9D 4KXZI 4DTGH 2BHUA 2IAMA 4DZBA 3ULSB 2ZZUT 3RKDC 3QDHA 2QQKH 4GAFB 4PUBL 4UNVA 3QEUA 2ADJA 5IBUG 2QQNH 4XPTH 1IKFL 3QXDA 3O3EA 3MRHA 3BQUA 3A6BL 5BS0A 1XF3B 4PBVC 4UILL 3L7FB 1IEHA 4XXDA 1P2CB 1CL7I 5CS7A 4ZFOB 3TWCL 3JWNC 3TBTB 3UC0H 5GRWA 4OFPA 1ZV5A 1QG3A 4PJ8C 1NLDH 4P5TA 1OM3H 1CZ8H 4LSPL 1X5ZA 2E7BA 2XXCB 2A73B 3GMLA 3REWA 4LP4A 1M6OB 1BFVL 3AU1A 2ZSVA 3FT3A 4Y8AA 4N5UA 1R5VA 1T21A 3PXHA 4ZXBD 3SGEH 1AO7A 3S96B 4ONFH 3U46B 2CLVA 2WUBL 2C7UB 4FFVC 1S9XB 3FQUB 1T4KA 1QBLL 5GSVB 4I48B 5EOCL 3QXUA 3IF1B 3JTTB 5LG1A 3G5ZB 4JPKL 4N0YH 3MLTA 3ILQC 1FNSH 3T0XA 3C09C 5F9OL 5BV7C 2CIIB 2BNQE 4JFFA 4F9LA 5C0RH 1N26A 1J8HD 5K9OA 3LHPH 1J1XL 4QRRA 1RZJL 5JHDA 1KC5L 2CK0L 4OZGF 5ID0B 1YMMA 4HPYL 2J8UF 4LEOA 2D03L 2ZPKL 3JVGC 5BRZE 3FRUA 4PJGB 1QUNA 5HYSG 5D7IA 3ZTJH 4G43B 3U36B 4BSJA 3FOMB 1B4JH 4XVJH 3VXNA 3IU3B 4UUJB 1YPZA 5JR1L 5IF0A 5T5FH 3NCYS 5IK3A 4OZHA 2VDLL 5C0NC 4XNYH 2C1PA 2XTLA 3UTPD 4RZCB 2WIIA 3MXWL 3ARGD 2AJVH 2FX9L 1TPXB 1M7IB 1U8LB 4YK4B 4NRYB 1G6RA 5DVKA 5EU6A 3D39D 2CDFA 1IC4L 3AAZB 3S36X 3QHTC 3ARGB 5EOQH 5IT2H 3Q2CA 3ARBC 3R06B 4IDJH 5DHVA 3GGWA 4ACPA 1KBGH 3EHBC 3NH7L 1TVBB 4NKIH 2FEEI 2VL4A 4Z7NE 4WWKD 4JB9H 1R5IB 2LTQC 3TCXA 3DRQB 2MWCA 5JXEA 5FV2A 3T0AA 1D3CA 3B9AA 3W39A 2XACC 1T5WA 1UCBL 4QF1B 4ZAKD 5HBBA 3WBDA 4JKPH 3BHBA 1RHFA 2B7DT 2JB6A 5IJKC 1EHLL 4D0CB 4L4VB 3HMWL 2O5ZH 5IVXA 2RAMA 2VYRE 2MPAH 2CR6A 3EYOA 4MA1B 3S8WA 2IPKB 1RJZB 1X4ZA 5FA4A 3K1DA 2D9CA 1QZ1A 4PTUB 3VXRD 2R39A 2X41A 3U30B 4Z7UF 1DLHB 1T04B 3BP6A 1D6VL 3PQYE 3RNKA 3H8NA 4HX1A 1FNEA 5DYOA 3VGFA 3VFPB 2Z92A 3VH8A 4D9RE 4X6DE 4TSCH 4M7LT 3O4LA 4ODXB 4Q7DA 1AHWB 4ZAKA 5DD3L 1W72B 4LSUH 4RWHA 1MF2L 3HC3H 3O6KH 1CK0L 5CAYB 5C07D 5HGHA 1BGXH 2X1QA 4DUXA 3MCLL 3UAJC 4P4RB 3PP4L 3GSNA 2QADB 3HHRB 1SBBA 5L9DL 2YD6A 3NTCL 3DARA 1CQYA 1AP2B 3MO1A 4PYGA 1XR8A 5EC1B 4HK0B 4R7NA 4KROD 3ZDXF 1YUHB 5D93B 5CP7A 4WI9A 4FXGA 1T1XB 4NFDA 4KRPB 4UNTA 4LVOB 3KR3H 2X9WA 1FJ1A 1U9KA 2IQAB 4YHPA 1A2YA 3G5YA 1NEZA 5D6CA 1A3RH 1IGJA 5D1QA 1FLRL 2ZCKH 1A7OL 4LVNC 4X80L 2A83A 3NCJH 3SKNB 1KXTB 1DQMH 5JPMB 4Y4HD 3FQXA 2CDGB 2EKSA 2P48B 4PP1D 1L7TH 3TJHD 2X42A 4O2EB 3FQWB 2HLFD 3TNMA 3NFSL 4LBEA 4YWGH 1GGYA 4IMKA 2OSLB 4LCYA 1CU4H 1IGFL 1NCAH 5GRZA 4OCMC 1KELH 1NGYA 1DR9A 1G0YR 3ARUA 3ULUL 2QQKL 3V52L 1NBVH 4I0PD 5KSAD 2HJLA 5HDQH 3CFKB 5DQ9B 4H26B 3Q1SH 4NCC2 1Z5LB 1AGCA 3CVIH 5D70H 1I7UA 4OLVH 4WU7A 4X5LA 4GRWE 1EBAA 1F5WA 3RVVC 5JHDE 1IKNC 2ICWJ 2UZXB 3NGBB 5I16B 1MH5A 1VFMA 2ICWI 5FAAA 3MUZ1 5GGTH 2YMXL 5E2VH 4X99A 2YD8A 4IJ3B 3I3BA 4U0QB 4CUCA 5KSUB 1M6OA 43CAB 1ZK9A 3I02B 4AEHH 3GMQB 3TZVB 5MEQA 1Q38A 3LH2L 3C8HA 1TZHA 4I77L 3OZ9H 4K8RL 3DO7B 4YX2H 4KH2A 5IMOA 3RWDB 3ZL4H 3CX2A 3QFJA 2AABL 1S78D 3O2VL 4MXVF 1K8DA 5D93C 5DWUL 4OM1H 4O02L 4R90L 4WTZG 3HCVA 1ZLVH 5MP6H 1I9JH 1N2RA 1ZVHA 5EULV 1W8NA 2CJUL 2W1NA 3L7EB 4HWZA 1GH7A 1A8JH 2CSPA 2J4WL 3KPRE 4ONGL 1WBYB 4PB9H 4XNZB 3EO9L 2BHYA 2HAZA 1RZGB 1FN4A 2QHRH 4JZJA 3ARPA 1U92A 4Q9QL 5IEHB 3DUSA 4W6WB 5AAMA 4G3YL 4QHLB 5HYQB 3N1GC 1SY6H 4Y5XC 4OIIL 2KPNA 3RWCB 1A7PH 1QR1A 1RZIB 3BGFB 1JPGA 4C4KT 1OGAB 4X9GA 3CC5B 1AI1H 1FVDB 1I3GL 2Y5TB 3TBYB 4JPIB 4JFQB 1ZLUH 1QQDA 3MMEB 3O45A 1MHCA 3BEVB 5DRNB 5C9JB 5DSCA 3VXTA 1EEZA 2X4SA 3T65B 4OM0L 2OCFD 2GK0B 1P5UA 4OQTA 4L3CA 4LKCB 5IKCA 4N0FA 3BD3A 3C9NB 5D7JD 1OGTB 4FG6D 4CRPA 4WIQA 1UM6H 3FO0H 2VDRH 3OKKB 4Y0GA 2EDWA 4R3SB 3L3DA 5BOPA 1FE8L 5JHLL 1X5FA 2X1WL 5DC4B 3BIKA 2EECA 2A0LD 5LXGL 1BPVA 3KR3L 4LSTL 1T89C 2DLEA 4J4PA 5AUMA 1IQWH 1A6VL 2WWMC 4YHLH 5DLMH 3C5SB 3FQTB 5DK0A 3AB0C 2NXYD 3WIHH 5KANI 2XKNA 1A7OH 3U0PA 4GAGL 5FYLD 4HW6A 2MKLC 2X5PA 1U8PA 3SO3C 1QYGH 3QO0B 4NQEB 4OSUH 3U7AA 5ADOH 1C16B 4NKQB 5K9OB 1FG9C 5I66B 4PRNA 3KWWB 5INDA 4DVBA 4JY5L 5FA3A 4K71C 4WWKA 1YC7A 1YMMB 1T0NA 2Q3AA 3GSUA 3CDYA 3VXOA 2VIRA 1AD9A 3L9RA 1QFWI 1NCDL 3F58H 3G08A 5CGYD 2CQVA 2Y06H 3LQZA 4IRJD 3X14A 4LLDB 3E0GA 4UT7L 3DYMA 1NJ9B 3SDDD 1HHJA 1A6TB 1YYMH 4XVSH 1E28A 3MNVA 4JO1H 4CL7A 2F54D 5FO7B 3MV7E 3SE8L 3VFPA 5B22A 3UAJD 2R2EA 1F4WL 4ERSL 2KUTA 4N8VB 5EU5B 2XZQH 1WVZA 4YDLB 4K7FA 4LEXL 1C5CL 3HC3L 3NZ8B 2BVPB 3MFFA 3GIZH 3QEGL 1ZLWK 3O81A 3IAGC 3QR2A 4GMTH 5JORA 5GGRA 1P4IL 4S1SH 3CDFA 1NCWH 3RA7L 4CMMB 2PUQT 4BK4A 3SCMA 4FQ2L 3L3IA 4XPAH 4P5TD 2BVUA 1D9KC 3KPPA 5C0CA 1FSKB 1WZKA 4LGSB 2HT4D 5HHPA 1KT2B 3O41B 4OLVL 3UJTH 5CEZD 4O02H 3UO1L 4Q6YA 1Z0NA 2Q6WB 2YEZA 1T5XB 4DGYH 1DFBH 1S8DB 2Y5EA 5DHYA 5E2JA 4FQCL 4OF0A 4U33A 1JTOA 3GM0A 4JO3L 3EO1B 1JNLH 5D1QB 1DEEA 1HXMA 4NUJA 3TPKA 3BIAX 1JWSA 5D7JA 3ULVF 1R5VB 2G60H 4NGHL 1SJXA 2Z4QB 3H9ZA 3MA9L 4PJ8B 3F8UB 4WO4B 2NXYB 1DN2A 4NM4H 5IW6A 4J8RA 4MX7B 4M5YH 5KSAC 4ODWA 3FB7B 5KJRH 1S7XB 5E8OB 5E94B 4X4XA 1CL7H 4YEEA 4U6YB 4PGDB 5CSZB 1P4LB 3IDMA 4GKNB 5D2LF 3UCRA 3MV7A 1V7MH 1EGJL 2H45A 2Z35A 2UZIL 3KVQA 2J4WH 2V2WB 3RWHB 2PYFB 4P9MH 3MLXL 1G0XA 2W0LA 3B4NA 1P7KA 5LJYH 4HEPG 4LLUB 3CFCL 4QRRB 5AG9A 2JJSA 4EQ3A 3KPTA 2BC4A 2NXZB 4FQIL 1LO0L 5KSBF 1C5DB 4K2UH 4AENB 1TETL 1ORSB 5TGBB 5HYSA 4LAJH 1ADQH 2XTJD 1J0JA 4NKDB 5J1AA 1CXLA 2EDNA 3TLRA 1JN6B 4U49A 2FD6L 1XF5B 3QFJD 2FATL 4OCYL 2NY4D 1SVCP 1SJVA 4BH7A 4NQSA 1NDMB 1F4YH 2NZ9D 4P59L 3MRDA 1IGJB 2JJUA 2YSSA 2OTPA 2DN7A 2L4OA 3AXLA 4GRMA 2FB4L 1FO0B 1CGSL 1T22B 4XNUH 5CZKA 3H9SD 4N1EA 3RUGE 3IDXH 2K3TA 3VFUB 1UH4A 2EC9U 5DMGD 3K80A 3MOQA 3GJEA 1OAXL 2F19H 5EZOH 2KKQA 3FB8A 1NGYB 4GS7B 3IRZA 4YE4H 2EDBA 4OLEA 4QHLA 1FHGA 4KJQD 4X6CB 2X4PB 3B6SB 1ZMYA 4KZDH 1C5CH 1Y6MR 1IILE 4P9ML 3ESUF 4JM2C 1GPOH 4NQTA 1DQJA 5IBTL 1U8NA 1CFNA 4JZNA 4O4YL 1UXSB 4QRPA 3MJ9A 3O6FA 4X7TB 1QQDB 3CGTA 3H9HB 3GUTA 4HEME 1GIGH 1Q9LB 4NQVA 1HIMH 2ATPA 4LCCC 1OP3H 4TQEL 3QUZD 2ADFL 3IFLL 3QXTA 4PJ9D 4OAWB 3A0OA 3RU8L 2DD8H 4RX4D 1HSBB 3QUZB 1DLFH 2DQFA 3QNXA 1X5IA 4Z7VE 4POUB 3ZE1F 1UXWA 2GAZA 1LE5A 4EXPX 2YUVA 2ZG1A 5IMMB 5TPWL 4TTDD 4KK5D 5ISZB 2OL3A 3FHQA 3P0YH 1K8IA 2GCYA 1TZIA 3M45A 5DS8A 4UINH 4EVNA 4NZJA 3RX8A 3WJLC 4EJ1C 1G1CA 2HFGH 1WWAX 3ZHLA 1FGNH 3STZB 4BZ1H 5JOFB 1BBJB 1JP5A 3RIFK 3EIFA 1QRKA 5T3ZD 5DGQA 3UXFA 4B50A 5C6PB 3QI9C 3CFJA 3VA2C 1D9KB 4TUOA 4Z7UA 1U3HB 4J6RL 2GTWA 4HCRH 4HUMB 1EA9C 2GT9B 3RGVC 4OJFL 2J8HA 1G7PB 4Z95L 4XVUD 4FOMA 3O2WL 1HHJB 4JFEE 4CJ0A 1CLCA 3EYOB 5F1OB 1AC6A 4F7EB 3RQ3A 5FO7A 5B39B 4E5XB 2HKHL 3QIUA 5DUPH 4WY7L 4QRQB 3HE6C 2I60H 3B9KB 2WW8A 5AZ2L 2IMMA 1QP1A 3EDJA 4PGEA 2VLRD 1VACB 3X11B 3LRHA 5GGRY 1FFQA 3HUJA 2IADA 4Y88A 1BMGA 2ADFH 3IFLH 3BKJH 3ARWA 1WJ3A 5KG9A 2XZCH 3FZUC 5F1IB 2HT4C 3LKSB 5HVHB 2VLKD 4NZRH 2R0WH 5I76A 3RKPA 3WIIL 3S3JA 5E9DD 5AYUL 4ZUWB 4L3EE 4U6HB 4Z5RB 2VZ1A 5F1KC 1L0YA 3C6LD 5F88A 5AWNL 3TBVB 1FNAA 4IDLA 2WANA 5C0CB 3K4AA 4JRXD 4KC3B 1FG2A 1R3LA 1VFAB 1MWAL 1Z5LA 3GNML 3ILQD 3FQNA 3NBNA 3BZEB 5DRXA 3PWJB 3KYNA 4JREC 3ARFD 2BVOB 4MNGE 4GG8A 3TN0A 3MNZB 5GGTA 3VFNA 3CSYA 1FZOA 1PG7L 5SWSA 1UWXH 1UA6H 3GKZA 4HIEA 4PJXF 1J7VR 3WD5H 5GSRB 1IAKA 1GZQA 4QTIH 1A6AB 1DEEB 2MSPA 2WM0A 1TTGA 5BW7C 4NUJB 3U7YL 4JEGB 1YMHA 2FEDC 1DL7H 4S1DC 4Z7WF 2NY5L 4MNQB 4BQ9A 4M3KB 3TEUA 3MNVB 2PXYD 3BSZH 1DBKH 5IBLD 1WWWX 3ARFB 2ITCA 3WFZA 3GBNH 3WNPA 1YNKL 5IB1B 3PHSA 1JYXA 5GGVL 4CMHC 2EIZA 4LSUL 3FOLB 3VRJB 3IT8D 4Y5YA 3RZCB 1TDQA 4JJ5A 4ELMF 2W0KA 1F4WH 1ACYL 2DQEH 2BSRA 3EYVA 5SWZA 3S34H 3MRJB 2IFFL 3BZDA 3VG9C 4XCEB 2DQGH 4N1HB 3CFDB 5IWLA 1OTUD 4XAWL 2NY4C 3LEVH 3CK0L 4XT1C 4DQOL 3DMMD 5F3HB 2W65B 5D96B 3ARDD 4S1SL 4O51B 2FHBA 3NN8A 2A6IA 5BVPL 1D5IH 4NKDA 3QZWA 4WO4C 4G8FA 4KJWD 2YWYA 4UT9H 4UINL 4GKZA 1I7ZA 1XIWB 3PHQA 2GK0A 3MXWH 4L8SB 3C2AL 1S7QA 4N0FB 1RIUH 3DVGA 3T3ME 2VQ1B 2EDDA 5KSUA 4KUZL 4OLUH 1HEZA 1WAAE 2FRGP 1DDHB 3BRGC 2A6KA 2FBJH 1C08B 1NLDL 3OB8A 4YPJA 4LF3A 4U2YA 3T3PF 5C6TL 1ONQA 2CXKA 1M7DB 3O3UN 2EDFA 4PB0H 5ANMA 5BW7A 4KHXH 2D3VA 3ULVL 2P5WA 2VABA 1T1ZB 5GIRB 1RZJH 2Z93B 4PJIB 4GKNA 1E4XH 2B4CH 3BKCL 1KULA 4N8VG 3SKJL 3NCBB 4K7PY 4R0LB 4XX1E 1FGNL 1MFDL 1M4KA 1NMBL 4X6CA 5CMAA 2CKBL 1B2WL 5CGTA 4F7MA 1E6JL 5ISZD 2QEJA 4QGYA 4LQFL 2W91A 3L3JA 4Y2DC 3OX8B 4K3HA 1MHHB 2UZYB 2OZ4L 4DOHE 1G7QB 1QRNA 5E5MB 4ALAH 2EIEA 3OKMB 2VE6A 3FMGL 3TPUA 1AO7D 1F3RB 1U8KB 2AEWA 5GJSH 1H8SA 1C1EH 1A02N 3QIBB 1BIIA 4RISH 3S35L 4UB0H 5F7EH 2EDOA 1QLFA 4PG9A 4KROC 5HHOD 4HJJH 1MHCB 5TH2B 1R5WA 4AJ0A 1XF5A 3BD4A 1N0XL 1FFNB 3C6LB 3MLWH 4BH7B 4BFEA 2Z31A 1I1YB 4MJIB 1B3JA 1I3UA 4C54A 1FL5A 4HS3B 2GSGA 2IBZX 4QOKE 5F9AC 3BJLA 4L8DB 5IMKB 5B21A 3HE6A 5E6IC 4PRAB 3V4PL 4JLRA 3QDGD 4D2NA 2OK0L 4R90H 4J4PD 2MJWA 4MJ5A 5J1SC 1LDPH 1JNNH 1BQHA 4OGYH 4Y4HC 4CAGA 3SDXE 2BHZA 4QWWD 5GS3A 3KLHC 2YKLL 5GGSY 4QT5B 4LGRB 3KXFD 3KPPB 4U1MB 3MRLB 4XI5D 2W59A 4MD4B 3OJDA 4OF7A 5F7FA 5IT2L 2R29H 3MLSL 5HHPB 3DTXB 2MQ0A 3QO0A 1OL0A 2IGFH 1ES0B 3TT3H 4BH8A 2VDOH 1PZ5A 1MCJA 3WDHA 4JQXC 1A3RL 4EQ2A 3BUYB 4MNQE 3VXOB 4Y16C 3VFRA 4ZOAA 4HF5L 2E5EA 2FGWL 1YEEL 4XMPH 4FP8H 3VXUD 3GUTB 35C8L 1K4DB 3F12B 1HK6A 1J0KA 1F02I 2DQGL 3KYOB 4TYUA 3D9AH 3THMH 1QO3A 1HDMA 1X5AA 1KLGB 2BRRH 5E8PA 5I1JL 4M6OH 4RFNB 3MCLH 4LMQI 4HJJL 1QFUH 2XZCL 2ZJSH 3GBNL 3QG6A 4HWBH 1W72H 4G9FD 5IB3A 3VD4A 3PJSB 2WUCL 4Y5XB 4NHUA 5CILL 4QHNB 4U6HA 4Z5RA 2RIKA 3SPVB 1BECA 5BZDB 2YA0A 4WW2F 5C86A 5CINL 4F8TA 3K8KA 4P4KD 5HY9A 4X9HA 1T7VA 1G6RH 1QFPA 1F3DJ 1K2DB 1J1OL 1DN0A 2XY1A 4DQOH 1XGQB 3L3KB 4K3DL 3RJQB 1F2QA 2PR4L 3BZFA 2ZSWA 3HZMB 1MCWW 3GSXB 2JTDA 3CFEA 5I8EB 5MI0B 4EOWL 2CRMA 2B0SH 5ITBH 4G8GE 5E8DL 3WL9A 1YEKL 3TA3C 3WXVH 2B4CL 3QUMB 1FGVL 2M2DA 2OS7A 1LD9A 1LMKA 5KS9E 4RWYH 4AQOA 2C9AA 2X89A 2X4UB 1HNGA 4Z78A 1DP0A 4FQJH 5LWYL 4IJ3C 3VXSE 3I3DA 4YWGL 4JFXA 5E6IB 1YY8B 2R69H 2YPVH 1F2XK 2XPGA 2YZ1A 5I19H 2PW1A 2VLLA 8FABB 3IDIB 4HC1A 3QEQB 1CR9L 1JIBA 5INCB 5SX5H 5CD5C 5F9JA 3QHFL 3PDGA 3QRGH 1OP3K 3DXAE 3QWOB 4D9LH 5I76B 5C2UB 1EBPA 2BXYA 3QIBC 1MFCH 1FBIH 4P2QB 1QSVA 4JGMA 5JMOC 1PAMA 1WICA 1SBSL 4K9EL 4BFBD 4C83A 2EYSB 1NGXB 1BQSA 5H35A 3B8YA 1M05B 3Q5OA 4HUWB 5D2LA 1JNHA 2OZ4H 4UILH 3IB4A 3ROLA 5TQ0L 4JG0L 5C08A 3I84A 4PIRF 4X6FA 1LEIB 1AE6L 5BV7B 1BOGA 3MNZA 1M71A 1C7SA 5DMYA 3MR9A 1TFHA 2OJZH 2NQCA 3BW9B 1OP5H 3OMZA 1BVLB 4K3JL 5J1AB 2Q8BL 2VQ1A 4H88H 2HTKC 3IAPA 3V5KB 4CN4A 1AXTH 3EFDL 3UTZB 4WI3A 3K2UH 2VLJE 3MLRH 2Y1VA 2A6KB 3QA3B 1YMHB 3UJJL 3TA3B 3VFSB 2VITA 3BVNA 3RJDA 1WFTA 4YPGB 4AEFA 2EE9A 4XPBL 4MDIB 5FO9A 4NP4H 4FQQA 3X3FH 5J13C 2FSEB 2J5LC 1IL1A 3UTSD 5HI5C 4QRSA 4WFED 5KS9A 4HK3J 4PGZA 5EFIB 4JN2A 2GFBA 2R0LH 1FYTD 3ECBA 1QEWA 1WCQA 1DQDH 1MFDH 4FTVB 4JJ5B 2CIIA 1U2HA 3MA9H 1G7HA 6FABH 1KCSL 1Q94A 1BFTA 4CVXB 1N5AA 2ITDB 1QOKA 3OR7A 2FWOA 2PXYA 4WDIA 5E4IA 4P99A 3ULSA 3I6LD 1INEL 3A67L 1U95A 2UYLB 4HJ0C 4LSDA 4L3EB 4BKLB 1ND0B 3VGAC 5IIEA 5T1KA 3AGVA 2P8PA 3HI5H 2R9HD 5EN2B 5BJTA 4TOYL 3LEYH 4IS6B 3D2UD 3QUMH 1JZ4A 1HWHB 5F1NA 1UQSA 1X5HA 3PWPB 1XIWA 5L0QC 2IH1A 4R7DA 5IVNA 1S7QB 3EOTL 4HWBA 4QWWC 1CDBA 3VGGA 4GG6E 5FECB 1LO0H 1PX4A 1RSFA 2F15A 2JLLA 2R2HB 3CVHA 2EEBA 1AGBA 4YO0A 3V6OC 5ABDE 5DJDB 4LCUB 5JUEL 3I6LE 4ODTL 3OKEA 3OAZH 4U6VL 1KB5B 1JL8A 1MELA 1WC7B 2APVA 3PL6A 4HH9B 4ZUTB 4DFHA 4JANB 3DPBA 3EYQD 4OSUL 4IOFC 3WNLA 2BDNL 4PJEA 4OLWL 1T1ZA 3ZYJA 1KPUA 2VLJA 2VDRL 4JR9L 4U1MA 1IGML 3G5ZA 2HP4A 4L4VE 2NLJB 1P1ZB 1VKXB 1R3LB 1VFAA 3DWTA 4U6XB 3HC0B 5TE7H 3QDAA 2HVJA 5LXGH 2E27L 2EKJA 3D0VB 4I18B 5EBWA 2DWEB 1BQUA 3AREA 3KYKH 1L0XA 4JRWA 4DGIL 2ZKHH 2XICA 1UZ8B 3O6MH 5IJVA 4GQ9L 1EZVY 1HHIA 4Q58C 1FVEB 1MI5E 4PFEA 3U0TB 2V2XB 3QQNA 1XEDA 3KPSB 5EUOB 1P9MA 1PG7W 3B9EA 4J3UA 3O2DH 3WXVL 4FQXD 1HNFA 3ZDZF 3UYRL 2C26A 3IJSB 2Z8WC 3C8KB 1QLFB 1CGYA 4PG9B 5E70A 5H37G 1HYSC 4UUJA 3QDGB 2FH8A 4ODBD 4RGOL 1DLHA 1T04A 3BP6B 3QUML 5EUKA 5ILTL 1NFKA 4F7EA 1LO5B 5AZEH 2BRRL 2R1YA 3MLUL 1NCDH 1NAMA 1XH3A 3GRWA 3WUWG 1T03H 4FABL 5KZCB 4NT6A 3BEWB 1F45A 1JUFA 1MCIA 1A3LL 2XNAB 1BZ9B 4OZHE 3RI5F 2D31B 3MLXH 5E8NB 5HGHB 2H2PD 2OM5A 3SPVA 4XBGB 1U3HD 3PP3H 2YWZA 3HAEG 5HYJA 5CKGA 2ZG3A 3LAFA 4W4NA 4NRXA 1MVUA 1N6UA 2D03H 3MRJA 4ZUWA 1HKLL 4R0LC 3UC0L 2IALB 4WFGD 3RGVB 2QADD 1Q9KB 2CDEA 2HH0L 3TVMA 2WP3T 5DMGC 5GZOD 4N8CL 4E41E 3IRPX 4I0KA 1ITCA 2FIRT 5F9WB 4JZJC 3KYMB 3DRQA 5K59F 1V3MA 1R3IH 1V3JA 4JG0H 5DDHA 5I30L 1U8QA 3P9LB 1A4KA 2ERJB 3UYOD 1BFOA 4OIBA 5FEBA 3I50H 4TNVK 2H9GB 5I8KL 4MJID 4NDMA 2LVCA 2XA8L 3NIFF 1P7QB 2WUBH 3G6JF 5EPMB 4Z78B 5JW4M 4TVPL 4DGYL 4OD2B 4JFXB 1HQ4A 3CXDH 4S1QL 4YHIB 1U8OA 4X7SH 2VQUA 1NFDB 4XMKL 3OF6A 4PJHB 4HX1B 1ZOXA 2OJEA 4YGAB 5HJ3B 5CEYB 3EYSL 4XCYB 2DKMA 1F11A 3MLSH 1JZ3A 2Z93A 4PJIA 1MPAH 2X7LB 2ORBL 2GQHA 3K4DA 4HSQA 4X6DA 5GZNC 4LQ1A 4D9LL 4JFPA 1KELL 3FOLA 1IBGL 4YHZL 3ULUH 4KK9D 4Y5YB 3RVXC 3RZCA 1B0RB 1Z6JT 3FO2B 5DD5H 2IJ0C 2VAJA 1JMZA 3PF2A 2XTJB 2HT3C 3ULVD 1DZBA 2AJXH 2HKFL 4PJ9A 2GYSA 1W72L 2YBRA 1JHKH 5C0AA 3HG1A 1E4WL 1PKQE 1ZHLB 5EIIA 4RMWA 1IKFH 3I75A 1E6OH 1YQ2A 4GXVL 3WFHB 4FNLH 2BNUA 4QYOB 4PJDE 3QCTL 3L7FA 3BT2H 1RZ7H 3BYTA 4GKZB 1V5JA 3QP3A 4AT6B 4EI6B 4F33B 4HZAA 1RVFL 4KJPD 4EBQH 3G5YB 4WI4A 4YXHL 2CK2A 3RIFF 1FL5B 1GOGA 2VKWA 4RZCA 1QPPA 2DQIL 2IAMD 1U8IA 4N0CC 3BN9D 4JM4L 1MQKL 3TV3H 3H42H 3UX9B 1QHOA 4M1DH 4NP4L 5I1LB 3KDMB 2A1WL 5C8JB 4LLYA 4MJ5B 3IXAB 2VAAB 4Q9BA 4F57H 1VGEL 4ZOCA 3SDCC 1QEWB 1SM3L 5C92A 3U48A 2VABB 4MJIE 4JFZL 3J8F7 2GJJA 3H3PL 2E8YA 3ZYOA 5FUOH 3QCVL 3V6ZB 2C3GA 4M7JL 3EAKA 4DGVL 2VDMH 1HINH 1ZHNA 5B38B 3ROOB 5KN5A 5HVHC 1YDPB 5DD5L 4ENED 3O9WC 4M8QB 1D5XA 1I3GH 1IC1A 3N1QC 4WW2C 3VFWB 1XZ0B 2GSIA 3BWAA 4YC2C 1UQSB 2V9QA 5C9JA 4UT9L 4TULH 4WI7A 4ELKB 4ZAKC 1EFQA 3S5LG 1JF1B 1BVLA 5IFHH 1YPZB 4BFIB 4LHUD 1OGTA 1MJ8L 4KGJA 5TE6L 5TH2A 1PKQA 5IF0B 3QRGL 3R0NA 3RWEA 4KGLA 1TITA 3MJ9L 2ATKB 1CFTB 5DUBA 2ED8A 1TZHB 5BVPH 2VDNL 1RJCA 1U6AL 5F6HJ 1BLNB 1I9RH 4KQ3L 4HUVB 3QPXH 4Z6AT 1RZKH 3G6JB 4HDIA 5JLZB 1WC7A 1JGLH 1LK3L 2GJ6A 3DV4A 2V5YA 1RFDL 1YYLH 2XFXA 3GHBL 2G2RA 3HZKA 3PDOB 5E00A 1IL1B 4M1CC 1EERB 1G9MH 3K2UL 3QULA 3GSVB 2JCCE 4JN2B 4KUZH 3GSNB 4OKVB 4IDJL 4NBYB 1OD7A 3TN0C 3ECBB 1KBGL 4LVEA 4DKEL 5JXAL 3QQ4B 4O2FB 4U1LB 2EEDA 3G6DL 5JXEC 4M48H 1EMTL 5IEHA 1RMFL 2X9XA 4AIXA 1K6QH 1KTKE 3KYAA 5CFHA 2HVKB 5IUSA 1FYTB 4KKCD 1UM5H 5FK9A 3S4SB 4KK8C 1H0DA 1GAFH 4LHJB 5DFVD 4G8GD 3UTSB 3X3FL 2P5EA 2W9EH 5I17A 2R1YB 5D7KE 4QLRA 1LNUB 3WHXB 4HAGA 1NCUA 1PQZB 1HZHH 4LCIH 1V3LA 1CD9B 1NBZA 3DI2B 4KU1A 5J06A 4WW2B 3NABL 5CD3B 5E8NA 5AWNH 5HDQL 2E7LA 2I9TB 1I1AA 3MTRA 4PJFB 2VSCA 1MSPA 4RBPK 4AEEA 1QFOA 1ACZA 2YN5A 5SX4I 1MWAH 4P5KB 1SJHA 5KVFH 1R3KA 4JKLA 3S37H 4OIIH 4YDKH 1RURL 4QHNA 5A2KH 5HI4D 2IALA 3RGVA 5IBUB 5FDWA 5IHUL 5GJTL 4MJ4A 3CFKA 5DK0B 5F6HI 2F54A 1HN1A 3GI8L 3CAFA 3UTTB 3KPLA 3NCYP 1BAFH 3MBED 1ULVA 2YPLE 4S10A 4M1DL 2DQUL 4K3EH 4PRHD 4ZTPL 4ZOBA 1QSEE 1U8QB 4PJ7A 5EZLB 4P57B 5IFAH 4HS6B 5IV2B 4HBCL 3K7UA 2XA3A 4JFEB 3OJ2C 4MQXD 4WFGE 3TYFA 4NCDA 1DL7L 3G6DH 1NL0L 1P7QA 1S9YA 2W0FB 4ZPVA 1XFPA 3BT2L 3GSXA 4Q6IA 3CFEB 3D85D 5I8EA 4WU5A 5C0BB 1T1XA 3O2VH 3BDYL 4Q9QH 2WQ8A 5EU6E 4YJZL 5L88L 2JJTC 4NO0D 4LGPB 3W0WE 2X4TA 1J18A 1NJ9A 2YD7A 4M7JH 3UJIL 4UV7H 3ULUD 1E28B 5E4EB 2PTTA 3BP7B 5E6ZA 4KV5E 1Q0XH 2A83B 5MEND 4OCSH 4UTAH 2MOVA 4H5SB 5B8CB 1FZMA 4ZYKA 1U91A 4NFBA 5IEKB 2IFFH 1EHNA 3IDMB 5EFIA 4F57L 5HHMD 1EV2E 5L7XL 1FZJA 5DEFB 4X9FA 2NY3D 2GY7B 3NOIA 2O61B 3O6FC 2Q86B 3Q3GA 2QJDA 1WBYA 2AJXL 1EVTC 1ORQB 5GGVH 4XBEH 1C1EL 2J2ZA 1ZKAA 1F6LL 1G6RL 2IBBA 5HHQA 1QFHA 3NIGE 3EJYC 2WUCH 4KRLB 1MWAA 2IAMC 5ILTH 3DGGA 5DJ6A 5GJTH 5IVZA 2AXHA 3DROA 2BNUB 5J9PB 3QXVA 3PQYA 2F9BT 2CH8A 1H3VA 1RZ7L 2DKUA 4JFED 4I2XA 3TBSB 3B5HA 4I3SH 2I9LA 1C12B 1MREH 2JJTA 1MCNA 4X6BA 4PJ7E 4P2RE 4Q6IC 4MAYA 5E03A 3MLVL 4BSWA 4JQXA 2R69L 3GB7A 1A1OA 1MFEL 2Y06L 4LLYB 2XY2A 4M8VA 2XN9B 3BUTA 4UV7L 1JWUB 4QOKD 4NWUH 4ZSOB 5AUMB 1AIFB 1RIHL 3O9WD 4OLZL 3C5SA 3FQTA 3TO2B 1X7QB 4QHKI 1HOCA 4OKDA 2VDOL 4TSAL 1BJ8A 3V79C 2JCCA 1Y18A 5DA4A 2A9MH 1NSNH 3HFML 3KPQA 1KGCD 1IM9A 2WWMD 3AY4C 4X9BA 3M1BB 3TFKC 3MRBA 4NNYA 1JWMA 1MJUH 1CFNB 4M02A 5JDSA 4P4KC 1WBZB 2O5XH 5L6YL 1YN7B 2YZ8A 5HDBF 4RQQA 2HJFA 2CUMA 3FCTA 4TQEH 3C8KA 4LK4A 4WEMB 3SKOB 1BJ1H 1NCBH 4XNQA 3SKMA 1T0MA 1KJ2H 2Q8BH 3CU1A 3QPQC 2W0PA 3PWPA 4ZD3L 5KSAA 1OVZA 3GKWL 1VFBB 4GBXC 1ZT1B 4P2OA 4F7PA 4MQ7A 5TQ0H 2BVQA 3HS0A 4X0KB 4D3CL 1UM6L 2PNDA 5TPWH 4JRXB 1MREL 2VERN 1OF2A 4MCYA 2IAND 4NKMB 4Y2DA 4YBLB 2V7NA 4K71B 4NN7C 1GGIH 1N0XH 3D2UB 4FHBD 4G7YL 2W07A 4M1GL 3DETD 4EVNB 1YECL 4LHUG 4MZ3A 2CIKA 2X1PA 4PJEB 1J87A 3H7LA 3SO3B 4OGAD 3STZA 2Z9TA 3H42L 3O4LD 4M5YL 5I1DB 3UPRB 1FO0L 2VXSH 1PEZA 4FFWC 3DX9A 1CFVL 1J1PL 1K6QL 3IFPA 4NQED 4P2YA 3DGCR 1CICB 1ZVSA 4KPHL 4PPTA 4HK3N 1TVHA 4EBQL 3VXRA 3G04B 4M4RA 4OCRH 4GW1B 3WNKA 1D7FA 1C7TA 1OAKL 1O5DT 5HGDB 5IW1A 3CCHA 3IU4H 3SHSA 1C5BH 1L4IA 5B39A 4S2SA 2VDML 4QRQA 2Q7YB 2Y25A 4LAQH 2ATPB 2LAAA 1ZA6A 5L0QB 3RPIB 1FFOA 2XQBL 4HXBH 2B20A 4WW2A 5I71B 1DEDA 2P5ED 1PG7X 5DRZA 4OLXH 1X6LA 3D69A 3WN5C 3BGFC 1JI2A 1E27B 4YE4L 4K7PL 2BVEA 4P5KA 2R0WL 3B5GA 4JFPB 3VGAB 2DMBA 1XIWD 4Y19B 1N7ML 3LY6A 2O26U 4HUNB 1JGVL 1HILA 5IESH 4MB5A 5TDNA 3U83A 5K33A 2G2RB 2OQJA 2Y07H 4U3CA 1YNLL 4LPYA 4L29A 1XGTA 5TJWK 3SCMB 5I1KL 4DCQB 3SDCA 4XC3L 1PKOA 2JKXA 2XKUA 4WUKL 5BV7H 1A6WH 5GGSB 4J7RA 1ZA3A 4TRPH 3VWJA 3QDME 3O8XA 1FZOB 3L3HA 3UJTL 5AYQA 4ZPVB 4OCWH 5E08L 3TIEB 2D7TH 2YC1A 1A6AA 2H9GA 3UTSE 1J05A 4F33A 2DQDH 4JAMA 5DVNA 2X4QA 2YUXA 1KEGH 2PR4H 3PWLA 4U1NA 3PIQA 4LCWB 2D7QA 4J3OC 5DTFA 5HPMB 5FB8A 5FGBA 3QHFH 4D0DB 1MCKA 2V5SA 1INQA 1PSKH 2RGSA 3NGBC 4GBXB 2E6JA 3KPSD 4HHAB 1JZ8A 1ZHBA 1YPZE 2O5XL 3GMMB 4GT7A 4I3RH 4JY6A 4Y8DC 1FZJB 5L6YH 5DEFA 5L2JB 1KCSH 1NBVL 2NW2B 5BRZD 3LQMA 3LD8B 1ZTXH 4PJ5D 1IAIL 1JTTA 3LN4B 1UENA 1AR1D 4WFEE 3MV7B 2BSSA 3CFDA 5FCUL 1GIGL 2GITA 5AEAA 1OHQA 5I0DA 4LDLB 2AJZB 4Z0XA 2GK2A 3GBML 1KN4H 3QXAB 4POZD 5FO8A 3P4OA 2BY1A 3KPRB 3ZSSA 5K9KA 1RURH 3MA7A 4JY4B 3ISWA 4Z7VF 3LH2H 1MRFH 4I77H 1FLTX 4HPOH 4NQVB 5CJBA 4I3SL 5T1LD 1S9YB 2M26A 3LPWA 1VCAA 1SQ2N 4N8CH 5A16A 3PG2A 1CFVH 3CXHJ 4FQXB 3RWJB 3RWIB 2CKBA 1NDGA 4GMSL 2PETA 4PRBA 1F4XH 5D1XA 4MA7H 4EI5D 3BOVA 2A9NH 5DUMH 3HMWH 3AFLA 3HZKB 5E00B 5D4QA 5DS8B 1KCRL 4NPYB 1BD2D 4JKPL 3TNNB 4NO0B 3V5HA 5JDJA 1CGTA 4R0LA 5ALBL 4NM8L 3GJEB 4XPBH 3O6ML 1QSFE 2H2PC 4JPVH 1DBAH 5D96C 2XQBH 4DZBB 4JDTL 4M3JA 4OCLC 4NRZB 2VZ3A 5J7CC 3ILPB 4NIKB 1W0WB 4Y1AA 1X4YA 2PYEB 1WTLA 4UDUB 1KJ3H 3DGGB 5DJ6B 1G7PA 2PKDA 1Q72L 1NGWB 4RGNB 1FCGA 3ZYIA 4Z7WA 1H0DB 2YA1A 4PJBE 5C07B 4QRPB 5ALCL 3O6FB 4X83A 3ALXA 2GSIB 2XIDA 3BWAB 3H9HA 5TFSL 4Y4FB 1RHHB 2LVEA 3IJHB 3OQ3B 4XP6L 5IK3B 1L7IL 5ICYB 5J3HC 3N0PB 2EZ0D 1UVQA 5I1KH 5FM5O 5FHAH 2QR0B 3REWB 2I25N 4OFYD 4MA1C 4LSTH 4HXBL 3ULUE 3T2NL 4D0BB 3HZVB 1QNZH 5LVEA 1WK0A 4M6NH 1QPXA 3BMWA 4JM2A 3LKSA 1MCPH 1KJVB 2OL3B 2CIKB 2BSED 3MRIB 3QUXC 1TVBA 5GGUA 2XFXB 4I48A 3EO0B 4UTBH 3JTTA 3P9MA 1AKJA 1D5BA 5EU3B 3TO2A 4KWUA 1QVOA 5HHOA 4CNIB 4KTDL 1AD0A 3FZUD 5I8CB 1MFEH 3LS5H 1VEMA 4F37K 3NACL 3UBXA 2OI9B 4LDEB 5TE4L 3QH3A 5EIQA 3KLAB 4PV9A 1GHFH 5DRWB 1L7TL 3HMXA 3WLWD 4LCWD 5DQDL 1Q9WB 3B43A 2QQLL 3CDGB 4IOIA 2W0FA 4XP9L 2WSKA 3KXFA 1U3HA 2JIXA 3WUWB 2AJ3B 4NHCH 4S1RH 4JHZA 4DUWA 3U36A 1INDH 5D7LB 2AQ3A 4IRSD 3D25A 2HJFB 1AR2A 1HI6B 1QA9A 4HGKC 4NQCA 1NCAL 1TCRA 2HKHH 5KW9H 4GMTL 4KROB 5DC0A 5DD6B 1UB6A 2BNRB 1A22B 5T1DH 4PP1C 5EO9A 3UPCA 1L7IH 2Y4SA 2HLFC 3FO1B 4NZDA 3VDCA 5J11C 1KFAH 3VWKA 1Z3GH 2JB5H 3HB3D 4N0CD 4NKMA 2ZUVA 4Y2DB 4JKKA 2MHAA 2JJSC 3ZYZA 3IYLW 3Q3GB 5H8DA 5D1QD 3V9FA 3A6OA 4Z7VB 3T77A 4AG4H 3E6HA 3EYVB 1EUTA 1FE8H 1XCTA 5LGKA 4I3GA 3F65A 3E6FA 4QRPE 4XP4H 3P2TA 1FVCA 3D3VD 2BNRD 4U6TA 3JV5A 1FNHA 1IGYB 3F7YB 3P4NB 4LLWA 4QTHA 4X5WB 1A7QH 1MLBB 4YX2L 1XT5A 3QNZA 3SN6N 2ESVE 2N56A 4XHQA 2YXFA 3W9EB 2VXQH 1YYLL 5CP7B 4WCYL 3O2DA 1RVFH 1BFVH 4RRPA 4HS6A 1QYGL 4UT6L 1AQKL 4GW1A 1YEKH 3SDAD 3MGAA 4Y4FD 3EDFA 4P5TB 5D7JC 1VHPA 3TBSA 4HD9A 1RUKH 3MV8E 3WDIA 3MLYH 1I3RA 2CLZA 4OF3A 5DD1L 1J1PH 3C87A 3MNWB 1H8NA 3QUXA 3JBG7 3BPNB 4PRIE 1YEFH 1AO7E 4XCNB 5F89A 4K94L 4BSWB 3QEHA 1OSZA 1FORH 4PY7B 4C59B 1IC5H 5C7XH 4JFZH 4P23A 1QHPA 2FGZA 3WYRA 4ERSH 5ESAB 4ODVH 2AK4D 4GFTB 2J1KA 3JVGA 4YC2B 4WFFE 5DVOA 1T2QL 3VG9B 1HWGB 2ZCHL 3LKPA 3EYSH 1QLRB 1NAKH 2OR7A 32C2A 1RZ8A 2NYYC 3FTGB 3NZHH 2IANB 3B3IA 3V95A 1P4IH 5SWSD 3RVWD 2ORBH 3AM8A 3PABB 1QSFA 3AMKA 3VFGL 4AIOA 5F7DA 3GSOA 4NN6C 5EC2B 5D5MF 1JGVH 1V8HA 3CUPB 2EDJA 3T4AB 1YN7A 3A6CL 2BOBB 4YBHA 3IDGA 4RQQB 2NY6D 3GSNL 5B8CC 5HDOA 2NY2B 5FYJE 3SKOA 2OR9H 3TBTA 5E99H 3G5VA 1EAJA 3WIHL 2ZNWA 2PO6B 5KSVA 1S9KC 3MRFA 4K3EL 3OXRB 1LK3H 4AIZB 1UT9A 4U05A 5J6GA 4D9QE 4RMRA 5GRUL 4U1KB 5JIKA 3SEPA 4LSSL 5DQJB 5E8EA 4FS0A 1TQBC 3HNVH 3K8LA 1OP9A 3HE7D 3ARGA 5C0IB 2VDQH 4HHAA 4JREB 1JPTL 4KHXL 3MACL 4GW4B 4WHYG 1P84J 3VRIB 5E5RB 5BQ7A 4V1DB 3GSRB 1G7MB 4L9LB 4UOW1 2AEPL 1Q94B 4P9HC 3JXAA 4PRHE 5I18H 2DICA 3HMXH 1ETZB 3VG0L 1IM9D 4NO3B 4PREA 2APWA 1BM3H 2P45B 3UTOA 5A2JH 2AV1B 4P2RD 35C8H 1TVHB 2AK1H 1MIEL 1EGJH 1S7RB 1XGYH 3F6LA 4LLAA 4PBXA 2Z91A 3RGHA 1NAML 3RNQA 1KV3A 1HHGB 1XGRB 2Y6SC 4ZPTB 5FO8B 3RX5A 2DQJL 1JWMB 2VH5H 4Z7WB 1MHPL 4NQXB 4MAUH 5I74B 2VE6B 2ZUXA 3GK8H 1RIVH 3MBEC 4YZFE 1SVZA 4X6FB 1LEIA 4WEBH 1WBZA 5D2LE 3MZTA 5E9DA 5KVGL 4G42A 4LLMB 1FDLH 3T1FA 4NOFA 3BW9A 3U4BH 4X99B 5JO5A 4MAYD 4K9EC 5C0BD 2RQ8A 4MB4A 4Y16A 4P46C 3OKOB 1CXEA 5DRZB 1OTTC 5L8KB 3BGMB 2N1KA 2P44B 1E27A 3OR6B 2DLTA 3TH4T 2ARJQ 3IFOA 4G5ZL 1NKOA 3HUJF 4PD4K 5D2NE 4JANA 4BZ1L 3MCG1 5DFTA 4MCYB 3MV9E 3MRIA 5GGUB 3D2UA 1Y6KR 4TVSa 5BZDA 3R06A 2GFBB 3D87B 3Q48A 4XNUL 5FYJD 4EOWH 1JPSH 5HXMA 4NQEA 1RULL 5F8RC 1I7TB 3P30L 4J2XA 3OHXB 1FL3A 3T4YB 1AY1H 3EDDA 5MEOB 1VDGA 2ZUYA 2E7CA 3C2SA 4DKFL 4HIHA 4LKXA 2WK2A 4G8EB 3CDGA 4XP5L 2VIRB 5FM8A 4JFFD 2JIXB 4WJ5B 2AJ3A 4I4WA 3WUWA 4WY7H 1AQKH 3QDMD 4U3XA 1V05A 4AQ1B 1QR1B 4GMSH 1J05B 4OD3H 1A7RH 5J0BA 2E6PA 4ZFOL 2WINB 4E42B 3D85B 4OCSL 3CXHK 4N9OB 1GPOL 5D7KD 3WFEL 2IPKA 1KJ2L 1I1FA 1XF4A 3NZHL 4D8PB 5FA4B 2CRZA 1JZ2A 4MXWL 1S7SA 5ALBH 2AAVA 4I0CC 2E7HA 3MBEB 5LCVL 2JB5L 2D31A 5D7SL 2ID5A 3V8OA 4JM2B 5K9JL 1CE6B 1HCFX 3LN9A 5EOQL 1A5FH 3SDAB 4ZUTA 3GJFA 3DX7B 2FR4A 4ONOA 3L3IB 1QLEL 4GS7C 2H2SC 1NQBA 4EZMA 2XKNB 3MBXH 3G9AB 3U0WL 4ODHL 2UWEE 3VWKD 2E9JA 4LNRB 1U8MA 5BO1H 4JY4A 3P77A 3ZE1E 3QIBD 5C09B 3IDXL 4ZFZA 1JPTH 1M71B 1UZ8A 5K9QI 4DVBB 2ENYA 1MCQA 3FONA 1Q9WA 4IOIB 3VXUE 1HHIB 4ZNEA 1I1AD 1JZ7A 2YC1B 4LVHB 5CBEB 1PBYA 3LQZB 4J6RH 3MGTA 1A2YB 2NZ9C 1I9JL 4UV4L 3IJSA 3NH7H 4JVUA 4NKIL 2R0ZH 4QKXB 4LIQE 4R6UA 4TOYH 3K3QA 3AS1A 3H0TA 4RNRA 3I2CH 5LWYH 1VA9A 4UTBL 2NYYD 1F3JA 1KB9K 2EO9A 2ICWB 2B8OT 1OY3B 2VH5L 4NPYA 4RAUA 1OAYL 2I60L 4AY0A 2VLLB 4Y1AD 3BESR 5GS0C 3WNNA 1EEQA 5A2LH 4U3HA 4HKBB 3K74B 2PYFA 3SDXB 3R1GL 1B9ZA 1J12A 3OV6A 4XC1L 3VG0H 3OR7B 3PP4H 1FN4B 4W81A 4X6DF 43C9A 2NPLX 4HWEL 4Y5YC 4IHOA 3F7PC 3PABA 2LQRA 4P4KA 4YIQA 2EICA 3Q5YA 3BZ4A 4LPXA 1MF2H 3VCLB 4YHNA 4MJ6B 1MLBA 4RGOH 4UDUA 4GXVH 5SWQB 1RU9H 1RZJC 3DXAB 4DZ8B 3CC5A 1NGWA 1L6ZA 4G6ML 4ZTOH 3LQAH 4YQXL 3MA7B 3ZKSD 5C08B 5D1XD 4F3FB 1JN6A 1UZ6E 5CJXC 1OTSD 1GZPA 1JHLL 3B2VL 1CGUA 4XRCA 3DURA 2PW2A 2ZKHL 3BPNC 3C9NA 3QQ3A 1I9IL 3O11B 3PWVA 4WUKH 5C0FB 1NC4D 43CAA 1MQKH 4ORGB 3WS6C 3IDYC 1BX2A 4WFHE 1RK1A 4OF6A 4TPRH 4OGXH 3O3DB 2YR3A 2DQHL 2NNAB 4PJFE 2C1OB 5H2BB 3VXUA 4MGXA 5DFWH 1WQVT 2NY5H 4LRNL 1NLBH 5E8OA 2FSEA 1G7MA 15C8H 2D9QB 2VLJB 1ED3A 4L4TD 5ESAA 3SO5A 5DZNA 3QUYA 4Z7QE 1YJDH 3V5DA 3NA9L 3IXTA 3J7HA 1BM3L 4JDVB 3EFFA 5EBMB 1XF2A 4EIZC 3KJ4C 4FQHB 1FNGB 2IWGA 1T83C 3I6KB 4K8RD 3HI6L 1UH3A 1JTPA 2EDKA 3B2UC 3RGVD 3L5JA 4NOBA 4L3EA 1RJLB 2EH8L 4NQXA 5DD0H 5HYQA 1NUFA 1H3PL 1J8HB 3CUPA 4TVPD 5C0AE 3X14B 4ODUA 1QTYT 5JOEA 1RI8A 2XZQL 3BP5B 1MCRA 3DVIA 3QDGA 1AC0A 3OKDA 3WFEH 3DX6A 2BX5A 1JRHI 4NQDE 4PJDA 1OWWA 4O5LH 3CLFL 2E7MA 2OTWA 3UZQA 3MJGX 3S5LB 3GMOB 4JGUA 3QWRA 5IOPA 4GRLB 3CVHL 2HTLD 4D0BA 3WSQH 3HZVA 5IMMA 2VISB 1H3TA 1JPST 3V0WH 4NWTL 5FHBL 5HYJB 3BKYL 3DX8B 4HIIA 2R29L 2VAAA 3TCLA 4GW4A 2IGFL 5C0CE 1QRND 5DT1L 4GKOA 4N9GB 5DJ8A 3B9KD 5HGBB 1K3ZA 1VADB 4WFFD 5GPRA 4O9HL 3VRLE 3FB8B 2R2CA 4XH2B 3TIDB 4XNMB 1EMTH 4JPVL 4MXVE 1OCWL 4M1GH 5C6WH 4LKXB 2QTEA 1EAPA 1KTLB 4J3TA 1MUJB 5EBWB 4Q9RL 1TZGL 1H3XA 2HLAA 4LSQL 4MS8D 1T5XA 1B0GB 1NEZG 5F8QC 3BE1H 4M43L 4R4FL 3WLBB 1OQOA 1WFOA 2RB8A 1BWWA 3TH3T 5JPNB 5FDYA 3HI6H 4MHHI 1W0VB 4FQ1H 3X3GL 2HRPL 3EO9H 5KSBA 4TNWK 3QIUB 2FJFA 3QZWG 3FMGH 3OF6D 4OZIA 1T1YA 2EXWD 3TP4A 3WN5B 1PYWB 5HGGS 1R24B 3CLEH 1IGCH 4P23C 4L4TB 2WNGA 2E7LC 2P24B 1DUYB 2NY6B 4X6EA 3T8XA 1JYNA 4RFNC 1N5YH 3SY0A 1ZTXL 4M5ZL 4XCYA 1E4XI 1T03L 1MCFA 5T1MA 2D7MA 3V6BR 4RSVA 4XAWH 3O4OC 1N8ZA 4LAQL 4POYA 1RY7B 3G6JA 4HDIB 3BXNA 4X6DB 5DEZA 1I8MB 4FMKA 1OB1B 4TUKH 3DX7A 4BUGA 2FR4B 5D6DC 1HKFA 2GCYB 2JELH 1BVKA 1K85A 1U2CA 3QULB 3VI4F 1W0YT 2GW5A 4X4ZA 2H1PL 4KKNA 2XZZA 3CNKA 3TVMD 5CWSB 4YGVA 5GZND 1AGDA 4NQUA 4PJ7B 2FATH 4PV8B 2EH7L 2F8OA 5MEOA 2HFFB 3EGSA 4JN1L 3QBTB 1IQDA 3RY4A 2BOBA 4FTVE 5EU7C 5TDPB 4LPTA 4ZTOL 5E24E 1TTUA 3L95B 2B1HH 2Q6WA 1KXVC 1IAKB 5A3IC 4OD1L 3F58L 1A7NH 3RAJH 4KJYB 1FPTH 4P2OD 3SDXF 5F44A 4TN9A 1IQWL 4NQSB 2DM2A 4I8DA 4K7PX 4OBSA 1CG9A 4ONHA 4AH2A 1QRNE 4YK4C 4R8WH 2VXTL 1YEDB 3FB6A 1KCRH 5DQJA 2D4DA 3U6RB 4LQFH 3TC9A 1S7SB 5F7WC 1G0DA 1T22A 3R8BB 4DKEH 5JXAH 3MOBH 5C0IA 2B2XL 3IXAA 4XWOD 2OJEB 3P30H 5IW6B 4C56A 2DI8A 3ZE0F 5CEYA 4O00A 1NC4B 4PJFA 3BN9C 5J6HB 1F11B 1CE6A 1N59B 1R3KB 4HWBL 5EU7E 1WBXB 3QPXL 2Z35B 5ISZE 4PJ8D 5FXCH 1UB5B 1KJ2B 1YC8A 4HMCA 2DLGA 5D7SH 5CILH 1JF6A 4ZPTA 4M8QA 1IAIH 4QCIA 1PY4A 1CI5A 4IBLT 4XPFH 4B53A 4MXWH 1J10A 2K7QA 3QZWB 1ZLWH 4F3FA 5C09A 4OFDA 4UT6H 3TYFB 2XTJE 1I7ZB 3PWPD 1YEIH 1BQLL 5ETUB 3WLWC 4WU5B 5C0BA 4ODHH 4OAWA 1F6AB 1G7IB 4OGYL 4IRZL 2XYCA 4EDWH 3X13B 1MCPL 3OKOA 1AGFB 4RDQF 5DJAB 4WW1A 4NGHH 2NNAA 1XGUB 3MV9D 4ZFGH 3IFOB 1M7DA 2VDKH 2FJHB 3IFNH 5IB2B 4H20H 2ITCB 1KCVH 5ITFA 2PYED 1OAUH 2A77H 2BY2A 1JNNL 1HCVA 4OKVA 3X3GH 4PGJA 2JJVA 3KPOB 3SCMC 3WEXA 4XI5C 4IEFB 2G60L 4NKOB 2O93L 1T2QH 2AEIT 3DI3B 1WITA 5A40E 1LILA 4G8IB 1ODAA 1J1XH 1WTGT 2YS4A 3MJ7A 2BFVH 4U7KA 3BDXA 1TJHL 2CUHA 4F2MA 4J3VA 4MVBC 1Q9OA 3IGAA 1MHHA 3G9VA 3ARTA 2WV3A 4FFZH 4LEOB 5HHQB 1MFCL 5IVOA 3M07A 1P69B 3VCLA 4MJ6A 5BCAA 4PY8J 4YHKL 2Q3ZA 3DROB 5JQHC 2A6IB 1SMOA 3NIDF 4JZNB 5KW9L 5FOJA 4J23A 2E3VA 4W6XB 1XZ0A 1T80A 1KIRB 1T0MB 5EOTB 4Y19E 3JV4A 3EYUH 4OZGE 4ODTH 1YNTA 3FRPA 2J8UE 4CMHB 3GSQB 4EDXA 1ZVYA 3K1KC 3HPJA 3M17A 4FFVD 5KSBE 4YDKL 2W60B 5EO1A 1DUZA 3D3VE 4LASL 1KYOJ 4GXUM 5DFVC 1RK1B 5EU6D 2V7NB 4WWKC 2A74B 1I1AB 2XQYK 5KOMC 1IC4H 2IPUK 5F1IA 3HNVL 4OB5L 3OTTA 5FYLE 4NQDD 1A7NL 3LV3A 1JGEA 3KYKL 3SGJA 1LO3L 1CT8A 4U1GC 4M6NL 1I8IB 2V5TA 1CGVA 2YPLD 4JQIH 3DUUA 3MLTB 4EN3C 3U4AA 3V4UL 3D6GA 3U9PH 1T89A 5I1GH 3ARVA 1BD2B 1J11A 5AD0A 4XP1H 3ARBB 1D5ZA 2BVOA 1MI5B 1WZMA 1Z0MA 2C3VA 1FNGA 4ZO6A 4KJQC 5F3BB 5CZXD 3FONB 4KV5F 2ZOKB 4LPUA 5HGDA 5IW1B 1NC2A 3PL6D 2NY3B 1OGAD 4XHJC 2DLFH 2YOCA 3F12A 4GUPA 3OBAA 2FYYA 4EUPA 2AXFB 2YPKA 5JW3H 3V7AE 4P46A 5C70A 3BN3B 1IGIL 4PJAB 1VFUA 3SJVB 2CK0H 1CD8A 2DTMH 2OBGA 4E5XA 2P24A 4X6EB 3T2OA 3DX6B 3E1F1 1ACYH 3ARBD 4Z76B 4XMLL 1DE4B 4G6KH 4XVJL 4KRPD 5IEKA 3B8SA 5C0GB 4QXUL 4Y5XA 4NHUB 3MBEA 2LV4A 5E2WH 2XRAL 4Y19A 1KIPB 3CK0H 2VZSA 5JOPD 2I9TA 4Z9KB 3LPFA 2M1KA 3BYYA 3QXWA 2R15A 1S7VB 1BQHB 3ET9F 2P7TA 4NBXB 4HC1H 5CLTA 4DOHB 5IHZA 1S9WB 4PV8A 4JRYE 3REVA 4YDIH 2FJGB 3QI9B 3O8XC 5T3XE 4YHNB 4XVTH 2VDKL 3UTTD 1MWAB 2W65A 3VWJC 5D5MB 3SGJC 1DLFL 2FX7L 4GAJL 1A6ZA 5GISL 3ZKMD 2KQNA 2VDLH 4OCYH 2ESVD 5A1AA 2Y9RT 5F7HA 3MROA 3U9PL 1OAQL 4OJFH 3BHBB 4L8SA 5IVXB 3WLBA 4E41D 4HIEB 4LSSH 3VD9A 3PWNA 1KCUL 3GIVA 2VL5A 1FC1A 5DK2A 3QJFA 1G6VK 1MFAH 5DO2D 3TYGL 1LE9B 4PJHE 5CIPA 2EXYC 4MAYB 3UJJH 3V6FB 1T20A 5LAXB 3MACH 3O3DA 3WN5A 5BXFA 2V5MA 1IFHH 2XWBB 3V6OA 1IBGH 2UY6A 4PJIF 2AGJL 3GDBA 4C56B 1BBDH 2XV6B 3NFSH 4H5SA 3TT1H 4ELMA 5GSVA 5B8CA 1YEJL 5GIRA 4P3CL 4EUPH 1MEXH 5FOBB 3PJSA 2EIZB 4M7ZC 2ICEB 3CLEL 4R4ND 4UI2A 3O3BB 4G6FB 5FYKL 5GQBA 3BKMH 3ZHDA 2VXVH 5EBMA 5FF6B 3DMMB 1LEKA 2BY3A 3OB0H 2EDEA 4M5ZH 3GSNH 3IDUA 3T0DA 5BS0D 1T7XA 5I1HL 43C9B 1IM9B 2BSTB 2G5BB 5AAWA 3ZDYE 1X5JA 2VOTA 2VSDA 2P5EE 4CN6A 5I73C 4OLYL 2UWEB 1BIIB 4DEPC 4ODUB 2DQCH 3ARFC 6CGTA 5TDPA 3HE7B 4ZS6D 2DI7A 1UA6L 3PUCA 1AXSA 1ERNA 1LO2H 4ZFOA 4OFYA 2F5BH 1QFWM 4HFWA 3GMQA 5MEQB 1J8KA 3DBXB 4YHPB 3S98A 3PHQB 4R4BB 4G5ZH 3IS1X 3TJHC 1NEZB 5D6CB 1PEWA 2HG5B 5EIVA 1TMCB 1CFSA 3RWFA 3QFJB 5IB2A 4G8GB 1BX2B 2BZDA 1R3JB 2ZP0T 4JFOB 4H20L 3Q5TA 3DXAD 5K59E 1F8TL 1KTRL 3LPGA 2EKSB 3DX8A 4HIIB 4GBXA 3CSGA 1CDYA 4N8PA 3IDIA 2VN7A 5ANMB 1O7VA 2CLVB 4BQ6A 3U1SH 2WIMA 4HUXB 1AY1L 4ZSOA 3VJ6A 1MQ8A 3EDKA 4OI9A 3IF1A 4KHTL 3NCJL 2B1AL 4XCFL 3MFGB 4XNMA 5C2BL 5GS2D 1S3KL 5I73B 4IRSB 2AKRA 1ROWA 4JFDE 1Q9OB 4CDHA 3DETC 3IGAB 4NN6B 3DRTA 3EFFB 4BH8B 2DWDB 1NGQL 1GVIA 5D71H 5HYJE 5IGXH 1HHHA 3AY4A 3RBSA 2VXVL 2H2SD 1FAKT 1A6UL 5I18L 5GHWL 1U3ZA 3GIZL 3DMMC 1NMAL 1G9NH 4JPIA 3VWKC 5F1NB 3MMEA 1JHKL 3O45B 3QIBA 2HRLA 4R26L 4G43A 4X4YB 1EEZB 2X4SB 3T65A 2NR6D 2IMNA 4XTRD 3BRDA 4UAOB 4WO4D 4GJTB 1CD0A 2Q8AH 3MR9B 2VMFA 4RGMB 3O0RL 1SJEB 4D94A 3K0WA 3BKJL 1JJUA 2VR4A 3V2AR 3S34L 4OF5A 2LAGB 5F97E 3SY0B 3X13A 1XAUA 2NXYC 1YNLH 1NEUA 5T1MB 3D69B 2D4FA 4NC2B 5IB3B 1XGUA 4WI5A 2QV2A 4X0KA 4GRWH 1U3HC 4HH9A 2D7PA 2VISA 1OF2B 3LV3B 1OP5K 1J1OH 3BD5A 1D5IL 5CZXC 4PJEF 4P4RA 3RZCD 4MYWB 3D5OF 1WAAF 5DJ0B 5DHVB 5ESQB 4KMTL 4PRDB 5BO1L 1AFVL 3WKMH 2ERJC 3T3PE 4OGXL 1L9NA 4I3RL 3EYFA 3ARBA 5GGSA 1LQSR 3P9WB 1XGQA 2CR3A 4HK0A 3MJ7B 5SWZD 1IQDB 4BYHA 1MLCB 1RUMH 5D6DA 3DTXA 5DQDH 1MUJA 3GSUB 1Q1JL 3MYZA 5DGRA 1T1WB 1T5WB 3GJFK 3KPSA 3G08B 3QCVH