3JUYA

Crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
233
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCQASGYRFSHFTVHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGEWGWDDSPYDNYYMDVWGKGTTVIVSEIVLTQAPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 3B3 variant-A broadly neutralizing HIV-1 scFv antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords 3B3 single chain variant HIV-1 antibody
total genus 51
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA01
4NQTA 3U9UB 4ZUWB 5F7DA 3HUJE 4YIQA 2A9NL 3ARGD 4OLVH 1YC8A 4ZPVA 4DFIA 5JXEC 1FYHB 4Q58C 4HUVB 1A22B 1A3LL 1KCVH 3OAYK 1D6VH 3RL1B 1VADB 4DCQA 4XZUA 1GC1H 5HHVL 3BKCH 3S5LA 3ULVC 3SE9H 5A3ID 3RI5F 2EDYA 5IGXH 5ISZA 1HH6B 5I66A 5MEPA 3TT3H 1UZ8A 3TNMB 3CVIH 3HZVA 4MNHB 2IGFL 4ETQB 2R69H 4KVNL 1S5IL 5C7XH 4KTEH 4L4TA 1LO5A 3K80A 4KTDH 3VFWA 4HXBL 1RZ8B 2FX8H 1AGCA 1AD9B 1EUTA 3BUYB 4NPYA 4LSSL 3ABZA 1T7YA 1UQSA 2AEPH 2X4NB 5JUEH 4POZD 2NY3B 3INUH 2IQ9L 5C0JA 5I74B 1TVBA 5SX4H 3CVIL 1WGOA 4Q74A 2F19L 2J88H 1PJ9A 2JJVA 2DQEL 3MREA 1O5DT 1Q1JL 3K2UH 2GW5A 2RCSL 5EZJB 1S7TA 5GS0L 1G9ML 4W68A 2ICWA 1HCFX 4G8GD 4KY1H 4C83A 5IMMB 4KZEH 1UYWL 2A0LC 5K9OB 1IAOA 4LHUB 1LO4L 4J4PD 4LGRB 1JNHA 1QRNB 3RZCB 4L3CA 3PP3H 2HLAA 3OR6B 1UH4A 4PJ9B 4M7LH 5E1AB 4MAUH 1MCSA 5IW3A 3U4AA 3IDGB 5HHMD 1LEKB 3P77B 1ZLSH 1G7QA 1MLCA 4RA0C 4H25B 1JI2A 2Z93B 1N0XL 2Z8SA 4HBCL 3VFGL 5IESL 3LN9A 5ENWA 4G5ZH 1RIVL 2JE8A 3VD7A 4C56A 1NGPL 1OW0C 2DJSA 3QDJE 3MRQA 4HAFA 2ZWLT 1TMCB 4JRXE 1QSED 4J12A 4U6HA 3G6JF 2E6QA 1DVFD 3BZFB 1FO0L 4NCC1 4ZFGH 3SDDD 5B38A 3HC0B 2WM0A 4UT6L 5DMJB 3TT1L 5C2UB 1YC7A 4YEEA 1WEJH 3K1KC 5D9SA 3EDEA 3O2DL 4ZFZA 4LHUD 1N0XH 3KDMB 4JFFA 3ARGA 1JMZA 4WTZG 2F53B 5ACZB 2DTSA 4ALAH 4X4MA 4L9LB 1OHQA 2ITCA 1XGRA 3ROLB 1JZ7A 1UM6L 1I1FB 5I1KH 3QXVA 1RZKC 4EQ2A 1PVHA 3NA9L 2JF1A 1UYWH 5D70L 4N0UE 1CYGA 2Z91A 2FH6A 1I3UA 4N0YH 4JFXB 1H3TA 3VGAB 1NCAL 3GMPB 5CIPB 4OD3L 1NBQA 2B4CH 3MGAA 4R2GD 5D6CB 2FJHA 1BX2B 3FO1B 3AAZA 2EYSB 1FNGB 1PY9A 3VMOA 4BQ6A 3PWNA 5EUOF 3F7VB 3OZ9H 5F9WB 5C0EB 4M8QA 2J12B 3FB8B 4RWHA 4WW2B 5I9QB 2I25N 4P9HC 4GLRH 1CCZA 5IBLC 3QEQB 4PJ8C 3K8LA 4XAKD 4YDKL 3EOTL 5EU6B 1U8NA 4ISVB 1N5AA 1MRFH 3JWOC 2FSEA 2Q7YB 2FLRT 3G08B 5DVMA 1RZ7L 1OP9A 3RHWK 3EYQD 5FYKE 3N06B 4OGXH 4B7LA 2XTLA 4B41A 3IDMA 4M8QB 1OAXH 3VMNA 1MJ8H 3IXAB 4Z0XA 5FHBH 1I8LA 2WBWB 3VCLA 2GIYA 5MP6H 4WTWA 2C7UA 1YNLH 1H3UA 1T04A 2M8XA 4WFHD 1C08B 4TVPD 1JZ5A 4FQXB 4CN1A 5D5MA 1IEHA 3RWDA 4MD4B 4F2MB 1MI5A 4C56B 4I0PD 5LCVH 4I18C 4PRPD 4N5EC 5DD3H 2YUXA 4LPYA 2CDEA 5MI0B 3J8F7 4FFYH 3UTSE 1X3DA 4QXTA 4J4PC 4PJIE 1X4YA 4UILH 4OQ1A 3IAGC 3MCKB 3DX9B 3LD8C 3GHBH 2EH8H 1J1XL 1M05A 5JOPD 1PG7W 4AEFA 4P5KB 4HUUA 1HQ4B 1ZAGA 1DUYB 2I07A 2YD4A 5IROC 1WQVT 3MV7E 2AXGB 5D2NE 2JB5L 3SE3C 1QA9A 4WCYH 1U58A 4JKPH 4ONHB 5C0BA 1A14H 4OGXL 3HAEB 1NMCC 2X70A 3HC3L 4X6DA 3QNYB 2CMRH 4M6NL 3GMQB 3ARPA 4L8SA 5GSRA 3OJMB 4OSUH 5FO7A 1FPTL 4BZ1H 2ESVE 4LMQI 1I7ZB 5CZXD 3AU1B 2R15A 2W0KA 1C5CH 1DQDH 3DBXA 2EEAA 4UOW1 4K8RH 3I2CL 4HFWB 3VW3H 1CD1A 4TOYH 1INQA 2DJUA 4WWKB 3DMMD 5SX5H 3B8YA 3KS0H 4E42B 2FO1A 3MV7A 1RZ8A 5T1LD 1D5XB 5EUOE 1MVUB 3QUYD 5A3IC 3A67H 3DOSA 4DWHA 5CJXA 3JTTA 1W8OA 4OD3H 1OOAA 1JV5A 3CSYB 1U8QA 1MJUL 2Z92A 5F1NA 5BMFL 4P9ML 1MY7A 4TSAH 2E5EA 4XP4H 2VYRE 2NY0D 4PJDB 3S34L 3BH8B 1SJHA 4NC2B 4KI5D 4O00A 2BRRL 3ULUC 5F6HJ 2K9UA 4JFDE 1S7TB 4O9HL 1BQHA 3RUGB 3MRCA 5A2IH 2YD6A 5GJTH 3QUMA 4YX2H 5EOQH 1GGBH 4ZPVB 3WDHA 4KI5F 43CAB 3QXAA 4JFQB 2MHAB 3VXMB 4RAVB 4U1HB 4YR6B 3CLFL 3MRLB 4OGAD 3T65A 4YHZL 4WHTB 4FOMA 3RVWD 3AREB 2DQDH 2OMNA 3O8XD 4PFEA 1CK0L 1J5OH 1KV3A 4XMKL 3AB0C 2FJFA 4MA7L 4G9DA 3TA3D 1FE8H 1R3IH 4AIXA 4YFLI 1JGDA 4X5XB 2ENYA 3ES6A 2X4RB 5ADOH 2QV2A 3VE0B 1ONQA 1N5YH 4X6DB 1BP3B 3JV4A 5IVZA 1P4IL 2FHFA 1OW0A 1WFNA 3ALPA 3P0GB 2IANA 4ZTOL 4GKNB 4Y2OA 4E41A 4PRPA 1KLGB 2AJYL 4YDLC 1YN7B 3SKNB 4X8JB 3MCLH 4QRTA 1OPGL 1U8MA 2H8PA 5HY9B 4P5KA 3QUKB 4Y19E 3RL2A 4JM2C 4EVNA 3NCCB 1GAFL 2XTJC 3NGBC 3SDAB 1CXKA 2XQYG 3DECA 5EOTB 4AIZA 2NY5C 5I1LB 3BPLC 4H26B 1MRDL 4XBGB 5HGGS 5T1DH 4M5ZL 1FLTX 5TF0A 3GI9H 3I6GA 1TENA 2ITDB 3L9RB 4WFGE 4UAOB 4KZDH 5B3JF 3BP5B 2CH8A 4ZO8A 1KNOB 3CZFA 5I1CH 3OB8A 3KYKH 3D9AH 1L7TL 3CFCL 2FEDD 3RA7L 1V3MA 3MLWH 3WIFB 3L3DA 5SX5K 2VXTH 2H32B 4X99B 3MA9L 3LS4L 5L6YH 3ARBD 2CK2A 2GCYB 3CH1A 4ZG1A 1FGNH 4PD4J 3LQAH 4JGMA 2GJ6A 3I3BA 2BVTA 1TZHA 4WW1B 3SDCC 5F6HI 3RNKB 1R5WA 1WITA 2QHRH 2QTEA 2VLRE 2WP3O 5SWSD 4GKZB 1OAQH 3EOAB 4IM8A 1HKLH 5T1LA 3OKOB 1ETZB 3IJYA 5IF0A 1D3CA 4LLQA 1IGMH 2FD6L 1FLRH 3RX5A 1SM3H 4EBQH 1AO7B 3FB6A 5E03A 1MNUH 3WN5B 1JUFB 3WFBH 5GGRA 2N1KA 4PJ8D 4IRJC 3GKWL 4K94H 2XACC 3DX6B 2BVYA 5EIQA 4JY4A 5F3HA 1NANI 2FJHB 4P4KB 4R3SA 4ZNEE 1A0QH 4RFNB 4OZ4A 2ZZUT 1TNNA 2O61B 3BP7A 3OMZA 2VZSA 4X7FC 3FT2B 2ORBL 3LKSB 5D7JC 3C6SB 1QSFB 3A6OA 4ZNCD 5IQ9A 4MJIA 3WKNA 3T2PA 2VXTL 3PGCB 4FZ8L 4PGZA 2NNAA 2QQNH 1U92B 3HCVA 3PGFH 3U7WL 1MCPH 2YPLE 1F4AA 3U0TB 5A1AA 2YUVA 4GBXA 5I1CL 1Q0YH 4NKQB 2BHZA 3WXWL 4N0CC 4ORGB 3QDJD 4LBEA 5J9PB 4KU1A 2AK4E 3T08A 4B53A 2HVJA 4MXWH 4OCXH 4PGBB 3KYNB 5IJKC 1MFCL 3OQ3B 3P0VL 5IHZB 5LBSH 3R8QA 2EYRA 5ISZD 4ODUB 1A1MA 4OF8A 1DE4A 3TV3H 5I17A 4OCNC 3MLSH 4WFED 5B4MC 2EIZB 5I18L 3DURB 1VACB 1IGIL 4FMKA 1B6DA 1JWSA 2R29H 1SYSB 2GEEA 5DJDA 3A6CH 4WTZA 3MV11 3O41A 2AJ3B 3RI5K 3S35H 4C4KO 2XN9E 3SGDH 5EZOH 3WBDA 3ZT5A 2HN7B 5KVFL 4UU9B 1AJ7H 4D8PA 1E4KA 5CJQH 2DF3A 4XWGH 3PL6A 1WAAA 3O9WB 3H9SE 2NY4C 4D0DB 3UBXI 2VZ1A 4S1QH 5KSBA 3O0RL 1TQCC 3VG9B 5EBLB 3JSSA 5FO9B 3IFNL 3VXQA 4OD1L 5E6YA 3PJSB 4LSTL 3QDHA 1JNHB 2CDFB 2AI0L 3LN5B 4ZQKB 5DRZA 2R0LH 3U30C 4AH2B 5DMYA 4P23B 4PJ7B 1NL0H 1L7IL 5KW9L 2P45B 4QY8A 3RWEA 3T8XA 4OAWA 4KPHH 1EJ6A 5L88L 2FB4H 3ZTNL 4XVTH 1A7RL 1D6EB 3GEWB 1K4DB 4YHPA 4IJ3B 4X6DE 3OXRB 4GAJL 2X1WL 2MPAL 4BFEA 5KVGH 5CBEA 4I0KA 4YZFE 2I9TB 1YEDA 4L9LC 4JFOB 4Q6IB 4KQ3H 5CP7B 2IBZX 2HFGH 3D48R 4FQIH 3NFSL 4XPTL 2CUIA 3BH8A 3E2HC 2X1QA 1RAMA 3VI3F 3GGWA 3DO7B 2BERA 5D96C 4GRWB 4QRQB 2FZ3A 2N7AA 5D6DA 5KBNC 3MNWA 4G6AD 5GQBA 2C1PA 1AGFA 3WEXB 5DVNA 4X7CC 3WSQL 1KTKE 1IL1B 3WHE0 1VFUA 3OF6D 2XTJD 5DF0A 5FM8A 4JM2D 4PJDE 4U4BA 4PLKC 4GBXD 2FX9L 3P30H 2PCPA 5C92A 1AXSB 3WHXA 1AIFA 4OFKA 2M2DA 1ZANH 1FORH 1R5IB 1RIUH 3DBXB 4G43B 3ZHDA 3OXSB 3LMJL 3M07A 4YAQB 5GZNC 1RZIB 4WFFE 3NN8B 4MNQA 3S37X 1LK3L 2GJZB 3BH9A 4QRPE 1ZV5A 5DJDB 3TZVD 2K1MA 4ZUWA 1RURL 2DQUL 4F37K 5HYJE 2MCG1 1VACA 1II4E 3TN0C 5HTSA 4NZUH 5GRJL 3JVGA 5FKPA 3PWJB 2PF6A 3RVUC 5I8KL 1A5FH 3ZSSA 4XCYB 4EOWL 4YHLH 3PQYB 4XP5L 1JGVL 3WNPA 4QNPE 1Q9OB 5C07E 2LU3A 3KHQA 4LK4A 5FHBL 3ZKNC 3ZHKA 4MA8H 4F80A 1DTUA 3QWRA 1WSST 3H9HA 4GAGL 4G9FD 3P11H 4JO1H 5CD3A 2P8MB 5E8NB 2GY7B 5C0DA 3SKOA 3UYOD 1RK0B 1KPVB 1KEML 1YQVH 1EFXB 1HOCA 3K1DA 1MI5B 2EE2A 3SDYL 1IM3A 5D7LD 2BP3A 5I1DA 1E28B 1T0MB 4LLMA 5IB1B 4N5UA 4M00A 4JVPA 5IW6B 1Y18A 5KG9B 1FVEB 1HHKA 4PRAA 4WY7L 2C7UB 4PJFB 5TDNB 3VFOB 2QR0B 3FRPG 3ZLQC 3IXAA 4Z0XB 2D03L 1PZUB 3RGHA 1C5CL 2DD8L 3KPSA 5GRWA 3V8CA 1QBBA 5EC1A 1PGRB 3TCXA 5CZXC 4FZEH 3QIUB 4UUJA 2NPLX 3EOAA 4HV8A 1F2XK 4U6VH 2IBGA 4PPTA 2BMKB 1S9WA 3WS3A 1WIOA 3DGGA 1TVHA 4GAGH 4PRDB 3Q5YA 5AYQA 1NDMB 2BNQE 1GGTA 3SDXB 5C0ND 4BFGA 5JPMA 1FG2B 4XBEH 1LMKA 5C8JA 1DANU 2B5IC 2FECI 2M26A 3CH1B 3IFOB 5L0QB 3D3VA 5CGMA 5I1IL 4NN5B 5C6TL 1AXIB 4F33B 3WIFA 2D7TH 4U1IA 4KDTA 3O4LB 2GT9B 4R3SB 1QHOA 4GG8A 4NZJA 2ZOLB 3X3FL 4L4VB 3QH3B 1A9BB 4PJEF 4MVBC 5GGRB 4N90D 2A6JA 4P5TC 4Y19D 3ORJA 3BVNA 1P1ZA 4MQXC 5FOBA 5T3ZD 5J7CC 1EEUA 4H1LB 3N1GC 2BVQA 3JV6A 1NEZA 4I0PC 4G3YH 1AKJA 4HF5L 3SGDI 1LK3H 3VXRE 1UVQA 1T5XA 1H3GA 4LSRL 3TESA 3CVHB 1ZEAL 3OKOA 4GW4A 1JHLL 4K55A 1J8HB 3CGTA 1BAFH 1DQJB 1JWUB 1ZVSA 3D3VE 4NQVB 4XB8A 2AKRB 4FFZL 3U9PL 1J0YA 3WFHA 2AXHA 2YC1A 4HPYH 1EK3A 4JM4H 3TYFA 3ULVD 4Q6YA 4PD4K 3BOVA 2YD3A 2ILLA 3AS0A 4KZEL 1X5ZA 4XPTH 2Y07L 5DUBA 2H2SC 4P48A 5EA0L 2HTLD 4H20L 4HLJA 2BRQA 2BVPB 1CXIA 1RZIA 3K2UL 3EFFB 4HWZB 3HE7C 3MROA 5DHXB 5EU5A 3N1FC 4HJGA 1T89A 1P84J 2VDPL 2MPAH 4WU7B 5TDOB 4E9LA 2H8PB 3VDBA 1N6QL 4Z7NF 3V8OA 3BGFB 4BELD 2B39A 3BSZL 4OT1H 3MRNA 4XNUL 3LS5H 2BSTA 5K9JH 5I1KL 1U8QB 2Z92B 1JTTA 1CGSL 2E9JA 5F1NB 3QNXA 4W70A 1OAZH 2CSPA 3CPLB 3G5YB 1N6VA 3KPNB 4FG6C 4OFPA 2RJMA 4PY7A 2Z9TA 5SWZB 4Q6IA 4KK9D 5DJAB 2X4NA 2W9LA 4FQLL 3O2DH 3I3EA 2V2WA 3TJHD 5AZEH 1S7SB 1OAZL 1AJ7L 5IOPB 4I77H 4KHXH 3OKNA 5ISZE 1L6XA 3SKMB 2EDDA 1LE9B 3F65A 4MNHA 5HVHC 4G6AC 4K7FA 3RWJB 3EYUH 3WL9B 4X9BA 5C0CE 2R1XB 4L1HA 5I66B 4NQDE 4HBCH 4XRCA 1F58H 3HB3D 4J3SA 3LN5A 4X9HA 3X14A 3TO4C 3T4YA 4GKOA 4LRNL 2YKLL 4IRSC 4RNRB 1T20B 1T83C 3WIIH 4DW2L 3JTTB 4L8BA 2HFFA 4LKCA 3VXNA 5E08L 1MPAL 5LXGH 3QQNA 2DS4A 3FKUS 5ANMA 1ZT1B 4OI7A 2R2BA 4UOW0 1BOYA 2VDRL 4DVBB 1I8IA 5FIEA 1CICB 2CXGA 4U1KB 2AABH 1CICD 1WTLA 5EPMB 3JZ7A 3PWLB 3U7WH 5JOFB 3PV6B 2XI9A 4FZ8H 4NSKB 1EO8H 3U36A 4K3HA 1R3LB 2X7LB 1TDQA 4JHWH 4LCUB 4YJZL 3QT2A 4WJ5B 5E2WH 5DD1L 5I71C 4Z7OE 3RZWA 1BAFL 3CCHB 3VMPA 1MHHA 3MOQA 2R2EA 4F57H 2YK1H 4XNMA 1MNUL 3QCTL 4RFOL 1L7IH 4HUUB 3MRPA 4JM2A 1KJVB 2X4SB 3CVHA 4HUKB 1HWGB 4BZ2L 1KT2B 3FQXB 4PV8B 4YQXL 4OZIA 2UZIH 3BRDA 5CAYB 2X4UA 4LP4A 4NGHH 3VA2C 3CXHK 2ESVB 1ZLWH 4R0LA 4O4YL 4BSVA 1BVLA 4HG4J 4R6UA 1U92A 3HCVB 2FX7L 3HNSH 1MEXL 4F2MA 3LSOA 1MAKA 3GSNL 3PWVA 3QUXB 4XTRC 3GMPA 2QLVB 1UWEL 1KTDA 5DFVC 5IEHB 3FO0H 1FJ1A 1H5BB 2YN3A 2BXYA 1G0YR 1V3KA 3V6OE 3STZA 2XTJE 3QUZB 3MRMA 4P46C 5CSZB 3S96B 3WJLC 3HZYB 4XPBL 4M6MH 3WXVH 4WI4A 3Q5OA 1WT5C 5TE4H 3DGGB 4K8RC 1WWWX 3PP4L 3ZKXB 1UEYA 4IOSD 3A0OA 1IGIH 4OGZA 3ET9F 1N3NB 4WFFD 5BZDB 2BDNH 1KYOK 1G6RH 5MEQB 3QUYB 4S1RL 4D2NA 1MIML 2C9AA 5I1HH 3PDGA 4W6WB 4OCWH 5IFHH 4Y5YC 1CE1H 5I76B 3DMMB 2A74B 3OHXA 3IFLH 4IOFC 1NEUA 4O5LL 3TVMC 1KXVC 3W81A 5KN5B 1I8LC 4O2FA 1CLYL 3PP4H 2E6JA 1CFQB 1NGQL 4IRJD 2KH2B 5CILH 4M7KH 2LE9A 4FTVD 2FRGP 1LDSA 3O6LL 1BZ9B 3WD5L 1B0WA 1KEMH 3OAUH 3C5JA 5DRXB 5C0IB 5ACMA 3P9MA 4KI5E 3S4SB 1LP9B 3O3DB 4KXZI 1KPVA 1X5HA 1CBVH 3BPCA 1B0GB 3ULUE 1BJ8A 2H26B 1QFPA 2YPKA 4YHNB 4NQEA 1IM9D 5F9DC 4NBZB 3FB7B 2HLAB 4UNVA 1K6QL 3V4PH 2VLJE 1I1RA 1K8DA 3S6CA 5F7FA 4XCCL 4XWOD 5EBMB 5FYJL 5IFJA 4I48A 3SE3A 1YJDL 1CR9L 5D1QC 1IT9H 2F8XC 2VABA 2NXYD 4GKNA 4UDTB 1LHZA 1MI5E 4NP4L 3CU7A 4R4NC 1W8NA 1FFNA 3CFKB 1FYTD 5C71A 3KYMA 4JY5H 3P4MA 4OLUH 4Y5VB 1GSMA 1FORL 2HYMA 1JJUA 2XA8H 4G9FA 1KCRH 3VFPB 1Q9KB 2Q6WA 3KNBB 3C6LA 3MLWL 2ERJC 5L8JB 5T3XH 4WHTA 1UQSB 1VGEH 4MS8D 5D7JA 1MLCB 2A9ML 3P77A 4LSPH 1LEKA 3CPLA 3VFWB 5IM7B 2AJVH 3S3SA 4DTGH 1EIBA 1H8SA 5HDQL 3BI9X 5C0BE 1MWAB 4M5ZH 1Y0LA 1MUJB 4P2OB 3QWOB 4DTGL 4RNRA 5D2LA 4QRRA 4F7PA 4OD2B 3VJ6A 4KJWD 2AJSH 3WIIL 4X98B 3LRSB 1P7QA 1KXTB 2GK2A 5T3XL 4NC1C 4C83B 4KV5E 5CP7A 4DCQB 5T1KD 3F7YB 5DJ8A 5F7WC 2OS7A 5EZJA 1I1AA 3GSQA 4KVCL 5KANG 4LKXA 1YEDB 4XMPH 1HSAB 1A9EA 1EHNA 1P4IH 2VLKD 1FC2D 1M7IA 2QSVA 2BVPA 3QO0A 1CL7L 3GBNL 1V05A 5EUOA 4KGJA 1WBXB 4KPHL 4MS8C 5C0FB 1INQB 1UJ3A 1DBML 3LKQB 3HPLB 3RWEB 3U83A 4FXKA 5JHLH 1BEYH 5L2KD 2NY0C 4QOKD 3QQ9C 4PJGA 5TGBB 4GUPA 1BWMA 2GTWB 4OV6F 2KQNA 4PYGA 4G6KH 1KJ3L 5MERA 2CDFA 3FN9A 1IBGL 5IBUG 5TQ0H 5CSBA 4JFDA 4K2UH 1NMAL 4OB5L 1NBVH 3FMGH 3L3OA 1IEAA 2WK2A 3FQUA 4QRUA 1HH6A 2PXYC 2SEBB 5MEPB 2CRMA 2AXGA 1JRHI 3P4LA 1YEGH 3IVKB 2F74A 1T1WB 1NGXA 3ULVF 4K07A 2HVKB 4ZFFA 3BIBX 3HE6D 4Y2DC 2X41A 2YPLD 4HEPG 4IMLB 3S35L 1KEGH 5CP3H 1IC7H 4F8TA 5CKGA 2FYYA 3MV9D 4HFUL 4FQQA 1AGBB 1UB6B 2D7QA 4H20H 2VMFA 3N1MC 1MCLA 3SKJH 3RHWF 2HRLA 4AM0B 4HUWB 5HI4D 3SE4A 3MTRA 3E0GA 1JE6A 1VEPA 1CT8B 3VFVB 3EZ8A 3F7PC 1FBIL 4MJID 2N56A 2LVCA 4UBDD 1OM3L 4IDLA 4HWBL 1HI6A 3RWHB 4PRIB 5D1XB 5E6IC 5ICZB 2XN9D 4YHIA 2VDMH 4LFHG 1IGFL 1GGCH 2DQFB 5FYKU 4JDTL 3RVXC 4UT9L 3OAZH 2A2QT 5GS0C 5C0AA 2CJUL 4AY0A 4NO0A 4OB5H 4L8DA 3ZDYE 1KC5L 2HJLB 5D1QA 3GKWH 5C0CD 3VFTB 1BGXL 4HQQL 3MJ9L 3KLAB 1J0IA 4TNWF 4P46D 2DI8A 5J8OA 3VXOB 1ZGLA 4AT6A 4ZFGL 4PREA 2OYPA 1IM3B 3RPIB 1CZ8L 2NY4B 2VL5B 3GBNH 3IJYB 1X5IA 3QPXH 3THML 4A6YA 5C0DB 2YK1L 1EAPA 3KJ4C 5MP6L 3H9HB 3I6LD 4S1SL 5LG1A 4G8FA 5JZ7C 2Y4SA 5LKNA 1A6UH 5ICYB 4ZD3H 2Z8WC 3EDJA 4KTYA 3ROLA 5IEKB 3WLWC 2ZCHH 2P4AB 1UA6H 2B0SH 1UFUA 4QOKA 4W81A 3BJLA 2OXHA 1E4KC 1T4KB 2BFVH 3ARGB 1R3JA 3MNZA 4JLRA 3IKKA 3H42L 4U1LA 1CU4H 4I18A 5HHOD 4ELMA 4CW1B 4KKBD 4CGTA 3BQUD 5JHDA 2R0ZH 1K3IA 1CIDA 1J10A 3EOBA 4WHYG 5TDNA 3VFOA 5HVHB 2CKBH 4FXGA 3V4VL 2IALB 3C08H 3HI1A 5B21A 4WY7H 4XBGA 3DUUB 3OJDA 4DZBA 4IMLA 3UTTE 3KVQA 1MY5A 4K7PL 5C0AB 3ZDZF 2VZ3A 3NIGE 5GSVA 1OSZB 2F58H 3MODL 5B39B 2ZUQB 5KSAA 5L88H 1GJIA 5E1AA 1OP5H 2NY7H 4U0RC 2A83A 3MYJB 4A6YH 1FSKB 3GSUB 3SDDA 1CLOL 4LCIL 1INDH 3FT3A 4GW1A 4QRQA 2UUDK 3MGOA 4M1GH 2YMXH 3K81A 3L5XH 3DSFH 5D71L 3QIBB 4EKXA 5K9OA 2Q3ZA 3C5ZA 3BYTA 1B2WL 3IS1X 2G5BA 3UZEA 5M7QA 4ZD3L 3PWPA 5EOCJ 1A6UL 3LRGA 4ZS6C 5HHVH 4U3XA 2CLRA 5KSBE 3SDCB 3CDGB 4KMLB 3BXNA 4NQCD 1YNTB 1T5WB 3HMWL 2FJGB 5IBTL 1J8KA 2C26A 4O9HH 4P5MB 5HI3D 1VPOH 4X6FB 3FTGB 2OSLA 5SV4A 3MRGA 3UMTA 4UIKL 4U6XA 4HJ0D 1AXSA 3WHXB 2P5EA 1G0XA 5T33L 4X80L 1XH3A 1UWXK 1RU9L 2WWMD 1U8IB 3MNWB 3VWKD 2HT4D 4BH7B 1YPZE 3QDGE 4U31A 1MWAA 3EO0A 1N2RA 4MQTB 5ADPL 3QXWA 1MVUA 1TXKA 4JANA 4TQEH 5IHUH 5HGHB 2P5EB 5D7JB 3WXWH 5DRWB 3LKQA 2YRPA 4HFWA 5F6IB 1T83A 2D9CA 2F5AH 3UZVB 4UT7H 2W9EL 3RNQB 2VE6A 5F7NC 3TFKC 3VFUB 2RCSH 3U0WL 4L8SB 5GSRB 2H1PL 1LEIA 1UWGH 2EH7H 4Y4FC 3ZDYF 4APQB 1U8LB 3B8SA 1OAUL 5JIKA 2AERT 5JHDD 4Y16A 3BFOA 2Z31B 1IILE 4M02A 1YMHB 3ARDA 5E6IB 1P7QB 5EZIL 4LVHC 2I07B 2VDLL 4HLZG 3CDYA 3NCEB 4NCDA 1MCWW 4F7PB 2BY2A 2KDGA 4HS6B 2EDRA 2DYPD 2PO6D 1LGVA 4OLZH 4I3SL 4MXQD 2AXFB 3OR7A 3TT3L 1UM5H 1QNZH 3GSOB 1Z3GH 4N8VB 4YE4H 4OIBA 1OSZA 4WV1C 1CGVA 4G80A 5LAXA 4N8VG 3VXRD 3MO1A 4OZFA 1GOFA 4MDJB 3O3EB 1V3JA 4NCC2 2L7UA 2Q7NA 3BD3A 4X6BB 3D3VD 4FP8L 4QRSB 4C58B 1EGJA 3KPRD 4ZXBD 3FN0H 4P5TD 3DIFB 1IGFH 3RTQD 1BEYL 1GRWA 4L9DA 1CFQA 3C2SA 2IBBA 1RPQA 1TJIL 3ESUF 1WC7A 3QG6A 1RZ7H 1YEKL 1MWAL 5KN5A 4U6YB 1NCWL 1ORSB 3KPMB 4NQCA 2XFXB 4ZAKD 4MHHI 5ALBH 5E9DD 4I1NB 1ZHLA 4TRPH 4MXQC 5IMLB 2NXZB 1Q38A 4U3HA 1T6VN 3U7AA 2A1WL 3ZE2E 1EEZB 4RMSA 3VWJB 3SEPA 4QTIH 3UJIL 5CGYD 3PWNB 3BP6A 3KYOB 4CUCA 1DQMH 1XGPA 4Z5RA 5CMAB 1B0GA 4OCSL 2E6PA 4LOUD 3STZB 2BVOB 1EO7A 1W72H 3KPSE 1DL7H 1NFDB 4MD0A 1XR8B 2BX5A 3RTQB 3TCLB 3IFPB 3BZ4A 5AZEL 3JWDH 3VGFA 4NKOB 1UM6H 3HE7B 2G75A 4JRYD 5E5RB 4YFDB 5HVWA 4YHZH 4UTBL 3RIAK 2ATPB 4HKXB 1F3DJ 2BNQA 4PJXB 2DLEA 4NO0B 3KJ6L 1L4IA 5I76A 1XGRB 4Z7VB 5JDSA 5J1AA 5EDXA 5HY9A 4Y7MA 1ADQH 1NLBL 3RGVD 1JGEA 5JHLL 1FZKA 2XWJA 1G9EA 3KDMA 5L2KA 3ARYA 5EU4A 1LO2H 3CCHA 4ODVH 1CG9A 3S36X 5EO1A 3JWOL 1ORQA 2EC9U 3G6DL 1LWRA 5SWQA 1HH9A 2DLTA 1MIEH 2JJTA 1A3RH 4R4BB 4DVRH 3G5XA 4Y19B 3HLAB 4JFZL 5GRVK 1EZVX 1N59B 3QUZA 2F9BT 3V5KA 2AGJH 2BJMH 3KXFD 3ROOA 2IPTH 2YUZA 4G5ZL 4PJBF 4YPGA 3MA9H 3MRQB 4OF3A 1YZZA 4ODSH 5DUPH 4ELME 3O3EA 3DRQB 4WDIB 2HKHH 3MV9A 4FQHB 4P2QD 3RZCC 2HG5B 3GJEA 3BUTA 4F8QA 1VFBB 5HHQA 5ITFB 2VKXA 2X4SA 2CMRL 3RWFB 4HKZB 3X14B 1NANH 2HKHL 2OJEB 5B3NA 1HDMB 1I9IH 4QHLA 2FL5B 2W38A 2DQTL 3RKPA 4Z7UE 2JJWA 4OGYL 2IMNA 4HSQA 4JFDB 2NY6C 3VRIB 1Z9OA 2D7MA 3FHQA 4DGYL 4JGJA 4GUPB 1ZS8A 4JEGB 3I6LE 3CJJA 1CDHA 1TFHA 3TF7C 5JOFA 5F7EL 4X0KA 5ESQB 5I1GL 1CICA 4U1KA 1TJIH 3FOMA 4P2YA 2OP4L 3OG4B 1S5IH 5EUOB 5C6PB 5DC0A 4NDMB 2WBJD 5E5MB 3B9DA 2B1AL 1CDIA 3S3PA 1JPST 1WJ3A 2X70B 1ZTXL 1A7PL 4LSVL 3HAEA 1AH1A 1GGIL 3FT4B 2Z31C 1QKZL 1UZ8B 1NKOA 3OKEA 5KTEL 2DIAA 2YD9A 3VFMA 3WUZA 4YXHH 2FX7H 3R06A 3L3JB 4ONFL 2XY2A 3IU4L 4I3RL 1YECH 3O6ML 4OCYL 4HT1H 5HHQB 2R1WA 3I85A 2D7NA 1AR1C 1ZSDB 3WFEH 2UZIL 3DX9A 4LPVA 3FTGA 5I0DA 1J8HD 1KTLB 4JPIB 5DURB 1JF5A 4Z7WA 3CDGA 1PFCA 2D7PA 2DLGA 3V6FA 3SO3B 2B2XL 3JVGC 4MJ6B 3TV3L 4XCNA 4ODWB 4UDUB 2VWEC 3AROA 3U30B 3MJ9A 3N85L 3W39B 3GMQA 4Y4FB 3O4LD 4BFIB 1FNLA 5MENA 3MBEA 4GW1B 2OLDA 3DHMA 5C0BB 4WO4C 5E2UH 4RGND 1Q8MA 2ARJQ 2R1YA 1FQ9C 2AABL 5F1SA 5EU7E 2NYYC 2XWJB 1VFAB 1JGEB 1DUYA 4ISVA 2QKIA 1HQRA 3ARXA 1QR4A 5C2BH 1R3HB 3FO0L 1JCKA 4HD9A 5CS7A 5DC9B 1M05B 5KSAD 4DK6A 1NEZB 3MV8D 1RU9H 4QXTB 3I3DA 4MLSA 3ZSTA 2L7JA 1OTSD 4WI9A 4HIEB 3GMRA 3DVGB 2C4FT 3HG1D 4R90L 3TH2T 1A1OA 2ADFH 4BZ2H 2E7MA 1IQWL 1MI5D 1KLUB 1FG2A 1Y6MR 3VXUE 4NWUH 3S36L 4WI8A 1KN2H 2ADGA 4JKWA 1BIIA 1CE6B 4YXHL 4X7TA 1CD8A 1P53A 4JPWL 1FYTE 5E2WL 5FB8B 3TIEA 4WGWB 1B2WH 5KOMC 3D25A 1NC2A 3UCRA 2G9HB 3D69B 5E99L 4GO6B 4R26H 4TTDC 4ZO7A 4PJXA 3KPSB 2ED9A 2VXVL 1YUHB 1JRHL 5JHDE 3STBA 1WC7B 1ZGLB 5DMGD 3HC0A 5CJOL 2W0FA 5C0BD 4D9RD 2NY1D 2ZCKH 4L29B 3W2DH 1E0OB 5E7BA 3ARBC 3RTQA 1H5BA 1FVEA 2WP3T 3C8DA 1FL5A 3EO1A 4U6TA 3QQ3B 2J88L 2D0FA 4LLYA 2Y5TB 5F89A 3OKLA 4N1EA 43C9A 1KPRB 1U3YA 2VH5L 3EDDA 3V7AE 3UTZB 1N7ML 3NH7L 4LNRB 4GMTH 3Q3GA 1PDKA 5HGBB 4BSVB 5IROA 3KYOA 2R4SH 4ZAKA 1EXUA 4FQ2L 4HUMB 2DWEB 4YHYC 4J3OC 1P6AB 2EE6A 3PHQB 2ZJSH 3CD4A 4P2RD 1NL0L 2BSED 1N5YL 4JR9H 4L9LA 2PNDA 4JZOA 5KSVB 2DMBA 2IGFH 3RPKA 5DJ6A 3S3JA 2FBJL 1JHKH 3NPSB 4TUJA 5GGUA 5IMMA 3MRBA 3U2SB 4BQBA 2IPUG 1TNMA 4KRPC 5CEZE 2IAMD 4XAWL 1C8PA 1BFOA 3SJVA 3BKCL 1OQXA 4MB4A 4YX2L 2ICWI 4XT1C 1CGSH 4OZFH 1L0XA 1X6NA 5F7MC 1A3RL 3RNQA 2VLLA 2OL3B 2DI9A 5TFSH 4WEBH 5HYJB 5L0QC 1NCTA 4NRXB 4YXLH 2Z93A 2QBWA 1QFOA 5D7LA 3NCJL 5DFTA 4R90H 5HVFB 1AGDA 5A40E 3TBVB 2VZVA 5TF1L 3O11A 3KPRA 3MV9E 3FQUB 2PTTA 1HXYB 1XF5B 2CDGA 1DBAH 3X17A 1YPZA 3QDGA 5HDBF 2X5PA 1FG9C 3DNKA 1KC5H 4LLAA 3RIFF 5D1QD 2VISB 2IAND 2EE9A 2E8ZA 4ODTL 5JLZB 5FKPB 2CUMA 1BJ1J 1L0YA 4XPHH 3F5WB 2AEQL 3TBYA 2XWBA 2UZXB 4NKIL 4XHQA 5I19H 4Z7UA 3FN3A 4JFOA 1DL7L 4RX4D 1FNSH 4RA3A 5I1AB 2Y7QB 4NQSA 5I1EL 4S11A 3C5SB 1VB9A 1QQDB 4JM4L 4O51A 2DQEH 1T2QL 1G7HA 3K8KA 3KPQB 4QYOB 3G5ZA 1OD7A 1C5BL 4EUPA 3BZEB 5IT2L 4W6YB 3S97C 1S8DB 2JB5H 1G9MC 4PG2C 1H0DA 2DYPB 3F5WA 3TBYB 4NRYB 4ODBD 1AY1H 1WICA 3UPRB 4EI5A 1PX3A 2HJFA 1QFHA 3NCMA 1C12B 1MHCB 2P44B 2EICA 4JQVA 4X98A 3BRFA 5GGQH 1G7JB 4IRSA 1U3HA 4HZLA 5BCAA 5IHBA 3MRKA 1P9MA 3STLB 3QAZB 4YXKH 3RY6C 5DYOB 2NX5B 5I30L 2VXQH 3NIFF 3OX8A 4XH2A 4GRMA 5JQ6H 3NCJH 1A2YA 1ULVA 4CVXB 3BKMH 5JNYA 3UPRA 4OLXH 4KI1A 4PJCB 1LD9A 1S7XB 5J57B 2VAJA 3RIAF 1U8PA 3SE9L 1U95B 3C6LB 2DBLH 3HTLX 5ESAA 5KTEH 2ZUVA 2I9TA 3DX7B 1M7DB 3ARED 1A6WL 3VH8A 2IALA 1SYVB 3HI1B 3OAYH 3FQWA 3LN4A 3UPAA 3UJTH 4EEEA 3VWJD 1EGJL 5EORL 4LIQH 2XY1A 3LKRA 4WUKH 1CWVA 1SYSA 2HMIC 2XXCB 1YEFH 1HHJB 2EDOA 2XZQL 1GZPB 2HP4A 4XTRD 3KR3H 3CU1A 5I17B 5E7FA 5K9KA 4YDKH 3GI9L 3LKNB 1MCRA 2V7HB 3FT3B 1MFBH 5MENE 3V5HB 2O5XH 3PWPD 5FEBA 4YHNA 3BISA 4ZXBB 1RJLB 5IT2H 4Y5VC 2PXYB 5B39A 1J8HA 3CH8A 3KLHC 2MCPL 5C0RH 1FNAA 1NC4A 3PL6B 5FKAB 3D2UB 1MJ7H 4J3XA 4PR5A 4KK9C 2W0PA 3EO1B 3S4SG 4NN7B 5CLTA 5BS0D 1Z2KA 1FNEB 5HHOA 1QRKA 2YR3A 1Z5LA 3L3GB 1BFOB 3SJVB 5JTWA 3BP4B 1EJOH 4TNVF 4GRLB 3BKYH 1H3VA 2GFBB 2XKUA 1U8JB 2AV7B 1BOGA 5CD5D 4LVOC 1DE4B 3O6KL 1CF8L 1S9XB 4N0FB 2DQJH 1TETH 3M8OH 3N1PC 3VXUA 5LVEA 1XGQA 5J13B 2GHWB 5ICYA 1QFUL 1XEDA 2JCCB 1MCBA 1SMAA 1JP5A 1CE6A 2PO6B 4QHUA 1QFUH 3IJSB 5E8EA 3GI8L 3DUSA 1BBDH 4NYLB 3Q3GB 2P24B 5HI5C 2Q76A 1CT8A 3QJHA 3VFVA 2ZG1A 4YGAB 3HMWH 3B9AA 4IDJL 4PGJA 2QSTA 3ZL4H 4L1DA 1RIVH 1OWWA 4ZOBA 4RGNE 1RQ5A 5DK3A 5HYQA 2MTPA 4JY4B 4XCEB 1DVFC 1FRGH 2HFEA 2PUQT 2V7NA 4J1UA 3L9RA 4K3GA 4TOYL 3VWKB 4ZUSB 1DFBL 2W0FB 2YRLA 4WWKC 5FDWA 4R7NA 5KG9A 1X5LA 2YZ8A 3LPWA 4PRIE 4K9EH 5IVXF 3ME0A 3X13B 1ZA3A 4I4WB 1P4LA 3VI4F 4U3CA 5HDQH 4JB9L 5DQJB 5E8NA 3T3PE 4F7TA 1ITCA 5F1KC 3TWCH 3IVKA 5INCA 3RUGF 4GKZA 2WMPA 2R2EB 1EBPA 5F88A 4IMKC 3T1FB 5DDHB 2ZSWB 1N4XH 1QBAA 2XYCA 1I4FB 3LQMA 2JJTC 3MBED 1KB5B 3IS0X 3MGTA 3KG5A 1T1ZB 4AG4H 2BOBA 1ONQB 2UWEE 4Y5XB 4PJCE 2LABA 3W39A 1X4ZA 1EZVY 1HYSC 1YDPA 1RJCA 2BDNL 3W2DL 2FB4L 3GRWA 4OIIH 4OZGE 4M7LT 3OG6B 3HKFA 4J8RB 4W4OC 1NFIB 2YSSB 1KLFA 2NXZC 1YEKH 3IJHA 3PXJA 4LDEB 3BP5A 4ZOAA 1L0QA 3LKRB 2VXVH 3FHAA 5C0FA 4JFYA 5TQ2H 1EFXD 5C7XL 5HDLA 4P2RB 2J1KA 3NN8A 3FQNA 2YA1A 3VH8B 4JPIA 3LB6C 3FN0L 4H26A 3MRCB 2ORBH 1BQHB 4PJHB 3VG0H 4EVNB 3P40A 3HZKB 5J12B 3B5HA 4PJCF 4R4FH 3MLXH 3QIBD 4NKDB 3WLBB 4OM1L 5D7IA 2IAMB 5TE6L 3IRZA 4OTXL 3DVFA 2ZPKL 3KPRE 3SO5A 3MXWL 3FT4A 1UZ6E 2OK0H 2E7BA 4Y4FD 5IR1A 3IT8D 5HHXL 5MENB 4NN6C 5C08E 1MHCA 3EOTH 4Z8FL 2EO9A 1T66C 5GGQL 4MJ4A 4PJGB 2E7LC 1NGQH 3MV7B 4PG9A 1FFPB 5EFIB 3EHBC 3QRGH 3MJ9H 3WO3B 5C9JB 5I18H 5F9WC 5J6GA 4GS7C 4OLWL 1I3GH 4J3UA 1MSPA 3VFPA 5DTFB 3G5ZB 1WBZA 5LBSL 1FAIL 4LGSB 4Z7WB 1F90L 3B5GA 3LHPL 3WFCL 1J11A 4Z76A 3WNLA 5L6YL 2DQTH 1YY9D 4KC3B 4IRJA 1JFQL 2ADJB 4GRWE 2NY5H 2FL5A 1OQOA 2PN5A 2XPGA 3V0VA 4P23A 5HHNA 2QQLL 2D3VA 4LMQE 2VDRH 3KPSD 5IFJB 5EB9A 5FFLA 5ILTH 3ELAT 4N0RA 4WU7A 4TNWK 4HJ0C 4KHTL 3VRLE 3MBEC 1BD2A 4PJHA 4LSDA 3WE6A 5EBLA 2IPKA 5D1ZB 3DETC 3GSNH 3MROB 2FGZA 3MCKA 3FO9A 1DBAL 4JRYE 1ZA6A 4DZ8A 2CGRH 8CGTA 4HK3J 5CWSB 4RDQG 1JGUL 1OARH 3BZDA 5KZCB 2AJYH 2IPTL 3KNBA 4P2OC 2Q3AA 4MD4A 3UYRL 5A2JH 3FOLA 3NMEA 5FM5M 3LPGA 2X9XA 1QFWI 1MF2H 4GFTB 1BZ9A 4CVUA 2AJXL 4Y5VA 3SBWC 3QXTA 1VPOL 3CFJB 4N9GB 4TUOB 5MHSE 3HG1B 3CDCA 3OPZL 1T89C 4KGLA 1FYTA 1S9KC 3QIWC 1WV7T 3WO4C 3VRJB 1QBLL 2EDEA 3W11C 1A7PH 4LSVH 4LP5A 1DSFL 3TYGH 1PBYA 2FBJH 4KDWA 2VDOH 4O02L 2VAAA 5ID1B 5DK0B 5D8JL 3SCMC 4AEIL 1K5NB 1BFSA 1S7QA 5K9JL 1KPUB 1AXTH 5BRZB 1EXUB 2W9DL 3C5ZC 1UKSA 4JN1L 5EUKB 5EBWB 2H26A 3QPQC 4F9PC 5AG8A 3CAFA 2DWDB 1PKQB 2F58L 2MQCA 1DVFB 5LXGL 2VDNH 3NH7H 3OKYA 4DGYH 5AUMA 4YC2B 1DQLL 5I0ZA 4KVCH 4KUZH 3NPZB 4JFXA 2NXYB 1CFNB 4RMUA 3LH2L 4BKLA 5CP3A 2R4RL 2IQ9H 3JXAA 4L5FL 2WIIB 5EBWA 2R8SL 1F58L 4LFHD 3NCFB 4PJFE 3CLEH 3TIDB 2JCCE 2X4UB 2NR6C 1H8OA 1A7NL 4X83A 1JPFA 1PSKL 2FX8L 1RJYB 4GW5B 1IAIH 2P8PA 4KTEL 3DVIA 4XHJD 3CC5A 1V8HA 5CEXB 3HC3H 1LEGA 3K4AA 4PGCB 3E8UL 1DDHA 2VERN 5HYSA 1ZKAA 3SJVE 1EGJH 1TZHB 3H3PL 5B38B 1ZWIB 4BKLB 2J8OA 3AAZB 3S36H 1BX2A 1D6VL 3UROR 4CAGA 1Y18B 5AAMA 1QOKA 3BPOC 1ZLWK 5MEOB 3KPTA 1KOAA 3GHBL 1BBDL 3MA7A 4LLMB 3NTCL 1KNOA 3CZFB 5ENWB 4KJYB 5LAXB 4ODVL 1YJDC 2ITDA 4PJBA 1X5GA 1YJDH 3UDWC 2R2BB 4U2YA 4TSAL 1A47A 4NZTH 5DHYB 1V5JA 5FYLE 1JGLL 1B0RB 3L5JA 1BREA 1S7VB 5C6TH 4UBDC 3G6AB 2VAAB 5ID1A 3OJ2C 4XCYA 5IJVB 2XTJB 1WF5A 4FQPA 4NNYB 4JDTH 5E6IA 1AQKL 4MAYB 2XPGB 3V0VB 1RIHL 3NABL 4M43L 1RUQH 3U4EA 4U6YA 2WNGA 3UO1H 1KELH 2WWKT 4Y16B 3P9LB 3WL9A 1J05A 4NQXA 4PJAA 4G6FD 1I1AC 2EIDA 3WUWG 4QWWD 4YEFA 2J4WL 3WUWB 5DA0B 3LVEA 1ZHKA 4P4KD 2UWEA 4Q0XL 3ZZ1A 5E8OB 2HAZA 4X5XA 1OAYL 4V1DD 4QXGL 4LEXH 1KCSH 4JKPL 4FQJL 1IEBB 4GAYA 4M43H 4N1HB 4V2BA 1U8PB 3GHEL 2D03H 2LV4A 3RDTD 1KIPB 5EFIA 4DVBA 2MHAA 3L7FB 2EIEA 4O2EA 2XG4A 4I5BA 1JI1A 4XPFL 5ALBL 2XQBL 4ETQA 3BGMA 3REWA 5I8CB 3FONA 1FNFA 1U8IA 2R56H 3M1BB 4FFYL 4F3FB 3T4YB 1SJHB 5ISZB 1R3KB 2Y5EA 2CLVB 4JJ5B 2RR3A 4RMWA 5FYKD 2R1XA 4UIKH 1FGVL 3LOWA 5DHVH 3HZMA 2ICWB 2R23B 1Q72H 3WIHH 3GBML 5EWIL 2P8LA 1DN2A 3U46A 25C8L 1UWEH 1KF9B 3HAEG 5E5MA 5CJ5A 1XIWA 1KJ3H 1S7SA 4AIOA 4YIQB 2CLRB 2LVEA 2EDKA 4ODHL 1S78D 3IJHB 5DWUH 5GRUL 2PTUA 4HKJA 2XWBB 3CK0L 2G5BB 4Z77A 1YDPB 3UTSD 3VFRA 2AQ3A 4GG6E 4X6CB 1PSKH 2BOBB 1X5JA 1ZLUH 1WZKA 2X4OA 5C08B 4BH7A 2DQIH 5DZNA 4F57L 3MLTA 5JOPE 3MYJA 1T7XA 15C8H 3CVHL 4QNPF 5IESH 2IAMA 3KPRB 1DJSA 2DIJA 4JO2L 2Q8AH 2VXUH 5KSBB 3MLRL 4LRIC 3KS0J 4LLDA 4D0BA 1HHGB 1VFBA 2AJSL 4IIQC 2UUDH 4H1LA 3O8XB 5EN2A 1MHPH 3BEVB 4FQHA 2EYTB 1FVCA 4O2CA 4R7NB 3O41B 2B5IB 1LVEA 5CJOH 3GFUA 1KELL 4M03A 1NKRA 1EUUA 3BDYH 4TQEL 5IWLC 1JWSB 4KQ3L 3SCMD 3MRDA 2FEDC 1CFVH 1UB5A 4I18B 1B88A 2HWZL 3B9KB 3W11D 2XICA 5IW1B 2P24A 2ZCHL 3O6FD 2VN7A 5CEZD 3GSWA 3MCG1 4GAJH 1F42A 5DA4A 4EUPG 3QEGL 1I4FA 3NCYS 1CVRA 1RZGA 2CRYA 3MFFA 1A21A 4R9HA 1IQDB 4LRIA 4TTDD 4MNGB 3FRPA 1KENH 4R7DA 1MCWM 5GSVB 9CGTA 2GI7A 2RGSA 1RZJL 1AKJB 4WW2A 5AG9A 4R97C 4DZBB 3C6SA 4EN3D 2DICA 1JPSH 2ADIB 4FABH 1I85A 4AT6B 2X42A 3I6KA 4OUOA 3BVNB 1X6LA 5LQBH 1P2CB 1YPZF 4LDLB 5ITBL 2WIIA 4H5SA 1ZLSL 4L29A 1PLGH 3BZ4B 1CFNA 3BPOB 1M71A 3E6HA 3IETA 2E7HA 5HHOB 2EDJA 4JHAL 5T1MA 4LL9A 3ARWA 2FWOB 3EDFA 3D87B 1MCIA 4FNLH 1L6ZA 1BVKB 2J7LA 4KAQL 4M62H 1NBYA 4KY1L 5JMRA 1G9MH 3MFFB 2PR4L 4GQ9H 4XX1E 5EH1A 2MJWA 3VXUB 1OAKL 2EE3A 3GSWB 1HINL 3UDWA 3ULSA 5MHSD 1B9ZA 3QDAA 1XF3A 4MSWA 4Y4KA 4OZGA 1AQDA 1T22B 3EHBD 4AMKL 1X4XA 3VXOA 4HIIA 4HUXA 1AXTL 1A02N 3F7QA 4HGMA 2R0WL 2X4TB 4LSUH 3T2QA 3CX2A 3DIFA 3Q48A 1IC7L 1BZ7A 3BGAA 4O2CB 1VFMA 3FQWB 3LN4B 3DMMC 5DUMH 3GBLA 4HPYL 4MAYD 4G43A 2G2RB 4R8WH 4JG1H 5CUSH 3ZE0F 5I75B 3L95A 32C2B 4HS3A 1BMGA 1I1CA 1NCNA 3IAQA 1A0QL 3RL2B 1P6FA 5D7IE 1MEXH 4DZ8B 4WENB 5E94A 1MHEB 3VU2A 1CXLA 2GSGB 3OPZH 1HHHA 1JHLH 4HK0A 4ZXBA 2VLRD 2ZUQC 5ESVB 3CXDL 1TVDA 4PJ9A 4PJEE 5DSCA 2CO6B 4G6FB 5SWSE 1WIUA 2NX5A 5TQ0L 1I7UB 2ZUSA 3V0AC 2FD6H 5C08A 4IRSB 4X6CA 1PW3A 4JHBA 4OLVL 5MERB 3TO4B 1NBZB 3GIZH 4UQ2A 3ARDB 4XMLH 1WISA 5DS8B 2EDWA 1I9JL 3NZHH 1PQZB 3TBWB 1LILA 5F7EH 5F9JB 3Q6FA 4JVWA 1CICC 3GZKA 4LPTA 3G6JB 3ZDXF 5M95B 1QFWH 2GJZA 3BH9B 43CAA 5T3XE 2ICCA 1JZ6A 1KTLA 2VQTA 3Q6GH 4OGYH 3UBXB 4ZYKA 4EXPX 5J6GB 3K2MC 3ZYJA 3CFCH 5D1ZD 3TBWA 2NTFB 4NPYB 4X8XA 1YQ2A 5D72H 1U0QA 4AH2A 1XT5A 1IL1A 1BD2E 2GTZA 5GS3A 1KBGH 3T0BA 4UINH 2NY6D 2AK4D 2YD7A 3K0WA 1Y6NR 3QWOA 2V2TA 1HIML 2B20A 1JV5B 3CSYA 1NCBH 3LKPA 3QCUL 4K7PX 4JRYA 4XGZA 2A9MH 1I3GL 4IIQB 3FFDB 4PB9H 4LIQE 4NJ9L 1J18A 2NTFA 1KIPA 5LQBL 4KROC 1ADQA 1MREL 4JO3L 5C0AD 1IGML 5GS2D 3WN5C 2DTML 4QYOA 4JFZH 1FP5A 3OKMA 1KENL 4I0PB 1YECL 2FO4B 3O4OB 4Z9KB 4YO0A 5INDA 1OAQL 2CIKB 4B5EA 3WUWA 4J8RA 1R0AH 1P7HL 2EIZA 2ZG2A 3U4EB 3NAAL 2V5SA 1GGIH 3VXSA 1TTGA 2OJEA 2O5ZH 4UOJA 1GGBL 2A0LD 3IAPA 5DVKA 1KB5A 3MGTB 3EZJB 4KDTC 4ORZC 4L4TD 2XN9B 2XKSA 2ZOKB 4IHOA 2CDEB 2HTLC 4H8WC 4QLRA 4OT1L 4XNUH 3BPCB 8FABB 3LDBC 4YFEA 2Y1VA 3CFBB 3X3GH 4UU9A 1MQKL 1LP9F 1F4XL 4POZC 1P4LB 5I16A 1F00I 2FLBT 5GIRA 4M7JH 5F9OL 3MRFB 5I15L 4OLYL 4RGOH 4LPCA 5FDWB 2NZ9D 3AFLA 1OPGH 4WI2A 3EOBB 2VLJB 4M1CD 3DV6A 5B39G 4JGUA 2A1WH 4K8RL 1OGTA 3M17B 5GZOC 1V7MH 4V1DA 2YN5A 5FUCC 3GKZA 1CU4L 5JDJA 1F97A 3WDJA 1WZ1L 1U8NB 1J87A 4DGIL 1FN4B 5DI8B 5CGYC 3S5LG 4MA7H 4LPXA 4LCCA 2OTWA 1FRGL 4F9PA 1IVLA 4PJGF 1R5WB 4YUEH 2EIBA 5F97E 1KB5H 2YPKB 3GSRA 1Z6JT 5DD5L 4LNRA 3AREC 5CSZA 3S96A 1DBJH 5DQDL 5KVGL 3D39E 2VL5A 5IQ9B 5GJTL 1HILA 4DGIH 1UCBL 1WZ1H 3C5ZD 3LV3B 4WNQA 3HPJB 3UTTB 1FL5B 2EH8L 4XVTL 3QUXA 3NA4A 3BP4A 4CNIB 1DVFA 4P4KA 3G6DH 4RMTA 3O3UN 4XP6H 2D4DA 1IFHH 2J8UF 5H37G 5TDPA 3GIZL 4YBQD 2EZ0D 1ADQL 4YDLB 1PKOA 1XIWD 4LSTH 1Q9WA 3ULUH 1TJGH 2YWYA 3IFNH 3GM0A 1K5NA 1NPUA 2EKSB 3ZT6A 1HHGA 2YS4A 4JN2B 4DOHE 3D69A 3E2HB 4M9PA 4S1DD 3IDYC 3LEXA 2AQ1A 3SE8L 4JZNA 2CR3A 5DD1H 5C07D 3I2CH 1J12A 1CBVL 3V5HA 1CD0A 3QG6B 2JB6A 4WW1A 4QXGH 3VXSD 3HZYA 1F4HA 5EZOL 5IVXE 3VE0A 5HXMA 1A8JH 4FHBD 3BPNC 3WNMA 3D18B 3DARA 4DEPC 5IB2A 2FJFB 4DUWA 2APVA 3EYSL 1AO7D 1T1XB 3FOLB 2DAVA 4PJ8B 4WU5B 1EH9A 5T3ZL 1CTOA 4N68A 5IP4A 2NY3C 4ODTH 2Y9RT 3ARGC 4FRWA 3REVB 1ZT1A 4NRZB 2VLRB 3OR7B 4R0LC 3KPPA 1C7SA 1F3RB 1QACA 1ZSDA 1KIRA 2VLME 2Z4QB 4UV4H 2R23A 1KEGL 4P2QB 3MRPB 3BKJH 1QRNA 3CDFA 4P3CH 4RAHA 4QGTA 1IC4L 1VFAA 1WFUA 1YMHA 4K71B 1H8NA 3NIDF 1MHHB 4WEBL 3OX8B 3MRJB 3NA9H 5M94B 4WRLA 4XVUD 1CDCA 4KJPD 4PP1D 2Q86B 2X4OB 5IBTH 1G7JA 3ZKQD 1D5XA 2VO5A 2GTWA 3OB0K 3OKNB 5CKAA 3FAXA 2MSPA 1JGDB 1PLGL 1G9NH 1MCDA 2V2WB 4H88H 4KMQA 2VE6B 3VFUA 5GRJH 4X9IA 4MJ2A 5FYKL 5JIIA 3EJZC 1LK2A 4LF3B 3TT1H 3QHTC 4M1GL 4GG6A 1AHWA 3RGVB 3TP4A 5HDOA 1I9EA 2AXJA 3T0XA 1RZFL 4RFOH 1HKFA 5DJ8B 2BSTB 3HZMB 1SJEB 4NHCL 1OP3H 3MRNB 2KQMA 3O6FA 1HHIB 4MD5B 4CDGC 3LRSA 2JJUA 2VDPH 3HAEH 4Y4HB 1IC5H 5E1HB 3OAZK 1KJMB 4BQ8A 4ENED 3K8MA 1FZMB 1N8ZA 3QHFH 2P7TA 3WSQH 5IQ7H 2NXZD 4G6JH 3IDIA 1ZT4B 4N0YL 1C16B 5IM7A 3EFFA 5H8DA 4Z78B 5BS0B 1RD6A 2P43B 4P2RA 3BWAA 3IYLW 4KROB 5DMGC 5AZ2H 5IMKA 4QEGA 1HYSD 3FOMB 3S35X 1E4WL 4CMMB 3WJLA 4HG4K 5FECA 4YC2C 1QLEH 4U2ZA 2AV1A 3W5NA 4PY8J 4G6JL 3ROOB 4DGVL 3V5KB 4YHOH 5F1OB 4QHNB 2XZZA 4LRNH 5B22A 3E3QE 4U33A 3L1OL 4OCMC 3QDME 4PUBL 3INUL 1A7RH 4M7ZB 3Q1SL 1D5MA 4NHCH 3DWTA 3VDAA 5DDHA 3RWIA 3T0EA 1PX4A 4MAYA 1U3HC 1YMMD 2BOCA 3D1MC 4YBLB 1IT9L 4C55A 3T4AA 3D2UD 5T3XD 1GHFL 4KMTL 5ADOL 4TSBL 4Y8DC 4ZSOB 1I1AD 2P8PB 2A77L 4LASL 3QEQA 3WLWD 3T2OA 5E5UB 4OD1H 4CRPA 1FZJA 2VR5A 4GMSL 3WCYA 4PV9B 3DX8A 3TIDA 4FQLH 1BGXH 4HQQH 1EEYA 2A6DA 3FB5B 3PP3K 4WW2F 3NFNA 5LGJB 4KAQH 4LLYB 4NO5B 1T1XA 3MA7B 5F7YC 5B4MD 4U1IB 1I85C 1LO3H 1T04B 3PDDA 1CLOH 4LCIH 1GGCL 1N59A 2D4FA 2JIXD 4OQTA 2F54B 4Z7OF 5C8JB 4WV1B 4U1GC 3EJYD 2YC1B 3CSBA 4J4PA 3BSZH 1HH9B 1ODAA 4XPAL 5BRZA 4P3CL 1U3JA 3FQTA 2XV6B 5GS0H 4UAOC 1Q1JH 3VXPB 4V1DE 1FZKB 1C7TA 5DK0A 4F37F 5GS0D 3WFCH 3TH3T 1A1NA 3LEXB 4N0FA 5EU6A 4KK8D 4BA8A 3L5WA 2P1YA 4JFFB 2X40A 4LCWA 4OIAA 5FB8A 3RJDA 5BQ7A 1PKQE 1WBYB 5FGCB 3MRRB 1Q0YL 3S37H 3DV6B 5C6WH 3E6FA 1VA9A 4PJFA 4M8VA 5BRZE 4N0UA 3SY0A 3B3IA 2NR6D 1FNEA 4R26L 1UENA 4Z95H 1KTDB 1RZKL 4JREB 1MOEA 3SGKC 5FYLH 1WZMA 3QHZL 3QQ4B 5EO0B 4YHOL 1M1SA 1BECA 5HD8C 2WINB 3V95A 4DGVH 4M6OH 5DK2A 5IGXL 4YDVB 5EUKA 4X6EA 3BDYL 5CJBA 3DX8B 5CJXC 3MUHL 3VWJA 3PGDB 2OTWB 3RRQA 3R8BB 2O26U 4MDIA 5IMLA 4XC3L 3WE6B 5L7XH 2LU4A 5I8OH 4HF5H 4G3YL 1CZ8H 3HC4H 5ACZA 3BMVA 3PHSA 3AM8A 4RRPA 5JR1L 2X10A 4V1DB 2RHEA 2X4QB 1AI1L 1BJMA 5LCVL 5J89A 1EMTH 1U42A 1MCHA 2BSRB 4ZDHB 4M5YH 1GCFA 3PF2A 3V6ZB 3PDOB 1JNJA 3ZE1F 2YBRA 3LMJH 2DQIL 4PRAB 2F54E 2AVGA 1REIA 2PYEA 2VB5A 4E5XB 4X6BA 2FYYB 5DD5H 4WI6A 3LS4H 4PB0L 5I1DB 3WKML 5BOZG 1NC4D 1SEBA 3MLVL 1T03L 3E8UH 3TVMB 1KXQE 3CK0H 3UEZA 4HS8L 1ZXQA 3IDGA 1NLDL 4P9HL 1JF1B 1G7MA 3D39D 3LIZL 3UTSA 4GRMB 1N2RB 4PJAE 5JW5A 1IAIL 1EFQA 1CS6A 1N8ZB 3TBTB 3EYOB 2EDXA 1GAFH 4FXLA 2AJZB 1MCOH 4PRHB 2YKLH 5E8PA 1PY4A 2PYEE 4BYHA 5C70A 1Q72L 1IGJB 2OZ4A 1J1PL 1VADA 4X7SH 4XVSH 5DC4B 3BZEA 4Y16C 3LQAC 3EYUL 4ZTOH 1CI5A 5GRXG 2J8UE 4HUVA 2IFFH 3MLZL 3OXRA 1RULH 1A9EB 1BQHG 3KYAA 4CL7A 1QPXA 3JWOH 3DROA 1QYGL 4L4VD 3MLPA 1EBAA 1AC0A 2MWCA 4XBPB 2O5YH 4P23C 4FFWC 3ULUD 5I9QC 1D5BA 3CMOL 3VXSE 1ND0A 1FFPA 1GOHA 5AWNH 1NBVL 2GSIB 1R24A 4NFCA 2PW1B 3V4PL 3DTXB 1K4CB 4O02H 1ZTXH 5DR5H 5E8DL 4KUCF 1Y6KR 4G7VL 1DSFH 5FK9B 3CFDB 5IR1B 1DANT 4QRRB 1QG3A 2VLJD 4N8PA 1IJ9A 4XXCC 3RP1A 2J8UA 5J06A 1FFOA 4RMRA 5F44A 3UC0L 4PRBA 3LY6A 5A16A 4XWOC 1ITBB 2VUOA 4JVUA 4Y5YB 2ZSVB 3S5LB 1RIHH 3NABH 4HKBA 1I3VA 3SE8H 4X4XA 4ZOCA 1JN6B 5J12C 5D96B 3QFJE 3MRHB 3REVA 3A6CL 3PABB 3VGGA 4FXGB 3D0VA 3GJFB 3ULUL 3FCTA 5DUBB 5EG6C 3G6JA 1CL7I 5J0BA 3C60B 3Q0HA 1I1YA 2YEZA 3CFEB 4JFFE 1DQDL 4PJ7A 4FMFA 4S1RH 2EDFA 2Q20A 2C3XA 2XA3A 3MMEA 4TVSa 3PJSA 1T1ZA 3DYMA 5E8EB 5KVEH 3GMLB 1EHXA 2FATH 3GSUA 3SDDB 1OP5K 3WFHB 3PWUA 4P2CG 3T1FA 2DWEA 5T5NG 4JFPB 3D6GA 5KSAB 5DUPL 1EAPB 1IAKA 3JWDC 2GKIA 1K3ZA 3D39A 5DQJA 3TN0B 2W60B 3OKKB 4Q9RH 2NNAB 5GGTL 5I73B 4WW2C 3ARFC 4OLUL 3BT2H 2BNQB 3SDXE 5KVEL 1ZA3B 4I4WA 4ZO9A 4LSRH 1Q9WB 4MNQD 4LCCC 1YN6B 4ZUTA 4AZ8A 1KN4L 3ZKMC 3BP7B 4NKOA 4ERSL 4OLXL 1A9BA 4HZAA 1QNZL 4YE4L 5KW9H 2ZOLA 3O3BA 4G42A 3AY4A 2AK4B 3I50H 4RZCB 5DFVD 4KDVA 4M9OA 2J6EL 4OFIA 1A6ZA 1D9KB 4KV5F 4G8GE 3L5WB 5I1IH 4JQVC 3D39B 1FO0A 3HE6B 3K3QA 5EZIH 1URLA 4PGBA 1F4XH 3SDXA 5IBLD 3JBG7 5IEKA 2DL2A 1OAUH 2J3SA 5GGSA 1UWGL 4G8FB 4PJ9D 3WFZA 1FGNL 1QLFA 2X9WA 2C3VB 1S9XA 4R8WL 5CUSL 2CIIA 1CDBA 1FH5L 3GJFK 2NY6B 5F6IC 3ILPB 3WO4B 1UG9A 2GUOA 2W9EH 5TQ2L 1Z9LA 3P73A 3OL2A 3PE9A 3QDMD 3M17A 1UB5B 1MRCH 4W4OA 5KJRH 1J1OL 4XVJH 2BK8A 5IHUL 1F02I 2YHGA 4Z0BH 4U1JB 2E3VA 5CD5C 1F6AA 1MRDH 4LLVA 4F7MA 3U6RB 3PABA 1T6WA 3RX7A 3MRFA 3BEVA 2V2XA 2P48B 4P4RB 5DQ9B 2Y06L 3RKDC 4LLDB 4D0BB 4XB7A 4ZSOA 1MVFA 4MJIE 5JW3L 1F11A 4R7DB 4KRNA 1HQRB 1T1WA 4PJ5A 1JPGB 3X11A 2YPLA 3ZYOA 4XPBH 4XNMB 2ZOKA 1UJ3C 5D6DC 1RZGB 1D5MB 1V7NL 3RWHA 4YK4C 2BCKA 2LFGA 3BDXA 5CINL 4IRSD 4NZDA 3CFDA 2CR6A 3TO4D 3R1GL 3HMXL 2RB8A 3HB3C 3PWJA 5K59F 5E56A 4K94L 5FO8A 4NRYA 4LPWA 2ARJB 1AP2A 3V6FB 3CSGA 1SM3L 1XF4B 2VRAA 2FO4A 4GMSH 3RBSA 3ZL4L 3OWEA 1JFQH 3MLYH 4L4TE 1CQYA 5JW4R 4ZPTB 1SYVA 4TULL 3TJHC 1NAKL 5SWSA 1P7KB 2VDLH 3GRWL 5DEFA 5K59E 2W65A 3LZFL 4XNQA 1RIUL 5GGVL 3L3KB 3MR9A 1U8MB 5JNYB 1K8IA 5IMOA 1JPTH 2A73B 3BW9B 3P30L 2DQJL 3RKDD 3QRGL 4K7PH 3VJ6B 1VKXB 4XP1L 3T0ED 1EO8L 2FDBP 1XH3B 2ZP0T 2V9TA 1N26A 4RFEB 2IH1A 1K4CA 2R0KL 3KYKL 3VFRB 4OZIF 1KCUL 3MXWH 4UB0L 5J6HB 2OTPA 2OR8A 4NRXA 2RFXA 3SOBL 2XZAH 4B50A 4X0KB 5ESQA 1SEBB 3F12B 2HFGL 1Q9KA 3HE7D 4X7EC 2AS5M 1FPTH 1E27A 4BZ1L 4LCWD 3UBXA 1WBXA 4XXCA 4M6NH 4M6OL 1NFDF 4O51B 1ZS8B 2BY0A 1NMBL 5IVXB 3MLRH 2OJZH 4NHUA 1G84A 5DUML 4D9QD 3H2WA 3QDMA 3H9SB 4NT6A 4EI5C 3F7YA 4ONHA 2CLZA 3U2SA 2CK0L 4HMEA 1S9VA 4YGVA 3LZFH 1H3WM 1PG7L 4UQ2B 1MLBA 5DRZB 5A2LH 1CDYA 3NCBB 5D2LB 3DXAB 7CGTA 1AKJD 2CDGB 1B3JA 3GJEB 3LEVL 3DETD 1ED3B 4R96B 3D5OF 4XI5C 5CFHA 1JF1A 4U7KA 2GSGA 1YEFL 4ZAKB 2DLIA 1FIGL 3MRIA 4I9WD 3ZKMD 3TVMA 2FBOJ 1WLHA 3FFCE 3P4NA 2ESVD 4M62L 2OL3A 5DRXA 5C0IA 5D71H 4UIMA 3RY4A 1ACZA 3SGEI 4JKMA 1TIUA 4OFVA 3OKDB 5KVFH 4J3TA 5C2BL 3GBMH 3WIHL 1ERNA 1IARB 1FZOA 3MJ8A 3PDOA 4KKNA 4PLNC 2J8HA 3VD5A 1D7FA 4XNZC 4UDTA 4HXAH 5CGTA 5E4EB 1W0VB 5CCKH 2A74A 2R56L 1A1MB 2XWTA 5DEZA 1FBIH 5JOEA 5IHZA 2FSEB 2Q7YA 1BLNA 1JYNA 4JZOB 3A67L 5KVMC 5KSVA 4XPFH 3FFCA 3BEWA 4MWFB 4WEUD 4JN2A 1T5XB 2APWA 5I1JL 4MDIB 1B0RA 4MXWL 5EO9A 5IK3A 5C0EA 4PJEB 5C07A 2R2CA 4JRXA 4XVJL 4F15B 1U6AL 4KKCD 4IEFB 3QH3A 3S8WA 5BOPA 2VLMD 1OAYH 1AE6H 3O3DA 1VSCA 2VXSL 1DQTA 4PUBH 2A6IB 5H94B 4BFBD 2J5LB 1XR8A 4KKCC 5FOJA 3KWWB 4NM8L 1RHHA 3K4ZA 1NDGA 2ATKA 3GMRB 4UNUA 3LB6D 3EO9L 1EJOL 3VFTA 4R0LB 3HMXA 2KPNA 3NCYP 5AD0B 2ZUXA 4ZMAT 4PGCA 1FZJB 1EEZA 3BAEH 1OLZA 4LVEA 3QPXL 5D5ME 5GGSY 1IBGH 4HWNA 4G6KL 2G9HA 2G60L 4ELMF 4F7CB 5KSUB 3KPOB 3MUJA 2E9BA 3N1QC 3D25B 4PG2A 4YHIB 4K71C 3T4AB 2VL4A 4DKEL 4ZFOL 3U4BL 5EC1B 3BGFC 4N8CH 3QUXC 2H41A 1IFHL 4YNYA 2XZCH 5DJ0B 5AD0A 4NQEE 4JDVA 1X5FA 4MXVF 2X9YA 2VZOA 3TZVA 4GSDH 5F9AC 1KN4H 2VLJA 4HULB 4KJQD 4TUOA 5GGVH 2D7OA 1UCBH 4XMPL 4Y16D 2CJUH 4YBLC 4TULH 1G9NC 2AV1B 1WAAE 4JFEA 3ILQD 1HOCB 4OFDA 1AC6A 3TZVC 1TPXB 3FB5A 3D9AL 4H25A 1AGBA 1UB6A 4WWKD 4UV7L 1FVDB 2WQ8A 4FZEL 5CEYA 3VXNB 1S7QB 4MXVE 4OKDA 4OZIB 4L3CB 4NKMB 1SY6H 3QFDB 3RJQB 5L9DL 1TLKA 2QKIB 5SX4I 4ZSOE 5IFAH 3VXSB 5HHNB 2Z31A 4QRUB 2E8YA 4YGVB 1WTGT 2IANB 5DT1L 2YWZA 5E2VH 3C60C 3BRGC 4RISH 4APQA 5D2LE 1NCDL 1S7WB 4DKEH 5HHPB 2X4RA 4R4ND 3IDJB 4UV4L 4GG6B 2BY3A 4UDUA 5F70A 1TVBB 1MIEL 3H0TB 5IBUB 3OKDA 2UYLB 5DTFA 3EDKA 1W2KT 1QFWM 1YEGL 4JRXD 1CR9H 5FECB 1QRNE 2DDQH 4YDIH 1GYAA 2AI0H 4FA8A 3TPUB 1U91B 4XP5H 1I7RB 3FFDA 3ECBB 4K3EH 1F4WL 5I6XB 4EOWH 4K2UL 5E4IA 2VDOL 4LEXL 2NW2A 5IV2B 2C1PB 1F4YL 4UTBH 4PTTA 5I1EH 4EDXB 2BNRA 1TZIA 5D7IB 5ID0A 1A6VL 1R0AL 1X5AA 3MR9B 1FL3B 1BM3H 1AR1D 4Q7DA 4XP4L 3RQ3A 4I3GA 1BFVL 3FONB 3PIQB 5BJTB 1QP1A 4J7RA 1T0PB 4Z18A 5CILL 4TSCL 3EFDL 3ARVA 3FQNB 3OV6A 4X7SL 2NY2B 3G6JE 4QHKJ 3O81A 5EBGA 1KFAL 4BQCA 4MAUL 5EZLA 4P0DA 1CLCA 1FFRA 4PJ7E 4PY7B 4QY8B 3VFSB 5TFSL 2HLFD 3NTCH 3QG7H 4YHKL 2QQKH 1ZHKB 4ZQKA 3HLAA 4LPUA 3B9VA 2AJVL 4KRMB 1T7WA 4H0GA 1NCWH 5E95B 1UXSB 4KK6C 4PGEA 4XAKE 4Q9RL 3MBXL 3C2AL 1G7LA 1DLFL 4LVNC 4K9EC 1KB5L 1KTRL 2YD1A 4H1LH 3E1F1 4HKZA 3EOYG 3QFDA 1F11B 1MJJA 3C60D 5IB4A 1NUFA 7FABH 4G8EB 1U2CA 5EU6D 4TPRH 2HH0H 2WW8A 1CGTA 3OJDB 3DUUA 2BVQB 3JV6B 4N0CD 4DAGH 1VGKB 2VLRA 1J9CT 3HE7A 3MV9B 3UTQB 1OLLA 3IRPX 5ANME 1HK6A 4NGHL 2R4SL 3C5JB 4Q9BA 3FJTA 3X12B 4M6AA 2X1OA 4H8WL 2DBJA 1ZLUK 4PRHD 3BESR 1G7PB 5CHNA 3ILQC 1U3HD 3CXDH 4ACPA 5F9OH 4FFVC 1FAKT 4H1LG 4QHUB 4KK5C 3BO8A 2BCKB 2PTVA 5HHMB 5DURD 3O9WC 3EKCA 3DMMA 3OHXB 2UVEA 3MNVB 2YRZA 4JHWL 4L3EB 5CEXA 3IKCB 3QRFM 1ZHLB 4NWTL 1QEWA 2DMKA 5BO1L 4KH2A 2R0KH 3SPVB 4M48H 4GW5A 4Z95L 1T21B 2E7CA 2YD2A 4OI9A 1HNFA 2HT2C 1A4JB 1KJ2B 4LSUL 2V2XB 4P4RA 2O5ZL 2JLLA 3B6SB 1BWWA 3SQOH 1X5YA 4GXUM 4PJIB 3EYVB 4OUUA 2R9HC 1E4XI 3TJEL 3AM8C 2EYSA 2JK5A 3DX6A 3CMOH 3OGCA 3SGKA 4MD0B 1AFVH 1FJ1B 5IW6A 4OKVA 3HPJA 5TE7H 2PYED 3P73B 1YEHH 1OY3B 1Q9LA 1G6RL 1OAKH 5I75C 1EA9C 1NC4B 2PR4H 1NCAH 4GQ9L 3QSKB 2VLKB 4Z5RB 2P8MA 4I9WE 2VC2H 5CEZL 5IB5A 1FNHA 3HR5A 3UYRH 3FFCD 3QXDB 5T5FH 1U8HB 3OB0H 5EO9B 1OTTC 4CN6A 2IAMC 3PV7A 3MPCA 3QDJB 4PB9L 4HS6A 5KSBF 1XFPA 4MWFA 4JM2B 35C8L 1BZQK 2FEEI 3MLUH 1WCQA 3DUHA 1VEOA 35C8H 2W07A 1GZQB 2AV7A 1W0VA 3G5VA 5D7SL 2YZ1A 3MV8E 5ICXA 4XNXH 1FYTB 2OMBA 3A6BL 4FG6D 4RAUA 3CLFH 3GIVA 4HUNB 4LCYB 4LCUA 4EBQL 3BJ91 4LEOB 2BVEA 3HG1E 2JELH 2AQ2A 3UTQA 3TA3C 3SO3C 1YN6A 1JNLL 5EPMA 1R5IA 3LS5L 5D7IF 5TE7L 3QCTH 1U95A 5ERWB 2OR9H 5B38G 1NGXB 3VXUD 1RUMH 3Q1SH 3G04B 4N8VA 2DL9A 3N50A 4QRTB 2KUTA 1AHWC 4X8JA 3UJJH 4JRYB 3MV8A 2HFFB 4LKCB 3L3OB 1OVZA 3MLTB 4GXVL 2R39A 3STLA 1W0YT 3GMLA 4IOIB 1W0WA 2ENSA 1QTYT 3LKNA 4FTVB 5EA0H 4LHUA 3PHOA 3QIWA 4Y1AA 4NNPL 1S8DA 3QB7C 4OM1H 2GK0B 3H9SA 3ESVF 4D9RE 1LEIB 5J3HC 4I0PA 4LVOB 3L3IA 3D0VB 3GJFA 3HNVH 5IOPA 5E2TH 4HCRH 1NAMB 3QHFL 5IIEB 3SDCA 3V52H 1S9YA 2L4OA 4NO0D 2JJSC 4WI5A 3RWGB 5DJ2B 1RZKH 4N90E 1YEJH 5GGVY 3GSQB 2VKWA 1QLRA 4JO2H 2Q8AL 5BJTA 3HI6L 1T7ZA 4MGXA 4NQED 3AY4C 5JUEL 2O5XL 2BNUB 5I1GH 5HGHA 3KPNA 1IGJA 3SQBA 4NQDB 3QIWB 4MNQE 4LSSH 4PLJD 3T0DA 1J0HA 3QNXB 3GMOA 4XCFH 5JMOC 1MAML 4OD2A 4OLEA 3I9GL 2DLFL 2EZ0C 5IVOA 2WQRA 5ESVA 5KSAC 5D1XC 3IDXL 1KCLA 2H9GB 4FN0A 4JPKH 1LE5B 2XKNB 5TDOA 4WUKL 2BNUA 4OCRL 3HRPA 4DN4H 3RL1A 4GAYB 4HJGB 3ARRA 4EUPB 1MCEA 2D2OA 3O45A 4YWGL 1GIGH 2WAHA 1T5WA 1CGUA 3P4MB 2YBRB 1T0NA 4N5ED 2VDML 4ZFOA 4K9EL 4LEOA 5JXAH 4RGMC 5TH2A 3BX7C 3S98A 4ZDHA 5HI3C 4CW1A 4P5TB 2CKNA 4OLZL 4FQ1H 1EVUA 1CFTB 3BKJL 1AQDB 4C57C 4HWBH 1RUKL 1XF3B 4MSWB 4IS6B 5EOCH 4JLRB 1HNGA 4MJ5B 5DJ6B 2VDKH 4PJGE 3MSPA 1JPSL 3BHBB 2EDTA 2VISA 4DOHB 1JZ3A 4K3DH 3G6AA 1EEQA 3UP1A 3SKJL 2IANE 3PGDA 1BFVH 4M1CC 1U8HA 1JPGA 4QRPA 4L8SC 3UTZA 2B4CL 1ES0B 2CPCA 4JFEB 2VLLB 1OTUC 3K46A 4LARL 4OFYA 1ZVYA 5MEOA 3TLRA 4PTUB 1L9MA 3SY0B 3UYPA 1X9QA 1T80A 5H2BB 3U7YH 2X4TA 4JO1L 2HFEB 4APQD 3KLAA 1CGYA 5BW7A 4Q9CA 3MRRA 1RMFH 5JHDB 2GT9A 1JUFA 4HPOH 4R2GC 1BJ1H 4ZODA 1QBML 3H9SD 2C3WA 4YNYB 3MOBH 4U1LB 3D3VB 1P7QD 3N9GH 1T2XA 5EIIA 2GUOB 1QUNA 1LEGB 1M7XA 2XNAB 2XT1B 3B83A 1JVKA 2BZDA 2J2ZA 1BQSA 2GITB 3NBNA 4UILL 2C3VA 1A1NB 4NQDD 4X80H 2HVJB 2PO6A 4ZOEA 1TTUA 4RX4A 1RUPL 4PJ5D 1WEJL 3WS3B 2DOCA 3E3QC 1RURH 1BIIB 4UUJB 3QUZC 5DJYB 4X9GA 5BVJA 3F6IA 2QQQA 4CN4A 3D85B 4N9OB 1NUDA 3H8NA 5I2IB 1D9KA 4M3KB 5GS2H 1Q9LB 4XNYL 1AGEA 4EI5D 4OKVB 4EIGB 3TA3B 3F6LA 3OF6A 3OGCB 2A6IA 4PLKD 4YUEL 5ALCL 3V7MA 1A6TB 3T0VA 3B2UD 2IBZY 3MYZA 3L5XL 3FB6B 1KPUA 4G7YH 4Q9QH 5IB1A 4AIZB 5I1LA 3LAFA 4QHMA 3EAKA 3NZ8B 4MQ7B 1INDL 3UTPE 5I8EA 5HPOA 2DD8H 5IB4B 5F71A 2DQFA 1A3QA 4OJFL 1U8OA 2C4FU 1E4JA 4K7PY 3VXPA 3VRJA 5J1TC 2ZCLH 1IC1A 1KLGA 2R4RH 1EMTL 3QR2A 1DBKL 5D93C 1Z3GL 4JPKL 3IXTA 4D9QE 3BIKB 4MVBD 4OLYH 5KANI 4MJ5A 2VDNL 4OV5A 5L8LB 4P46A 5I8OL 1X7QB 3U48A 1B4JL 3MZTA 2JTDA 3HPLA 4YZFF 3C60A 2WBKA 3AS1A 1UH3A 1AD0A 4HX1A 4HIJA 4QRPD 2C5DC 5FF6A 3H42H 3JV5A 3GHEH 1MFNA 2MKLC 3L6FA 3L7EA 4LQFL 4UTAH 1CXHA 2HJKA 3O45B 4XX1G 3O8XA 3I75A 1JN6A 1FV1B 4ESKA 1XR9A 3ULUF 4WI3A 1UCTA 2PCPB 4IJ3C 1FNSL 5FA3A 2NY4D 3QWQB 2BOCB 1NCCL 3QYCA 3BQUB 1P84K 4NNPH 4XWGL 4Y2DD 1JYXA 1XF1A 1A3LH 1KCVL 4PTTB 4P2OA 2UY6A 5FK9A 2F8OA 2P42B 3LKOB 3LRHA 3RFZC 3QP3A 1C12A 2QEJA 1F6FB 4NQDA 3P0YH 4O2EB 2V5RA 2VDKL 4FXKB 1CLYH 3DHJA 2QADB 4G9DB 4P3DA 1IEBA 5TF1H 1MFDL 1TQCB 3VG9C 1X5KA 5L8KB 1QSZA 2ED7A 2UYLA 2F8VA 4U1NA 3QO0B 4KUCD 3KLSA 4YHYB 4PRID 3KJ4B 5D1XD 4S2SA 4TTGA 1D6EA 4RFEA 1ZHNB 2FHBA 2Q86A 1UKTA 2P7TB 1J86A 1G1CA 2AJUH 2E9IA 2MKWA 1XCTB 1HDMA 3WFDL 2DMCA 4U1MA 4OCRH 2APTA 1R3KA 1SHMA 3T0WA 4RSVA 1IAII 5I74C 5AYUL 4KRPB 5B3JE 3TN0D 4EIZC 1YPZB 3QDGB 3FB7A 2BNQD 4XI5D 4UTAL 5B8CA 3R1GH 2NW2B 2PO6C 4JAMA 2HJKB 4I5BB 4BK4A 4R97B 1MAMH 1U91A 1WWAX 5DFWH 4WO4B 2VN4A 4XC1L 1V7ML 4RQQB 4WWKA 1PG7H 5J3HD 1I9JH 3NZHL 4HIJB 4JDZA 3CLEL 4MCZB 5C9KA 2HN7A 1QVOB 4V2CB 1XGTB 3C8KA 4L5FH 1NEZG 5E0QA 2AJ3A 2V17L 4R2GB 5T3ZE 5IB3B 3PQYD 3VCLB 3SDXF 2CKBL 2IPUK 1MQKH 3TFKD 2VABB 1JHTA 4CU6A 2MFNA 3O2WH 1QKZH 4E0RA 3P4OA 4JN1H 4OM0H 5KJRL 4NNYA 2VQ1A 1WUNT 1C1EL 3GMMA 4L3AA 2P47B 4DQOL 2UV3A 1MFEH 3QDJA 2QSQA 4ORGA 5H35A 2IEPA 5DHYA 4WEMB 1OL0A 1QBLH 1NQBA 5KOVC 4DKFH 3O2WL 5CJ8A 4JPWH 1T3FB 2VLKE 1KPRA 4OQTH 5KS9F 4S1SH 3F8UB 2OR9L 1IKNA 2E27L 2E7LA 5IB2B 2EC8A 4PIRF 3QEHA 1NGZA 4PRNB 1J0JA 2WUCL 4LAQH 1SMOA 2CIIB 3GSRB 2Q8BH 5JPMB 4OZIE 1MREH 4JRXB 2Q1EA 1RFDH 5E6ZA 4YHML 1GPOH 1DDHB 1YUHA 4BUGA 2OXGA 2YPVL 1RVFH 1T21A 5F7KC 2WUBL 5GZOD 4X5LA 1GL4B 1JF6A 3QWRD 4OZGF 3QCUH 4M4PA 1OB1A 1NCBL 3MOBL 1RJYA 3KPMA 2DQGH 1QRND 1QBMH 3BPLB 2H6PA 5ILTL 3OGOE 3WFDH 1ZMYA 4QXWA 3HG1A 2Y36H 5J11B 4F15C 4QXUL 3IU3A 3WV0A 2ED8A 4Y1AD 5CEZH 3ZYIA 1FSKC 1NSNL 1A1OB 3PV6A 1MCJA 3LV3A 4P23D 4WNQB 3UTTA 1XGUB 5GIRB 2DM2A 2EDLA 3H9ZA