3JUYA

Crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
249
structure length
233
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCQASGYRFSHFTVHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGEWGWDDSPYDNYYMDVWGKGTTVIVSEIVLTQAPGTLSLSPGERATFSCRSSHSIRSRRVAWYQHKPGQAPRLVIHGVSNRASGISDRFSGSGSGTDFTLTITRVEPEDFALYYCQVYGASSYTFGQGTKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B3 single chain variant HIV-1 antibody
publication title Crystal structure of a 3B3 variant-A broadly neutralizing HIV-1 scFv antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3juyA01
5BZDA 2NZ9D 4QEGA 1F13A 4PBWD 4JFFB 5FYKU 4MJIA 4Y2DB 4OUUA 1KB5H 1T89A 2XT1B 2EH7H 1D6EB 2R0LL 3QUXC 1JGEB 4WUUE 1HKLL 2AJYH 4KJYA 5BJTB 3P40A 4WY7L 4HS8L 1PVHA 3G08B 3LSOB 5ELIA 1T21A 3GMMB 4TUKL 2HT4C 4XTRD 1KTDB 2M26A 5L2KA 4PJIB 2NY0B 4NQDD 4LRNL 5A3IC 3RIAF 3DMMA 5JXEC 4I3RL 1MHEA 3CVHL 4QRRD 2GIYA 4ONHB 4ERSL 4CVUA 5LCVH 2WINA 1GZQA 1LEIB 1OP9A 3QIWB 3QJFA 5BS0E 5HGDA 4OFVA 1EAPB 1ZA3B 2CKNA 2VL5B 4U1SA 4MS8C 1T83A 3QEGL 3RWFB 2VLKB 1KJVB 4G8IB 1GSMA 2XOTA 5I1IH 4WGVB 4Y5YB 5E1AA 1XGQA 3MBEA 2J5LC 4ZAKB 2IBZX 3QSKB 2BSED 4MLIA 4JHWH 3PL6D 2GJZB 3MRKB 5FGBA 3VXRB 2JELL 4CVXA 4EI5D 1RZKC 1CU4H 3STLB 3H9HB 5FECB 4OI8A 3DX8A 2JJVA 3H8NA 4BKLA 2Z35A 2R0WH 4XCFH 3VGHA 4YUEH 2F53E 2Z9TA 3MJ8B 4HCRL 2E7LC 1QHOA 4U1LB 3QH3B 3MLVL 3NTCH 2IANB 1I3GH 3IETB 3UTSA 1NCUA 1DVFA 2XWJA 4HZLB 3MLPA 3L3JB 4LFHD 1DDHB 3MQIA 2CLZA 2J8HA 2B5IC 3HNVL 4XPGH 2OX5A 4R97B 4RQQA 4BFIB 1RUKL 3SGKC 3VXNA 2XWTA 3V4VL 4MLSA 5IB3A 2BJMH 1SY6H 3ESUF 2XRAH 3B2UC 4FZEH 2ENSA 4Y8AA 5C0JA 5D1QC 3PXHA 2HA1A 3ALWA 4I77H 4F8QA 2NYYC 1HNFA 3E2HC 4ELKA 3H9YA 5DLMH 1WBYB 2ADJA 4JY6A 4FHBD 5DT1H 3KXFE 1UEYA 4Y19E 2D0FA 2X4SB 1Y6MR 2W0FA 4U6XB 3P11H 5C0AA 3ZTJG 5DEZA 2C1PA 4LDEB 3TN0C 1QLEL 1V3LA 2DQFA 4JPVL 4MA8L 5E8DH 5JTWA 1Z9LA 4U3HA 3K4ZA 3PWUA 3FT4B 1N4XL 4IRZL 1Z9MA 2ZCKH 3RVTD 2EECA 3SKMB 1T4KB 3DVFA 4M7KL 5CS7A 3CMOH 3LKRB 4HJ0C 3LMJH 3WFHB 5CWSB 3BHBA 4KI5F 5I1CL 3KLHD 1L0XA 1WCBB 2FZ3B 2HFGH 2A74B 2P47B 1KIRA 1F58H 1A9BB 1HSBA 4JJ5B 3C5SB 3G6DH 2OMNA 1F4WL 5JOFB 3V6FA 2ID5A 5ICYA 1EHNA 1LO3L 1NGWA 3MCLL 5EU5B 4XBPA 3SJVD 4DUXA 4GKZA 3W9DA 1S5HA 5CILL 2APBA 3O3EB 1YPZA 2ED8A 2WBWB 5D71L 2HG5B 4YHNA 2AK1L 2ZOKB 2V2WB 4FP8H 4EI5A 1BQLH 3VRIA 3IDNB 3OB0H 3A67H 5AG8A 4KJWD 1YEEL 5IKCB 3H9SD 1CIUA 2NR6D 5E8EB 4KHTH 2FNBA 3S37X 1R3HB 5DD6A 2DQGL 5E2UH 1G7LB 3I50H 1J87A 1EFXB 3SDDB 5LXGH 2CKBA 1OWRM 3MRNA 4BQ9A 5I1DB 3SKUD 4BFBD 3S3SA 2OTPA 2P5WA 4RGOL 3V0VB 3O45A 3OAYK 4R7NB 2BRQA 5E6YA 3MLTA 3LRHA 4ORZC 5MP6H 5C0FB 1YJDH 1A64A 4ZO6A 1KB9J 1PG7X 2VN4A 1ZVSB 3BP7A 1KLGA 1A6UH 2M2DA 2BSSB 1EGJA 1CXIA 1WFUA 3EDJA 5KSAD 4IRSB 2MFNA 1T22B 2UZXB 3O41B 3UYRL 1Q9KB 4KMQA 2WIIB 4ODBD 4PLJD 3E3QE 1TENA 3OKOA 4WJ5B 4U7MA 4ZNCD 1ERNA 3RP1A 5J12B 5B8CB 5KSUA 3MLXH 5D1ZC 3BEWA 1U58B 4QHMA 3PHOB 4L9LC 3RVUC 1OSZA 4OIIH 2PUQT 3CSYB 5DJZB 3ARQA 5J6HA 1BLNA 3ARBC 4PS4H 4IRJD 3D5OF 2DM2A 1KFAL 2EDXA 3T0WA 5ICXA 5T5NG 1CICC 3LVEA 5GGVY 3KPSE 1SYSA 3ZT5A 2XV6B 1AKJD 1LO5B 5F9AC 5T1MB 1UKTA 3IDUA 5ERWB 5K93A 3VD7A 2VABA 4BFGA 4PBVC 1ZLUK 1MVUA 5DTFB 4OCWL 5ESVA 2HT3C 3MRLA 4FXGA 5IQ7L 1TPXC 5DJ2B 1EFQA 2Y07L 3ECBA 4TRPL 5ENWA 4UDTB 3ULUE 5DMGD 3GMPB 3PWVB 4PJGE 4NO2A 3L3OA 4AMKH 1HSAA 3LCYA 4QHUA 5BS0D 4NPYB 5LKNA 3BXNB 1MCCA 3IAGC 4DKFH 1XR9A 3WIHL 4PJBB 1CDUA 2P4AB 2Y5TB 5DJCB 3C6LA 4WV1C 4ZS7H 3F5WA 4RGMB 5C0CE 5F7HA 3W39B 3S97C 5I1GH 3C08L 1N59B 3QEUA 4HLZG 4RMUA 1AD9A 1RURL 5ADOH 1P5VA 2KQMA 3DUSB 4JLRB 4F33A 2YRLA 4YR6A 4Z6AT 5E95B 5DJXA 4JN1H 3GSRB 4PJAA 1ES0B 2X5PA 2PO6B 4IHOB 3BDBA 4U6YB 3S5LA 3LIZL 3RX7A 3DHJA 3MGOB 3QFJE 1K4CB 4D8PB 3MV01 1I7TB 4Q6IB 4UINL 3FQRA 5ITBH 1W0VA 3MA9L 4JVPA 1RZJL 3QHZH 4P23A 3SDXB 3NCJL 4FTVA 4JQXA 4IRJA 4U1HA 1MQKH 1QACA 3UBXA 1PLGH 3STZB 4G9DA 2AXJA 2NXYB 1B0GA 3O9WC 4MQ7A 3OKDA 4U1NB 4WUUA 2P48B 1L9MA 4OZHF 4FXKA 5BW7C 2A9NH 1Q72H 5I73B 3V5DB 4MAYD 4Y1AB 3VXUB 3WO3B 2BVOA 1QSFE 1JN6B 1KCSL 3DV4B 3IJSB 3U79A 5FGCB 2JB5H 4DZBA 5E7FA 3OTTA 3QUXB 1C08B 4JO3L 4M6OL 4R9HA 1YECL 3QRGH 2DQUH 3FFDA 4M61A 2IGFH 1I7ZB 3SQOH 1HH6B 1CFQB 3SGJA 1RD6A 5D2LA 5HHOB 4WHYG 4O02L 5BRZE 4R4ND 3AXLA 3RY6A 5ANME 3B4NA 4NOFA 3L1OH 3ZZ1A 4NNYB 1I3RB 5CEYA 4NIKB 4AEEA 3TBYA 2O5YH 4WO4B 1KCRL 1NPUA 3SE8L 2D7MA 4F58H 1WK0A 1BBDL 2BSTB 5IR1B 1IZJA 1KENH 2Q1EA 3O2DA 4JJHA 5BV7C 5KBNC 3V7AE 3CVHB 5B3NA 3W5NA 2GAZB 1MVFA 1M7XA 2R2CA 3D48R 5IHUL 5F7EH 3PGFH 2Q3ZA 2VDPL 1UZ8B 1TQBB 4R26H 4NT6A 1BWWA 1NBYA 1QVOA 2QHRL 1ORSB 3VGGA 4ESKA 5E6IB 3GMNB 5FHAH 2F53A 4EOWH 4YDVA 2HWZH 1JF1B 4A6YH 1QSZA 1ZT4A 5DMIL 4Z5RA 3V0AC 1K9TA 4EVNA 3VFOB 4O5LH 4YE4H 4KDTA 4HAGA 4XNQB 2YA2A 4FXLA 4KK8D 4L8DA 4P5MA 3TYGH 2DWDA 3BSZL 4BQCA 3WKNA 1NGYA 3BP5A 2QR0A 5DJ8B 1HHJA 1JPGA 4GKNB 4YBHA 5C92A 4M3JA 3T2NL 4WWKB 5DWUL 4HC1L 5FKAB 3ESVF 3S8WA 3H0TB 1S9KC 2XKNB 1L7TL 3KGRA 2MHAA 1R5WB 1A3RL 4GG8A 1RZFH 4OCXH 4EDXB 1W0WB 4UT6L 3KXFA 4Z7VB 3MRFB 2OJEB 3SE4C 4Y19A 4NQSB 1BZQK 3P30H 4G6JH 4XNZC 1PZ5B 4XPHH 1JZ8A 4I3SL 5D1QB 1GZPA 3H9ZA 2QADC 2ICEB 1PKOA 1RZKH 1YUHA 3UPCA 4ZTPL 3PWLB 5CSBA 4MD4A 3CFEB 2X4RA 3HB3D 4UDUB 3IDMB 4XWGL 1X6NA 3TBVA 4S1DD 1D5IH 1Q8MA 2RFXA 5CHNB 3DX9A 5JDSA 1CGUA 1F4YH 3KPSD 4KI5E 3OKKA 5KG9A 3TN0B 3BKMH 1JCKA 3QNYB 3K46A 4LIQH 3EJJX 1HINL 3BPLB 3ROLA 2FX8H 3BZ4A 4QOKE 2EDEA 3ZLQC 1TIUA 2ADIA 2FJFA 3QDME 2QHLA 2X6MA 5C0ND 3D0VB 1D5ZB 3CVIH 4OCSL 2R0ZL 4OZFA 5E5UB 2A6KA 3KJ6H 3WS3B 4HFUL 4RBPH 1JE6A 1F8TL 1SM3H 3I6LD 3HG1E 4ISVA 4JQVC 3QHTC 4NRXB 4EDWH 4EQ2A 3E6HA 4KC3B 4QHNA 4CN1A 1KCUL 1SVZA 2F8OA 5DUPH 2NTFA 5H94A 3DRQA 3U0TB 3BPCA 3GIVB 3GSXB 1OB1A 3P9LA 5GRUH 4HUWA 4X4ZA 4HUVB 2KDGA 3P77B 2CK2A 4YFDB 2VLRD 4X80H 4MNGE 3FB6B 4S0SD 1KELL 5C0CD 1QNZL 1U2HA 1A3LL 4XVUD 1I75A 3IU4H 3MJ9L 5C9JA 5CMAA 4PGEA 1T1YA 3NGBC 1IAKB 2V9TA 4ZUUA 4PRDA 1YNKH 3MV7E 5I1KH 3FRUB 3AGVA 1MHPL 3B2VH 5EDXA 2EDQA 5KANG 2BSRA 4U1KB 4L3CA 4YXKL 1TETH 3GRWL 4DZ8A 2X2YA 1INEL 1GAFL 5CD3A 1K5NA 2YPLB 4Q9QL 1M7IB 5FYJL 4K8RD 5IMMB 1LP9F 1KJMA 1YN6B 3EKCA 3GSNL 5EBLA 2EZ0C 1FNEB 1OW0C 4E41B 3IB4A 2FO1A 1SJEA 2B7DT 2DLFH 4R6UA 5EA0L 4X4YB 5I16B 3RWCA 1HQRA 4RNRB 4L5FL 5ACZB 3NFPB 4P59H 3ARFA 3S35L 5JXAH 4HUXB 4S1QH 2IF7A 3OB0K 1MUJA 4HQQH 4X7SH 4Y0GA 5GZND 3DXAE 3RGVC 4OGZA 2GUOB 2WP3T 5GGTH 3DJ9A 4GAYB 3KPSA 3JV4A 3WBDA 5D1ZB 4LLYB 3VDAA 2EIZB 1I1AC 3DECA 4FQHA 4L9LB 4G9FE 3D2UB 4ELMA 5D9SB 1CTNA 3H2WA 1RUMH 1A0QL 5E2VL 1Z5LB 3LB6D 3VFMB 1OAYL 2FLBT 1D5MB 1DN0B 3ARBB 3RU8H 4JG0L 4LLWB 2G60L 2R2HA 4JFZL 1CICB 4PRNA 3KYKH 4XMKH 1WBXA 1RIVH 2JCCB 4GBXA 3GSWB 4OB5L 3O6LH 5JIKA 4P46C 2D0GA 4NWTH 3VWKA 2YMXL 2BK8A 3MCG1 4PJGA 3N85L 1M7DA 4AL8H 3MRHB 3WJJA 5DEGB 5BRZD 5IROC 1TPXB 5D72H 2OK0H 3B6SB 1FN4A 4Q6YA 2A6DA 3T08A 4OLWL 4JHAH 4PGDA 3Q6GH 1T1ZA 4HEPG 3LKPA 1EJOL 1VSCA 1NCAH 4PY7B 4PRAB 2AI0H 5C0CA 4JKWA 4K71C 1IVLA 1CXHA 1D9KD 2W65B 4U1IA 4DVRL 5JMOC 3WUWA 2X70B 3AU1A 2ITCA 2X4UA 4OF6A 3RWHB 4QWWD 5J9PA 3T4AA 4RGNB 1C16A 2CDFA 5IEKB 4WV1B 4WW1A 3QUZD 3LQZA 4KHXL 3SCMC 5F6HI 4LVHC 3MRJB 1WICA 3P0VL 4P4KA 2D3VA 3VFWA 1FCCA 3WFDH 1QUNA 3F7YA 1CD1B 4B5EA 2PYEB 3F7VB 3ISWA 1F3DH 1W72A 3IRPX 3QFJA 1KGCE 4DFIA 1G7HB 1FL6B 5LWYH 4P2RE 1OAKL 4WU5B 1AGCA 5TE7L 5E2WH 2WUBH 3WFCH 5DRNA 3KYNB 2FX7L 3C5ZB 1UCTA 3FOLB 1ITBB 5KOVC 4HIXL 1EHXA 1NQBA 3RL2A 4CVWA 3SE9L 5AD0B 3DRTB 1HHKB 4YXHL 1G9NL 3QBTB 4OZHE 3JSSA 3K4DA 1KEML 4G8EA 4PYGA 2G9HA 1QO3B 3CJJA 3QPXL 2P8PA 1YEIH 1MEXL 2X1XR 3X12A 5LG1A 2X1PA 4MSWA 3VD4A 3KDMA 4G6FD 2QQKL 1QSFA 4KGLA 4XX1E 4ZFZB 3EFDH 4MJ5A 4P3CL 5DJDA 4F9LA 4F2MA 3WLWC 1M4KA 1P1ZA 3I3EA 4JZOA 4PJ7B 4RAVB 4CJ1A 3EYVA 4E5XB 3O9WB 4OV5A 1AGEA 4PLKC 4L4VB 1OAUL 4KI5D 5IJKA 5E9DE 4NZUH 2HMID 3QUMA 3N1MC 3TT3H 3L5XH 1MHCA 5ANMA 4QOKD 1PY9A 5IT2L 4QLRA 1QQDB 4RWHA 1I4FA 1X5KA 1GGCH 4QXUL 5EU3B 3WN5C 3H42H 5MEOA 5JPNA 4L8SB 4N8PA 5HD8C 4X5WA 2Y36H 4LAJH 4Z8FH 3CFJB 3CCHB 2Y72A 3CFCH 3GMOB 3QI9D 4J3XA 3SY0A 4LDLB 3MUGB 2MPAL 2VIRB 1CD8A 2X4TA 3RVVC 2UY6A 4PTUB 4X99A 3T65A 5E00B 1YQ2A 3MUHL 4YLQT 4PB9H 2NW2B 1VGKA 5KS9E 3OJVC 4F9PC 1YN7A 3DIFA 5C6WH 4TSCL 1YDPA 3TA3D 1KN4H 5F97E 4YX2H 2CIIB 2EEAA 3LRSB 3MMEB 3FQTB 3D6GA 4GS7C 1KYOJ 3MV7D 4R4FH 1JZ5A 1IGJA 1LEGA 2E9BA 3QULB 4NQEB 4JRYB 3MODH 1MRFL 1U3YA 1NMBL 5ADPH 3QWOB 1NC2A 4G42A 3ZL4L 5DD0L 2Q3AA 4KFZC 1IGTA 4Y16D 3PDOB 1CE1H 1OTUD 4HWBA 4XNYL 5BV7H 4YC2B 3G5YB 5GS1A 2Y06L 1S78D 5T1KD 5JIIA 4NRYB 1H0DB 5GRWA 5DEFA 1CXKA 3BO8A 3R0MA 1KF9B 4K3DL 5K9JL 3CAFA 1YQVH 4M1GL 1FG2A 3DXAD 4XMPH 2E8YA 3ARWA 4GRLD 4MDJB 4MQTB 4V1DB 3JWOC 1MNUH 1CL7L 4YDJB 3CUPB 2HFGL 4FQXD 1WZMA 5JW4N 4B41A 4XNZB 4PGCA 4NKQB 2QADB 2UVFA 4QXWA 1WT5C 3L9RB 4G9FD 3RFZC 4ZD3L 2JJWA 4QOKA 3X11B 1RI8A 2XWBB 8FABB 1F11A 4H20L 3RVXC 4JGMA 4O2CB 5EUOF 2DQDH 4YDIL 4AY0A 3QDMA 1QLFA 1NBZA 4EKXA 3LKNA 2CXGA 1PZUB 1T5WA 3AAZB 3PQYB 1FIGH 3V8OA 4K3JL 3HG1A 4XBEL 5SWZD 2J6EA 5I2IB 1CL7I 5L6YL 5AAMA 3W9EA 4H26A 2FIRT 4EIZC 1BFSA 4LOUC 4HKZA 5EUKA 4S10A 2UY7A 2A6IA 1S5IL 5TFSH 4ZOCA 4MNGA 2IFGA 2YD4A 1GVIA 1MIEH 4HXBL 1S9WB 4O51B 3BGAA 2JJTC 1OTSD 3VWJD 2H32A 1D5BA 3FONB 3K7UA 1SJHA 1CG9A 1T04B 1AO7E 1L9NA 1OF2A 2WBJA 1NMAH 1LNUB 1TTUA 2E6PA 3RWGA 3VH8A 1S7RA 2N56A 3QO1B 12E8H 3KLSA 2VQTA 1LP9E 4WU7A 5JIPA 3RTQA 2JF1A 1K3IA 4QHLA 1FNSH 3NGBB 1TLKA 4Y16A 1LILA 5HGHA 5IG7A 4PRPB 5GZOD 2P24A 3HPJA 1KGCD 3K3QA 3NACL 2BVTA 4BH7A 3NN8B 3TZVC 4GXVH 3RGHA 4XCCH 3V6ZB 3FB7A 3QIBA 1U3HD 2Q6WB 4LLVA 1DBML 1QR1A 3T4YB 2YSSA 2VNCA 3DXAA 4QXTA 4GRLA 4UMGA 3O3AA 1ZHKA 1I1FB 2VC2L 1XGUA 4FQXA 1L7IH 4AG4H 2AEPH 2G2RA 1TDQA 5EOTA 3GSNB 2VDQH 4KKNA 4U0RB 1QP1A 4G9FA 2C7UB 3HI1B 1K8DA 3ZT6A 2VOTA 2EIDA 3HMWH 1UJTA 2QQNL 3FT3A 3RGVB 3HAEB 2YK1H 4ETYA 1DLFL 4XPBH 3OZ9L 1HILA 3V9FA 4OCRH 5TPWH 4MJ6A 1CTOA 1I1AB 1AHWC 5FM4A 4XVSH 2ZSVA 2XXCB 4PRHE 2G75A 4OM1H 5SV4A 4FNLL 4JY4A 4JO1L 5F1IA 5E8NA 1JPTH 1DEEA 4NUGH 1U8HA 5F89A 2GT9A 4P46B 2IH3B 4RDQF 1BGXL 3Q3GA 3TJHC 3G04A 1XCQB 1ZT1A 1FZJB 1BFOB 4Z0BH 4YDKH 1EEZB 3GZKA 5C0EB 2OXHA 1QLRB 1RMFH 2JLLA 1UYWL 2BVEA 5HVFB 3LEXB 3QEHA 15C8H 1Y6KR 4C4KT 3PUCA 1PX4A 2FJHB 3HNSH 4K71B 1MWAH 1IQDA 4LVEA 1EBPA 1LO4H 3L5WB 1SEBA 4M7JH 1MCRA 1UM6L 3EDDA 2X9XA 4MHHG 5ID0B 4I0KA 1UWGL 5IEHA 3FKUS 4NN7C 5JHLL 2G5BB 4KKCC 5FO7B 1RZGA 5D6DC 5AEAA 1T6WA 2DDQH 2CUMA 2LU7A 3WKMH 3HE6C 4AENB 4NKIH 4P2RA 3MLYH 4PB0H 3MNVB 2MKWA 3I2CL 2BY0A 4RA3A 4YHPA 5KJRH 3VFGL 1P7HL 3VFVB 3SCMB 1CI5A 4L4TE 3LEVH 2DM4A 5MERB 3GMLA 4HIHA 3WFEL 4PJXF 2EKJA 2OTUA 3INUL 4UB0H 3KYMA 4D3CL 5H8DA 4LARH 4JN2B 3LKSA 2XA3A 1CT8B 1MRDL 3RNKA 5HY9B 2BCKB 2LV4A 1NDGB 4FQQB 1P4LA 1R3JA 2NY7H 4YK4B 1LO2L 3BEVB 3M17B 1JYWA 3L5JA 2IQ9L 2PR4H 1HH9B 2VH5H 4GW1A 2ZSWA 4C56E 2ESVE 3SQOL 1H3XA 4OF0A 5HGBA 4R3SB 3LQMA 3TYFA 3NCYS 3PHQA 1FL3B 5D5MB 5E9DA 2X05A 1UB6A 4JKPL 1ETZA 5C0BD 1EZVX 3G6JB 1X6LA 4K23H 2FCBA 4PJ8B 5LGHH 3SO5A 1B0RA 3WJLC 5DHYB 1ROWA 1KENL 2XFXB 3LZFH 4JGUA 1U92A 3L95B 3VG9C 5HDQL 3F12B 4FFYH 4NNXB 1UH2A 1QYGH 2AS5M 4J3UA 1X5YA 4P57A 2X4OB 4K9EL 3MV8E 1XAUA 3RBSA 1NCBL 3WXWH 2RJMA 1DQJA 1IKNC 4UV7H 4Y4FA 2VRAA 4KRNA 4LPYA 3BN9D 5FM5O 3FO0H 1MREL 3WN5B 4KDTC 4IMKA 3M07A 5FK9B 4O5LL 5L9DL 1A1NA 5IFAH 3P2TA 3EOBB 1U93B 3BP4A 1TZIA 3RA7H 5KS9A 4CU6A 1IAOA 4NCC2 1B88A 3VXTA 1BEYH 1DP0A 4JCMA 1SYVA 4WW2F 1LO0L 2P43B 1LK3H 2VDOH 3H3BC 3TJEL 2BHZA 1AO7D 3QUKB 3QQ9D 4PY8J 2WWMD 4JVUA 3U36B 1MLCA 1G7MA 4M1CC 3MRCA 1VCAA 1RZFL 2FIKA 1A6WH 2IH1A 5T5FL 4K94C 5I1EL 4GS7B 1FZKB 4BYHA 3EJZC 4RRPG 4WDIA 4N0UE 1S9XB 1DUYB 3LH2L 2OTWA 4Z7UB 4C83A 4JQIH 1JPSL 2IQAB 3C87A 1CF8H 3FO1B 4UIMA 1I85A 1HHIB 3QHFL 3P4LA 1TVBA 4ODTH 1T03L 4MCYB 2BZDA 1QBLH 1K8IB 2RR3A 3MA7A 1PKQE 2XTJB 3UX9B 3OJ2C 5EUOE 3CVIL 5DJ6A 5D7JC 3KJ6L 3MRIB 2V2TB 5EPMB 3BRDA 2DL2A 3HMXL 1YEFH 4YIQB 5JA8B 3CDYA 4PV8B 4Z77A 5C0GA 2QSTA 4FS0A 3MUZ1 5GRUL 4PRHD 1MCQA 5DRWB 1AFVH 1OP3H 2HN7A 3MOBL 4NC0B 4M7ZC 5DHVA 2HH0H 4IDJL 4MA7H 5I1LA 2QQLH 4KTEH 2BOCA 4KJPD 3GO1L 2NY4D 1RU9L 4F37K 1EBAA 1KJ2A 4BSWA 1OTTD 1UC6A 4OGYL 4H1LA 5KANI 4MVBC 5EOQL 1NSNL 1OGAA 3IDYC 2CO6B 3FCTB 3JWOH 1F6AA 2P7TB 2XACC 4ZDHA 3CU1A 3MJ7B 4O2FB 1HXYB 2H41A 5F1OB 2CPCA 4Y89A 4BJLA 4NQCA 1KC5H 2Y7QA 1I9JL 5H2BB 3HNTL 4JHZA 4D94A 1FRGH 2NY5L 1RZ7H 1LP9A 1IQWL 3LDBC 3MR9B 2AJVL 3AREB 2N4IA 5D1XA 2KQNA 4F7PB 5E2TL 4NYLB 4J8RA 4OD2A 1H3UA 1N6VA 4QT5B 4CMMA 1N2RA 5DURD 3H6JA 1JHLH 2CKBH 4L4TD 1OM3L 1Q0XH 1RIHL 3EGSA 4D9RE 3QXWA 4YGVA 2DD8H 5FCUH 2I07A 1ZS8A 4ORGB 2E7BA 1P9MA 4LPVA 3OKEA 5DO2D 1FSKB 2VKXA 1DLHB 3TZVB 3GUTA 2QSCL 4RCAA 1JGUH 3UZVB 1BFVL 1YMMB 1FO0A 4LSTL 4DCQB 4ZUSA 3HUJB 3IDJA 4CMHC 5HYSA 4NQTA 5EOCL 1EGJH 3RZWA 3ZDXF 5I18L 4C56D 2ESVD 3WJJC 2XN9E 2DTSA 5T3ZE 1VPOL 2F8XC 1B2WH 4ZNEE 4WFED 1CK0H 4HEME 5KVEL 1Q94A 4Q9RH 2Z8RA 3UROR 5I30L 4S2SB 3SGEH 4HK0A 5AG9A 3G6AA 4LFHG 4NZJA 1CWVA 4APQC 1TZHA 3MV9E 4IJ3C 4OI9A 2HVJA 3HC3L 1FGVH 3QXTA 1IGFL 1GCFA 1T0NB 3DV6B 3PWJA 3F7QA 4NKDA 5M94B 1IC1A 3G5ZA 2VZUA 4DVBB 5EN2A 1KEGH 1HKFA 5J3HD 4Z0XA 3MV8D 1JHKL 3JTTA 1FYTD 1V7MH 4R4BA 2Q87A 1NDMA 2ICWA 2ITDB 4HJGA 5LGKA 4AEHH 1KIQB 3QAZB 2YC1A 4R2GC 3VRJA 4HLZH 3S34L 4OSUH 2X42A 4XP5L 4YXLL 1TVHB 2R1XB 5I15H 2ZPKH 4MD5A 1TZGL 2AXGB 3AY4C 4KV5F 2L4OA 1JFQH 5KVDH 4UT9L 2BFVH 3SDAA 1FC1A 5H35A 5JQ6L 5K33A 2XNAB 5BCAA 1RJLB 5FF6B 3C9NB 3X3FH 3Q1SL 3FQWA 1MOEA 4NO3A 1RUPH 1U8LA 3QDJB 4YHLH 3SO3C 2B4CH 3IFOB 3PWNB 4CUCA 2P46B 5HHME 5CEZH 4I9WE 4KAQL 1GGIH 1L6XA 1YYML 2XQBL 1CFBA 4TSAH 1TTGA 2FWOB 4OQTA 1KCKA 2BVUA 4G7YH 1JYXA 1Z9SA 3HE6B 4LSPH 3T77A 5T3XD 3GSOB 4TPRH 3EYSH 4U49A 1CBVL 2V7NB 2D31A 3MLZH 4I0PB 1T6VN 5DYOB 1ACZA 4LNRA 3CLEH 3QXAA 4PTTB 2VDLL 2J88L 4C56A 2ESVA 3BKCH 3LHPH 3ME0A 1N64H 5FB8A 4YO0A 2Y23A 3BWAA 1JNNH 5D6CA 1LWRA 1QSVA 1T5XB 3QCUH 3QQNA 3ILPB 3PIQA 3DVIA 3FMGL 1WV7T 4PJDF 1BP3B 1KG0A 1OPGH 1SEQH 3O6FC 3WXVL 4X9IA 3C5JB 2FYYA 4DN3L 1MFEH 4POUB 1Y18A 3OR6B 3TFKC 4JFPB 2VLKE 1FVCA 1T2QL 3QA3B 1ZANH 1ZAGA 4M1DL 3MV8A 4LSRH 5DFTA 3S5LG 5HHQA 3TO4D 4P9HC 1M05B 4Q58C 2BDNH 4TQEH 2AQ1A 3NAAL 2NNAB 3S4SA 4Y5XC 3VXRE 4JO2H 3VG9B 3DUUA 2EO9A 4YPGA 3O6ML 5DD3L 4ODSH 1FVEB 1VKXA 3AM8C 3ARGC 1REIA 4RIRA 3RY4A 1WEJH 1BBJA 4JO4H 4NO0D 3Q5OA 2AABL 2BXYA 1WC7A 1RSFA 1JPST 5J1SC 5BO1L 1F4XH 2YKLH 5FYJD 4KU1A 3TNMB 5GS2H 5IB4B 3L3GA 1JWUA 3V52H 3ARPA 2NXZD 4NP4L 1C7TA 1N7MH 2H8PA 3WIFB 4QTIH 3O2DH 5GRJL 2IAMD 2D03L 4M5YH 5FA4B 4P2YA 5KAQF 5DQJB 1WCQA 5KVFH 5E70A 4GXUN 1FE8H 5AZ2L 3EYUH 1FYHB 5BQ7B 4P2OC 3FTGA 5GSVA 4JFEB 1M6OA 2V2XB 4N0UA 1RV6X 1LK2A 3NIDF 1G7IB 3P4NA 1NCCH 4ODVL 5C2UB 1MFBL 4LBEA 4PJCF 3RZCD 3DGGB 4Z7VF 1F3DJ 2LAGB 5HI4C 3NCFB 1EVTC 4U33A 5F7DA 3P9MA 2ZG1A 3L3HA 1ODAA 2OQJA 4PJ9C 4LDOB 3MO1B 3ULSB 4OD1H 1TFHA 4FMKA 5E6ZA 4CNIB 5ID1A 4MNQE 5J13B 1TJIH 1HDMA 4WFHE 5EUOA 4LPTA 1HQ4B 5CLTA 2R1YA 1NJ9B 1MCKA 1WWWX 4U6VL 4ZFOA 3FQNA 1UXSA 2AKRB 2OI9C 5DZOA 4DGVH 5T3ZD 1JZ4A 1NAMA 3Q5YA 1K4DA 2ADFH 1DBJL 5C71A 2YWYA 3KPNA 1KXVC 5D7JB 4K94H 4FG6C 4Z7WB 2H1PH 3R8BB 1K3ZA 1CGSL 1U9KA 2YN3A 4ZPTB 2AGJL 5F3BB 2H2SD 5HHVH 1ZHNB 1XIWD 1YNTA 2ADGA 1NL0L 3QNXB 2P5EB 3QUYC 1HZHL 1YEGH 4UILL 5EU7C 5JR1H 2BNQB 1CQYA 1GL4B 1Q0YL 4OGXH 5DRXA 4P99A 4UIKL 2DWEB 4M7ZB 4YBQD 5JDJA 2MQ0A 3GGWA 1DQDH 1ZHLB 4PJEB 1WBZA 3CFKA 4K3GA 5DC9B 43C9A 2PXYC 4KUZH 4M4RA 4OZFH 1P2CB 3C8HA 1FNSL 2IAMA 4ETQB 4YNYA 3IDYB 3JZ7A 4K3EL 5EORL 4KDWA 4NSKA 3VFNB 5AZEH 2R23B 4G7VL 1A1MB 2OYPA 2WLYA 1MI5B 2X41A 3SKJL 1QG3A 4JKLA 1T66D 3IDXH 3THML 3HRZA 1DE4A 3PNWB 2AEQH 2OL3A 3IXAA 5IHLB 1IC4H 3MXVL 2FBJH 3FHAA 3GJEA 1M71B 3KJ4C 5HHMD 1ZLWK 3E0GA 4I9WD 1IARB 1OP3K 3DURB 3U1SH 3LDBB 4NDMB 2VZ3A 4TUOA 1OARL 4TSBL 4X7DC 4HG4K 3WFBH 5CBEB 4KROC 5KZCD 4LEOB 4NBZB 2HRLA 2OJZH 4MA3A 1MCLA 4OTXH 4IOIA 3RWEB 2APFA 1DSFH 2YEZB 1MRCH 5E08L 2XY1A 1HK6A 5AUMA 4FFVC 3ZDXE 1JRHL 2V7HA 3KPQB 5T1DL 1CXEA 4JDZB 3KPRA 4X4MA 1KOAA 2VQ1A 3K4AA 4FFWC 4XH2B 2XN9A 3QWQB 3BD3A 5I1AB 4HKXB 2DYPB 4ZNEA 3GMRA 3U0WL 1RULL 3CH1A 3B9KC 4ZXBB 2F58H 3SPVA 4CMHB 3VFSB 2JCCF 3MV9A 5IESH 4HPOH 4WGWB 3L7EB 3K8MA 4MAUL 3SOBL 3TT1H 3K2UL 4DW2L 1GHFL 5D7SH 4BSJA 3MCKA 4XRCA 5T1LA 5K9QI 4LHUA 2YPKB 1CFVL 4GW4B 3C60C 1FLRH 1JRHI 2VLKD 4UBDC 3BZEB 1YEDB 4G43A 3ZHLA 2W38A 4PJBE 1OCWL 4ZSOE 1U8OA 2MCG1 4MHHI 2Q8AH 3IJHB 4X6EA 4APQB 3ARDA 2Z4QA 5CP7A 1QTYT 4P3DB 1RZ8B 4IJ3B 5K59F 3CXDL 3TH2T 4KV5E 3ULUH 4Y88A 1KB5A 1VFMA 4OCYL 4XB7A 3WE6B 1UQSA 1I8LA 3IJYB 2L0DA 3NZHH 1IC7H 4M6NL 5C86A 1J11A 5J11C 3QRFM 3ET9F 1HEZB 4R2GB 3BUYA 3IFNH 3K81A 3Q48A 2JIXB 4BZ1L 1A7NH 1T1WB 3BX7C 3HPLA 3KWWA 1N5YH 2HJLA 3HE7D 4JFYA 1I8KB 2R9HD 2ZCLH 5F1KC 1OLLA 1JNHB 5E5MB 3EHBC 4OLUH 2WZPD 3VXOB 4LVOC 4P2QD 4R0LC 4YHKL 2DLTA 2IALB 4OCNC 4GOSA 1ED3B 4XNXH 3QXVA 3RRQA 4HH9B 4DGIL 4Y2DA 3B5HA 3SO3B 1D6EA 1XGYL 3ARZA 1JZ2A 2F54B 2A0LD 4C54A 2IBGA 1JGEA 4LSUL 5BJTA 1YEKL 3EJYC 4MXVF 3G08A 3LSOA 5EBMB 3GMMA 2I60H 2E8ZA 1KTDA 1CS6A 1W72H 3TH3T 2F19L 1AE6L 4J1UB 1VEMA 5FGCE 1OWWA 2EDFA 4PJDE 4YBLC 4G3YL 5GHWH 4PJ7F 2C1OB 3B9VA 2X4PB 2IJ0C 4U1MA 4JFOB 3S96A 4XZUB 4MNQD 4ONHA 3WUWG 1CDIA 5CJXC 2VXSL 3T3MF 4DUVA 1LEIA 3QIWA 4G5ZL 1EAPA 3O3UN 1ZA3A 3LS5H 2R56H 3OX8B 5C08B 2VL5A 2CJUH 4F7EA 3RWFA 2VLKA 1KJVA 2DQIH 4G8IA 1DQMH 4JR9L 2EE2A 4W6YB 1LEKB 2WUCL 4Y5YA 1KCLA 1F02I 3O6FB 1HWGB 2NX5E 5ALCH 4BZ2L 4ZAKA 1SY6A 4LLQB 1ONQB 4MNHB 3ZHKA 1YC8A 1T7ZA 2GJZA 3MRKA 3VXRA 1K6QL 4MX7B 2GJ6B 3STLA 3H9HA 5FECA 1P7KA 3KNBB 4M8QB 1MLBB 1IKFH 4NUJB 3BPNC 2F5BL 3ZKND 3MJ8A 1DJSA 3DETD 3QH3A 1Q1JH 2IANA 3FO2B 3IETA 4HZLA 4F37F 5C0DB 3L3JA 1G7JB 4UQ2B 4Y5XB 1DDHA 4KJQC 4MDIB 2A9MH 4LVNC 3OGCB 2IADB 4BFIA 3EAKA 1VADB 3HE7A 4J4PD 4X7TB 5DI8B 3ARGB 5HI3D 3FN3A 4D9LL 5EU6E 5L0QC 3BZFB 5HHPB 5DUML 5EWIL 3PWPD 3UZEA 1IM9D 1ADQA 5HJ3B 5C0RL 3DSFH 3HFMH 1S3KL 4LIQE 4XHJD 4TULH 4M7LL 1JGVH 4H88H 3NIDE 3MRBB 4UNVA 1I85C 4KKLD 3KYAA 1WBYA 2WNGA 2D7NA 1JJUA 3KLAB 3MOAH 4PJCE 4E9LA 2YPVH 4Z7VE 1BM3H 1QSEB 1C1EL 2X4SA 4P9HH 4U6XA 1RK1A 1E0OB 4DGYL 3HC4H 1PGRB 3ZE1F 2V5SA 2B1HL 2HLFD 2AJZB 5FUOH 3FT4A 3V5HA 1BZ9B 3VW3H 1U91A 4XNUH 1U8QB 2NZ9C 4YFLI 4NM8L 3O4LB 4M8VA 4MNQA 3LKRA 5MEPA 3WFHA 5MENB 5CWSA 2LU4A 5GGVL 3MRQB 1WCBA 1ACYH 2VDML 2FZ3A 2A74A 1UT9A 2HRPL 1A9BA 4JJ5A 3MRGB 3C5SA 1S8DB 5I8KH 4PJ9B 4L1DA 1QFWL 5IJVB 4PR5B 2A1WH 4XTRC 4IBLT 1FJ1B 5EU5A 5CCKH 4GO6B 1R3IL 3O3EA 3R1GH 4XVJH 3UAJD 5GS0L 2HG5A 2YD9A 5IGXH 4OI7A 1TVDA 2ZOKA 1A6ZB 1VGEH 2OI9B 2V2WA 3GI8L 3IDNA 4LPUA 1JWMA 1IEAB 5IKCA 5KSVB 5E8EA 1Q9LB 4FQLL 1B0WA 5HPOA 1R3HA 4XXCC 3IAPA 1G7LA 1GGBH 1EFXA 2CLRB 4IIQC 1X44A 4KTDL 1SBBA 4HT1H 1E6OH 5B21A 3U4BH 4W68A 5I1DA 2Z93B 2DQEH 1QFWI 2EYTA 4AEIL 5E1HB 5EU4A 1PBYA 2FEDD 3EZJB 2I26N 3V0VA 2FHFA 3QUYB 4YHZL 3PL6C 4R7NA 5HDLA 4Y5VC 4EZMA 5C0FA 4X6DB 1IM9A 3OHXB 3PV6B 2CGRH 3RDTB 1ZVSA 1R24B 1EXUB 2DKUA 2BSSA 5I1HL 1JHLL 2CKBL 4HKJB 4OKDA 4IRSA 3VE0B 2PXYB 3U4AA 2VLMD 3O41A 2VISB 1C5BL 1Q9KA 2WIIA 4S1SH 3UO1H 4YHYB 3QDGE 4G8FB 4P9ML 4WJ5A 5IFHH 3HR5B 4HUNB 1A4JA 2AEWA 5D70H 5B8CA 1QR4A 3RVWC 3CK0H 4EN3D 1U58A 3PHOA 4W4OC 3CSYA 5DJZA 1MFAH 1MIML 4KK9D 7FABH 3QJHB 3A6BH 3QCVL 4PFEA 4GRMB 4OGAD 2D4DA 2AV1B 3B3IB 2UWEB 4Z7OF 25C8H 2BP3A 1LO5A 5T1MA 1Z9OA 5D8JH 2GSIB 3FJTA 5D2NC 2BVYA 1MJ7L 5DTFA 5TQ0L 3V4PL 4R90H 4NCDA 5DJ2A 4ODHL 1YMHA 1DBAH 2JCCE 4LLMB 4UDTA 5FV2A 5ISZE 4NM4H 1KNOB 3GJFH 3QWRA 4U1GC 3GMPA 5HHXH 3RVTC 4H8WC 1RHFA 2A77L 2J1KA 3NIGF 3PWVA 2B0SL 1OAQH 5DUBB 2HT4D 4NHCL 4NPYA 1I9RH 3BXNA 3FN0H 5A3ID 4XVTL 3KLHC 5F7WC 4LEXL 4K7PL 4PJBA 3DBXB 4WRLA 5DJCA 2Y5TA 3BYYA 3VH8G 1NEUA 5K59E 1T7WA 4I18C 4UTBL 5C8JB 3ULVL 1P7QD 2NX5D 3OAUL 3W39A 2WAHA 4HWZB 1N59A 4LU5L 3HCVB 1X9QA 4M43L 1JFQL 3TV3H 2K7PA 2R1WB 1J0HA 4JPWL 4LMQI 1L6ZA 4MS8D 3DUSA 4JLRA 4WEBL 3C60B 3TH4T 4KKAC 4L3EE 1TMCB 3A6CH 3QIUB 4O58L 3GSRA 3BH9B 4KJWC 3UMTA 4HG4J 1FFQA 4N0FB 4QRTB 2NR6C 1AC6A 4JKMA 2PO6A 4IHOA 4N8VG 4P0DA 1B6UA 4UTAL 4JKKA 4LSSH 4FA8A 1PG7W 4FZ8H 4JY5H 1SJXA 2XG5A 3DI3B 1CDGA 3MGOA 1K4CA 1MAKA 4D8PA 1I7TA 1U8KB 1X5XA 3B8YA 4Q6IA 4BH8B 4EN3A 5CJQL 3U9PH 5EU6D 1EUUA 4NJ9L 5J11B 1A7BA 2MSPA 2OR7A 5CJOL 3LS4L 3SDXA 3E8UH 1JHTB 1URLA 1IT9L 1JI2A 5GRVK 1HI6B 1T7VA 3RWJB 2C3VB 3S88L 4JRXD 1GYAA 3STZA 3NCYP 2LFGA 4N0YH 4NQXA 5IW1A 3A6OA 1I8MB 5KSAC 2YA0A 3NCEB 5IVOA 4Y1AA 3V5DA 4RFEB 4LVOB 1AI1L 3B2UD 1X7QB 4PLJC 3W2DH 4R0LB 3X13B 3VXUA 1JN6A 3DV4A 3IJSA 4J3SA 3P73B 3RWDB 4NGHL 1UA6H 4PJDA 2Z0BA 1P6FA 4PJ7E 3QUXA 4YQXL 1C08A 1YEHL 4M3KB 1I7ZA 3T3ME 1HH6A 1JBJA 2Z31D 4QY8B 5HHOA 2R15A 4PD4K 5HXMA 1NAKH 2GY5A 5D5MF 4MGXA 4NNYA 2VR4A 5JXEA 4WO4A 5BZDB 5ILTL 3H7BB 2EDKA 1C8PA 3UC0L 4LCWE 2NY6B 1JGLH 5FV1L 4MJIB 2PN5A 4HJ0D 5IR1A 1IC5L 3CVHA 1JI1A 4XWOC 2XKSA 2GAZA 5CINH 1INDL 3C09B 3Q6FB 4RWYL 2QV2A 4ALAH 1INQB 1UZ8A 5DMGC 1OP5H 1ORSA 4ZYKB 4M7LT 1JTPA 4R8WL 5L8KB 3GMNA 4S11A 1JK8B 2B2XH 4LCIH 5L2KB 3EOAB 2CRIA 2BVPA 5IW3A 3GK8H 2A73B 1JF1A 1D6VH 4JM2C 3TWCL 5F8RC 2DJUA 3DMMB 3O3DB 3U2SB 2GK2A 4OLYL 1N7ML 2VUYA 4OLEA 1ITCA 1FQ9C 3NA4A 4CRPA 2PW1B 2VITB 4XNQA 4LKXB 4P2CG 4NWUH 2AJUH 1QBAA 2E7LA 5HGAB 4L1HA 4RAUB 3MX0A 5I74C 3BP6B 4NQEE 4JRYE 5DJ8A 5IBLC 4GKNA 4QRPB 4JG1H 4WWKA 2OP4L 5TE6H 1PQZA 1VFAB 5IVXB 1OAXL 4LVNB 5FKAA 4M9PA 3QXDB 2Z8SA 3H0TA 4DKEH 2E9IA 1MCJA 1R5WA 3SGKA 3VG0L 3WNLA 3O6KH 3QDGD 4EDXA 5GJSH 1W0WA 5L8LB 4KY1H 2DKMA 5L0QB 3GBLA 2VJXA 3MRFA 2OJEA 4Z7VA 4NQSA 3TVMC 4PP1D 1PZ5A 3ZE1E 5LQBL 1P4IL 5D1QA 2ICEA 2W9EH 4OM0H 3ARSA 3PWLA 3MACL 3CFEA 4OFKA 4UDUA 4ZFGH 4HF5L 3IDMA 5A16A 2AK4E 4FQJH 3FHQA 1EERB 2H6PB 4DK3A 1FFRA 3U6RB 1GC1H 1A7PH 4X7FC 3TN0A 3QNYA 3SDCD 2GEEA 3G5XB 4RQQB 3ARRA 4OAWB 4O9HL 2P42B 3IDIB 2J8UB 2Q76B 4MAYC 4OZGB 5AWNL 5JNYB 5CBAB 4XMLH 5F3HB 1T20B 3D0VA 1D5ZA 1MHHB 1V8HA 4TYUA 5TQ2H 5IVNA 3X3GH 4KVNH 3VGDA 1YYLH 5ISZD 1I8IB 3WS3A 4ELKB 1IZKA 4ZTOH 4WFGD 3SGDI 3ZDZF 3BIKB 4NRXA 1CR9L 1CYGA 3U0TA 3GIVA 3GSXA 2C1PB 2DQFB 3NFSH 3R8QA 4HUVA 4NQDB 1AY1L 2KZWA 3GSUA 1BF8A 3FB6A 1J05A 1CFNB 4OJFH 2FRGP 3IKCB 2AXHA 3GNMH 4QRRB 4LLUB 2EEDA 1NCWL 2VLLA 5ICZB 5TDOB 1IAKA 1OLZA 3BHBB 4YPJA 1KTLB 2EYRA 5IM7B 5GISL 3FRUA 3N9GH 4LSVH 4JEGB 3D85D 4L3ED 1E28B 4GRWB 1FPTH 3V6FB 5ICYB 3VXSD 5KTEH 5DHVH 4HX1B 2A83B 5IF0B 3EOTL 5HYQB 3O4OC 1JL8A 1KN2H 1M7IA 1NEZG 3W9DB 2UZIH 1S7VA 2ICES 5IMMA 2Z91B 3O2WH 1KJ2H 4WFFE 1YN6A 5DGRA 1MPAH 3QDGA 5CSZB 1FNEA 3PL6B 5T5NF 1RZIB 3KVQA 4Y5VB 4E41A 2N7AA 2DQCH 4EI5B 3A0OA 1OOAA 4HMCA 4U6TA 1A9EB 5H37H 4X4YA 5I16A 1TITA 2C4FU 4RNRA 2A6JB 5ACZA 3NFPA 3OKMB 1TQCC 4HUXA 1X5FA 4KK8C 5CJ5A 2APTA 5FO9B 1WFNA 2K3TA 3UJJH 4Z7OE 2GUOA 1CLOL 1Z6JT 2QEJA 3MRNB 3OKYA 4P3WA 4XPAH 4I48A 5AYUH 5D1ZA 2EIZA 4TN9A 4L9LA 3BT2L 3D2UA 3T1WA 5D9SA 3B83A 1Z5LA 2F58L 1I7UB 3VFMA 3CDCA 2CRYA 3GHBH 1D5MA 1DN0A 1X4ZA 1B4JL 3ARBA 3HUJF 4JE4B 1P4BH 5FYLH 2MQ3A 1CICA 5F96L 3D3VB 2JCCA 4H1LG 5L88L 1WZ1H 5DC0A 5JIHA 3GSWA 4JM4L 3HB3C 1ZSDB 1QBMH 5KW9H 4KZDH 5L2JB 2BVQB 1R3KB 1EEYB 1XEDA 3MRRB 4S1DC 4P5KB 4CVZA 4GMSH 3MRHA 5DEGA 4K7FB 1QRNB 3ARDC 4HZAA 4D0BB 2BNRE 4NZRL 3B6SA 1F90H 4OIBA 4OF7A 4KH2A 4DN4L 5LGJB 4N5UA 4PY7A 4PRAA 4HGWB 4LCWD 5E7BA 5E99H 4IS6A 3DOSA 3MOQA 1AD0A 5EBWB 3O0RL 2W65A 4UT7H 5C0NC 3I9GL 3LRGA 2YD3A 3WS6C 2H3NB 1KPRB 3RWHA 3FQUA 3O2VH 1MAML 5I1JH 4WV1A 1N0XL 4OLXH 3GBNL 1NUNB 2RIKA 5CD5D 4XCYB 3WIHA 1EMTL 3SJVB 2QLVB 5L7XL 2WSKA 3MRJA 1ZMYA 1CD1A 4LSQH 3F7VA 4JDTH 1G7HA 5JORB 1FL6A 4CN4A 1LVEA 4XVUC 4NO2B 3L3OB 4ZPVB 4H8WH 3GJFK 4WU5A 5I19L 1DQLH 4QRQB 1N8ZA 3H9SB 3VA2C 3KYNA 3HRPA 1G6VK 2OR9L 3FOLA 3PP3H 4OLVH 4AQ1B 1XR9B 3EDFA 2C4FT 1KBGL 5HGGS 5AD0A 1HHKA 2FGWH 4K8RL 5BVPL 1A6TA 5CZVH 1QO3A 1U3ZA 1UJ3B 1R5VB 2VXVH 2OLDA 4MXQD 4D2NA 4K8RC 4W70A 1CDCA 2J3SA 1YNLH 1J7VR 1J1PL 5C70A 3RUGB 4ZFZA 4X6CB 4FRWA 2R4RH 4MD0B 2GHWB 1JWSB 1V3MA 5DJXB 4PJ7A 4RAVA 3UTTD 4E5XA 3O9WA 3KHQA 2AK4D 4EIGB 1WUNT 5BW7A 5KSAB 4GJTB 3EYOB 2VTFA 4OQTH 5D5ME 2E27H 1ZGLB 1KJ3H 1EHLL 4HAFA 5J56B 3RAJH 5ESQB 1ZGLM 4JZNA 2R0KH 1W0VB 1QQDA 4K2UL 5D2LF 4B7IA 5EU3A 2DAVA 4LCWA 3HR6A 1HIMH 2VXQL 2W9DH 1PG7L 3OKNB 2BHYA 1CZ8L 3CFJA 5IP4A 3CCHA 4MQ7B 5F70A 1AKJB 2FB4H 3IYLW 3L3DB 8CGTA 3QUML 5E8OB 6FABH 1KCVH 3GMOA 4NN5C 3MUGA 2VIRA 3LV3B 1DL7L 2EH8H 5MI0C 5E00A 5FGSA 3ZYOA 3FFCD 1GGTA 2O5XH 3MNWB 2NW2A 4N8CL 1AC0A 2ENYA 3CPLB 1H5BC 1FH5H 1YEJH 5A2JH 3UJTH 4FMFA 4Y4KC 2CIIA 1D9KC 1G0XA 1S7XB 3FQTA 3MMEA 5FA3B 4M6MH 5IW6B 5BS0B 2DBJA 4U6HB 3QULA 4QHKI 4NQEA 1F4HA 4JRYA 1DBBL 4XNMB 5CEYB 2DM7A 3S36H 4WUKL 1VDGA 3QUZC 2HP4A 4WFFD 3BGFB 5E8PB 5TE4L 3PDOA 1RK0B 5EO0B 5CIPB 1A6VH 4MJ4A 1WAAA 5I74B 3G5YA 1PJ9A 1YA5A 4NRYA 1H0DA 3MFFB 4PD4J 1NBYB 5E94B 2Q20A 4DFHA 4GMTH 2ARJB 4HS3B 5GGSB 2AJSL 1OP5K 2BXZA 4MDJA 2AK4A 5IMLB 3DLQR 3BN3B 4KTYA 4YDJA 2X4NB 4M48H 2VYRE 3M45A 4P4RB 3SE4A 4LAQH 4G8GD 2HVKB 3TVMB 5F88B 5GSRB 1EA9C 4HWBL 3FB5B 1H3PH 4QCIB 4IEFB 3L9RA 2I5YH 4NNPH 4O00A 1NGQH 3X11A 1I1CA 5DK2B 2XWBA 1EK3A 3AS2A 2A38A 8FABA 4XVJL 4Q2ZB 2CK0H 3S4SG 4O2CA 3L5IA 1VGEL 3FT2B 3HZMB 1EIBA 2R69L 4GAJL 3AAZA 3PQYA 1MF2H 3ZSSA 3ZDZE 4MQSB 2VDKH 2V9RA 3QDAA 2KUTA 3DROB 3ZDYF 3SDDC 3BWUC 3EYFB 4MAYB 2BNRD 4ODUB 4KZEL 3WSQL 4EI6B 4HT1L 1GZPB 3Q0HA 1AXTL 1LE5B 2LTQC 4O51A 1S9WA 4ZQKB 1EO7A 3EIFA 4JQVA 1GXEA 3UYPA 4PJ5D 3FONA 5JDSB 2EE9A 2J6EL 1T04A 1MFDL 3MTRA 4W81A 1NAMH 4HD9A 4PJEF 2P5WE 4RSVA 4DAGH 2D7TH 3BZ4B 1LNUA 4U3XA 3EYQC 2Q8BH 3RIFK 5HVHC 1G6RL 4KI1A 4EEEA 3QO1A 1BHGA 3MLWL 1FFOB 4MWFA 4PRPA 4F7TB 2APXA 2ARJQ 1BMGA 3MJ9A 3CC5B 2DQJH 4ISVB 3NN8A 2KKQA 4B7LA 1MJ8L 3TA3C 5F72S 3BESR 4EUPG 1NCDH 5H94B 2Q6WA 1J1XH 3V4UL 4FQIL 3O4OB 3T4YA 1G9ML 4HUWB 1E4WH 1WTLA 4JB9H 1FNGB 1WWBX 2VR5A 3TIEB 1I1FA 1N6QH 2XQYK 2DI9A 1OW0A 2J4WH 1KIPB 1S7TB 2V17L 3CMGA 1V3JA 1BOYA 3GSNA 3VFTA 5FOBB 5CMAB 1JIBA 1MFNA 4XP6L 2LABA 3WD5H 5EC2A 1RIUL 2V5TA 1TQCB 3HI1A 2EDWA 3HUJE 2ATPB 1XR8B 4L9DA 4Z7NF 5CEXB 5IHBA 1C5CH 4JFHD 3RGVA 2OL3H 3HAEA 1S78C 4CJ0A 4ELMF 4R7DB 1CN4A 1BOGB 4DZ8B 1I1AA 5LAXB 1DN2A 3MLUL 3IKKA 1KT2B 1ZHBA 1BAFL 2NY3C 3EDKA 2HJFB 2BNRA 3ULUF 3WLWD 2XA8H 1ZOXA 2YZ8A 4XAKD 1GIGL 5EO9B 4ZO8A 3CSBA 3CZFB 1CGTA 3F58L 3OG4B 4P46A 5DQDH 2IH3A 2H2PC 1MCPL 1E4JA 1XCQA 4XPTH 2CMRH 1FZJA 4YHMH 5FUZL 3AB0C 4ONFL 4RZCA 1U42A 5IROA 1BFOA 2DQTL 3KPSB 4BQ6A 4FQ2L 3MBED 1U6AH 2PO6C 5C0EA 3OV6A 1QLRA 5C3TA 5ALBH 5I66B 3LEXA 4PUBL 5MEQB 5I6XC 4TVPE 1V3KA 2FJHA 2EDDA 1NFKA 3IFLL 4HXAL 3L5WA 5HD8D 1NH6A 4NFCA 1X4YA 5FO7A 2W0KA 4PG2C 1CE6A 1FFNB 1T7YA 5FO8B 1OTSC 3VWJC 4U7SA 2FX9L 1E6JL 3RVVD 4AENA 1IGIL 1X5JA 4GUPB 3V0WL 3VFVA 3DX7B 1UM4L 3SCMA 1S9YB 1KPVA 2A6DB 5MERA 1NUDA 3CSGA 3MUY1 3LKPB 3LQAL 2APVA 2VLRB 4TOYH 5C6TL 1UWEH 2P44B 5C0CB 4QRSB 1CT8A 4FTVE 2RCSL 2BCKA 3U7YL 3WUWB 1NDGA 4FQQA 2GITB 2DBLL 1PX3A 2DQHL 2ITCB 3BEVA 3M17A 4J3TA 5TF1L 3T0DA 4LKCB 1HH9A 2FHBA 1KXTB 3SDYL 3DYMA 5FUCC 1QFHA 5C0AD 2XZAL 4FQCL 5CJ8A 5D93B 3DPBA 5DDHA 1U3HC 1AXSA 2DMKA 2ZJSL 3WHE1 1XF1A 3UJIL 1FL3A 1T80A 2IPTL 4BSVB 2DIJA 4WO4C 1DTUA 4GLRH 5DD5H 5D5MA 1RVFL 1ZEAH 5D7LB 1JV5B 2FHCA 5GS0D 4HPYH 4IOFD 5IK3B 5EZJB 1NLDL 4YGAB 1I7RB 5D2LE 1FGNL 3UTQB 3O11B 4J6RL 2XFXA 5I8OH 4KPHL 1RUAL 2DTML 4F57H 3L95A 1TQBC 4NJAL 2R2EB 3F12A 2YD1A 3QG7L 3RL2B 5E6IC 4NNXA 5BMFH 4M5ZH 3PP3K 2CUIA 2C3GA 2X4OA 3MROB 4G8EB 1WIPA 3IS0X 5DD1H 1EO5A 3MLSH 1NUGA 1IAIL 3L3IB 3WN5A 3QCTL 5FK9A 3EOBA 1MCNA 1P1ZB 2PF6A 1R3LB 3O3BB 3PP4L 4OV5B 1D7FA 2AJ3B 3UTZA 1Z0MA 5ESAA 2ILLA 4NN5B 2DICA 4WWKC 3NCCB 1U8IB 4LOUD 3NMEA 2GQHA 4UV4H 3FB8A 5BRZB 1H3VA 5MI0B 2P5WD 3QUKA 2JK5B 3VI3F 1CLZH 3S37H 3U36A 3W81A 1KV3A 4F9PA 2GSGB 3EO9L 3GI9H 1H5BB 4XPFH 4XAWH 2F5AH 4KY1L 2AXFB 3U7AA 3NABL 4Y4KB 1E4XL 4PYHA 1D9KB 3CXHK 4BQ8A 2W9LA 2YBRB 4JFEE 2VDRL 3MC0A 4PRIE 3TBSB 1S9XA 1DUYA 3G5VB 5F7MC 3EO1B 2AJXH 2HT2D 3PE9A 2X4TB 2IQAA 4RA0C 4N90E 4AM0B 2PYFB 3QUZB 2Q7YA 5ITFB 3BPLC 3FO1A 5C9KA 2DLGA 1HHIA 1VGKB 1YN7B 3CLFH 3U7WH 3M8OL 3E1F1 3MBXL 4MCYA 5D96C 1NGPL 4I2XB 1K8IA 4CKVX 1ADQH 1E4XI 4QF1B 5CUSL 4CN6A 2R4SH 2ZG2A 1PSKL 3H3PH 1OAZL 4KQ4H 1MFCH 3D69A 4QO1A 2AP2A 4I4WB 4LCCC 3MRIA 5EPMA 5M95B 2XZCH 5JA9A 2Y6SD 3BMVA 4X0KB 3MNZB 4YIQA 4YWGL 2NLJA 2VXUH 4UUJB 1G7PB 4PV8A 2VLJE 1RJCA 1WT5A 3ZDYE 2MCPL 2MOVA 3ULVD 4HWEL 4LLDA 5DRWA 5IBTH 3FL7A 3QDHA 4Z7WE 1CLCA 5KN5B 1PEZA 1QKZH 1DFBH 3CFDB 4UAOC 4OJFL 4G6FB 1F6FB 2ZKHL 1DBKL 4WCYH 3RWIA 2IFFL 2VE6B 5T33H 3L7FB 2BNQE 4QXGH 3BKYH 3C6LD 1FORH 3FCTA 5CEZD 3MLRH 3DHMA 2P7TA 4KUCF 4PJEE 4PGCB 1J8HE 4LGPB 3MJ7A 4O2FA 3REWB 1HXYA 1RUQL 1ZTXL 1RFDL 2ATKB 4Q0XL 1UKSA 4XC1H 3MUJA 2LTQB 1IGMH 3AS3A 4DQOL 2DLEA 2JJTA 2LVEA 3TJHD 5H2BA 3BN9C 3ZYZA 2AQ3A 1NLBH 5JUEL 3VFRA 5CJBA 4X6DF 3NA9L 3MR9A 3PV7A 4NBXB 3AREA 2JTDA 4F7PA 2E5EA 3I6KB 4NYLA 1BF2A 1XF2B 4BQBA 2O26U 4QT5A 4W4NA 5FYKH 5HVHB 3EBAA 3QI9B 1HHHB 3W9EB 1A7OH 3WO4B 4XP1H 4ZOEA 4Q7DA 1A7RH 35C8L 2XY2A 2E7HA 1AP2A 3NCMA 5HYIA 1G6RB 1VHPA 3QQ9C 3BKJH 4ORGA 1IFHH 1T0MA 4LQFL 4OT1L 4KQ3H 4MXWL 4P23D 4LCUA 5C7XL 1IBGL 4FTVD 3TZVA 3BE1H 3TA3B 2LVCA 3D18A 3ARUA 4WUUD 4Z7NE 2DLHA 4DCQA 3HUJA 2UWEF 3MV7B 4JCLA 1AQDB 4ELME 1QBML 3DVNB 2HKFL 4Z95L 4LPXA 4AT6B 3VH8B 2HLAB 5I8CB 1TJHH 4FABL 2VDNH 4HW6A 3ZHDA 1X3DA 1PY4A 5SWSE 2B1AL 3DTXB 2P24B 1EO8L 4S2SA 1FO0L 3HI6H 3MXWH 1FDLL 1BVKB 4WHDA 2PTUA 5T1KB 2FD6L 3BW9B 1FBIH 4LRIC 4GQ9L 4XP9H 1PD6A 2O93L 2NY2D 1T0NA 3DV6A 3QZWB 3I02B 4UOJA 1AHWA 4N8VB 5GS2D 4RGNC 3TEUA 1X5IA 4DVBA 4FQXB 1AQKL 2NY3B 2WW8A 1A7QL 5GXBB 2ITDA 3RX5A 2ZUTA 4G9FB 1KIQA 5C3LD 3LEYH 5ACLA 2EDLA 3PJSB 1H3GA 3PG2A 5EZIL 4JPKL 1TVHA 2R1XA 3VFPB 4Z78B 4DOHB 2AXGA 2NY4C 3AB0B 4LASL 2F53D 1UWXH 3P4MB 4V2BA 5FKPB 4XP4H 1HYSC 3VJ6B 4MJ6B 2XNAA 3C5ZC 1RJLA 3C9NA 1HXMB 3NZ8B 3QQ4B 2ORBH 5SWZB 1A22B 2FEEL 3EW3B 1UCBL 2VERN 5I6XB 2G75B 1T2XA 2HTLC 4GW5B 3IFOA 3PWNA 1MJUH 4KVCL 2R8SH 3BD4A 5F1IB 5F93C 1FC2D 2W92A 2FWOA 1HYRC 5D6DA 2JJSC 3OXSB 2GT9B 1G0DA 1AJ7L 2BNUB 3VWJB 4OLZH 1KULA 3OWEA 1I3UA 3HE6A 3P0YL 3HC0B 1RZJC 3GSOA 4F15B 2VZTA 2ZCHH 4PRID 5HYFA 2V7NA 4M1CD 5DYOA 1O5DT 3GIZL 3KXFD 4GSDL 2FBOJ 4PTTA 4Y19D 3VGFA 5LBSH 3QP3A 2FEEI 3HLAB 2HTKC 4O4YL 4OQTL 5GPRA 1IQDB 1WZKA 2E27L 1H8SA 1T5XA 1FAIH 3EJZD 1L4IA 1SBSL 3ILPA 4PREB 4NN6C 1IL1B 2R0KL 1QFUL 1ZLSL 3GMQA 3CFIC 3TPUB 1VEOA 4L8SC 3EFFB 4YHPB 3C5JA 1H3TA 3EO0B 1U3HB 2D7PA 1Z3GH 4D0DB 1X5HA 5C08E 4QGYA 3IU3B 3OR6A 1A14H 4JFPA 4NC1E 1OSPH 3QA3A 1J5OH 2VLJD 1KLUB 4OZHB 1RJZB 4OD3L 3RNKB 5D7IB 3WJLA 3OPZH 4FFZL 4WVRA 1EVUA 1BJ1H 2QKIB 3VGEA 2NNAA 2I9TA 1I9IH 5F7YC 3RI5K 2GJ6E 1FVEA 1FIEA 2R0LH 1VACB 1HKLH 3I75A 5HGBB 3GHEH 4M62L 5C2BL 1QRKA 2BNQD 4ONGL 2BRRL 4WY7H 1IKNA 5F9OL 1I1YB 4KXZI 5EZLB 5KS9F 5FDWB 4G80A 1J8HD 3VI3E 3FAXA 5J3HC 1UB6B 4LRNH 1CLYL 3BMWA 4UQ3B 1ZV5A 3WIFA 4I3RH 1KIUA 4YC2C 3CVHH 4TNVK 4DEPC 3PABB 5FA4A 1J1OL 4G6MH 5DQJA 3U82B 5SX4I 4F3FA 4ERSH 3BGMB 4RMQA 5BQ7A 5EZOL 3OXRB 4JFEA 3UYOD 2V2XA 4NCC1 1CGVA 4PRIA 5IVXF 2NPLX 3QEGH 3JWDL 1DQJB 2DOCA 1MCWM 3T2QA 3ZTNL 1QSEE 3DGGA 3ARFD 3BDYL 1TZIB 1OGTB 2JELH 3PGDB 5IMKB 5K9KB 5T3XL 3MO1A 2ICWJ 4S1RH 3ULSA 1BQUA 2RQ8A 4CNIA 4HCRH 5J4MA 5MENE 2D7QA 3TCLA 1HQ4A 5F7KC 3MLVH 1NJ9A 2YUVA 4ODWB 5EFIB 4FQ1L 1R6VA 2AKRA 3B9EA 1R0AL 3GKZA 3VXQB 3JV6B 1FNHA 2CH8A 2HFEB 4XXDB 5JW4Q 3HNVH 5D96B 4RMSA 5JQHC 4X6BA 2W60B 2J8UF 2VLJA 1RUKH 4KMTL 1F2XK 1IGYB 4GBXD 2GFBA 3V4VH 2IH1B 4U7KA 3ZKQD 3QNZB 3ULUD 5SWSD 3VMPA 5D7JA 3WLBB 1U8JB 4Z7WA 2P8LA 3T0EC 3VWKD 4LCCB 2PCPB 4ZPTA 4C83B 5F3BA 4NKMB 1ZHNA 3RL1B 4LHQB 3QNXA 2LQRA 3C8KB 3TCXA 3K1DA 1CCZA 1H8OA 2BNQA 1NEZB 1TCRB 1NAML 2DWEA 2FR4B 4ZO7A 1MCOL 5EIVA 1QLEH 1ZHLA 4JPVH 1J8HA 4PJEA 4UAOB 2HFTA 3CXHJ 1T3FA 5C0BB 5A1AA 3LD8C 1N4XH 2O5ZL 4IRZH 4UI2A 5DSCA 5DJ6B 1CGXA 1P2CA 5DVMA 5GJTL 5EU7E 4ETQA 2YUXA 4M7KH 4X6DE 3IDGB 3VFNA 2R23A 1A1MA 2KL6A 3BAEL 3HZVA 2CD0A 1MI5A 5I1CH 4DTGL 3PNWA 4P4KD 3PHSA 3K1KC 1F4WH 2HN7B 3F62A 3QFJD 3V7MA 1LO3H 5I1LB 3GB7B 3MCLH 1M71A 2DN7A 5CILH 4NZTL 2Z8VC 2J4WL 4GQPH 2XXMB 5DMYA 4U0RC 3NIFF 4NDMA 5D71H 2AK1H 4H1LB 3WDHA 5CBEA 4LEOA 4LPWA 5FCSH 4E0RB 1YEEH 1C5CL 3RWEA 4HK3N 2YEZA 2UWEE 1UM5H 4ZDHB 1AO7B 2DQGH 3WIIL 3KPQA 4CU8A 4JDZA 1EUTA 3P4OB 1QSFD 3UXFA 5I1AA 3UPRA 3RZCC 4HKXA 2DYPA 5IVZB 3OB8A 2Q86A 4RGOH 4UNUA 4BK4A 1NBVL 5B4MC 3ZSTA 5SWSA 3K8LA 4X9GA 3QEQB 3VFSA 3C2AL 5JOPE 1S7SB 3BDXA 2SEBB 3L7EA 1AIFB 4WI6A 1V7NL 3GKWL 1RAMA 4TVSa 3UYRH 5J8OA 2YPKA 5T3ZL 5F7LB 3HTLX 2I07B 4GW4A 4XCEB 1ZS8B 1YEDA 3T8XB 1WSST 4OFYA 1B3JA 4APQA 4Y8DC 3O6FD 4P3DA 1RZ8A 3IAQA 1LE9B 1FO0B 1A5FH 2WK2A 1KLFA 5F7UA 2OZ4L 1XGPB 4HLJA 2GJJA 3BUTA 1LD9B 3LOWA 1KFAH 4YHOL 1UACL 1B6DA 1XIWC 3IJYA 2YRZA 4DK6A 2GKIA 2VR9A 5GGUB 2WIMA 2R29L 1YC7A 5HDOA 1FZMB 1HEZA 4OCWH 4PRHB 2HKHL 5IQ7H 2RBLA 2JIXA 3P9WB 3QPQD 1T1WA 2Y07H 2VZOA 3AY4A 2NY4B 4TRPH 1I8KA 1KB5L 2F74B 3NFNB 4YK4C 3R0NA 1JNHA 2EH7L 3PWJB 5DA4A 4NKDB 1BQHG 1EH9A 2AJYL 2IALA 1ED3A 1AH1A 1CGYA 4HH9A 1NC2D 5KSBB 1NC4B 3JUZA 2F54A 4R4BB 1NANI 4X83A 5DHXB 1G9NC 4PP2B 3WIHH 1C5DB 3VMNA 1J0KA 4U2ZA 3CSPA 4PG9B 4MA1C 4ZUTB 4ZOAA 5EBMA 1EAJA 1VENA 3C08H 4PJ8C 3MRDA 1DUZB 4P2OD 3KS0H 3MYJB 4J1UA 1RURH 3RUGF 5LCVL 3JTSB 1Q9WB 4OCMC 1F5WA 2C1OA 2X4PA 1UWXK 4JFOA 4ODXB 2KBGA 4POZC 1MQ8A 4XZUA 1WWCA 4Q74A 2Z92B 4KRMB 5DURB 4RX4A 4L4TB 3WMSA 5I1IL 3OX8A 5C08A 4NN6B 3BI9X 4JHWL 3QDMD 4HDIB 3MLSL 1CGWA 4UINH 1CU4L 3ZKSD 3O6FA 3MA9H 4PPTA 1C7SA 3QXUA 4LLQA 1PFCA 4JFDB 3JVGC 3ROOA 2W0LA 1HCFX 2R0WL 4MNHA 5FYJU 1RZJH 4XCFL 3HG1D 4YUEL 3OGOE 2D31B 4PV9B 4N1EA 1BFTA 2GK0A 3NCJH 4LNRB 4MX7A 4WI9A 4UOW1 5HTSA 2GJ6A 3NTCL 2K9UA 1I3GL 2ESVB 5TGBB 3KNBA 1MLBA 4XGZB 4NUJA 4XPGL 3CIQA 3D87B 2X44D 4KUCD 4FG6D 3PIQB 3FO2A 5C0DA 1IEBB 1R5IB 5FDYA 1G7JA 2BJML 4UQ2A 4Y5XA 1SY6L 1KCSH 4MDIA 2XRAL 4FZEL 2AV7B 3OGCA 4R96B 1VADA 4X7TA 5DI8A 3AM8A 3ARGA 4JO3H 4M6OH 5C1MB 1YECH 2FYYB 2WBJD 2HFFB 4I77L 3BZFA 5HHPA 5DK0B 2IPKB 3TLRA 4WTZA 5DLML 4QRPE 2V5MA 1QOKA 4O02H 4JM2F 5DT1L 3VCLB 5IVXE 3TBWB 3P11L 3RTQD 1FYTB 4WW2C 3ZO0A 3MRBA 5E8DL 2YD2A 3KLAA 1KCRH 3SE8H 5AYQA 1BVLB 4DEPB 1QSEA 2X4QB 2DRUA 3S4SB 1KACB 3ALPA 1BBDH 2ZCKL 3DUUB 4OF8A 5KVGH 3QIBD 5IIEB 4KKBC 2XTJC 2ZP0T 1VKXB 2AJZA 4P2OA 5HI5D 3CMOL 1BZ9A 2R9HC 3LMJL 5IHUH 2VDPH 1U8QA 5HHNA 5HSFA 2QHRH 2BY3A 3GSQB 4MZ2A 1F58L 5CZXD 3G6DL 2XZCL 5MENA 4U1JB 1G9EA 3BQUC 3MRQA 4X4XA 2A0LC 3N06B 3BYTA 5DMIH 4KROD 2H45A 4WHTA 2J8UE 1S8DA 3L3KB 4PJ9A 5B39G 3CU7A 5IJVA 4PR5A 1QKZL 2IWGA 1FJ1A 4FP8L 1BQLL 3A67L 1NGXB 1U8PB 3BSZH 3Q5TA 4KHTL 1A6ZA 3T2NH 1LK2B 5E2UL 5DWUH 4Z7QF 2VAJA 1CFTB 4HC1H 3I50L 4AIXA 5LXGL 1IEAA 3RKDC 4OKVB 3AS0A 4ZMAT 1A3RH 1KXQE 1Q9LA 3B9KD 2B20A 1ZT7B 5ECJE 4U4BA 4UT6H 4NQDE 5F7DB 2CLRA 1NGZA 3T0EB 1OGAE 4I3SH 4ZTPH 5C09E 5MP6L 3DVGB 3KYOB 1PKQB 1YJDL 4QRRE 5CKAA 2G5RA 4XWGH 3AREC 5EUOB 4EUPB 3QUYA 1A6UL 3C60D 4NQCE 4X6DA 1E4KC 2X1WL 5DQ9A 4ZUWB 4GRWE 1R24A 3RJQB 1EXUA 1HINH 4KRPC 1LHZA 3LD8B 1J18A 4HKJA 3MLXL 3VE0A 2PXYA 2VISA 2J12B 3DETC 4RMVA 3TO4B 4G8FA 4OIIL 1FSKC 4JFXB 3KPLB 4XC3H 3NIFE 5FYLE 4P2RD 4OCSH 4PS4L 2DF3A 1YNTB 4J4PC 1YZZA 1QFPA 3GJFA 4HFUH 5JW5B 4WI7A 3STBA 1F8TH 4O2EB 4NO0B 3QJHA 4GRMA 1KCUH 2AV1A 3B3IA 2APWA 2UWEA 2H9GB 1SQ2N 3S36X 2ZOLB 3D9AH 3GFUA 4XHJC 2DKSA 3HI5H 3KPMB 2NXZB 4BUGA 2EDRA 1TJHL 4KKLC 2GSIA 1KELH 1QNZH 5JZ7C 1A3LH 1ZA6B 3OF6A 2IAMB 3X17A 2DLIA 1KTKE 3MJ9H 4N68A 3HI6L 5F6IC 4NSKB 5HBBA 1WQVT 2HLFC 3D3VE 4LLMA 4AMKL 1MHPH 2EKSB 5CKGA 3EJYD 1KNOA 5DMKB 5E9DD 5D2NE 3HA0A 4DKFL 5DUBA 4YXKH 3GRWH 3QFDA 1INEH 1GAFH 1QRNE 3RZCB 4Q9QH 4ZS7L 1ZVHA 4QTHB 5DJAB 3GSNH 3B9KA 5I1GL 3QAZC 5F1SA 3KPTA 2GTWB 3DBXA 5ADOL 5JPMB 3GM0A 5EA0H 3ALXA 5C8JA 3QQ3B 4L5FH 3HAEH 2EDTA 4HWZA 1A02N 3S35H 3HCVA 3P3YA 2BOBB 2R1WA 4JN1L 3UAJC 4OV6F 5ETUB 4JRWA 3VXMB 4Y4FD 3C60A 4Y2OA 3WL9B 1TNMA 1E27B 3QIUA 3BH9A 2NW3B 4N0FA 4QRTA 2EYSB 2MQCA 5A2LH 4PY8I 1A0QH 7CGTA 1OAYH 5ITBL 5L8JB 3RI5F 5BZWB 4JG0H 1JMXA 2G60H 5B22A 3QHZL 4JFZH 3LN9A 1U8KA 1XIWB 3F6LA 1AGDB 4OB5H 2NZIA 1MQKL 2FEDC 4L29B 3H9SE 1PLGL 4I0PC 4CBPA 1JPFB 2YMXH 4HV8B 3N85H 1CIDA 3TF7C 2A9NL 1JHTA 1Q72L 4LGRB 1W2KT 4KJQD 1HI6A 1U8OB 2YXMA 3RWJA 2C3VA 2IPUG 3LPWA 3H3KA 4OLWH 4JDVB 4TNVF 4B0MM 5INCB 3W0WE 1DQQB 1I8MA 1DANU 1HCVA 2JB5L 2DIAA 4RFEA 5IB2A 1HNGA 1X7QA 4R0LA 3X13A 3QRGL 2DQUL 4DVRH 2IGFL 5B38G 3RUGE 5FM8A 2P8MB 1ZXQA 2L7UA 3P73A 3RWDA 1F4AA 1KUMA 4F8TA 1Q9OB 5DJ0B 3DX6A 4TTGA 2NCMA 4CL7A 3V6OC 4KK9C 4PJIF 3L1OL 4GXUM 3EOYG 3LN5B 4OGAC 2FL5B 2W07A 4MA1B 4QY8A 2O5YL 4KHXH 2Y25A 3VD3A 5HHMB 3HPLB 4F58L 4PJXB 3MGTA 3P0VH 1NFDB 2H26B 4YEFA 2GY7B 9CGTA 3OJMB 5KZCB 2CR3A 2GTZA 3H7BA 5BXFB 5CFHA 4JHBA 5F7EL 3PGFL 3T1FB 4YAQB 1OAKH 1I9IL 4R26L 5TE7H 5CJXA 1K2DA 2FX7H 4N9OB 5FHAL 4EOWL 4QNPF 3Q6FA 3GHEL 4HIXH 1INQA 3KHOA 3SE9H 3UDWC 2HWZL 4YXHH 4K9EC 1D5XA 1G9NH 4A6YL 4ZYKA 3UCRA 1KEMH 4QRUB 5FOJA 5EBGA 4YE4L 1JK8A 3WNOA 1I3VA 4H5SB 3EOAA 3QPXH 1MEXH 2A73A 2D4FA 4ZG1A 3O3DA 3U2SA 1OGAD 2JB6B 3E6FB 4WI8A 2QQKH 1BQSA 4RRPA 3TYGL 4U1MB 4P3CH 5C09D 1PAMA 4HGKC 5GGQH 2XZQH 2PW1A 2VITA 4G6ML 3S96B 3HHRB 4LKXA 4J23A 4EQ3A 5E4EC 5HGAA 4NQCD 4RAUA 3MZTA 2W59A 1OAUH 4NQUA 3BP6A 2OSLB 4F7EB 4QRPA 4OCXL 3T3PF 4Q9BA 1WFOA 1VFAA 5IVXA 3P30L 4G6JL 3QXDA 4XPHL 5IT2H 4NZDA 1RZKL 4XI5D 5D1XD 3QO0A 4QXUH 2D9CA 5FYLD 5IBUG 4LF3B 1O7VA 5KOMC 5C07B 3JWNC 1D5IL 1GGUA 4S1RL 5J13C 1DANT 1P7KB 1F4YL 4WW2B 3BKML 3ZTJH 1JP5A 3SQBA 4LIQL 1DCLA 3NCBB 2MPAH 2FX8L 5E0QA 4ZS6D 2ZUYA 2H6PA 3U6RA 1JUFB 3CDGB 2J8OA 3RVWD 3SEPA 3G5XA 2X7LB 3HE7B 4OAWA 3O81A 1HOCB 5J06A 1S7WA 4TSCH 2X09A 3IDIA 2J8UA 4JAMB 2Q76A 4OZGA 4P2QB 5CBAA 5JNYA 4LCYB 1SM3L 5F3HA 3V5KB 1T20A 1MHHA 4EDWL 5HYJE 2IEPA 1SHMA 2BMKB 1U36A 3D3VD 5DRZA 5BOPA 3N0PB 2ED9A 3U0PB 5DUPL 3BQUB 3ARXA 1I8IA 1MRFH 4TUJB 4Z7QE 1ZLWH 1NMBH 4OBSA 5GQBA 3BIKA 4D0CA 1MCFA 4X5XB 4M93C 1T7XA 4X80L 1QRND 5DVLA 1RK1B 5DD0H 5F8QC 3ZL4H 5A43C 2Z31C 5IB1B 3L6FB 4GKSA 3LKQB 1EEQA 3IU4L 1F45A 2ZUUA 4XNYH 4NQDA 3V5HB 1PYWB 1CFNA 2Y06H 1U91B 1FFPB 5CGYC 1YNKL 5I1KL 5TDPA 2V5YA 3B2VL 3IKCA 5C09A 3W11D 4QRRA 5K9JH 4K3DH 4LLUA 5FGRA 3SHSA 2VL4A 4MNQB 4I1NB 5MEPB 4M1GH 5ICZA 5TDOA 1TETL 4DWHA 1KTLA 5IM7A 1CL7H 4PIRF 4XXCA 1BZ7B 3WDJA 1BJ1J 1E28A 4IIQA 1AGBA 3IF1B 2VO5A 4JREC 1GRWA 4HX1A 2A83A 4OFPA 5IF0A 4X6FB 4ZD3H 3SDAD 5HYQA 4NHUB 2GCYB 2DLFL 3D25B 2Z91A 4H20H 2NY5C 5CSZA 4YDIH 4P59L 3PL6A 5JXAL 1RZIA 3C6SB 4S1QL 4Y5VA 4HQQL 3BJLA 4X7SL 4KKAD 3GSVB 3VD5A 2ICCA 1A9EA 1J0ZA 3N1PC 1JWMB 4KK5C 1UH4A 5GGTL 2A6JA 3SN6N 4KRPB 4K3JH 3OKMA 4XBEH 3OKLB 1UM5L 1J9CT 1MH5B 5FO9A 4ZFFA 5L6YH 5EG6C 2COQA 1RUML 4OZIB 5GIRB 4OBRA 2YRPA 1S5IH 3DGCR 3RU8L 2EYTB 3W0WD 3CD4A 4ZXBC 5EU4B 4HXBH 4CDHA 3KYKL 4XMKL 4W4OA 1RIVL 1G1CA 1I7UA 3PGCB 3O6LL 2NY1C 3PWPB 4PP1C 3KPRE 1EDQA 4X4ME 1IM9B 4NWTL 5F9JB 4WENB 4URTB 4AL8L 3D3VA 5D72L 1AR1C 2OK0L 1ZSDA 1F42A 4J7RA 2OCFD 5D2NA 3TBTB 4B50A 5L2JA 2BVQA 4JHAL 3Q6GL 1R3KA 1EEYA 1SMOA 3MRRA 1X4XA 4P5KA 4PJFB 1NCAL 3MSPA 1A2YB 1A4JB 1S7QB 4K7FA 4U31A 1QRNA 2AI0L 2C3XA 4D0BA 1WZLA 5F7NC 4BA8A 5I8EB 5F6IB 5I0ZA 3SDCC 2WM0A 4U0QB 5LGJA 3NACH 2BY1A 1A5FL 2YR3A 4RMRA 4HGWA 2EEBA 5EBWA 3NPSC 4WEMB 3JV0A 1DBMH 4I5BB 6CGTA 4PJBF 2H3NA 2Q7NA 1KPRA 4RISH 1IJ9A 4K3HA 2VC2H 3G9VA 5JLZB 2P45B 3WFDL 4I18A 4ACPA 4XCYA 1YMHB 3SJVA 4XWOD 5LWYL 4HUUB 5GGRA 4CW1A 2QQNH 5DS8B 5E2WL 2WUBL 5HVWA 3WFCL 2PTTB 3D39B 1DLFH 2UVEA 2FO4B 3I6LE 5E03A 5JORA 3OZ9H 2UYLB 4ZPVA 4JZJC 4LK4A 4QRQA 4HHAB 3H9SA 4IMLB 4LP5A 1QA9B 4JM2D 1I9EA 5I71B 1YEIL 2VLRE 1VERA 4ZSOB 1WIUA 4FNLH 2CUHA 3D0LA 4PGJA 2PW2A 1XGTB 4JO1H 3RHWK 4TVPH 3BH8B 4JFFE 4V2CB 5IB5B 1BIHA 1OT2A 1UJ3A 3SDXF 1R5VA 3EFDL 3W0WA 4LQ1A 3J8F7 1N5AB 4QYOB 1BGXH 1IM3A 1N3NB 5IBLD 3VU2A 3RUGA 4X6CA 4CAGA 4MD0A 1A8JH 4N9GB 1JWSA 3U48A 4J3OC 1EJ6A 4NZUL 3BJ91 2YD7A 4HKBB 4PJIE 3TT3L 1UYWH 3L5XL 1BD2B 3KPPB 5KSAA 1J10A 3TVMD 1BX2B 3EYOA 1GGCL 3FZUC 5C0IB 5D7LE 1ZGLA 1UM6H 3QB7C 3H42L 4YDLC 1UWGH 2AEIT 3F7RA 5ESQA 4EN3B 4F7CB 5JHLH 2Y36L 4Z8FL 1FP5A 1OY3B 4WHYH 3VDCA 1HWHB 5HYJD 3CFCL 3I2CH 1X5LA 2CLVB 2DJ4A 3VFGH 1XF4B 3OKNA 3TPKA 4QNPE 5DFVD 3WFEH 5F1NB 2I9LB 4NQXB 2WMPA 5IW1B 1AKJA 4PB9L 3INUH 3L3DA 4D3CH 5E8OA 1KYOK 5D7IF 4G6KH 1FVDB 1H8NA 3LV3A 5DJYB 1MRDH 3RNQB 4HIJB 2YZ1A 1NBQA 1KN4L 3MNWA 4YX2L 1LO2H 4PJDB 5LJYH 4DUWA 2IQ9H 3CPLA 4HBQA 4R4FL 1VFBB 4Y4HC 2IANE 4ZO9A 3MODL 3UBXG 4JGJA 1S7XA 5FA3A 3N50A 5ADPL 1U95B 5IW6A 5BS0A 5IUSA 1MCEA 2XPGB 4LL9A 4U6HA 5GRYA 4A6YB 3WHE0 3T3PE 4JM2A 4K7PY 5CP3H 4XNMA 1CE1L 4JKPH 5BV7L 1UB5A 4HIIB 4FN0A 5GGRY 1BECA 1YY9C 4EJ1C 1BIIA 3SBWC 3FOMB 4LNVA 1P7QB 2NX5B 5CD5C 5IOPB 3VD9A 5E8PA 2EXWC 1RK0A 1ZK9A 3PDDA 5EO0A 5E4EB 5CIPA 1T2JA 1YQVL 5EC1B 4XMPL 5HDQH 3MFFA 1A3QA 1MNUL 5E94A 2ARJA 2MWCA 4K9EH 4HS3A 4D9RD 5GGSA 1NCBH 2OR8A 2BVPB 2VWEC 1G7QB 2J5LB 5IMLA 3DO7A 2X4NA 4MQXC 1MREH 4P4RA 2HVKA 2PTVA 3TVMA 4PGBB 5F88A 5GSRA 1UFUA 2P49B 5L9DH 2DQDL 2W91A 3FB5A 4QCIA 4I2XE 1XCTA 3O8XC 4C55A 5DK2A 5J6GB 4MXQC 5EU6B 4Q2ZA 4U2YA 5KVMC 1LO0H 3KPRD 1FIGL 4JPIB 2XN9D 4Z18A 2CDEB 3REVB 3FT2A 5HYJA 3HZMA 1QZ1A 3TJEH 1IAMA 1PQZB 2B5IB 4YEEA 4JRXB 3DROA 4AIZB 3KS0J 4PJCB 2VN7A