3JUYA

Crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
233
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCQASGYRFSHFTVHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGEWGWDDSPYDNYYMDVWGKGTTVIVSEIVLTQAPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B3 single chain variant HIV-1 antibody
publication title Crystal structure of a 3B3 variant-A broadly neutralizing HIV-1 scFv antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA01
2P49B 3VWKA 2YSSA 1MCKA 4KJQD 4U1NA 1A6UH 4P2QB 4MCYA 4PJGA 4C58B 1W8OA 2XNAB 4X7FC 4L3EA 3MA7A 1KCKA 2ARJQ 5GXBB 4LCYA 1M7DB 2ED9A 1PKQA 2JJTA 4G8GB 3WHE1 3QPQD 4Z9KB 2X70B 3FFCA 1FYTE 5F7KC 4XNQB 1BM3H 3H6JA 4Y5XB 1JF5A 4KZEL 4D94A 1P84J 3HZKA 2X10A 32C2B 1G7PB 3WFHB 3WO4C 2IANB 1I8LC 5ICYB 4HWUA 1P6FA 3EJYC 5DTFA 1ZSDA 4QCIB 4QRRD 1BZ9A 1CD8A 2VKWA 4HAGA 3STLB 4TPRH 3PWUA 4CADA 1YJDC 3MGTB 1KG0A 3P73A 3ILPB 5GGVL 4UT9H 4U2ZA 2NMSA 3V6ZB 5L88H 5FM5M 1PZ5A 5FYKH 3SDXF 3NMEA 4ODWA 4UT7L 1AD0A 4C83A 3VRIA 5DXWA 3CCHA 4ENED 5I74C 2P5WD 4ZUWA 5CZXC 3GEWB 3EOBB 4G6JL 5F9DC 3VXRE 3TYFB 1RZ7L 5EUOE 5C2UB 4ZPVB 1M6OA 1ADQL 4NWTL 3VGDA 4UOW0 3L3DB 1MH5B 1ZVHA 1H9VA 2VXSH 3VFVB 2CJUL 1UJ3B 2WK2A 1T20A 4FQPA 3VMOA 2DWEA 4CL7A 3Q6GL 3EJZC 3IETB 3OKEB 4LSDA 3BVNA 3EYSH 3O6LL 1HQRA 3SDDD 4WGVB 4C55A 4AH2B 5HHQA 3UTTE 4XPAH 5CIPB 4GUPB 2Y36L 4GT7A 1LO4L 4FG6C 4PYGA 2P4AB 2EDEA 3OQ3B 1YECL 3ARGB 1T3FA 4XVTH 3OGCB 5E24E 4YHPA 3SEPA 5C08E 2C4FT 1WC7B 5GRVL 2W60B 1SYVA 3CZFB 3FB5B 1TVBA 3W9EB 2B5IC 5GS2H 5JTWA 2P7TB 4XH2A 1WFOA 4BH8B 3LKRB 4PJGF 2V2WB 4HWBH 3GSOB 1T5XA 5E95B 1HEZA 5D7JB 3QDMB 4MAYC 3O4LD 1MQKH 5C8JB 2AJUL 2XRAL 1DUYB 1P69B 1I9RH 4MS8C 4FQHA 1PQZA 5T5FL 1S7XA 2GTZB 5B3NA 2FH8A 1ZOXA 5T1LD 3NA4A 1NAMA 5FCUL 2ZOLA 3QR2A 3VJ6A 2I9LA 1IGJB 5EPMA 3HI5L 1FV1B 4L8SC 3FT4B 4JJHA 1S9WB 4EQ3A 3NIGE 1UKQA 3RP1A 5IFJB 5JIKA 1HNFA 1A9EA 1ZLUK 4K9EH 1CIUA 2FWOA 4ELME 3KYAA 2WWMD 1MLBA 4XNZB 3MUY1 1FFPB 3IFPA 1XGRA 4HMCA 1MHHB 5FKAB 4YO0A 1BD2A 4XPBH 5LAXA 2VQTA 3DUUA 4H20H 5DD3H 2BVOB 1T2QL 5GJSL 1MFNA 3MRFB 2C5DC 5F1NB 3DVFA 2DMKA 3NAAH 4YR6B 4DZBA 1K8DB 2RQ8A 3ZE1F 2QADB 3BKMH 4KWUA 4HS8L 1JGVL 4GW4A 5F1OB 2YUVA 2C1OA 1UYWL 2NY5H 1WZMA 2CO7B 5E5RB 5I15L 5LGJA 4J8RA 1AKJD 2DI7A 4G6KL 1YUHA 5AYQA 3A0OA 2X4PB 5GS1B 1SYSA 5I8EA 2R8SH 1RZKH 4U6TA 1S8DA 1UM4H 4K3DH 1LE5A 2CKBL 3MA9L 3QO1A 3UTSE 2IPKB 5SX4I 2F53A 1NMCB 4LQFL 4N9GA 3DV6B 4M03A 3ARUA 5A2KH 5CJBA 3B9VA 1OSPL 3QUZA 4KRLB 1YY9D 1OGAA 3VXQA 3O11B 4NKIL 2VB5A 3MR9B 4LSQH 3EDKA 3RI5F 3Q5YA 4X7SL 1R0AH 5I1DA 4ETQB 3QHFH 1IKNA 2YS4A 1DQML 3GKWL 3QWOB 2VITA 3HPJA 5F97E 4IRSD 5D2LE 2OCFD 5IBTL 4PRPA 3PQYA 3QIBD 1JTPA 1CXFA 3FN9A 3QUKB 4Y8AA 2VL5B 3WEXB 1WIPA 1YNLL 4UQ2B 1QP1A 3V6OC 2ORBH 2XY1A 3LKQA 4U1KB 5TE4H 4UMGA 4G9FE 3WUZA 4DKDC 2D7OA 5INDB 4L4VA 1NBZB 1Y6KR 3DO7B 4WV1A 3OSKA 2IEPA 3A6CL 3DETD 3I85A 4YXKL 1M7IA 3QG7H 3ZTNL 3TO4B 3KXFE 4G5ZH 2Y6SC 2ATKB 4WFEE 4X6CF 5FO7A 4DAGL 4LVOC 4F9PA 4YGAB 1U8NA 1IEAA 1MPAL 1VADA 5F9OH 1INDH 2ICEB 3SKJL 4U0QB 3ARZA 2YD7A 5FA4A 4HV8B 4R7DA 3MBXL 3LH2H 4PP1C 3CFJA 5I76B 5DJXA 4OZGF 1HXMB 1I7RB 3PDOA 1BWWA 5F6HJ 4ZQKA 1L7IL 3RQ3A 3SDXE 4PGEB 3WKMH 4PD4K 4K71C 3MXWH 5IIEB 5GHWH 3WLWC 3RY6A 1NMBL 3WNMA 3P0GB 2XOTA 4MJIE 2VDQH 5CINH 5HGBB 3MLZL 1PKOA 5M7QA 12E8L 4CRPA 2OXHA 4P2QA 3ZTJH 4M6AA 3LEYL 4H1LH 3E3QC 4GXVL 2Z91B 1H3PH 1U8PB 5IV2B 4ZUTB 4XNMB 1KULA 3RVVC 2VZSA 3W39B 2V17L 1OAXH 4LSUH 4EVNA 1XGQA 1JWMB 4XCEA 1LE9B 4Y5XC 1LDPL 1D5XB 3HR5B 4GRLD 3D85B 4X6DA 2EC8A 1PLGH 3FFDA 4GMSH 5A43C 4FQJL 32C2A 1G7PA 2IANA 3AS0A 3WNKA 3C5SB 5TGBA 1TTGA 1WLHA 4C59B 4OJFH 3UCRA 1Z3GH 3MGTA 3QIWB 3V4UL 3M8OL 4GO6B 2PR4L 2C3HA 3ILPA 4OLVH 1CLOH 1OCWL 5DC0A 3V6ZA 3KYNB 6FABL 1IGYB 4F57L 4Q9RH 1URLA 4KK6C 3BQUA 4XTRD 1EFXD 3EOBA 4KK5D 4PJGE 2E27L 3V4PH 1CLZH 4NRXB 5I0ZA 1ZWIA 3RNQA 1JGLL 1HNGA 2IADA 5LQBL 5H35B 1YYLH 1PKQE 4OAWA 5BO1H 1UJ3C 3I6GB 2VLKD 1JI2A 3OJVC 5EZLB 3VFVA 3C8HA 1IE5A 1HILB 5JDJA 3HRPA 5KSAA 3VXUD 1WICA 4UILH 1BX2B 1RIVL 3FFCE 2BVEA 4QEGA 4Q97A 3NOIA 3OKEA 4Y1AD 1RK0B 4PV8B 4WTWA 1HQ4A 1NCTA 4AH2A 5E08L 4RMTA 3A6BH 5CIPA 4GUPA 2OQJA 5DUBB 4MJ2A 4HLZG 4P2YA 4XC1L 2XTJB 1ZLSH 3OWEA 4FQQA 5KBNC 3ARGA 2XA8L 4Z0BL 4ZXBB 1MELA 4M1DH 2A6JB 5A2FA 5T3ZD 3QCTH 5K9KA 3W0WD 5C9KA 1NMAH 3ES6B 4OI8A 2BJML 3ESUF 3VFWB 2YK1L 2WP3O 1NBQA 1QR1B 5CHNA 2OTPA 3ZDYF 3CZFA 3RPIA 1SMAA 5EB9A 1F58L 3QQ4A 1MCFA 1VENA 1XR8B 3WFDH 3W9EA 3QDHA 5DD6A 5J3HD 1NGYB 1IC7L 3B6SB 5EZIH 3A67H 2RB8A 1OW0C 1SJEA 3SGEI 5D7JC 2Z93B 4NZUH 3GSOA 1S7SB 3O3AB 3QDMA 3TLRA 2R2EB 2YN5A 5C8JA 1DUYA 4UU9A 3VI3F 1PSKH 5EOCJ 1H3TA 2G2RB 3RWCB 2F19H 4R2GD 1T21A 2F58H 1GCFA 2QSCH 1TJHH 1UM5L 3D69A 1AY1L 5HPOA 1YEKL 4PRNB 2Y07L 4ZODA 2VABB 5EFIA 2D03H 2IF7A 2HFFA 5AG9A 3O9WD 2FATH 1IGJA 4HT1H 1FL3B 3B83A 3OKOA 3FT4A 1S9WA 5FECA 4LGPB 4M3KB 2UY7A 5LBSH 5IFJA 4KDVA 3HFMH 4P2OD 1JNNH 2NY3B 3DURA 4KUCD 2DBLL 4XVSL 1A2YA 1T6VN 1MUJB 4OQTA 4R7NB 3FCTB 1C7SA 1A7NH 4F3FB 1QSVA 4PJFB 3LCYA 5FAAA 2BVOA 3S35H 4R3SA 1KCSH 2AV1A 2Z8RA 2QADC 5HHNB 4ZFGH 2LV4A 5ISZE 1A1MB 4HJ0C 5CJ8A 1GJIA 4PG9B 3G08A 5T3XD 3T08A 5IBLD 1HSAB 3MBED 4JQIH 3DSFH 5GS1A 5D2NA 3OX8A 1AH1A 3P11H 3TZVA 4EUPA 5ENWA 4NO2A 1CFNB 5KAQF 3D39D 1FVDB 4OCMC 1NMCC 4KVCH 3ZO0A 3V0WL 4PBWD 2FEDD 4YHIB 4X9BA 5MP6H 2Q3AA 3OPZH 3LIZL 4TSBH 4YH6A 1DVFC 2XKNA 4QRPB 3DBXA 1XIWD 1NBYB 1P7KB 2V7HA 4EUPG 3KR3L 3SOBL 3RGVA 3FO9A 3MR9A 1EUUA 2C9AA 2DMBA 3SCMB 5H8DA 2NY4B 1BD2E 4HUXB 5IM7A 1VCAA 1U92A 4Y19A 5MEND 2Y06H 4FOMA 5JLZB 2A6IB 4JO3L 5EORL 1PG7H 4IIQA 5EU6D 5ACZB 3QWOA 1A4JB 2AKRB 4H1LB 4YBLB 1CQKA 1GGTA 1A3LL 2BC4B 2FL5B 3PV6A 4QTHA 2P5EA 3HMXA 3QUKA 4X8XA 5IQ9B 4JFOB 4XPTL 43C9A 2XZAL 1KJ2H 4L9LC 4ISVB 1EHAA 3DUHA 5IG7B 5INDA 1KN2L 1XCTA 3RDTA 1NBZA 4HC1L 4KDTA 2GSGB 2EDQA 2ZG2A 4RGMB 1G7QA 2IPTH 1BQHG 3P9LA 4YJZL 4NP4L 3RHWK 3B9DA 3EYFA 5ICZB 1AGCB 1EMTL 2A73A 2EH8L 1P4IL 4UV4H 5HSFA 3OAUH 1QSFB 2F53E 4WU5B 3MLTA 3L3JB 5BMFL 4OD3L 3D0LA 5H2BA 3V6BR 5HVWA 1FL5A 3CLFH 1N8ZA 5FHBL 2DYPB 1TITA 1DZBA 4LPCA 1OGAE 2ICEA 4QF1A 4BM7A 1KIPB 4HV8A 4XVUC 5DO2C 5I76A 1T6WA 2YMXH 2NW3B 5FOJA 4NKQB 1R24B 1QSEA 4S1DC 1MCBA 4HIXL 4PGEA 3NABH 2LU7A 4PRID 4QXUH 4PJDE 3F6IA 3PQYE 1T2JA 3CFDA 1O7SA 4YWGL 5HGBA 1YDPB 3GBMH 5INCA 5JHDB 3ULVE 1T7WA 1JNLL 1U8QB 3P30L 2CDEB 1FNEB 4ODVH 5HDQL 1JYVA 2Y7QB 4L4VE 2VN4A 5BS0A 2F54B 5DD0L 1TTFA 1U8PA 4MWFB 2C4XA 5IV2A 3HNTL 5J4MA 1JWUA 5C0IB 3UO1H 1AO7D 3W39A 1INQB 4TNVF 1XF5B 1JWMA 5KTEL 1MCOH 3C5ZA 3NCMA 5FM4A 1NCCH 1AQKL 3U7WL 3MJ8A 4LLAA 2NY0B 4I0PC 5DI8A 4P9HH 5T3ZL 1P9MC 2AEQH 3IF1B 2EDYA 5BQ7A 1BIHA 1J1XH 1JFQH 5D1XD 1BQLH 4KMTH 4MQSB 3QIWA 4PG2C 4NFBA 3ARFA 4MLSA 3K2MC 2LABA 3LS4L 2C3VB 5I9QB 3ZDYE 2EDFA 4A6YL 2BXZA 5CUSL 3GB7B 3O2DL 1TQCB 5L2KB 4N90E 1EVUA 1Z0MA 4KJPD 2HP4A 5T33L 3UC0H 1CR9L 1D9KA 1JHKL 1B4JH 4PGDA 3SGJC 1ZVSB 2D0FA 4P2QE 2I5YL 4R4NC 4Z95L 4LOUC 1B3JA 2COQA 4BK4A 2Q76B 4XNXL 5FYLD 1T0MB 3VI3E 1OTSD 5HYSA 3FB6B 3I6GA 3BRDA 1RIHH 2R0KL 5D71H 3CU7A 5CP3H 4AJ0A 5BRZB 2FSEB 4PJ9A 4ZTOH 1WBZB 4X6DE 1OWRM 3KLHD 4K9EC 4PV8A 1V3LA 2EDNA 2V5MA 4WFGD 3S4SA 2XTJC 3HI6L 3MV01 1LEIA 1IFHL 1QVOA 2ZPKH 3MACH 3FN0L 4PJ5B 2QQKH 3AREA 2BY0A 1IAKA 2A6JA 1FC2D 4HBCL 2MSPA 5SX5K 2IH3A 2R1YB 4ORGB 3WJLC 4MJ4A 3UYRH 3ES6A 1L6ZA 5C0GB 5IW1B 3TBYB 3S4SG 5HI4C 5IMOB 1I8MB 3CDGB 5TQ0L 5HY9B 3MZTA 1QQDB 4MJ6A 4OFYD 2EDHA 5FYJH 5L7XH 5JO5B 5D6CB 4KTYA 1NC4B 2AABL 3DMMD 2N1KA 2NY5C 3PIQB 5CD3B 4OF0A 4HWZA 1NUFA 1A3RH 1MCPL 3GSXA 2Z93A 1HKLL 1RZKC 1FRGH 5T3XL 1S7SA 2OS7A 3O3AA 4M1GL 1CI5A 4XPHH 2I9TB 2R2EA 3GJFK 2WNGA 3DHJA 1AGFB 5DWUH 2FLBT 1SM3L 3ARDD 3ZT7A 1RUQH 4PP2A 4FZEH 3U0PB 4JO2H 4PRNA 3STZB 3DIFB 4GMTH 3CDYA 2FBJH 2VXQL 1Y0LB 4FQ1L 5I1KH 2GIYA 1ZT4A 1NCWH 2F74B 1FL3A 2XI9A 4M7ZB 4RA3A 1I7TA 4NPYB 1F3JB 5DEFB 1BBJA 3G6DL 5DVLA 4WNQB 4GRMB 2ZUVA 1WCBA 3BZ4B 2Y25A 3U46A 4DVRH 4R7NA 2PXYD 3FCTA 5DHYB 1XH3B 1KELH 2FEEI 4NNPL 4ODXA 4PJFA 3C2AH 1IILE 3C6SA 2VLRE 1DEEA 3KGRA 2XQBH 3BKCL 2E9BA 1NGPH 4OM0L 4YIQB 2X4TA 1YQVH 3T0ED 4GAYB 4XHQA 3SKOA 3MUJA 1A1MA 2X9XA 3MRBA 3QDME 2IMMA 4NRZA 2HKFL 5KZCD 4I3SL 4GFTB 4KHXL 4ZMAT 1JZ3A 1T04B 4C4KO 3SKMA 1YY8B 1JBJA 2VKXA 1TMCB 5GSVA 4LARL 3RWIB 1CFNA 3VWJB 2QHRH 3BP4B 4O51A 5E00B 2WBJB 5TDNB 4P5TD 4JFQB 4NQED 5FM8A 1AC0A 3FQNB 4IM8A 5IK3B 3TEUA 2Q20A 3C6LC 4IMLB 1P7KA 4NFDA 3SDAB 2OJZL 2X4RA 1I85A 3SCMC 2KZWA 2HT4C 2NY4C 4KZEH 1D5BB 4G7YH 2Z31C 5E7BA 3KPRE 2OSLA 3S36L 2V5TA 1U8HA 5JLZA 3DRTA 4W6WB 1IAOA 4J3XA 1N2RB 5GJTL 1IEBB 1TENA 3FOMB 4NKDB 4R97C 3VFTB 3CDFA 4WUUB 1OSZB 3RZCC 5CJOH 1UCBL 4Q7DA 4L4JA 5GGVH 1UQSA 4JFDA 4UB0L 1W72A 4JFOA 2JK5A 4PJBB 1CVRA 4NC1C 4ISVA 4P4KD 5IG7A 4UT7H 1G84A 3DOSA 2LAAA 2RFXB 5C07D 4DEPC 1HIML 5D2NE 1QEWB 2IGFL 1RZ7H 5ICZA 4K23L 3U7YL 5FO8B 3C60C 1ADQH 4TUKL 1QSFA 4MNQB 3SGKA 4WU5A 3SDCA 3L3JA 1QBMH 2NYYD 1KPVB 5I0DA 3WDIA 2CJUH 3GSNL 4OSUH 4D8PB 1BEYL 3FJTA 3IDJA 4EI5B 3O2VH 1SQ2N 1H3GA 4LCCA 4AMKL 5A16A 2CLZA 3Q6GH 5LWYL 3GBLA 3O6LH 4FTVA 4PBXA 5IROA 2NW3A 5EBMA 2WBWB 4CJ1A 2NLJA 3QDAA 4Y19E 2Y36H 3TA3B 2CMRL 4JN1L 2DLIA 1LO4H 2UVFA 3LS5H 4PJFF 1MY5A 3I3EA 1F3RB 3QQ3A 2P8PB 4HF5L 3H7BA 4JREC 4PTTA 1CZ8L 2P5EE 2ZOKB 2L7UA 1AHWA 1CXHA 3RWDA 1A3QA 1YDPA 3HZMB 4GKOA 2XXCB 5FYLL 4K07A 1ZHNA 4K3JL 5IHBA 4NRYA 1FNEA 4KVNL 2X42A 4PGCB 4MHHG 4LAJH 1CDBA 4YDLC 43CAA 4LIQL 1DFBL 4Y16B 3PHOA 1DBML 4LHUB 4WO4A 4LCWB 3G6JB 4KJWD 1INQA 1BBDL 1XF5A 3MJ9H 5D1ZC 1AP2B 5FGCB 1W0YT 4PLJC 4G6ML 1K8IB 3WE6B 2AJUH 3QUXD 5C1MB 3UAJD 4GBXC 5F6HI 1TPXC 3WIIL 5FCUH 3RZWA 2YOCA 3T8XA 4LPUA 1RJYB 4J4PC 2P42B 2YN3A 1ZGLP 4TULL 1QSEE 4JDVB 4YXLL 5I9QC 4OZIB 2WBKA 3HI5H 2C3VA 1VGEL 1MIMH 3QXAA 1U2HA 1TQCC 3GB7A 3WL9B 1CGYA 5L2KA 4JN2B 3BPCB 3IAPA 5FUZH 3UPCA 2H2PC 3ARBC 1I3VA 1EHXA 5K9JL 3QPXL 5BS0E 5ADPH 3QDJE 3ZKQD 5GJSH 3X11B 3M1BA 1WEJL 4JZOB 1IQDA 3SKNB 3I6KA 3PGCB 1AR2A 5JMRA 1FVCB 5ESQA 5FO9A 2HWZH 5DS8B 3T0AA 3C9NB 3DROB 4WY7H 3HLAA 4YQXL 4HS8H 2MQCA 2PF6A 1CFTB 1JGVH 1NGQL 4YBQC 1X6LA 2W0KA 1XEDA 4LK4A 2GAZB 3G5YA 2CGRL 4G6KH 3CC5A 3O8XB 2JB6A 3J8F7 5DFVC 4PJ5A 3T4AB 4JZJA 1NFDB 1IM9B 2CKBH 4WI6A 2EXWC 1WWBX 4PTUB 5TDOA 4UBDC 1JN6B 2H9GA 4ORGA 2C3XA 9CGTA 2EXYD 4U05A 1N0XH 4I18B 3VI4E 1OSPH 1I8MA 3CDGA 3IDXH 5GPRA 2WWKO 3QEQA 5HY9A 1PBYA 2VLJB 4KRPD 3T2OA 1NBVL 2ZG1A 1X5HA 1XFPA 5D6CA 1L7TH 1SVCP 1NC4A 1KV3A 2GTWB 3PIQA 5CD3A 4JRYA 4QWWC 4M48L 4KRNA 4XAKD 2AEPL 2J6EH 4Y4FD 3TBSB 2BNQA 3MYZA 4G6AC 3MCG1 1DQMH 3GKWH 3FAXA 8CGTA 4YDVB 4S1SH 3VGBA 2YD8A 1X7QA 4G9FD 1S9YB 5ITFB 5AAWA 3RVTC 4F7EB 1YNLH 3FQUB 5B38A 3ZT6A 5CKAA 3U0PA 2VDOL 1DBAH 5C0BB 2Q6WB 4FHBD 3CFKB 4Y4KB 3QDGB 3DIFA 4HCRA 1YEDA 4WFED 3QA3A 1VACA 5F7WC 1A6WH 3A6CH 1FHGA 3ZTNH 4Y4HD 3GUTA 4E41E 5IVZB 5DEFA 5B38G 2YA0A 1W0VB 4F58H 3H0TA 5E8NA 4DAGH 1CL7L 1UKTA 2X1XR 4K7FB 3VXMA 4GRMA 5IB3B 1UA6L 4ODBD 1MPAH 1XH3A 3SKJH 1I9EA 2VDPL 3BN3B 1BOGB 3MBXH 4NO0D 3ZKXB 3P4LA 4FQXD 3H7LA 4GAYA 2YPLB 3ULSB 3GMLA 1XMWA 1RSFA 4MJID 5EO9B 4BSJA 5ALCH 4N0FB 3RHWF 4C54A 3N1QC 4OCSL 2H2SD 2PKDA 5DJ0B 3MLZH 12E8H 3VWJC 1I8LA 3LEYH 4HKJA 2MPAL 2R1WA 4AEHH 4D0BB 4GXVH 1NDGA 3LN4A 5E00A 4P2RD 3BPNB 3GIZL 2WBJA 5TDNA 3C5JA 4FMKA 35C8H 3ORJA 3QUYA 5F7EL 4D2NA 3GGWB 5IK3A 3BEVA 4DOHE 5KS9B 4U6YB 4JFXB 1I9JL 4CW1B 4PV9A 3S37H 1X5GA 3CFBB 2ED8A 2H1PH 4FQJH 4MLIA 3VFSA 5CZVL 3BIBX 3PP3K 2YC1B 5HYJD 2EYSB 2VC2L 4OIBA 5I8CB 4GQ9H 3HE7B 4XNUL 1IC5H 1IEBA 4NKDA 1MF2L 3VFTA 3GSQB 4WUUA 1OSZA 4QHNB 3M8OH 3TO2B 1QFUH 2PR4H 3V4UH 4PRAB 2X5PA 3VWKD 1OCWH 1VFBA 3WHXA 4KC3B 2GCYB 6FABH 1MHPL 4LLQB 5EU4A 2PYFB 4HAFA 1JNHA 3CPLA 4L3ED 4Z7UE 3SQOL 2WIIA 1BJMA 2OR8A 3DECA 2OTUA 1C1EH 3PDDA 2E27H 1QEWA 2J5LB 1OARL 1O5DT 1R3HB 3IRPX 1HHJB 3KPLA 5FO8A 3QHZH 5LQBH 1E4XL 1UCTA 5EBLA 5ICXA 4L8DB 2NTSP 4LU5H 3QCUL 2XFXA 4WFFD 1RUKL 1CT8A 3NZ8B 2D7TL 1V8HA 2FJGB 1QFHA 3ARPA 5IB1B 4O4YH 2ITDA 5BZDB 3QJFA 2CUMA 4HGKC 5F70A 1HHIA 1CXIA 4CVZA 2FH6A 3EJYD 1G0XA 1T0PB 4LRIA 4NQDE 3CSPA 1AD9B 3TA3C 2CUHA 5E08H 3VRJA 4U7KA 3LN5B 4PS4L 4XC1H 3MLWH 4TOYH 4UAOC 3TH4T 3MRKA 2XA8H 1JPTH 5KSVB 1WSST 3BGFC 4WU7A 4JFDE 1A6TB 1X4XA 4XGZA 1JNJA 1T66D 2YK1H 3OTTA 2ICWJ 4MA7L 5JW3L 3MV7B 3JWDL 3TPUA 2A6DB 4Y16C 1JE6A 1RK1A 1IC7H 4XP9L 5J12B 4LHUA 1MCLA 3EHBC 1LP9B 3D0VB 2AK4A 1BIIB 1AP2A 3T2NL 1Q72L 1MRCL 3IXTA 2CKBB 1G9NL 3CSBA 3NFPA 2NR6C 3PV7A 4GRWH 3L5XL 2MQ3A 4KKNA 2BSTB 1AY1H 4FTVE 4KZDL 4FQLH 3Q0HA 3H3KA 3V5DB 3NCEB 3JUZA 1DBKL 4YGVA 3WV0A 2F8OA 4M8QA 5AG8A 5JIIA 4KHTL 5I19H 3S35X 2QSQA 5D7IA 4GSDL 1JWSB 1A02N 1FZMA 1A6AB 3HKFA 5K59E 2ZUSA 5CEZE 3OXSB 4NZTL 2DBLH 3UEZA 2V2TB 4XVSH 4CVXB 4IRJA 4ONFL 1CGXA 1IGTB 1ND0B 1J5OL 4PJBF 5JXEC 1F6AB 3QXWA 4J3TA 4RDQG 1FG2A 1NANI 4M9OA 4D9RD 4JPVL 3X11A 3L3OB 4JZOA 3N85L 3SKNA 3MRCA 3PGCA 1FVCA 1LD9B 2HN7B 4YX2L 4IJ3B 3DROA 1FDLL 5FV2A 2FGWL 1Q0YL 2Z8WC 4UDTB 1AGEB 4JZNB 4Z7VB 1ZLVH 2GAZA 4IDJL 1MCDA 4L1DA 4NKOA 3QFJE 4O5LL 3O8XA 2XZZA 4NFCA 1ODAA 3G5XB 3MV8A 4P5KB 4GW5B 5EZJA 2B1AL 5E9DB 1EBPA 1X5JA 1PG7X 4NM4L 1UACL 4I18A 5CJXC 3KDMB 3RVXC 5IESL 2VLJA 4D0CB 1BD2D 3KR3H 4OF5A 1JF1A 4C56D 3OR6A 4PGZA 2HVJA 3ET9F 3B9EA 3U36A 2QKIB 3LV3A 4OFPA 2QTEA 5DJ8B 1SHMA 1KLUB 4HIHB 5DRWB 4OCXL 1MHEB 4F7TA 4JO3H 4DGVH 5EORH 4PJXB 1H3XA 4Y2DB 4HIJA 4XPGH 4BQBA 1A3LH 2YWYA 3G6JF 5IHZA 2XZAH 4BQCA 2IH1B 4Y4KC 4DVBA 3S6CA 2XWTA 3SDDB 1KN2H 4JM2B 1KPRA 5TPWH 1X5IA 4HC1H 4UTBL 4LLUA 5ESVA 4GKNB 4NP4H 5C9JA 3S8WA 4MA1C 4KPHL 1FZJB 4J12A 4NOBA 5F3HB 2FZ3A 2B2XL 4PJ5E 5H94A 1EMTH 3QUZD 4E42A 1P4IH 5IVZA 4U6XB 2DD8L 1OGAD 2E3VA 4LKCA 4K7FA 1MI5A 5BMFH 5C0CB 3U1SH 2MTPA 5IB3A 3KHOA 4WDIB 3O3EA 3QEQE 5E2WH 1YYML 2Z35A 4RDQF 2R2BB 1JZ4A 2VXTL 1ZEAL 3JVGC 3QQNA 1HZHL 2FIKB 4IMKC 4CVWA 3ZKXC 1BOGA 1QNZL 3OMZA 1YN7A 5DHVA 5HDLA 4JRYE 4O2EA 3KPNB 4PRPD 3PQYD 5IHLB 1DL7L 3N06B 2BNQE 1J7VR 1KPUB 4HIXH 4OCWL 3REVB 3SGDH 3BX7C 3V9FA 4R4FL 4R0LB 1R3KA 4LL9A 1E6OH 2O5XL 3VRLE 1YC8A 2ZKHL 4OGZA 4ZUUB 5DJ0A 2BOCA 1ZHKB 3GDBA 2FR4B 1Q0XH 1JNLH 4PRBB 2V7NB 5HDQH 2XWJA 1BECA 4LDEB 3TYGL 3OJDB 3FQXB 3SPVA 5DD0H 4PB9H 4S0TD 3HNTH 1L9MA 3S98A 3TVMB 1MFBH 1UVQB 5KTEH 3VXME 2H26B 2YBRA 1AQKH 1NFDF 3AXLB 2D3VA 4AIZB 1Y18B 3CFBA 3O3UN 1VFAA 4EXKA 2NXZD 1IM3A 1VPOL 5T3ZH 2KUTA 2JELL 5DMGC 1EUTA 4Q0XL 3HE7A 4GKZB 4M7KL 3GSQA 3WLWD 4QHNA 2Z4QB 3TO2A 2JIXD 4FFYL 4N90D 4N0RA 1HYSC 2JTDA 5SX4H 3DSNA 2ADIB 1CG9B 4A6YH 3MNVA 4AENA 4P2QD 5CUSH 2WANA 3O2DH 3EFDL 4PJAB 5T33H 5JA8B 4YUEH 3MJ9A 4JPWL 1NH6A 1CR9H 1JHKH 1HI6A 1MRDL 2I5YH 4Z95H 2HVKA 2PCPB 1R3HA 4N5ED 3FT2B 5DQ9B 2A9ML 3UYOD 1MCCA 3DX7B 4XNXH 2HTLD 4GRWB 4GW1B 3RVUC 4HZAA 8FABA 1B0RA 4YAQB 3DWTA 4M61B 5IB1A 2IAND 4M62L 3N0PB 3FQRB 3HA0A 2WUCL 5TF1H 1AD9A 3VXOB 1GSMA 4WHCA 3X3GL 1IARB 1IVLA 3MCKA 3MLUL 1RULH 5MEPA 3FN0H 1EEZA 4EIZC 5JPMA 1EAPB 1OD7A 1C5DA 1PYWB 3QIBB 3TP4A 1H15B 1RUPL 3I3BA 4HBCH 2UUDK 3T77A 4RGNB 2EE3A 3BQUD 1YMMA 3UTPE 3MO1B 2AAVA 4OM1L 4XP4L 5TQ0H 5DC9B 4MX7B 4UIMA 2DJ4A 4KH2A 5JXAL 1ZGLB 5J12C 4J6RL 2ADJB 4WFHD 2AABH 2RCSL 1U93B 1G6RL 1NAML 3O6MH 4G42B 4P46A 5I8KL 4QRUB 1MCPH 3BDBA 2K7PA 1HKLH 4MNGB 1KIRB 2YD9A 5T3XH 2VLME 3EO0B 4M1GH 4KAQL 3D87B 5HGAB 3C8DA 1FFOB 5JR1L 2NTFB 1SM3H 1WV7T 3GMRB 5DQJB 3EDDA 4AT6B 1I3RB 4ODTL 4K7PL 5E6IA 2VIRB 5I1IL 1GAFL 2VXQH 3ARGD 4FQ1H 3V5DA 2YEZB 2OM5A 3CZJA 3BP5A 3L5WA 4GOSA 2BRRL 1J1PL 5CMAB 3G6DH 3ROLB 1JWSA 2YRZA 3U4BH 2VZVA 4LPXA 5JORB 4KJQC 3MUZ1 2NX5E 5K9QI 1F3DJ 3LKOB 3ARWA 3WIHA 4ZFZA 1YNTA 1IGTA 1ND0A 5F1IB 4R8WH 4NNPH 3Q6FA 5EBGA 3PE9A 5D93C 3QPQC 3BKCH 3QDMD 2DTSA 4OM0H 5T1KA 4M6NL 4P3DA 5IR1B 1LD9A 2L4OA 4LSVL 1OF2B 2AK4E 3PWPA 1N7ML 3GKZA 4EI6B 3IKCA 5MHSE 5KVEL 2HKFH 1LO5B 4GRLB 4JFYB 5I71B 3WFBL 4I3SH 4KKBC 3BXNB 4KHXH 4Y5YA 1RD6A 4XB8A 4JZNA 4QYOA 3S97C 5E8EB 3HRZB 4F7MB 4UTAL 4FRWA 4P5KA 3SE3C 1EGJH 3MRPB 4GW5A 3UBXB 1JRHI 3LKNB 1KF9B 1QLFA 4OLYH 1XF1A 1B0GB 5C71A 1JZ7A 5D7IE 4ZAKB 5TE7H 4H25B 1RZIB 3R06B 5HVGB 3KDMA 5IJKC 4M4RA 3VDBA 2Z8VC 4BFIA 3FQWA 2IQAB 3JV6B 5J1AA 4LNRB 3GSWA 1T4KA 2QKIA 2JB5L 1H0DB 3HCVA 4HIHA 1CFVL 2KZ1B 5IOPA 3QG6B 3FB8B 3S36H 5FXCH 3RIFK 5D1QB 4U0RB 5LVEA 2DQDL 4O2CB 4RISH 3AY4A 4NQUA 4Y2DA 4Y7MA 3K3QA 4JKMA 2BSSA 3LQAH 1UCBH 3CD4A 5EC2A 4EN3B 4UB0H 1C16B 3NACL 3LVEA 3SDDC 2PETA 4IS6B 4I5BB 3VGAB 4I0CC 4J3WA 1F13A 2HLFD 4Y1AB 4BH7B 3TZVD 4JM2A 2HH0L 3LDBC 3CIQA 4O58L 1R3IL 1FE8L 1NGXB 1VEOA 3ILQC 5CGYD 3BMVA 4M7JH 3DX6B 2W1NA 4QGYA 1FZJA 3LRHA 3MV8E 4V1DB 3ZDZF 4K23H 3U7YH 1BOYA 4FFWD 5F96L 5D8JL 1DN0B 4TUKH 2OI9C 1QSZA 5DRXB 3STBA 1S5HA 3RL1B 3P4MB 4ZSOB 2BMKA 3L95B 3RGVD 1QFPA 3GSNH 1NSNH 1BEYH 4V2BA 2ATPB 3MRGA 2E9JA 3WXVL 5TDPB 3ZLQC 4AMKH 2R2BA 2HJKA 5LWYH 4Y19D 2BK8A 4NBZB 5EBWB 2FB4H 1FNSH 3KJ6L 4WTZG 2E7LC 5IKCB 1XT5A 4M4PA 4X80H 1F6FB 1LEGA 3ROOA 2X9YA 2CMRH 5IGXH 4F7PA 4R0LC 2ZUXA 3K81A 3REVA 1T89A 5CBEB 3BRFA 4MZ2A 4YDJB 5FA3A 1CZ8H 2HRPL 3CSYB 1P5UA 3FKUS 3IDIA 3RDTD 1T7VA 4R2GB 3N1MC 4YHML 5FYLH 3UTQA 5I1GL 4J23A 1OP5K 1AXTH 4KVNH 4F9LA 3TO4D 4CGTA 1S7UB 3OJDA 5FHAH 5ITBH 2DLEA 3O9WB 2E6PA 1ZT1A 4ZFOB 4D3CL 4X98A 3BH8A 3TVMA 1FVEB 1YC7A 4Q9BA 1BBDH 2BSRA 2VQUA 2H26A 1MI5E 2WWMC 1ZHLA 4U1IB 4RBPK 4AIZA 2E9WA 2H8PA 4F8QA 3RTQB 3LPFA 3QO0B 3L7FB 3FRUA 1HHKB 4PFEA 3UDWC 5J0BA 2NW2A 4ODHL 4GKZA 1Q8MA 3SKUD 1T0NB 3IU3B 3QYCA 3TNNB 2O26U 4GXUN 4NQCA 1AIFA 5J11B 3PWJA 1OGTB 4NYLA 1AQDA 4N0UA 4PIRF 3O2WL 2ADIA 4OF8A 3U7AA 3JV4B 3Q3GB 5E2TL 4KXZH 4KROD 4FQCL 1EPFA 5BS0D 3RBSA 2AV7A 4XHJD 3BH9B 4N0YL 4YNYA 4POZD 4HS3B 5EO1B 3SJVB 2K3TA 5DT1L 2PCPA 3QNYB 3ULUF 3QPXH 2R23A 4J1UA 3FT2A 4H88L 3DX7A 4JM2F 3C5ZD 2XKUA 5KVFL 4GW1A 3BPLB 3WFZA 4RMVA 1MSPA 3VH8B 5J6HB 4FA8A 3LOWA 1X44A 1ZTXL 5DDHB 1XIWB 3G9AB 3IRZA 1HOCB 4JFPB 5HHOE 1NGQH 1LWRA 2OJEA 5ILTH 3WN5B 2XICA 1MJ8L 3K4ZA 2XKSA 3QIWD 1QYGL 2CGRH 3T1FB 2G75A 4OFKA 5F7YC 4U4BA 1CFQA 2ESVA 4LSPL 1J18A 1Q9OB 4IRSC 5GS2D 4JAMA 2IBZY 2FHFA 3QIBC 4Z8FL 1Z9MA 2WQ8A 1JGEA 3QCVL 5JDSA 4YLQT 5J1TC 4WWKA 1D9KD 3UTZB 5C92A 1GGCL 5EC1B 2DQIH 2HG5A 1NBVH 4MX7A 4ONHA 4Q9QH 3DETC 4M7LL 3IJSA 3MGAA 1U93A 4M48H 1KBGH 4U1LB 1UWEL 5DJ2B 4QT5A 2AEPH 1JPSH 5F8QC 1WGOA 1CF8H 1IZKA 1QKZH 1CE6B 2V5YA 1C12B 3JWNC 3LY6A 3QJHB 3PL6A 3VE0B 4PJ8B 2NTFA 2GYSA 3RA7H 5F6IB 4AT6A 2LAGB 4K2UH 1PGRB 3AGVA 4OQTL 1OTTC 4ZXBD 1X5XA 1UWXH 2IALA 4QHKJ 1FBIL 5DJYA 4HLJA 4LCUB 3NCYP 1WQVT 5CMAA 3ROLA 1T1YB 1JK8B 5HI4D 1CL7H 4PYHA 1TZGL 3FOLB 4OB5H 5JORA 4UOW1 1UA6H 1D5IL 1YMME 3DXAA 4PY7A 4Z0XB 4MNHB 4NGHL 4XBGB 1S9XB 4Z5RB 2EC9T 3LB6D 3TIDA 4LEXL 1U8MB 1NFIB 2FHCA 4DUVA 4EBQL 1JTOA 1AO7B 3WJJA 4XPFL 5EOTB 3G04B 3QSKB 3F62A 4UQ3B 3BZDA 4ZO6A 3KPSA 3IKKA 3QZWB 4GRLC 5I71C 2FGZA 2GFBB 2DQUL 4JFYA 1M71A 4OCRL 2DLHA 2BVUA 4X9IA 1WAAA 3VFRB 4L5FL 1S3KL 3IDGB 2DKMA 5E8EA 3MRJA 3O41B 3ZDZE 3S37X 5A2JH 3GSNB 3MYJB 4I1NB 5D9SB 2MPAH 3QXDA 4XX1G 5BZWB 5D1XB 5AWNL 1SY6A 3LKNA 1N5AB 2IQ9L 3WMSA 2NY3D 1J10A 3GIZH 1B0GA 1U95A 5C0FB 1A9BB 3LPWA 2EO9A 3RZCA 4ZAKA 2ZG3A 4H25A 1RZIA 1NCBL 3G9VA 5F7EH 4XTRC 5GS0D 2LFGA 3CVHA 3UX9B 4KK5C 5CP7B 3HMXL 5I1HL 4LNRA 4NUJA 5KANI 2BHYA 5CZVH 1IGFH 2PW1A 2VC2H 2MMXA 5IBUB 4U0RC 3WUWA 3QAZB 4G6FD 1MF2H 1BM3L 3LKPA 3QNZA 3T04D 1RZJL 2O61B 3PWPE 4HFWA 4HKXB 4EN3A 3VGAC 1C16A 2N7AA 5KG9A 1RHHB 3VFMA 1MHPH 2YRLA 4PRHE 4BH7A 3NZHL 4K3GA 4KTEL 4BKLA 3E1F1 3WUWG 1JPFB 1NGXA 5GRJH 4BELD 1QO3A 1KB5B 1CD1B 2BNRA 4EQ2A 4UT9L 1Z6JT 2XQYK 4V1DA 4NUGL 5C0RL 3D2UA 1SEBA 3MFFB 1E4XH 3OAYH 4JRXE 5L0QB 2CRIA 1KJMB 2W65B 3QCUH 2BVPB 3P4MA 4ZSOA 3BUYB 1RUKH 1CGVA 2ATPA 1ZV5A 2UWEA 1J9CT 3BP7B 2HT4D 2NY4D 3QRGL 4KDWA 2HT3C 5J3HC 1OOAA 4H5SB 3JBG7 4Z78A 5IKCA 1YPZA 4LLYA 3F7YA 1H3UA 3D1MC 4PJHB 4PJIA 2R0LL 4U1MB 5CBEA 1Q9LB 3EYSL 4HH9A 4R2GC 3NPZB 3ALXA 4XPAL 3P4NB 5CWSB 1U8LB 4MA7H 3JWDH 2ILLA 3O9WC 3MUHL 1I9IL 1S7UA 3FT3B 4X7DC 4XVTL 1IKFL 5BOPA 1QSFD 1K4CA 1WAAF 3NIDE 4ZFOA 5DJ6A 5DZOA 1X4YA 4P2OC 2ZSWB 3G5VB 4L4TA 1YEIL 2YD1A 2FO4B 1MFDH 1CDUA 1W0WB 5FK9B 3P77A 1Q72H 1MRCH 4S1RL 4PB0L 1LO2H 5DJCA 2ARWA 5DMYA 3BZEB 3Q2CA 3QT2A 2PXYB 1G9NH 3RTQA 3MV9B 1KIUA 3T1WA 3JWOL 3QO0A 5TH2A 2DIAA 1Y6NR 3L5XH 5BOZG 3EFFA 1Z5LA 4KZDH 3GHEH 3DX8B 2JJSA 5J7CC 3ALPA 3T0EB 1DBKH 4KHTH 1JRHL 2GKIA 3THML 1S7QB 3I2CL 4R4BA 1DANT 4LLMB 1AJ7L 5FYKU 5CGTA 4GSDH 2BCKB 3Q3GA 5IBLC 2AS5M 1FC1A 5E1AB 4G8IA 2DS4A 2F54D 5B8CB 4WJ5B 4ONFH 4CMMB 4HS3A 4ZUVA 3SJVA 2D31A 4CNIA 2C4FU 2NY2B 2FEDC 3UXFA 3K1DA 3BPLC 3CVIL 2EE6A 4K9EL 1FYTB 3SE4A 5I1EH 3N85H 5DMKA 2FJFB 2MNUA 4JHWH 1UFUA 4P5TB 4PLJD 1XIWC 1KIQB 5I2IB 2HKHL 2NY0D 4YX2H 4QXGL 1FDLH 5DD3L 2JLLA 3WN5C 2FGWH 4HXBH 1CDHA 3FN3A 2X7LA 4IDJH 4RMUA 1N5YH 3T1FA 3WNLA 3KYMB 5GRVK 3OB0K 2P8MB 3LHPL 6CGTA 5GSRA 1Q9OA 4PPTA 3OKNB 4PRDA 1MFEL 3E8UL 2NY5L 3WDJA 1YPZF 4NQCE 5L2KD 1TJGH 4J3UA 4N0UE 3GSUB 4NM4H 3UTZA 4PJIF 4YPGB 2X4NA 4GG8A 4WENB 3REWB 5DJDB 3VXRB 4ZOAA 5IESH 5D7KE 3KPPB 5EUOB 4ZYKA 1QRNE 5J1SC 3KLSA 1XGPB 1OY3B 1VFMA 1VFUA 4OUUA 1J8HB 2J8HA 2ITCA 4M3JA 3T0VA 1JZ8A 1XF4B 3OXRB 5BW7A 1CLCA 4PJ8C 1I75A 3QJHA 5HPMB 1IZJA 4L3CA 1FZKA 5F6IC 1KGCE 2P47B 3UTTB 1T1ZA 3QHFL 3ZKSD 2ZUTA 4XP5H 1GXEA 4PJ5D 4W4OC 5I73B 4QXWA 2FRGP 5GS0L 4UTBH 2ESVE 2EXWD 4KPHH 5C08B 5SV3A 2X09A 1OP3K 2ORBL 4LCUA 2DD8H 1JK8A 3RIFF 4N8VA 4P23A 4R9HA 3LN9A 5A40E 1NC4D 4RWHA 3LEXB 1YMHA 4JPIA 4XC3L 1V05A 4ZS6C 4MNHA 4Z0XA 3D48R 1YYMH 3QG7L 2VXTH 1ZEAH 1HZHH 2PO6B 4HJJL 5CD5D 1QNZH 2WQRA 4LFHG 3BD5A 2QQLL 2VERN 1NL0H 4N8VG 4IBLT 1RIUL 4X4XA 5EOTA 1DL7H 3G04A 3I6LD 5I8OL 4ZO8A 2Z92B 3VDAA 4M1CD 4R4FH 1X5KA 1AGDB 5FGBA 3LH2L 4RCAA 3T4YA 3P3YA 2ZKHH 1B9ZA 5ESAA 2I60L 1A7QH 3VFRA 1ERNA 4N8CH 3IDGA 4AM0A 5D1XC 1LEKB 4G9DB 1AGBB 3KLDA 4IHOB 5GHWL 3C09B 2X44D 3TYGH 3X13A 4TTDD 2HFTA 2NNAB 1JCKA 3NCBB 3PDGA 3QHTC 4ZFFB 3VXMD 1BFVL 3BHBB 4ELMB 1A9BA 4YHYB 1F4XL 1A6ZA 1GZPA 3SO3C 1CYGA 2IG2L 4KJPC 3OG6B 2R4RH 5AUMA 3L3KB 2ERJB 1H3PL 5CP7A 2AXFB 4HKZB 3DXAE 4I77H 4TSCL 1LK3H 5EUKB 4A2LA 4XBEL 1CK0H 2JELH 1OTSC 3L5IA 3QAZC 4Q0XH 3DARA 1UZ8A 2UZXB 4M7KH 4HX1B 4JG1H 4FFYH 4XP1L 2O61A 4DKFL 2ZCLL 3KPSE 4XX1E 1IC4H 5DUMH 2QQQA 4JB9L 3KLHC 1A4KB 1RHHA 5F7NC 2VMFA 1P5VA 3VWJD 1CTOA 3TT1L 1Z3GL 1WAAE 3JTTB 3CFCL 4JPWH 3AS3A 4KJYB 3UTSB 5J9PA 2CIIB 1MRDH 1KB5A 5D7LA 4OLVL 4LPWA 2WBJD 5KOMC 4XP6H 3QUYD 2A9MH 4RQQB 2A1WL 4ESKA 2VUYA 1WFNA 3SDAD 4LF3B 4F2MA 1ED3B 1BFSA 4NNXA 2KDGA 1T5WB 5DA0B 1MCEA 2VSCA 2XYCA 3V4PL 4KTDL 4KRPB 1JGDB 3CX5J 3DMMC 5E5MB 2YPKA 1YYLL 1FAIH 5KSBA 1S7WB 3E6FA 2I25N 5E2VL 5D2LB 3TH2T 4WUUD 3X3GH 3NFNA 5JIHA 1Q94A 4F7CA 3WLBB 4U6HB 4UILL 3MLUH 2B7DT 4XBPA 1TNMA 4XNYH 1U3YA 4DGIL 3UTPD 3CFEB 4HGMA 4JY4B 4OD2B 4POYA 3BW9A 3MRNB 1KYOJ 4RMWA 3ARDC 2AXGA 4G9FB 1G0DA 1HSBA 1RUML 2GK0A 1XGTA 1N59B 1R3JB 2H45A 3E2HB 5B22A 5GGQH 4OM1H 4XP4H 4QHMB 1JV5B 3KXFB 3KJ4B 4X6BA 3MRQB 5JXAH 5C0JA 4J6RH 5HHXH 3QCTL 4LEOB 1NJ9B 3TBVB 4IOIB 4S2SA 2RCSH 2BNRE 4W70A 5IJVB 1NAMH 3BGMB 4I4WB 4Y4HB 5I8KH 1XF3B 3G5VA 5EN2B 1QBLH 3AS2A 1T7YA 4UV7L 4EI5D 1JYWA 1E4KA 2EIDA 4KAQH 4NN7B 2PXYC 4ZSOE 5DLMH 3WFDL 3H9HB 1TTUA 5EZIL 2UWEE 3TN0B 1FYHB 3GM8A 4UZGA 5IHUH 4XCFL 3SDXB 5ALBL 4K7PH 3T0EC 5EDXA 5I1IH 4R96A 4HQQL 4PUBH 4MQXD 1YPZE 3DX8A 1CCZA 1GAFH 2G60H 1HXYB 4NQVA 4MJIB 1PSKL 4PJIE 2MKLC 2XZQH 4HK3N 2BRRH 4NBYB 5C0ND 2BCKA 4Q6YA 5M94B 1J1PH 5HGHB 1G0YR 5B8CC 3HZVA 3I84A 2CR6A 1ZE3C 2D03L 2X05A 4Y16D 2FATL 2UVEA 3L1OL 4MD0A 3VFUA 4LHUD 5LGHL 1S78D 2R29H 3VA2C 4EZMA 5HHPB 1G7IA 2GY5A 1KLGB 2RAMA 3HFML 4QRQA 2UV3A 4LCIL 4P5TC 1GOGA 4DW2H 5HYQB 1S9VA 4M6NH 1U41A 4ETYA 3KPOB 5C2BL 4L4TE 2X1PA 4LSVH 2YA2A 1A7NL 1FL6A 1N7MH 5CJXA 3RWFB 5KVEH 3S35L 3FZUD 4J3OC 3WFBH 4FNLL 1VKXB 3VFOB 5F3BB 4HEPG 4NQSB 1WITA 1G9ML 1H5BB 4OFIA 4MSWB 3KYMA 4JFHD 4UTAH 3I50H 3WS6C 3OKNA 2VOTA 5KSBF 1T7ZA 4KU1A 1A47A 4P5MA 3WNOA 3S36X 3VWKB 4JQIL 4P4KC 1IEHA 4U1NB 4Z6AT 5MI0C 4PJGB 4MCYB 2EEAA 3P11L 2CLRB 1ZVYA 4XB7A 2DJSA 5DJDA 5C86A 1GC1L 3KPPA 5EUOA 3MRRA 4YK4C 1PKQB 1QD0A 4DWHA 5MP6L 1Q38A 1XGUA 3RNKA 3ULVH 3V5KA 1BJ1J 1J8HA 4O02H 1EEQA 4HCRL 2NYYC 3FFCB 4DTGH 4PLKD 3OXRA 2OMBA 2VJXA 1HCFX 3HZKB 3MMEA 2VDLL 2CSPA 3VXSE 4OTXH 5K9OB 5DTFB 1NCNA 3NACH 1ZSDB 3P0VL 1BZ9B 1S7TA 2OBGA 2Y06L 5I73C 3O8XD 1PG7L 4RMQA 3MV8D 4CADB 4X9HA 1KG0B 1R3IH 3OF6A 1FE8H 5CBAB 1C8PA 4JR9H 3P73B 5HDBF 1DDHA 4KKCD 5C08A 5HGDA 4WI4A 4W6XB 1PZ5B 4WIQA 4UDUA 1AD0B 5D8JH 2VLJD 1WFTA 5F9AC 2MWCA 3VRIB 4C83B 3CCHB 1GZQA 2LVCA 4ZUWB 4OCYL 1BHGA 5I1AA 2PO6C 3FO0H 3WD5L 5ADOH 1F2QA 4D0DB 1FGVL 1M6OB 4Y5VB 5HYEA 1NGZA 3K2UL 1FNAA 3CLFL 1T20B 2KKQA 4JFFA 3QUXC 1EERB 3UAJC 5DURB 2G5RA 4DUWA 2HRPH 1E6JL 3QDGD 1MCRA 3BFOA 4QHKI 4QNPE 4PJCE 1JZ5A 3B9KA 1BFTA 3C09C 1AGBA 2V9RA 3NABL 4RMSA 5IWLA 4IHOA 3Q5OA 5CJQL 4RRPA 1T3FB 5EWIL 4OZFA 1BZQK 5CS7A 3K8MA 4ZFFA 4YHYC 1NANH 2FECL 4YHPB 4EDXA 4D3CH 1UM6H 5HVHB 1RJLB 1UWGH 1A64A 1L0XA 2A38A 4JHZA 2ERJC 1NUDA 4AZ8A 4ERSH 3EOTH 4JCLA 4OZ4B 2APVA 4RRPG 1G6VK 4OZFG 3S96A 4MXQD 1MCSA 2BX5A 3HNVL 3HG1E 1GGUA 3U79A 4OLEA 1CD9B 5ISZB 4ZS7L 3JWDC 2LU4A 5EUOF 3VMNA 5I18L 3PGDA 1SVZA 3O6FA 4XCCH 3INUH 1KNOA 1DQDH 1RVFL 4OKVB 3M07A 4RNRB 1EJ6A 4FQHB 1PQZB 4P9HL 4HDIA 2AEQL 1A4KA 1NAMB 1J1XL 4ODUA 4HLZH 2X4OA 4FQCH 3VJ6B 3OJ2C 3UJJL 2I9LB 2E6JA 3JTTA 3OKLB 4KJYA 5EPMB 4N0YH 1TFHA 1G9NC 5AEAA 3MRDB 1UKSA 1QG3A 4Q6IA 1QA9A 1A9EB 4H88H 3BUTA 5CIPH 1J87A 3UPRA 3BJ91 1BFOA 1J86A 3UC0L 4KRPC 1ZTXH 3IFPB 1XGRB 4YO0B 1BD2B 1JGDA 5GRXG 5LAXB 1BVZA 3DUUB 5KVMC 5E5MA 2O5ZL 2A9NH 1L6XA 1S7WA 3N9GH 3HE7D 3RUGA 1MJ8H 3B3IB 1VEMA 5D2LA 1LK2A 4LSPH 4N5UA 4OLWL 4U6HA 2V2XB 4GW4B 1RURL 3CFEA 4JY4A 4ZTOL 1HYSD 2DQEH 2HJLA 4Z8FH 4KKLD 5LGJB 4J8RB 1N59A 3SBWC 3QCVH 3U30B 1YUHB 2FNBA 1XGYL 4I2XA 1SYSB 3KJ4C 1SJVA 5D70H 5H37G 5I8EB 1MCHA 1S8DB 1LE5B 1QPXA 5I1JL 3QO1B 5AD0B 3T3PE 4M7LH 1BVLB 1F00I 1NJ9A 2F53B 1U8IA 4LEOA 2ADFL 4XVJL 1MWAA 4N9GB 4Y4HC 5D7LE 5DR5H 3UYRL 5IJVA 3TBTA 3ZDXF 5BVJB 4I4WA 2DI8A 5EN2A 4NN7C 3NIGF 4P59L 4LBEB 1OGAB 2VXVH 1HH6A 5L7XL 2H6PA 4QKXB 3H9HA 3WO3B 3HC3L 1GHFH 5E03A 3TN0A 3TF7C 3BKYH 2VAAB 5KSBE 4FQXC 3EYUH 2VITB 2BY2A 3HPJB 3O4OB 4YDIH 4XPHL 1MNUH 4OQTH 3CX5K 4PJDB 2EO1A 5EOQL 3PQYB 2VUOA 1JMXA 1FBIH 2AJ3B 1RUQL 3CX2A 3U6RA 4FZEL 5E8OB 2APXA 1DQTA 1ONQA 3LKQB 4APQA 1ZLWK 2H2SC 4MXVF 3MV7D 4RWYH 4X6FB 5JOFB 3CMOH 1WT5C 2DTMH 2DWDB 4L4VB 2AI0L 5I1KL 1D5IH 1FNHA 4WV1B 3T09A 4NHCL 5L6YL 1NCWL 4QRRA 3FRPG 1QFWL 1X5ZA 1M7IB 3V79C 4P46D 1IAMA 5J13C 2N4IA 1CN4A 2EDTA 1KCRL 1EH9A 5SWZE 1I3UA 4TNWK 1DQQA 5HYQA 1U8NB 3IGAB 5CEYA 5TF0A 1FGNL 4YC2B 1VADB 4EBQH 3KPOA 4EUPH 3MOAH 4MCZB 2DF3A 3K46A 3E0GA 3O3BA 5BCAA 5E70A 1RI8A 3C2AL 3EOYG 3CFJB 5E6ID 2A0LD 2XQBL 5DJXB 1VKXA 1H5BC 2NXZB 3PDOB 5FDWA 1I8KA 1YQVL 3GI9L 3LRGA 4K94L 4IOFD 4L5FH 1P7HL 5GRZA 5E2UH 4ZQKB 3MREA 3VG0H 1IBGL 3DJ9A 4P9ML 3VFNA 3GHBH 5AWNH 3VWKC 2IQ9H 5IFAH 1GL4B 3LQZB 4TVPD 4WTXA 4DGYL 4FS0A 5D2LF 2PYEA 2M26A 3LQMA 3B2UD 1NCBH 5FYJU 2VLLA 4KUZH 2CLRA 4KI5E 1DEDA 2QHRL 4OLZH 2JJTC 3HMXH 4CU8A 3L5JA 1X5AA 5I1HH 1EIBA 3AMLA 3WKNA 3GRWA 4M9PA 2VQ1B 3TBWB 3PWPD 4EVNB 5C3LD 1XGQB 4XCEB 5D7SH 1ZA3A 4C4KT 5IMLB 3NIFE 5GZND 3QUMA 4X6DB 1RZJH 3FFDB 5GRUH 4G7YL 2Y5TA 1K5NA 2YHGA 2I07A 5K9OA 4KKBD 5TGBB 1ZLUH 1NLBH 3NZHH 4KTEH 1IRAY 3EYVA 3MX0A 4G80A 5CBAA 5CJOL 5MERA 5C0AA 5E9DD 3BPOB 5KN5B 4LGRB 3LEVL 4NUGH 5C0RH 4BUHA 2AJSL 4NCDA 3IVKA 1T66C 3BQUB 3N1GC 4IOSD 5B39G 4OT1L 3QRGH 2JE8A 1ZWIB 3RNQB 3ZYIA 2IADB 4D0DA 3U9UA 4L1HA 4Y5VA 3RFZC 4OAWB 3TGXA 3KNBA 1QBML 5GGSY 1SJXA 2AK1L 4Y2DD 4X5XB 1J8HE 2P43B 4OSUL 4HMDA 5J6GB 5KSAB 1V5JA 3O2VL 5C6WH 2R0LH 5CEXB 4B50A 2IBZX 3DGCR 3ULUD 2VXUL 1JYNA 5IFHH 1M05A 1AC6A 1HQ4B 1OAZL 4JM2D 1INEH 4M93B 1U3JA 1Q9KB 2OQJB 4XRCA 1FFNA 2ZUYA 3ILQD 4FQQB 3LS5L 4JQXA 1J1OL 1I9IH 4MJ5A 1IKFH 5K9KB 5GRWA 5C0CD 5FUOL 1RJLA 1YEIH 1J0JA 5CHNB 3RPIB 2P48B 3QQ4B 4HUVB 5C7XL 3QXVA 4S1RH 4PB0H 4OZ4A 1OL0A 2VLRB 5DD6B 5HHME 4NC0B 4OLXL 5ANMA 3AS1A 4DN4H 3DI2B 1AR1D 1SJEB 4N0CC 2CIKA 3JWOH 1OQXA 5ISZA 3MJ9L 3RGHA 1PZUB 2J88L 3BYTA 2H3NA 3PP4H 5F93C 3UBXI 3HB3D 4UU9B 4OKVA 4RNRA 1JRHH 4JFFE 3THMH 3I2CH 1T1WA 1AJ7H 1T21B 3QP3A 3D69B 4JQVA 3GZKA 3H3PL 1OAUH 3T0DA 1I8IA 2QQNH 3MRMB 2EYRB 5EFIB 2HFFB 3GI8H 3V52L 3ZDXE 1U3HB 3OKLA 3EYOA 4TQEL 4NN5B 1I1AB 4H8WH 3SGDI 3S9DB 1CFSA 3OKOB 3F65A 3MRDA 3RY5A 1MIML 5I17A 5FECB 3DRQA 3TVMD 3CVIH 4P49A 3DURB 1C5BH 5FUCC 2E7BA 5FUZL 2LU3A 1A2YB 3PNWB 1GRWA 2HKHH 3IJHA 4Y89A 4GKSA 3KPRB 4QXGH 5KVDH 5ADPL 2YUWA 4R3SB 3FQTA 2AV1B 1FFQA 5EIVA 4DZ8B 3B3IA 4MB5A 1TVHB 2HWZL 4NQCD 1KXQE 4WY7L 3LHPH 3DV4A 4MXVE 1VSCA 2V2XA 2WLZA 2Y72A 5GGTH 4WEUD 2Z8SA 4HWNA 1MFEH 3GMMA 3E8UH 4LMQE 3U30C 3G08B 2D0HA 5DJZA 1EXUA 3OX8B 5D2NB 3TZVB 4EUPB 5ENWB 4NO2B 5ETUA 3ZKMD 2DKSA 1WK0A 5AD0A 1BVLA 5ID0B 3IDYB 2YA1A 3SO5A 3QUZC 4HUKB 5BVPH 5E7FA 5BVJA 1N0XL 3IDXL 2XKNB 1KGCD 3DBXB 4LBEA 2V7HB 3N1PC 3V0VB 2ZNWA 3RGVB 1L7TL 3IXAA 3FO9B 4N8PA 1J05A 1IKNC 4FXGB 5IM7B 2J6EL 1U92B 3MLYL 4Y19B 4F8TA 5EG6C 4TVPL 2CK0L 3O4OC 2ESVD 2W92A 2VAAA 4RSVA 3HC4L 15C8L 4WWID 4IIQB 3KPQB 3RUGE 4PJDA 4S1SL 1BQHB 4HPOL 3PV6B 2WWKT 4QTHB 5GS0H 2P5EB 5I66A 3ULVC 4RGND 5K93A 3NBNA 2AJ3A 2YD5A 43C9B 1R6VA 4I9WE 3JTSA 5E8OA 1DBAL 1H8NA 1A7OL 4X6FA 5JOFA 4WV1C 5I30H 2DWDA 4NOFA 4P3CL 1TZIB 1XCTB 3RDTB 3RX8A 4PBVC 1G7QB 4XC3H 3EZJB 4FN0A 4I2XE 3P9LB 3MRIB 1A6WL 4NQTA 3AAZA 3EYFB 3AB0B 4CDGC 2A73B 4HJJH 2GQHA 3ZT5A 4F9PC 1II4E 5KW9L 3NFSH 4F58L 1G7HA 3MLTB 4LHJB 4YC2C 3D0LB 3HMWH 2GK2A 5H2BB 2QQLH 3IGAA 5EULV 3PL6D 2VISB 1RIUH 1FL5B 4MCZA 1N8ZB 5I8OH 2X1WL 5IMKA 4QF1B 4MAUH 3X12A 4AYFA 2NXZC 1EFXA 3UBXG 4ODSL 3RAJL 4L8BA 1DSFL 3JUYA 2I60H 1QSEB 1OTTD 2PW2B 2R39A 1JUFA 3RY6C 2HLAA 5ALCL 4ZDHA 1HE7A 3TV3H 4WW2A 1KACB 3ZYOA 1BFVH 3LQZA 3CFDB 4U7MA 3VXUA 1AE6H 5INCB 1F4XH 3C08H 5A2LH 2IG2H 1MJJB 4I48A 4KROB 4AEHL 5BS0B 3QIUB 3L7EB 3QDJB 1R5VA 1W72H 4OQ1A 4QRRE 1TIUA 1KJVA 4N5EC 3ULUL 4TSCH 1JWUB 2D7QA 35C8L 5DHXB 2VQ1A 2HTLC 4XBEH 3TBWA 3QI9B 2CDGA 3C5ZB 5GZOD 5BV7H 3HC0A 5IMLA 3S37L 3OR7A 4WHTA 3W2DL 4XP1H 3MJ8B 3GMPB 2H1PL 3LKSA 4DKFH 5L8JB 2ZCLH 5DI8B 3OGOE 4M43L 4JB9H 5BQ7B 2P5WE 2A6KA 4GQ9L 3WS3A 2R0ZH 1PY4A 1IC5L 5EIQA 3TT1H 2H32B 5HYIA 1U8JA 2V9QA 3ARFB 3BPOC 3CFCH 3CK0L 3U0WH 1QFUL 4K3HA 2DM4A 3UP1A 4YFEA 5KN5A 4ZAKD 3TNMB 3VXPA 2APTA 3BQUC 2A1WH 1TXKA 2DMCA 4PJDF 1EO7A 2PYEE 3I75A 1D9KB 3MNZB 4PGDB 1C1EL 1HDMA 4NWUL 4BFGA 4KTDH 2GJZB 1KT2A 3ULVF 4XXCA 25C8L 3QHZL 5J89A 5E56A 2V9TA 2MCPL 1FNLA 4U1SA 5D1QD 3TESA 1OAYH 2QV2A 4X0KA 4LU5L 5E2VH 5HYSB 4X5XA 5J6GA 4EN3D 3NTCL 4KI1A 4O4YL 3EO1A 4WRLA 4DGIH 3NCCB 4PJ9B 5CEXA 4LLDB 1CU4H 1J88A 2IPUK 1RUMH 2Q7NA 3S4SB 1Q9KA 1B4RA 5ACLA 1LEIB 1QVOB 4NM8L 3IFOA 3MLWL 3ARGC 2BNRD 2FX9L 4TOYL 2O93L 1P84K 5DYOB 1OP9A 2XN9B 4V1DD 4E41B 3IJYA 3AREB 1JPTL 1MHCB 3BIAX 4D9QD 1IAKB 3P2TA 2IH3B 5C0AE 1HHGA 1KOAA 2CXKA 2J7LA 4K7PX 4BYHA 3O4LE 1A14H 4UV7H 4MJ6B 4WW2F 4HUVA 3MBEA 1HKFA 2VLRA 2HT3D 4HWZB 4YFLF 2EDDA 3B5TA 4QRSA 3GSXB 2OP4H 4JHAL 4XCFH 1Z0NA 5ALBH 2ZUWA 4HQQH 4JDZB 4LGSB 1ULVA 1N4XL 1FAKT 3OAZK 3MODH 1RZ8B 3F12A 4PP2B 2FLRT 1FNFA 1ZAGA 2VDKL 2XPGB 1D6VH 3BESR 1FIGL 1BPVA 1FZOB 5MEQA 4FQLL 5FEBA 3MRMA 3RKDC 2EYRA 2EH7H 5HI5D 1ZT4B 4X6DF 1U3HA 5MENA 1I1AA 4TUJB 3L1OH 5I19L 3PWNA 1FCGA 5LGHH 1T83A 1I7TB 4AEIL 1UT9A 4L4TD 1BBJB 3MXVL 5DUPL 5L2JA 2APBA 4LCIH 4DOHB 3RWGB 2Y5EA 2DLTA 1WCBB 4XNZC 2X1OA 3U46B 5C2BH 3PNWA 2Q8AL 4PJEA 3RTQD 3KPRA 4ODXB 3C6SB 1DEEB 4FNLH 5ANME 2X4TB 4DZ8A 5IQ7L 4HS6A 1FFRA 5IW6B 1BVKA 1G9MH 3SKOB 1TVHA 5AZEH 3MRBB 2X4UB 1FLTX 4G6FB 1ORSA 4NRZB 2VL4A 2P24A 3BT2H 1GGBH 5JOPD 4Z7UB 5GS1C 5D2NC 3SKMB 1XR9B 2HLFC 5CAYB 2ENSA 3TZVC 1F8TL 1GOHA 5GSVB 3SJVD 1JGUL 1GC1H 5CGYC 1IGIH 4O51B 3IDYC 4FXLA 1LNUA 4W4OA 2EDRA 5ID0A 4FFWC 2BRQA 4KXZI 4HCRH 1K4DA 3RGVC 2ZCHL 1EZVY 1NC2A 1TJIL 5GGSB 3V0VA 2X4RB 4MQ7A 1P7QA 4NQDB 2VDLH 4FXGA 1JPGA 2OSLB 4IIQC 1U8HB 3MOQA 3P0VH 3DRTB 3GJEA 1IAOB 4LRNL 1KENL 4DGVL 3KPQA 4P99A 1HWHB 1WIOA 4PLNC 4XPGL 5FGRA 1BQHA 1UQSB 2FJHA 1A21A 4JFDB 1W72B 1FPTL 1TQBB 2JK5B 1BLNA 4B41A 2J8OA 3RDTC 1BGXH 4LSTL 3BP6A 1CTNA 5TPWL 5LXGH 1JHLH 1TZIA 4UIKL 3V6FA 5BV7B 4OCYH 1RZJC 1I3GH 2H41A 1C5CL 3TO4C 4UNUA 3MRIA 3WD5H 5JPNA 3ARXA 4G3YL 1WBYA 4PGBA 1JYXA 1P4LA 1FGVH 3CU1A 4ONGH 3SDCB 3U1SL 2YD6A 2VISA 4WW1A 3K2UH 4X4MA 4PJ8D 3IDJB 1OB1A 5E2WL 4LCCB 3BDXA 5A16B 2CLZB 1ZANL 1SY6L 4G8EB 4XZUA 4MDJB 5F9JA 4O2FB 4FTVB 5SX5H 1E6JH 2IBGA 5EBMB 1MVFA 3K0WA 2NY7L 2BVQA 4HIEA 2NLJB 4PJEF 2DQTL 5HJ3A 3CVHL 2PW2A 3H9ZA 4NKMA 2I27N 3DVIA 5CJQH 3QQ3B 5EWIH 3H7BB 1YEGH 1E6OL 3QEUA 4PTTB 3IFLL 1IL1A 2GJJA 1AHWB 3RWDB 4KROC 3D9AH 1ZHNB 1Q0XL 1MJJA 2FBOJ 4HUWB 1UH4A 4NRYB 4ZS6D 2BNUA 3WNNA 1RFDH 3D3VB 4XHJC 5IEHB 4ELKA 43CAB 3QIUA 3GJFH 4POZC 3L7EA 3PHOB 3QDJA 3C87A 4ONOA 1D6EB 4PB9L 5GGRY 4WO4B 3HNVH 2OTWA 1CL7I 3C5ZC 3QWRA 5J8OA 1MFBL 4ZS7H 3QI9A 3GK8L 5I18H 2B0SL 3L3HA 1RVFH 1ES0B 3GMPA 3DPBA 1R5WA 1ZS8B 2IAMB 3QFJB 3T8XB 3BKJH 2OXGA 3QIWC 5IP4A 3ARFC 2XY2A 1PG7W 2K7QA 4OFVA 4E0RB 2H32A 3UJJH 2R1XA 4Y88A 3MNWA 3C2SA 3ZYJA 2BY1A 3TNMA 3QXAB 3JWOC 1CXLA 4OBSA 2VLKE 3CXDL 3ISWA 3F7PC 1HCVA 3MC0A 3QFDB 1D9KC 2CKNA 4YUEL 3VXUE 4NN6B 3I3DA 4OV5A 1U58A 3MNZA 3BI9X 1R5IB 2GJZA 1TCRA 3RWJA 1CICA 1A7RH 3NCFB 2R4SL 1UENA 2O5ZH 1AI1L 1QHPA 3I02A 3M1BB 3TC9A 1IQDB 3I6KB 5ESQB 1YEJL 5FO9B 5DK0B 1ACZA 4R90L 2PTTA 3HLAB 4OLWH 5T3ZE 4CU7A 3W0WE 4JANA 4LLDA 1RURH 1U2CA 4ZFOL 1UB5A 3TCLB 5TF1L 2ENYA 3G5YB 4Z7WA 4CKVX 5KVGL 4XMKH 3SN6N 1XGYH 3CC5B 5D7LD 4K8RD 2JB6B 4ZXBC 2P45B 1RULL 3EKCA 4WI3A 1QHOA 5DYOA 2XN9A 2J3SA 1A5FL 4FXKA 4E41A 4JZJB 4V2CB 1MHCA 5I1JH 1RHFA 5TDOB 4LHQB 4MDIA 4XVJH 2ADFH 2H9GB 5HI3D 2BHUA 1RZFL 2XTLA 3QEQB 2W9LA 4OIAA 3FO2B 4P59H 3GMQA 3WSQH 5GGTA 4G7VL 3HC3H 3F7RA 2Q86B 4JRYB 4EXPX 3LB6C 4J7RA 3O6ML 3F58L 1E4XI 1LO0L 2BNQB 5E1HB 1Y6MR 2CH8A 1ROWA 1A0QL 2NZ9C 4JDZA 1J0HA 1X7QB 4H26A 5EOQH 5JA9A 2X2YA 1B2WH 3FB7A 3HAEA 1RZ8A 5E4EB 5B38B 4XCYA 3WBDA 2XPGA 2L7JA 3RPKA 3EUUA 1FZOA 4HFUL 2AI0H 1YEDB 3GIVA 3QA3B 1GPOL 3V7MA 4NHCH 5AZ2H 1VACB 5L6YH 4TUJA 1KFAH 1QFWH 3GUTB 4M5YH 3HAEG 2NY3C 1KCRH 5JUEH 3RI5K 3H0TB 5E8NB 3VXMB 2DQJL 3U4BL 2EYTA 3RWGA 2AQ1A 5DJAB 1FGNH 3MQIA 5GS0C 3MV11 4Z7QF 4JVWA 1X9QA 3LAFA 3MV9D 4P4KA 2BDNH 4R8WL 3VI4F 1XCQA 4LP5A 5C07A 2OR9L 2W07A 2ZNXA 3GI9H 4K94H 5IW6A 3O6KL 3D39E 3GMLB 1OHQA 1PJ9A 3W5MA 5F21B 1BP3B 4RX4A 2E8YA 3EOAA 1IBGH 2X4UA 4JFEA 4P9MH 2ZUQB 5DRNA 2BZDA 4F37K 1P2CA 4DGYH 5CCKL 5HXMA 4Z7UA 4YHOH 1VDGA 1XR9A 2YWZA 1ZGLM 4I0KA 1FH5H 4HKJB 1MEXH 2OMNA 2R1WB 4U3XA 1EGJL 2NY2D 1X5YA 2DIJA 1NDGB 3LN4B 5MENE 4OLYL 1FYTD 4Z7WF 3C5JB 1KXTB 2IPUG 2D4FA 5EU6E 5TE7L 4OD1L 5IUSA 5D6DA 3S3SA 4YDKH 3QUYB 5HYFA 4X8JA 3BEVB 3EGSA 1I85C 3M17A 3IDNA 4PV9B 5GGSA 4XXDB 4PJEE 1WF5A 4NQDA 3VFSB 3NN8A 3T65B 5EU5B 5FKPB 4YBLC 4RISL 2B8OT 3LQAL 3GJFB 4GAJH 1TQBC 1U3ZA 1VFBB 3WHXB 1CVSC 3LEVH 3WFCH 5DHVH 4HKBB 5F88A 5EU4B 1JZ2A 1JNHB 3CPLB 2AJSH 3VXRD 3EJJX 2RHEA 3MLRL 4RGMC 4Q58C 3T0BA 1FG9C 2WIIB 2YUZA 4M7JL 2OTUB 2QSVA 3OHXA 5CZKA 5CILL 4OT1H 1J8HD 1J0ZA 3KPLB 3SGKC 4OF6A 2V5SA 5EBLB 3LRSB 5DA4A 3QULB 5ICXB 2XFXB 2AK1H 4PRIE 1MREH 1NSNL 1CT8B 1ITCA 4OLUL 2ITDB 3UTTD 1DJSA 5T1DH 4G8EA 3QJFB 2FB4L 4MDJA 5IROC 1MRFH 2VXUH 1HHIB 4CVZB 4O2FA 1FNSL 1OAZH 3VD3A 1RV6X 4X80L 1RPQA 3OF6D 3K80A 4ZG1A 3VRJB 5DQDH 5IGXL 4FFVC 4X7TA 4ZOCA 5C08D 1FJ1B 3MRKB 1FLRL 1J1OH 4Z77B 4WU7B 3DYPA 1AHWC 3MUGA 2Q8BL 4XGZB 5FUOH 3DYOA 4YHNB 2NX5B 3KPMA 1AXTL 4HUWA 4KK9C 3AU1A 3TPUB 3D3VA 4X5WA 5IEHA 5C7XH 2PO6D 5FHAL 5ITBL 2AJZA 4WO4C 1RK1B 4OLXH 3WYRA 1D6EA 4DK3A 4Z7UF 1G1YA 3KLAA 2A83A 1F45A 4L8SB 2AK4B 2OL3A 3K8KA 2J88H 1NKOA 2CXGA 2ZJSL 1KB5L 4K8RL 2NY0C 4BUGA 3IXTB 4AL8H 4X4ME 2AJVL 1ES0A 2B4CL 1ZS8A 2IAMA 3EIFA 3NFPB 3Q1SL 3QFJA 4MD5A 3B9KD 4KGLA 3H3PH 3DHMA 4H0IA 2DQGL 1VESA 2QEJA 3T0WA 3BGAA 4E0RA 3V52H 4YGVB 4TQEH 4M8QB 1TVDA 2KPNA 4Y4FA 2VDNH 3UZEA 2G5BA 5D7IB 1WIUA 2IWGA 1DP0A 1S7RA 3MLVL 2AVGA 5HHVL 5FFLA 2AXJA 1F5WA 1REIA 1FZMB 4MD4A 4NN6C 4LIQE 3QFDA 2X89A 2FD6L 1G7JA 4IRJB 4YFDB 3SBWA 1R5IA 5LJYH 2KL6A 3J7HA 1FG2B 3IT8D 5C0EA 3GFUA 5FCSH 1F6LL 4RIRA 3MRCB 3HNSL 3BIKA 5DK0A 1G1CA 3R4DA 2M8XA 3HUJA 1VGKA 4I13B 4UOJA 1A7BA 1T03H 1JJUA 1QR4A 4OF3A 5ILTL 3TCLA 4L8CA 4PD4J 4UUJA 1TDQA 1CDCA 4NKOB 1J0KA 3UTSD 1ETZB 4GAGH 4Z18A 4JZJC 4NO0A 4OGYL 1Q9WB 2WUBH 3MV8B 5EZJB 2CPCA 2V6HA 4Z7OE 2IBBA 3UMTA 4LLWA 4Z7QE 3O0RL 2MCG1 2HRLA 4WVRA 1K3IA 3PP3H 1G9MC 3GMOB 3MSPA 5DVOA 2DQIL 3HE6A 3FO2A 3VCLA 1JF1B 4HW6A 1KTRL 3OR6B 2HVJB 4Q9QL 5IVNA 1KC5H 3AUVA 3U36B 5K59F 2DM7A 2Q86A 3LV3B 1KBGL 5CD5C 3CFIC 2ZWLT 2VN7A 2X41A 1JPSL 3MLYH 1CBVL 3LD8B 4TVPH 2CK0H 1BREA 4F7TB 3HC4H 15C8H 5KSUA 3WXWL 1GC1C 4P2RA 5EU7E 1CF8L 1QKZL 3WIHH 4HIJB 5KJRL 4HPOH 4JRWA 5E4EC 4M1CC 5GISH 1QOKA 3PUCA 5E94A 1C7TA 3RA7L 5IHZB 5EU3B 2P46B 4K2UL 4DVBB 1WBXA 5F1SA 2XWTB 1A7OH 1KPRB 3KXFD 4Z7WE 4P3CH 2X1QA 2G9HA 3LZFL 5HYJA 5E99L 4M7ZC 4LLUB 5ESVB 5C9JB 4TTDC 2FZ3B 2XN9E 5H94B 3AMKA 4E42B 1RZGA 4OF7A 2ADGB 5KW9H 4G8FA 4LKCB 1MI5B 3QEHA 5GGRB 4OB5L 5DJAA 1MFAH 1EEYA 3O3EB 2Z35B 3TN0D 5IB5A 1J0IA 1XZ0A 3NCJL 2B1HH 1YN7B 5DHVB 4ODSH 3RAJH 1PFCA 2AGJL 1RY7B 1DSFH 2BXYA 4O2EB 1AXSA 2BOBA 1V7ML 4OZHA 1I7UB 4JGMA 2AEWA 4JFZL 2FX8L 2ZUQC 5CKGA 3FL7A 1R3KB 4OIIL 4APQD 4NQEE 4PY8I 2BOCB 1NCAH 4RAVA 3HUJF 1P1ZA 2XWJB 3W5NA 3SPVB 3EO9L 2WBJC 4LVNB 3ULUH 3QUYC 5DEGA 5C6TH 1FNGB 3RL2A 3G5ZA 4GJTB 3MCLL 3RVWD 2D7NA 2CRZA 1OLZA 3P9MA 1DBBH 5DFTA 3SDAC 5HHOB 3NA9H 2EC9U 2YBRB 4BA8A 5CFHA 4WCYL 1VFAB 3W2DH 4XXDA 1G7MA 1IM3B 5JW4N 5CGMA 4M43H 3S88L 1IGFL 1MJUL 3T65A 3ZZ1A 5D5ME 5C07E 5EU5A 5FKPA 4QOKB 1UEMA 4URTB 1QRKA 3CK0H 3T3ME 2VE6B 2WMPA 3GJFA 2NY6D 1FO0A 1NEZA 4B0MM 2PYED 4JFEE 5IF0A 1SJHA 4LNVA 4HWEL 4AENB 1S7VB 3MNVB 4HKBA 5I16A 4S10A 3B2VL 2GJ6A 5GRJL 2BHZA 4QXTB 4DK6A 3VRLF 4TNVK 1HI6B 3QWQB 4JEGB 2Q87A 5EIIA 2HVKB 4NWUH 5C09B 4P9HC 1SMOA 4QRTB 1NEZG 2P8LA 5IW3A 25C8H 3FO1B 3DX9A 2DDQL 1MCIA 2MCPH 3LRSA 3FFCD 3QULA 3U2SA 4EI5C 3ECBA 4XMPL 8FABB 1B0RB 1GGIH 5GGUA 3NTCH 5IVXA 5DSCA 4LRIC 4ALAL 1WCQA 1T22B 3VXTB 2JCCB 4P48A 1KTKE 2DRUA 1NLDL 2J2ZA 1A1OB 4UINH 4MQXC 4NM8H 5C0AD 3DVNA 3MCKB 4LKXA 4UT6L 2FX9H 5MEPB 1JHTB 1FJ1A 1EEZB 5JPMB 1C5DB 4Z77A 3T77B 3MLXH 4MAYA 5C0NC 1P4BH 1N3NA 1YMMB 2NX5A 3KHQA 3KG5A 4RGOL 4YHNA 5DGQA 4PLOB 4OZHF 1G6RA 4BSWA 4X6CA 5F7FA 1LHZA 4HZLA 4UIMB 1V7NL 2R9HD 3RWHA 1S78C 1WUNT 3CGTA 1DUZA 1EX0A 5FOBA 4P46B 3IFNL 5IMMB 4L8SA 4ACPA 4JHAH 1RU9H 1WFUA 3EDFA 1MFDL 5CSZA 4MVBC 4BQ6A 5BXFA 4OZGA 5DURD 1LO2L 1N4XH 4LPYA 2EDLA 2NZIA 3FZUC 4YFLI 1Z9OA 4WGWB 3DYMA 4C56A 2VDKH 3JV5A 5F89A 4LAQL 5E6IB 1FIGH 4NT6B 1R3LA 2HFGL 3GHEL 4U1JB 1IGML 2Z0BA 2EIZB 3BP5B 5AYUL 1U6AL 3L5WB 4RFNB 2I24N 5TJWK 2A2QT 4AEIH 4K3EH 1BJ8A 1J11A 3MXVH 5DUPH 5M95B 4IRJC 3P40A 5FF6B 4ZFZB 4NSKB 2Q8AH 1YNTB 4TUOB 3WIFB 3D3VE 4NO3A 1UH2A 3Q6FB 5ISZD 4HG4J 4JJ5A 1N6QL 1I1YB 4N0CD 3IAQA 3E6HB 5T1KB 5I1EL 4JHWL 4P3DB 4A2MA 5IQ7H 1UZ6F 1A6VH 1DE4A 3H9SA 5DMJB 4PLKC 4NCC1 3PWPB 4NQXA 1DVFB 3BEWA 5I6XB 3D18A 4HJGB 1MWAL 3IKCB 4PRHB 3DO3A 1IGCL 4HXBL 3F5WB 4Y5YB 3B43A 5EH1A 3CUPA 4QYOB 1BQUA 1BF8A 1N5YL 3QQ9D 3O8XC 2VWEE 1ETZA 1F8TH 4KQ3L 2VYRE 1PVHA 5IVXF 5C0DA 4EOWL 4TTGA 1JGUH 1DANU 1Q9WA 1OWWA 4XAKE 1QLFB 3SQBA 4JRXB 3TT3L 4KKCC 4NDMA 4I18C 1TJGL 2P44B 2UYLA 3OL2A 4K94C 2M2DA 1QTYT 3GMOA 3PHSA 5JZ7D 2ZCHH 3V6OA 4B7IA 2C3WA 4L9LB 4BFIB 1TJIH 3FQWB 5J1AB 2F15A 1EO5A 4EJ1C 3GSWB 1T4KB 4JVPA 1GGYA 2D7PA 3LD8C 4F37F 3HCVB 5IOPB 2E8ZA 2OLDA 3QRFM 5TE6L 4LRNH 1WJ3A 1KENH 3S5LA 1SBBA 3VXNB 1PY9A 1KEGL 3HZYA 2BSSB 4HULB 3GSVA 4OKDA 2FCBA 3HUJE 5EC2B 2E5EA 4PJ7A 4ZNCD 1FPTH 2R15A 1A1NA 5EU3A 4XP5L 3O45B 5E8PA 3MGOB 5FB8A 3CH8A 4MMXC 1CDGA 4LSTH 3TJHD 3S5LG 4UIKH 4MA3A 1CWVA 3KS0H 3ZYZA 2F53D 1C5CH 1H3VA 1P6AB 4G3YH 1I4FA 4P2CG 1YEFL 3PGFH 1MFCH 1F11A 2ADGA 4G43B 3UTOA 2CDFA 2AXFA 1S5HB 1KCVL 2JIXA 2QLVB 5GGRA 2BMKB 5JHLL 4GAFB 3ZKNC 3MRGB 5ELIA 5D7IF 2HJKB 1ZANH 1SY6H 2XNAA 4MXQC 2UUDH 2UY6A 1M7DA 1LEGB 1NL0L 4G8GA 2NY7H 3ROOB 2X70A 3EZ8A 2DQTH 4U6VH 3CVHH 4F7PB 1I7UA 3CMGA 2VZUA 4CN4A 2RR3A 1ACYL 2HFEB 4P2RE 2FDBP 3ULVD 5LCVH 4DQOL 4XNQA 3EDEA 5FA3B 3GRWL 4Y5XA 1U8KB 3IFLH 4L4VD 1NFKA 3F6LA 3IDIB 1A7QL 3WFHA 4N8CL 5ICYA 3UTQB 4OGAD 4I0PB 4QCIA 1DLFL 1AFVL 2GITB 4HD9A 3QUML 3STLA 1OAKL 4XWOD 5DFWH 4FZ8L 4HUNB 1N6UA 3BPNC 4LVNC 1OLLA 4P57B 5HYJE 1EHLL 1F2XK 1ZT1B 2CRMA 4X98B 1FNGA 4YE4H 3BH8B 1MAMH 3X17A 1U36A 2BSRB 2R4RL 2B39A 4NCC2 4WEMB 5HHOA 3GK8H 1ZHLB 2B0SH 4I77L 4OV6F 2H8PB 3SDYL 4AEEA 2X40A 1I1RA 4M6ML 3TYFA 1LK3L 3FRUB 4L3EE 1CK0L 3HE7C 4ZPVA 1BWMA 2F5AL 2NW2B 1KB9J 2A74B 3L3DA 2FX7L 4QOKA 1MH5A 4K55A 2EEBA 3FAWA 4JG1L 2C26A 1UJ3A 2VE6A 4NQCB 1AIFB 4OZHE 2VDML 3PWJB 4NYLB 1AQDB 1NKRA 4N0UB 1IC4L 5DUML 3IETA 1S7VA 3CXDH 4KKLC 4WFFE 2EEDA 2AV7B 1QRNB 1QUNA 2J5LC 4QXTA 4S0SD 4YNYB 4PJ7F 1A8JH 5C09A 4QRTA 2EDKA 4XP6L 2R23B 4J1UB 5KAQG 2R4SH 3OJMB 3FO1A