3JV3A

Structure of sh3e-dh unit of murine intersectin-1l
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
278
structure length
278
Chain Sequence
GSCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-1
publication title The minimal autoinhibited unit of the guanine nucleotide exchange factor intersectin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 105
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3jv3A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3jv3A01
2B86A 3I5RA 3EG1A 1FOEA 4GZUA 1NTYA 2EYZA 3EHQA 5FWCA 1JXMA 2BZ8A 3JV3A 1T3SA 1UHFA 4J9EA 1JO8A 1NEGA 2EQIA 2K9GA 1PHTA 2D1XA 1X27A 2D8HA 1HD3A 1KFZA 1LCKA 2F2VA 5I22A 1UECA 2JM9A 1SRMA 1N5ZA 2K2MA 2RQWA 3VS4A 3PE0A 1M3CA 3EG0A 3H0IA 1CKAA 1GCQC 1I0CA 3NMZC 3ODXA 3QBVB 2DA9A 1W70A 1ARKA 3VS1A 4JPBW 2M51A 4QT7A 1CSKA 4Z8AA 2O2OA 4D8KA 3KFVA 3U23A 1NLOC 2OAWA 2J05A 4R0KA 2HSPA 3KY9A 1VA7A 4AFZC 1ZUKA 2C0OA 3NPFA 2E5KA 3LH5A 5I11A 4Z88A 3GBQA 1WIEA 1WX6A 2GTJA 4LN2A 1ZSGA 1M3AA 4AG2C 1E6HA 1M27C 3TSZA 2KT8A 1LB1A 2EYXA 2RNAA 1M3BA 1VYVA 1UHCA 2V1RA 1DBHA 2KT1A 2AK5A 2J7IA 2ROTA 4OMLA 4E6RA 2BTTA 1T0JA 1TXDA 2YUPA 1WI7A 1SHGA 2JT4A 3A98A 1PNJA 2ABLA 2PTKA 1PWTA 4K11A 1WXTA 1W1FA 2LMJA 1K0SA 1BBZA 4HVWA 1NG2A 2DILA 2KYBA 1JU5C 4JZ4A 1H8KA 2X3WD 2AKLA 1RLPC 2ED0A 4WCIA 4LE9A 1NEBA 1H92A 3THKA 1K9AA 2FRWA 4JZ3A 1ABOA 3UA7A 1Z9QA 3UATA 2DL4A 2RF0A 4HVVA 5IXBA 3RBBB 4GBQA 2KRSA 3EG3A 3RNJA 1RJ2A 2G6FX 2KROA 2EGCA 3ZL7C 2F2XA 2EYYA 2GNCA 2K7AA 1GFCA 2JMCA 2YT6A 2H8HA 2HBWA 4AFUC 1CKBA 2CSQA 3M0PA 4CC3A 2DFKA 2F2WA 4LUEA 2KR9A 2W10A 4IIMA 2O88A 2FPDA 1AZEA 4CC4B 4KRTA 1YP5A 4ZNXA 1X86A 1HJDA 3I9QA 1JEGA 2DLPA 3TVTA 2M0YA 4OMNA 3VS6A 4F14A 1GRIA 2DBMA 2ED1A 1JQQA 4X1VA 5ECAA 5GJWB 2AKKA 2JXBA 1OEBA 4F17A 2Z0QA 1YNZA 4A63B 1UUEA 4F16A 2LX7A 3O5ZA 4JJDA 1K1ZA 2L3QA 3M0TA 4D8DA 2A36A 2SRCA 1NYFA 5L23A 1S1NA 2MIOA 3C0CA 4M4ZA 1B07A 3P6AA 2DMOA 3NHNA 1A0NB 1AWWA 1UJYA 2ENMA 1F5XA 4FSSA 3ODWA 2K3BA 1YN8A 1X2QA 3EGUA 2KNBB 2LCSA 1G2BA 1GCQA 5IHNA 1QCFA 3VS2A 3EG2A 4ORZA 2A08A 2OJ2A 2LZ6B 2X3XD 2KGTA 1Y0MA 2VVKA 5FI1A 4J9FA 2GTOA 4OMPA 2C0IA 2KXDA 1UJ0A 3SEMA 1OV3A 1QWFA 1BU1A 4LNPA 2NZ8B 1TUDA 1PKSA 3VS0A 2AZSA 1M8MA 1YWPA 4RTZA 2YSQA 1WA7A 2RQRA 1MUZA 5FI0A 2VRWB 1E6GA 1KJWA 1W6XA 2DL8A 2DX1A 3KZ1A 4CC7A 1BK2A 2FRYA 3VRZA 2P4RA 2MOXA 2EVRA 3VS3A 1OPKA 1NYGA 2FPFA 4HXJA 1V1CA 1KSWA 2NUZA 2A37A 4HCKA 2EYWA 4RTTA 3QWYA 2DNUA 2DVJA 3T06A 2EGEA 1X43A 5IXFA 2RPNA 4CC2A 2I0NA 3REAB 4RTXA 1SHFA 2CH4W 3H41A 3GF9A 1VYUA 2DL5A 4GOUA 5GJVB 1AWJA 2RQVA 1WFWA 4D0OA 2KRMA 1Z9ZA 1AOJA 2RQTA 3REBB 4GLMA 2DYBA 3EO2A 2J6KA 1B3QA 3VRYA 1X69A 1QKWA 1AVZC 2GBQA 3H0FA 5IHKA 2DL7A 2CREA 1SSHA 2EPDA 5JHHA 2BZXA 2YDLA 4J9BA 1IO6A 2SEMA 4AG1C 2DRMA 1ABQA 5IH2A 1OOTA 2VWFA 1PKTA 1KZ7A 1T3LA 2LJ0A 2EGAA 1UGVA 4HVUA 1XOVA 1OPLA 2JS0A 4D0NB 2L3PA 1U5SA 3I5SA 5JHGA 1KZGA 2KXCA 3UA6A 2PNIA 1GCPA 2AZVA 2YUOA 1T0HA 2FPEA 2JMAA 4GYVA 1QWEA 2D8JA 4LUDA 1EFNA 2A28A 2O31A 2JM8A 2KBTA 1G83A 4RTWA 5FW9A 4RTUA 1GFDA 1ZLMA 2VKNA 4DEXA 1AZGB 2O9VA 3M0SA 4J9CA 4AFSC 1KIKA 4RTYA 3I35A 3KSYA 2J6OA 2CH4A 1KI1B 3H0HA 3UF4A 2LQWA 1MV0B 1H3HA 2XMFA 1SRLA 1ZUUA 2KE9A 2YUQA 3SHWA 5HCKA 2LJ3A 2RQUA 2LQNA 2JW4A 3QWXX 1VYTA 2ESWA 1U3OA 1GBQA 1X2KA 2IIMA 3M0QA 2CUDA 2DE0X 1ZBJA 2BZYA 3VS5A 2NWMA 3M0RA 2EW3A 1RI9A 2CT4A 2DL3A 1ZX6A 1BY1A 1UE9A 2J6FA 1JXOA 1X6BA 2GQIA 3NGPA 1WLPB 2RGNB 2DRKA 2ROLA 4J9DA 2LJ1A 3MPXA 1YWOA 1K4US 1BB9A 4OMQA 1X6GA 2KEAA 2FO0A 4OMMA 2DJQA 3TSWA 2K79A 2JS2A 1WYXA 2HDAA 3ODOA 2DF6A 1FYNA 1TUCA 2W0ZA 1QLYA 1SPKA 1AWOA 1I07A 2HCKA 3R6NA 2KR3A 4MT7A 2RMOA 4AFQC 4Z89A 1NM7A 1WXBA 1AD5A 4ESRA 2LNHB 1AEYA 4JJCA 2EBPA 2GGRA 2EKHA 2JTEA 3IQLA 5FWBA 2QDLA 2O9SA 2V1QA 3M0UA 5EC7A 3VS7A 2L2PA 2YUNA 1RUWA 1RLQC 4J9GA 5IHIA 2CUBA 2DBKA 1K76A 4DEYA 2C0TA 2HEQA 2ECZA 3FJ5A 1U06A 2D0NA 2CT3A 1XCGA 1SEMA 4OMOA 1YCSB 4JJBA 1QKXA 4EIKA 1GL5A 4YONA 1UG1A 3PVQA 2FG0A 2L3SA 3ULRB 2KYMA 1Y57A 1UDLA 1UTIA 2MCNA 1XD4A 2RN8A 1NLPC 1MV3A 2L0AA 1FMKA 2LP5A 1UFFA 2PZ1A 2CDTA 3PVLA 4J9IA 3BJIA 1E7OA 2FEIA 1GBRA 4RUGA 1M30A 2OI3A 1HSQA 1TG0A 4IIOA 2K6DA 1WXUA 1PRMC 1J3TA 1WDXA 2CSIA 4Y92A 1PRLC 3CQTA 1K0XA 1I1JA 1ZUYA 2KRNA 2J06A 4J9HA 1AWXA 3EHRA 4RTVA 2DM1A
chains in the Genus database with same CATH superfamily
3BDUA 1Q7YR 1WJQA 2BUDA 4DBRA 3CCVQ 3JCMb 3EG1A 1PSFA 2PVOB 3OYFA 1PM3A 1T3SA 4J9EA 1JO8A 1NEGA 3M59A 2EQIA 4WF2A 2LCCA 3AHUA 3JB9G 1Q7YU 4M7DD 4BE1A 1K9MC 5KCOA 1UECA 3CCLQ 1NZ9A 2DD4A 2K4YA 4J6WA 1OX9A 1N5ZA 1YCYA 2K2MA 3OA6A 2RK2A 1NBEB 1I0CA 3ODXA 1OZ3A 3VUZA 1IREB 3RERA 3RMSA 3VS1A 4OVAA 1HK9A 1FMVA 5KYYB 4D8KA 1UGQB 1AT1B 2DEUA 1G3TA 1VA7A 3NPFA 5CQYA 5I11A 3G71A 2OAUA 1WHKA 3GBQA 3L2RA 1M1GA 1D0YA 3A1PA 2NUTA 2DIQA 5KCHA 2E41A 1M9SA 1E6HA 3V8KA 4FYXB 3RKYA 3JCMW 1MNDA 4N4HA 1KQ1A 4C8QA 2EYXA 3BE3A 5GMKh 3WVEB 1M3BA 1DBHA 3CD6Q 2ROTA 2J7IA 3I56T 2JUFA 1G5VA 2BTTA 1T0JA 4XQ3A 2LC4A 2X4WA 2YUPA 3CMAT 5LJ5h 2G3RA 1JJ2P 1PNJA 3SWNA 2FYKA 2PTKA 3V8JA 4HKEA 1VQ9T 4K11A 2JVVA 2ZPIB 1WXTA 1W1FA 2R57A 1K0SA 1BBZA 3DKMA 3DB3A 2K3YA 1Y71A 5J3BA 1JU5C 1WHMA 1H8KA 5HY6A 4II1A 5FRMA 2QEXA 4LE9A 2YRCA 3THKA 4NS5A 1UGRB 3CC7A 3UA7A 1X01A 1WHLA 4ANJA 4N0AA 3OYJA 4BE2A 3FB9A 2G6FX 3MEVA 3I56Q 2E3IA 3CMAQ 2GNCA 5DY9A 2OTJA 4LDUA 2HBWA 2YRDA 1CKBA 2X51A 5J39A 1SKUB 4CC3A 1FX7A 4A4GA 4AMCA 1VQ9Q 3LWHA 2F2WA 2VGNA 4PKCC 1BCOA 3INZA 4IIMA 4M77G 2OTLT 3RDVA 4CC4B 2M02A 1M2VB 2MWPA 2P84A 1X86A 1S72A 4DBFA 2MI6A 1JEGA 3JB9F 2DLPA 3TVTA 1K9MR 2Z0WA 3JCMV 1GRIA 3HRSA 5KYYA 1VQLT 4QVCA 4M7DE 1TOVA 1JQQA 1OEBA 1K9MU 2LX7A 5EG2A 5GMKl 4FU6A 2L3QA 3M0TA 4KGZB 2RK1A 5GANh 3VYGA 2SRCA 4C92B 4C5GA 5CCAA 4M4ZA 2XI9A 3HRUA 2OTLQ 2HAXA 2QQSA 1F5XA 4EMKC 1RI0A 3NFCA 1TWBA 2QQRA 4N4GA 2RJFA 5IHNA 1QVPA 1OU8A 1ZHIA 3PIOA 1ZA1B 4M7AG 2X3XD 4BI4A 1NE8A 2QK0A 2GFAA 3OW2A 2C0IA 2DEQA 2RJCA 4LNPA 1PKSA 1R0BG 2XDDA 5GAOp 5A2QE 1YWPA 4M77B 3PFSA 4XU2A 2YSQA 5GAMh 2XKOC 1QW1A 2RQRA 1VQMT 2JTMA 2MWOA 4FL6A 4C92F 1PCXA 1NPPA 4CC7A 2FRYA 2P4RA 2COYA 3VS3A 2FPFA 4IUTA 1V1CA 4M78F 3JCMJ 4O5VA 2A37A 4PLLA 2EYWA 2DNUA 2DVJA 5CKFA 4E7LA 3PNWC 2ZGWA 3GIBA 1X43A 2JTFA 5GMKe 3MPUB 3ME9A 2I0NA 3REAB 1KQSS 2CH4W 3URGA 1M2VA 2EJFA 3SD4A 2DL5A 4QQDA 4JRQA 4NL3A 3NTKA 3UPUA 3JCMX 4D6WA 1S72Q 1AOJA 2KDSA 3REBB 2DYBA 4M77F 1UGSB 3EO2A 2J6KA 4BB7A 1AVZC 2GBQA 3ZEHA 1VQMQ 4J7IA 3G6EA 3H0FA 2CREA 1Q95G 5JHHA 2CGHA 2K3XA 2Y90A 1IO6A 3PGGA 2DRMA 1R77A 1ABQA 1RADB 4M7AB 5D6YA 3M4GA 4C92A 5I21A 2XD0A 1W2BA 2DTHA 4E2FB 4C92D 2XDPA 2YHTA 1C6VX 1XOVA 1QVGP 1OPLA 4M78D 1N27A 2KY9A 3A8GB 1C0MA 3CCJT 2PVDB 4L6V5 1KZGA 2KXCA 3QDRB 2PNIA 4GYVA 2V8IA 3OYAA 1EFNA 3V7SA 1KK7A 2JM8A 1ZBXA 3JCMP 5FW9A 3S3OA 1ZLMA 3G1JA 4M77A 4J5YA 2O9VA 5LJ3f 4LXCA 3I55A 1IHWA 3C4SA 4MDXA 3J7AF 3I35A 4F7UG 4NL2A 3UF4A 1KI1B 5LJ3d 2XIDA 3SHWA 3QYGB 2LJ3A 2HD0A 2LQNA 3WVDB 3OYBA 2Y4XA 3M0QA 2DE0X 1YHQA 3HSBA 3X24B 3CCJQ 1R8OB 4B9WA 2CT4A 4KUIA 1BY1A 2YLBA 2J6FA 3NGPA 2V8JA 3CPWP 2HKQB 2LJ1A 5DM7R 4YTLA 3SWNC 1YWOA 3ASKA 1BB9A 3QHSA 3TSWA 5GMKi 2DETA 4OGEA 2DXUA 3A5ZB 2DF6A 2QI2A 1BKBA 5LJ3e 1BI1A 3PMTA 1M90C 1BI3A 1TUCA 1QLYA 4E7IA 1AWOA 3ZBDA 1OYXA 1N9RA 2RD1A 4MT7A 4KH0B 2LQKA 3EGDB 3P8DA 3MO8A 1MGQA 1WXBA 1NJIC 1AD5A 2BKDN 1AEYA 2HNIA 1F1BB 4KGVB 5HKCA 1BCMA 2BIVA 3L2ZA 4OP0A 5FWBA 3G6EQ 3CC4A 4LDWA 5D6XA 5EC7A 4M7AA 4N0AC 3TQ7P 5CVIA 1V76A 2DBKA 2VXEA 2ECZA 4IKFA 2HQHA 1U06A 2CT3A 1XCGA 1K73U 4BD3A 1OU9A 4FSXA 5GAN7 4M7DG 4ZTFA 3ULRB 2KYMA 4F7UB 1B7TA 4DBQA 3M55A 1BYMA 6AT1B 1YJNT 4GLKA 1NLPC 1KQ2A 3EH2A 4OB2B 4C92E 1MNEA 3HRTA 4J9IA 2DTIA 3BJIA 2WSCE 1UEBA 2LNVA 1QVGA 3EGXB 4M78E 4KGXB 1HSQA 4O6JA 2D6FA 3UWNA 2CP5A 1J3TA 1PRLC 1ZUYA 5I2SA 2KAFA 1M8VA 1N9SA 3MEUA 5HK0A 5FLXE 5LJ5g 4X9DA 1EX4A 2X35A 2EYZA 3EHQA 2BZ8A 3JV3A 1D09B 2D1XA 1KFZA 4F7UF 4M77E 1YJNQ 2WACA 4FIBA 1N6AA 2MAMA 1N8RU 2XU8A 1G3YA 3TEEA 1M3CA 1CKAA 1YJWA 4C0DB 2A7YA 2E6ZA 4PJMA 3RIRA 3LW5E 3QBVB 2DA9A 4CI0C 1W70A 2M9UA 4FCYA 1CSKA 1I5OB 3KFVA 3KUFA 3QBYA 3SB2A 2J05A 4M7DB 3CPWA 3EGDA 3S3NA 1ZUKA 3LH5A 2RB6A 4Z88A 1Q82C 1M90R 1WX6A 4PNOA 4LN2A 1WJSA 1VUBA 3MCAB 1ZSGA 3EG9B 5GAN6 2EWNA 2FB7A 2V26A 4J7FA 1NJIR 3H9NA 2ZPHB 4L59A 4ZN3A 3EFRA 3ZFJA 1QCOA 3OYHA 1LB1A 1VYVA 3BFMA 1UHCA 4QVZA 5KH6A 2KK4A 1VQNA 2AK5A 1LVKA 4OMLA 4C5IA 4E6RA 1VQ7A 2JT4A 4F7UA 2ABLA 2EQKA 2ZPBB 3CC2A 3DLLA 3JSCA 3CCSA 2CZ1B 4RCCA 1NG2A 1ZSZB 5GANg 3EGXA 3CCVT 4BUGA 1WNLA 2IG0A 1NEBA 2FRWA 1ABOA 2DL4A 4HVVA 5IXBA 3GNGA 4MMKA 2JNGA 1I8FA 3CCLT 2HZYA 2DFUA 4GBQA 3EG3A 1QVFA 2EGCA 4C92C 1NPRA 1FMWA 3A8HB 4HCCA 2YT6A 1OULA 4AFUC 2DXBA 4RMOA 4OB0B 2KR9A 2W10A 2COWA 2O88A 1YP5A 3OYCA 5KYNA 4ZNXA 1HJDA 4IUVA 5GAMg 3VS6A 1YJWQ 1QVFS 5DLOA 3V8LA 4DQ2A 3L2QA 4M7DA 3CXCA 3OSVA 3QXEB 3UDCA 1Y07A 4M77C 1YNZA 1LOJA 1ZQ1A 3UT1A 1UUEA 4F16A 2F1LA 3CD6T 2M0OA 4JJDA 4XU1A 2DZ9A 1LNXA 3EG9A 3F70A 3A8LB 2EFIA 4BI3A 1BI0A 4AT1B 4L5GA 1Q82R 2XHCA 2DXTA 2R5MA 2PVGB 3C0CA 4RG2A 1B07A 3P6AA 1D0XA 2M1HA 1AWWA 1UJYA 3ODWA 3G4SA 1Q82U 2FL7A 3X26B 3QSUA 2LCSA 1G2BA 2NYSA 1GCQA 1O9SA 3EG2A 4ORZA 2OJ2A 4HCBA 5FRNA 2L3RA 3X28B 1ZSZA 4OMPA 4IUUA 2JJ9A 4FYYB 1OV3A 1TUDA 1X75C 2AZSA 1M8MA 4F7UE 1WA7A 1HYOA 4IUPA 1E6GA 4R56A 2DL8A 4M7AC 5HK3A 4E7JA 3PTAA 3OYNA 2EVRA 1NYGA 2NUZA 4A53A 1M1FA 3L42A 2RA2A 8AT1B 4C92G 3OQ5A 3T06A 3L1AA 5IXFA 4M78G 2RPNA 5C6SA 2L89A 4CC2A 2H3JA 4RTXA 2E12A 2K57A 3GF9A 1WGSA 4GOUA 5GJVB 1M4ZA 1WFWA 2DVEA 3G71T 4D0OA 2RQTA 1Z9ZA 5GMKm 2K5FA 1X69A 4HCZA 2P4TA 1Y96B 4LDVA 5IHKA 2EPDA 2YDLA 1K8AC 4F04B 1M1KC 3M57A 5IH2A 2FZCB 2VXFA 3GPLA 4PK4A 4Y91A 4LDYA 2LCLA 3PIPA 4PJJA 5CR2A 2X4XA 2ZPGB 1VQ6A 4ZGEB 5GAOl 2LQ8A 2RI3A 1U5SA 4ZGDB 5CKBA 2R5AA 3M9QA 1ACMB 4JLIA 1GXIE 3VV0A 3GF5A 7AT1B 3G71Q 5AT1B 3M4YA 2YUOA 2FPEA 2JMAA 1QWEA 2E70A 2E3HA 4LUDA 2QEXT 2A28A 4JRKA 2HKNA 2R58A 3CC7T 1G83A 3OYLA 4RTWA 4M78B 1GFDA 2QXFA 2MMPA 3V7RA 1WHHA 1VIEA 2KMTA 3JCMh 3HP9A 4EDUA 1H3HA 2OTJT 1ZUUA 2KE9A 4XK8E 2YUQA 2RQUA 1XQHA 3QWXX 2ESWA 4MZMA 1UB4A 1X2KA 4QKUA 2CUDA 1ZBJA 2BZYA 4PJOF 3M0RA 2ZCFB 1RI9A 1KHCA 5LJ5f 1JJ2A 1S72T 4KT0E 4DOVA 1JXOA 2HL3A 3OYYA 3VU3C 4B6MA 1IB8A 1YITA 3EH1A 2QEXQ 1K4US 4OMMA 2FO0A 4ZN1A 2DJQA 3M53A 5LJ5d 3CC7Q 2K79A 3VUBA 3FIFA 1WYXA 2HDAA 1JB0E 5GMKj 5GAN3 4BDZA 1SPKA 3JRZA 3HHTB 1I07A 2HCKA 4BACA 3OW2S 4JJNK 2KR3A 3KXTA 2DPPB 1YJ9A 1SSFA 2E1HA 4JJCA 3X25B 2EBPA 2OTJQ 3R6OA 1PG5B 4JUVA 1D1CA 2GF7A 2JTEA 1IRXA 1YFNA 1QP3A 2QDLA 2O9SA 4KBMB 2YUNA 3LX7A 1RUWA 1RLQC 4J9GA 5LJ5e 3OYDA 5IHIA 1YI2A 2DO3A 4WTOB 4DEYA 2C0TA 4DBHA 1K8AR 1SEMA 4OMOA 1K73C 3QZ9B 1QKXA 2EQMA 4XU3A 1M1KR 3PVQA 3HPWA 3PMIA 4BY6B 4XAXB 3EAEA 4PJOD 4A4KA 1Y57A 1UTIA 1TUGB 1PD1A 1K8AU 1Q81U 2RN8A 4C0DC 1MV3A 1M1KU 2L0AA 1FMKA 2LP5A 5A0GA 3V7CA 4R55A 4XTVA 2CDTA 2RO0A 1E7OA 2D0QB 1GBRA 3HFOA 4M7DC 4M78A 3VJPA 3AT1B 4Y92A 1K0XA 2KRNA 3HTRA 5KE2A 2ZPEB 4OF1A 4JS5A 2QQ9A 5GANf 3I5RA 5IN1A 1FOEA 4M75D 3BDLA 3J81E 2COZA 5FWCA 2QTVA 1JXMA 3D7SB 2K9GA 1W2BS 5GANd 2YXYA 5KYUB 4JS4A 1LCKA 2F2VA 4PJNA 1B34B 3OYIA 1VOMA 2ZAEA 4E7ZA 1N8RC 2JM9A 1SRMA 1TTHB 3PE0A 3OSSC 3EG0A 3H0IA 3JB9I 1RAGB 1GCQC 4EMHA 3NMZC 3O8VA 1TS9A 1VIFA 3G6ET 3MHXA 4JPBW 3RKXA 2CZ0B 5CO7A 4Z8AA 1ZSZC 3U23A 2OAWA 4P5NA 4R0KA 5GANe 3ER0A 2HSPA 3KY9A 1M2OA 2C0OA 5LJ3j 1JBMA 5GAMf 1WIEA 3QO3A 1EZZB 1Y7XA 3M56A 4J6YA 4C0ZA 1KG1A 1M3AA 5GAMd 3CCMA 4AG2C 4BE0A 1M27C 3M5AA 3TSZA 2KT8A 4ZTJA 2DJZA 2RNAA 1YI2Q 2VUBA 2V1RA 3H8ZA 2KT1A 2P0PA 2EKOA 3LGLA 2QA4A 1SHGA 2FVUA 2EYQA 4XTYA 2QYZA 1BIBA 4VUBA 3S3MA 3CCUA 1K73R 4LDXA 4ATOA 2LMJA 5GAMe 2LT4A 3I55T 1PC0A 2DD5A 2KYBA 2DILA 4OGCA 3JCMc 2DZCA 1RAFB 4JZ4A 2X3WD 2AKLA 2ED0A 3RMQA 5KYWB 4PJOE 2O4XB 1K9AA 2WSFE 3MP8A 1VQOA 2PUOB 4C0GA 2Y4YA 1Z9QA 2QTXA 3UATA 2RF0A 1VQPA 1RL2A 4E7KA 1YHQT 1Q86U 2KRSA 1OI1A 1RJ2A 1FXXA 3RUXA 2DK3A 3CBMA 2F2XA 2EQUA 2RI5A 1GFCA 3QUIA 2JMCA 5KYUA 2EQJA 3RKWA 1B34A 4PFPA 1H641 2HQEA 2X4JA 3C94A 3I55Q 2FZGB 2M0YA 4OMNA 4F14A 5I2MA 2KQWA 2AHJB 1N8RR 2CZ7B 5IAYA 2ED1A 4X1VA 1QVGS 2AKKA 2JXBA 2ZPFB 3CC4T 1VQKA 3TU4K 1YHQQ 1RACB 3L2VA 2VASA 4A54A 1I5LA 2FHDA 3O5ZA 4FM4B 4DOWA 3QYHB 1K1ZA 1WHGA 2CYZB 1O75A 2P0QA 5C0MA 2A36A 2BE7D 1VQ5A 5L23A 1S1NA 3G7ZA 2LT1A 2BE9B 3CCMQ 2QASA 2OX7A 5IT9E 2DMOA 1A0NB 1M5Q1 3FLGA 4FSSA 1MMNA 2K3BA 1YN8A 3OS5A 4KH1B 2QG9B 2KNBB 3EGUA 2QGFB 3VS2A 1QMCA 3E9FA 2VC8A 2LZ6B 4C5HA 3JAME 3CC4Q 2KGTA 1Y0MA 3CCUQ 1U1TA 5FI1A 3HL8A 2KXDA 1UJ0A 2LX9A 4OB1B 5M9OA 4JDSA 1BU1A 1H3ZA 2NZ8B 3L2WA 3CPWS 5KYWA 2O4XA 2L8DA 3LLRA 4RTZA 2RI2A 1TSFA 1G3WA 1W4SA 1D3BB 2VRWB 2GQVA 1KJWA 2JZ2A 2DX1A 3VRZA 1VQPQ 1OPKA 4HXJA 1KSWA 3CMEA 5A0DA 2CP2A 4HCKA 3QWYA 3FJPA 1YJWT 2EGEA 3JB9H 1TU0B 3OMGA 1BIAA 4RKUE 3OS2A 3H41A 2EJGA 1G8XA 1VYUA 5FU6B 1OZ2A 3JCMg 1U1SA 2KRMA 4C8QB 4GLMA 3BY7A 2DAQA 5DLQE 1QKWA 2NLUA 4M78C 4FW1A 3JCMQ 3PT9A 5KYXB 1X6OA 2O01E 2BZXA 3M58A 4QQGA 4MZTA 1TXQA 3C12A 3MP6A 2FZKB 4OB3B 4C5EA 3VYHB 4QQ6A 4XU0A 1VQNT 2LJ0A 1VQ7T 4V2SA 4HVUA 2QDYB 4RCBA 3CC2T 1KD1C 1VQ5Q 2JS0A 3FEOA 3CCEA 3MP1A 5J26A 3CCST 1IZ6A 5JHGA 1PSEA 3I56A 1GCPA 2AZVA 4C8QF 3CMAA 2VGMA 2D8JA 3J80E 4MMLA 4EMGA 2QGGA 2O31A 1VQ9A 4FW2A 4FYVB 1AHJB 3CXCS 2NUPB 3MKDA 4DEXA 1AZGB 4KUDK 4AFSC 1KIKA 1D3BA 1VQNQ 3OS1A 2CH4A 3H0HA 1VQ7Q 2B8AA 2MF2A 3CC2Q 5HCKA 1VYTA 2IIMA 1OX8A 4Q5WA 2V8KA 2EW3A 2P0KA 3CCSQ 3CMEQ 9ATCB 4PFZA 1ZX6A 1UE9A 1YIJA 4BY6C 3WXMB 3SFMA 2E10A 5CIUA 4PJOG 5GAOr 1G3SA 1U8RA 2RM4A 1X6GA 4LD9K 2PU9B 2JS2A 3E9GA 4FT2A 3N5BB 3ODOA 4MZPA 2OTLA 1FYNA 2HBPA 2W0ZA 3CCET 3X20B 2HMAA 3OB9A 4C8QD 5FU7B 4IUQA 3OW2P 3FDRA 4Z89A 2GCXA 5KYXA 2LTOA 5KE3A 4ESRA 2LNHB 1VQLA 2DTOA 1WQ7A 3P8BB 2WSEE 3VS7A 1KQSP 2L2PA 5GAOm 4QVDA 2HQXA 1MMDA 1WJRA 2CUBA 5FROA 4M75G 3OY9A 2C06A 2HEQA 3FJ5A 3G4ST 1YCSB 4JJBA 2XICA 2LRQA 3CCRA 1KHIA 4QW2A 3QJ6A 2L3SA 5D6WA 1UDLA 1BI2A 1MHNA 1Q81C 4IURA 3CCEQ 1KD1R 3QG1A 5GAN4 1YIJT 1HXDA 4ELZC 2PZ1A 3P8HA 4RUGA 1M30A 2OI3A 1KD1U 2K6DA 2NUPA 1YBYA 2CS7A 1QCNA 2ATCB 4PJOB 1I1JA 4J9HA 1AWXA 3EHRA 4N4IA 1LJOA 2EJ9A 4RTVA 2B86A 3MJXA 3G4SQ 3GLXA 4FT4A 1SF9A 4GZUA 1NTYA 3QPHA 3OYMA 1VQMA 1UHFA 1PHTA 1X27A 2D8HA 1HD3A 2E4HA 5CKHA 4Z02A 1W2BP 1XTDA 5I22A 3GNFB 2RQWA 2CKKA 2HL5C 4TVRA 3VS4A 1YIJQ 3EFSA 2CZ6B 2CP7A 4M75B 3CCRT 2F5TX 3CCQA 1ARKA 2RHUA 4XTWA 2M51A 4QT7A 2O2OA 2DKGA 1NLOC 4J8OA 4PFOA 4E7HA 2PUKB 4AFZC 2E5KA 1RABB 2K5IA 2D9TA 3LWIA 5LJ3h 2IVWA 2GTJA 2KVQG 1VQLQ 5CAIA 2EIFA 1I81A 1VQ6T 5D7UA 4C8QE 1IXDA 3QIIA 3JB9D 4JLGA 2H3EB 3OYEA 3MEAA 5LJ5j 1Y96A 1JJ2S 5A0LA 1TXDA 1WZOA 1WI7A 3QKJA 3A98A 4M75F 3CCRQ 4Y28E 1KQSA 1LPLA 1PWTA 3M54A 1XJWB 2K5LA 3OYGA 3CCJA 3GOXA 2RHIA 2RJDA 3KBGA 2CP0A 4HVWA 5GAN8 1Q81R 1RLPC 2AIRB 4WCIA 3QZ5B 1H92A 1D0ZA 1RAIB 4XTUA 3CCQT 4JZ3A 4PJOA 2E65A 1VQ6Q 2KSSA 2E64A 1RAEB 1Q86C 2QQAA 3DB4A 3RBBB 3RNJA 2KROA 5GAN2 3EFOB 3ZL7C 2EYYA 1YITT 2K7AA 1MMAA 2H8HA 1IHVA 2CSQA 3M0PA 1RAAB 1SG5A 4JRPA 2DFKA 4LUEA 4MDWA 2ZZDA 2FPDA 2MYSA 1AZEA 4KRTA 2A0FB 4NOYA 2RHZA 2K2VA 3HKSA 3I9QA 4M75A 3FRNA 1YJ9T 2DBMA 2A3LA 4XTXA 5ECAA 5GJWB 3E19A 3CCQQ 2RHYA 2VYTA 4F17A 2Z0QA 2E6NA 4A63B 4A4HA 1YI2T 3JCMf 2MK5A 1IGUA 5GANj 2E5QA 4D8DA 2VV5A 1YITQ 1QQJA 3JCMd 1NYFA 2MIOA 1I4K1 2CP3A 4C0FA 3NHNA 2ENMA 2IPOB 4M7AF 4M77D 3QJYA 1X2QA 3META 2JN0A 1YJ9Q 5GAOq 1IGQA 4KULA 1QCFA 5FU6C 2JOYA 2A08A 1VQ8A 2VVKA 3E1SA 4J9FA 4C8QC 2GTOA 3JCMe 1YJNA 3A8OB 3SEMA 3LGFA 1QWFA 4HA8A 3Q1JA 3VS0A 2AT1B 5GAMj 1R0CB 4E7SA 1MUZA 5FI0A 1JRIA 2YRVA 3HFNA 1W6XA 3KZ1A 3NTHA 1KC8C 1BK2A 2MOXA 2EAYA 1PD0A 2CP6A 1WPYA 3EFOA 5AYFA 1D1AA 4PL6A 4RTTA 1C1AA 1Q86R 1QP2A 2HSEB 4EMKB 4RG8A 2F69A 1SHFA 1WQWA 2MPXC 2M16A 4M7AD 4HT9A 1AWJA 2RQVA 2DIGA 3CBPA 1B3QA 3VRYA 3DLMA 2RH2A 1VQ8T 1P92A 2DL7A 1SSHA 2PQWA 3CCMT 4XTZA 4J9BA 3OBYA 2SEMA 4AG1C 1OOTA 4M75E 1XNIA 2VWFA 1PKTA 1KZ7A 1TH7A 2XK0A 3A8MB 1MMGA 4CRIA 1T3LA 2EGAA 1UGVA 2QA4T 1QVFP 3TCJA 4ZGJB 3LYIA 2DXCA 5CK9A 3CCUT 3OS0A 4D0NB 2L3PA 4HT8A 2LDMA 3GP8A 3I5SA 5GAN5 3E2UA 3UA6A 3OMCA 4UC4A 2XDBA 1VQ4A 1T0HA 2F5KA 3L2UA 3FC3A 4ELYC 3LH0A 1DJ7B 3S6WA 1VQ8Q 2XG8D 2KBTA 3H6ZA 1VQOT 1Q7YC 5FU7C 2DYIA 1VQPT 4C8QG 2VB6A 4ME7A 2QQBA 4RTUA 3CXCP 2VKNA 1WHJA 3M0SA 4J9CA 3QDFA 3CPFA 3CCVA 3MEWA 4RTYA 4FYWB 3KSYA 2J6OA 5CQXA 2LQWA 1MV0B 5L8RE 2QA4Q 2XMFA 1SRLA 3RR6A 2JW4A 1ZA2B 1U3OA 1GBQA 5LL6S 3VS5A 1EIFA 2YLCA 2NWMA 3C95A 3CCLA 3T9NA 3TREA 3BW1A 2DL3A 3SDZA 1D1BA 1KC8R 4EMKA 1V29B 1X6BA 2GQIA 1WLPB 4OMFB 2RGNB 2DRKA 2ROLA 4J9DA 4LD6A 3MPXA 4B9XA 4OMQA 4JRIA 2KEAA 4A4EA 2QAZA 1VQOQ 3VKIA 1KC8U 2DERA 1M90U 1VQKT 2X9HA 3RESA 3R6NA 2LVMA 5CKEA 1FWZA 4AFQC 2RMOA 2RHXA 1VQ4T 1NM7A 4J83A 1NJIU 4PJOC 2GGRA 2EKHA 3IQLA 4M7AE 1VQ5T 2V1QA 3M0UA 2NUTB 4EPCA 4M7DF 2L5QA 8ATCB 4PLIA 3CEYA 1OQKA 2YWWA 1K76A 3CD6A 2KI7A 2D0NA 5CKDA 4X34A 4EIKA 1UGPB 1GL5A 4J6XA 4YONA 1UG1A 1RAHB 2FG0A 3NTIA 4BDYA 2MCNA 4GY5A 3SWNB 2I2LA 1VQKQ 1XD4A 4DA4A 4E47A 5LJ3g 4M75C 3OBWA 1UFFA 4X9CA 1VQ4Q 3PVLA 3JB9J 4BI8B 2FEIA 1TG0A 2RJEA 4IIOA 4PJLA 1WXUA 1PRMC 2GFUA 1WDXA 3OYKA 2CSIA 3CBOA 3CQTA 5GAOn 2J06A 3CMET 4A4FA 2X4YA 2DM1A
chains in the Genus database with same CATH topology
2B86A 3I5RA 3EG1A 1FOEA 4GZUA 1NTYA 2EYZA 3EHQA 5FWCA 1JXMA 2BZ8A 3JV3A 1T3SA 1UHFA 4J9EA 1JO8A 1NEGA 2EQIA 2K9GA 1PHTA 2D1XA 1X27A 2D8HA 1HD3A 1KFZA 1LCKA 2F2VA 5I22A 1UECA 2JM9A 1SRMA 1N5ZA 2K2MA 2RQWA 3VS4A 3PE0A 1M3CA 3EG0A 3H0IA 1CKAA 1GCQC 1I0CA 3NMZC 3ODXA 3QBVB 2DA9A 1W70A 1ARKA 3VS1A 4JPBW 2M51A 4QT7A 1CSKA 4Z8AA 2O2OA 4D8KA 3KFVA 3U23A 1NLOC 2OAWA 2J05A 4R0KA 2HSPA 3KY9A 1VA7A 4AFZC 1ZUKA 2C0OA 3NPFA 2E5KA 3LH5A 5I11A 4Z88A 3GBQA 1WIEA 1WX6A 2GTJA 4LN2A 1ZSGA 1M3AA 4AG2C 1E6HA 1M27C 3TSZA 2KT8A 1LB1A 2EYXA 2RNAA 1M3BA 1VYVA 1UHCA 2V1RA 1DBHA 2KT1A 2AK5A 2J7IA 2ROTA 4OMLA 4E6RA 2BTTA 1T0JA 1TXDA 2YUPA 1WI7A 1SHGA 2JT4A 3A98A 1PNJA 2ABLA 2PTKA 1PWTA 4K11A 1WXTA 1W1FA 2LMJA 1K0SA 1BBZA 4HVWA 1NG2A 2DILA 2KYBA 1JU5C 4JZ4A 1H8KA 2X3WD 2AKLA 1RLPC 2ED0A 4WCIA 4LE9A 1NEBA 1H92A 3THKA 1K9AA 2FRWA 4JZ3A 1ABOA 3UA7A 1Z9QA 3UATA 2DL4A 2RF0A 4HVVA 5IXBA 3RBBB 4GBQA 2KRSA 3EG3A 3RNJA 1RJ2A 2G6FX 2KROA 2EGCA 3ZL7C 2F2XA 2EYYA 2GNCA 2K7AA 1GFCA 2JMCA 2YT6A 2H8HA 2HBWA 4AFUC 1CKBA 2CSQA 3M0PA 4CC3A 2DFKA 2F2WA 4LUEA 2KR9A 2W10A 4IIMA 2O88A 2FPDA 1AZEA 4CC4B 4KRTA 1YP5A 4ZNXA 1X86A 1HJDA 3I9QA 1JEGA 2DLPA 3TVTA 2M0YA 4OMNA 3VS6A 4F14A 1GRIA 2DBMA 2ED1A 1JQQA 4X1VA 5ECAA 5GJWB 2AKKA 2JXBA 1OEBA 4F17A 2Z0QA 1YNZA 4A63B 1UUEA 4F16A 2LX7A 3O5ZA 4JJDA 1K1ZA 2L3QA 3M0TA 4D8DA 2A36A 2SRCA 1NYFA 5L23A 1S1NA 2MIOA 3C0CA 4M4ZA 1B07A 3P6AA 2DMOA 3NHNA 1A0NB 1AWWA 1UJYA 2ENMA 1F5XA 4FSSA 3ODWA 2K3BA 1YN8A 1X2QA 3EGUA 2KNBB 2LCSA 1G2BA 1GCQA 5IHNA 1QCFA 3VS2A 3EG2A 4ORZA 2A08A 2OJ2A 2LZ6B 2X3XD 2KGTA 1Y0MA 2VVKA 5FI1A 4J9FA 2GTOA 4OMPA 2C0IA 2KXDA 1UJ0A 3SEMA 1OV3A 1QWFA 1BU1A 4LNPA 2NZ8B 1TUDA 1PKSA 3VS0A 2AZSA 1M8MA 1YWPA 4RTZA 2YSQA 1WA7A 2RQRA 1MUZA 5FI0A 2VRWB 1E6GA 1KJWA 1W6XA 2DL8A 2DX1A 3KZ1A 4CC7A 1BK2A 2FRYA 3VRZA 2P4RA 2MOXA 2EVRA 3VS3A 1OPKA 1NYGA 2FPFA 4HXJA 1V1CA 1KSWA 2NUZA 2A37A 4HCKA 2EYWA 4RTTA 3QWYA 2DNUA 2DVJA 3T06A 2EGEA 1X43A 5IXFA 2RPNA 4CC2A 2I0NA 3REAB 4RTXA 1SHFA 2CH4W 3H41A 3GF9A 1VYUA 2DL5A 4GOUA 5GJVB 1AWJA 2RQVA 1WFWA 4D0OA 2KRMA 1Z9ZA 1AOJA 2RQTA 3REBB 4GLMA 2DYBA 3EO2A 2J6KA 1B3QA 3VRYA 1X69A 1QKWA 1AVZC 2GBQA 3H0FA 5IHKA 2DL7A 2CREA 1SSHA 2EPDA 5JHHA 2BZXA 2YDLA 4J9BA 1IO6A 2SEMA 4AG1C 2DRMA 1ABQA 5IH2A 1OOTA 2VWFA 1PKTA 1KZ7A 1T3LA 2LJ0A 2EGAA 1UGVA 4HVUA 1XOVA 1OPLA 2JS0A 4D0NB 2L3PA 1U5SA 3I5SA 5JHGA 1KZGA 2KXCA 3UA6A 2PNIA 1GCPA 2AZVA 2YUOA 1T0HA 2FPEA 2JMAA 4GYVA 1QWEA 2D8JA 4LUDA 1EFNA 2A28A 2O31A 2JM8A 2KBTA 1G83A 4RTWA 5FW9A 4RTUA 1GFDA 1ZLMA 2VKNA 4DEXA 1AZGB 2O9VA 3M0SA 4J9CA 4AFSC 1KIKA 4RTYA 3I35A 3KSYA 2J6OA 2CH4A 1KI1B 3H0HA 3UF4A 2LQWA 1MV0B 1H3HA 2XMFA 1SRLA 1ZUUA 2KE9A 2YUQA 3SHWA 5HCKA 2LJ3A 2RQUA 2LQNA 2JW4A 3QWXX 1VYTA 2ESWA 1U3OA 1GBQA 1X2KA 2IIMA 3M0QA 2CUDA 2DE0X 1ZBJA 2BZYA 3VS5A 2NWMA 3M0RA 2EW3A 1RI9A 2CT4A 2DL3A 1ZX6A 1BY1A 1UE9A 2J6FA 1JXOA 1X6BA 2GQIA 3NGPA 1WLPB 2RGNB 2DRKA 2ROLA 4J9DA 2LJ1A 3MPXA 1YWOA 1K4US 1BB9A 4OMQA 1X6GA 2KEAA 2FO0A 4OMMA 2DJQA 3TSWA 2K79A 2JS2A 1WYXA 2HDAA 3ODOA 2DF6A 1FYNA 1TUCA 2W0ZA 1QLYA 1SPKA 1AWOA 1I07A 2HCKA 3R6NA 2KR3A 4MT7A 2RMOA 4AFQC 4Z89A 1NM7A 1WXBA 1AD5A 4ESRA 2LNHB 1AEYA 4JJCA 2EBPA 2GGRA 2EKHA 2JTEA 3IQLA 5FWBA 2QDLA 2O9SA 2V1QA 3M0UA 5EC7A 3VS7A 2L2PA 2YUNA 1RUWA 1RLQC 4J9GA 5IHIA 2CUBA 2DBKA 1K76A 4DEYA 2C0TA 2HEQA 2ECZA 3FJ5A 1U06A 2D0NA 2CT3A 1XCGA 1SEMA 4OMOA 1YCSB 4JJBA 1QKXA 4EIKA 1GL5A 4YONA 1UG1A 3PVQA 2FG0A 2L3SA 3ULRB 2KYMA 1Y57A 1UDLA 1UTIA 2MCNA 1XD4A 2RN8A 1NLPC 1MV3A 2L0AA 1FMKA 2LP5A 1UFFA 2PZ1A 2CDTA 3PVLA 4J9IA 3BJIA 1E7OA 2FEIA 1GBRA 4RUGA 1M30A 2OI3A 1HSQA 1TG0A 4IIOA 2K6DA 1WXUA 1PRMC 1J3TA 1WDXA 2CSIA 4Y92A 1PRLC 3CQTA 1K0XA 1I1JA 1ZUYA 2KRNA 2J06A 4J9HA 1AWXA 3EHRA 4RTVA 2DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B86 A;  3I5R A;  3EG1 A;  1FOE A;  4GZU A;  1NTY A;  2EYZ A;  3EHQ A;  5FWC A;  1JXM A;  2BZ8 A;  3JV3 A;  1T3S A;  1UHF A;  4J9E A;  1JO8 A;  1NEG A;  2EQI A;  2K9G A;  1PHT A;  2D1X A;  1X27 A;  2D8H A;  1HD3 A;  1KFZ A;  1LCK A;  2F2V A;  5I22 A;  1UEC A;  2JM9 A;  1SRM A;  1N5Z A;  2K2M A;  2RQW A;  3VS4 A;  3PE0 A;  1M3C A;  3EG0 A;  3H0I A;  1CKA A;  1GCQ C;  1I0C A;  3NMZ C;  3ODX A;  3QBV B;  2DA9 A;  1W70 A;  1ARK A;  3VS1 A;  4JPB W;  2M51 A;  4QT7 A;  1CSK A;  4Z8A A;  2O2O A;  4D8K A;  3KFV A;  3U23 A;  1NLO C;  2OAW A;  2J05 A;  4R0K A;  2HSP A;  3KY9 A;  1VA7 A;  4AFZ C;  1ZUK A;  2C0O A;  3NPF A;  2E5K A;  3LH5 A;  5I11 A;  4Z88 A;  3GBQ A;  1WIE A;  1WX6 A;  2GTJ A;  4LN2 A;  1ZSG A;  1M3A A;  4AG2 C;  1E6H A;  1M27 C;  3TSZ A;  2KT8 A;  1LB1 A;  2EYX A;  2RNA A;  1M3B A;  1VYV A;  1UHC A;  2V1R A;  1DBH A;  2KT1 A;  2AK5 A;  2J7I A;  2ROT A;  4OML A;  4E6R A;  2BTT A;  1T0J A;  1TXD A;  2YUP A;  1WI7 A;  1SHG A;  2JT4 A;  3A98 A;  1PNJ A;  2ABL A;  2PTK A;  1PWT A;  4K11 A;  1WXT A;  1W1F A;  2LMJ A;  1K0S A;  1BBZ A;  4HVW A;  1NG2 A;  2DIL A;  2KYB A;  1JU5 C;  4JZ4 A;  1H8K A;  2X3W D;  2AKL A;  1RLP C;  2ED0 A;  4WCI A;  4LE9 A;  1NEB A;  1H92 A;  3THK A;  1K9A A;  2FRW A;  4JZ3 A;  1ABO A;  3UA7 A;  1Z9Q A;  3UAT A;  2DL4 A;  2RF0 A;  4HVV A;  5IXB A;  3RBB B;  4GBQ A;  2KRS A;  3EG3 A;  3RNJ A;  1RJ2 A;  2G6F X;  2KRO A;  2EGC A;  3ZL7 C;  2F2X A;  2EYY A;  2GNC A;  2K7A A;  1GFC A;  2JMC A;  2YT6 A;  2H8H A;  2HBW A;  4AFU C;  1CKB A;  2CSQ A;  3M0P A;  4CC3 A;  2DFK A;  2F2W A;  4LUE A;  2KR9 A;  2W10 A;  4IIM A;  2O88 A;  2FPD A;  1AZE A;  4CC4 B;  4KRT A;  1YP5 A;  4ZNX A;  1X86 A;  1HJD A;  3I9Q A;  1JEG A;  2DLP A;  3TVT A;  2M0Y A;  4OMN A;  3VS6 A;  4F14 A;  1GRI A;  2DBM A;  2ED1 A;  1JQQ A;  4X1V A;  5ECA A;  5GJW B;  2AKK A;  2JXB A;  1OEB A;  4F17 A;  2Z0Q A;  1YNZ A;  4A63 B;  1UUE A;  4F16 A;  2LX7 A;  3O5Z A;  4JJD A;  1K1Z A;  2L3Q A;  3M0T A;  4D8D A;  2A36 A;  2SRC A;  1NYF A;  5L23 A;  1S1N A;  2MIO A;  3C0C A;  4M4Z A;  1B07 A;  3P6A A;  2DMO A;  3NHN A;  1A0N B;  1AWW A;  1UJY A;  2ENM A;  1F5X A;  4FSS A;  3ODW A;  2K3B A;  1YN8 A;  1X2Q A;  3EGU A;  2KNB B;  2LCS A;  1G2B A;  1GCQ A;  5IHN A;  1QCF A;  3VS2 A;  3EG2 A;  4ORZ A;  2A08 A;  2OJ2 A;  2LZ6 B;  2X3X D;  2KGT A;  1Y0M A;  2VVK A;  5FI1 A;  4J9F A;  2GTO A;  4OMP A;  2C0I A;  2KXD A;  1UJ0 A;  3SEM A;  1OV3 A;  1QWF A;  1BU1 A;  4LNP A;  2NZ8 B;  1TUD A;  1PKS A;  3VS0 A;  2AZS A;  1M8M A;  1YWP A;  4RTZ A;  2YSQ A;  1WA7 A;  2RQR A;  1MUZ A;  5FI0 A;  2VRW B;  1E6G A;  1KJW A;  1W6X A;  2DL8 A;  2DX1 A;  3KZ1 A;  4CC7 A;  1BK2 A;  2FRY A;  3VRZ A;  2P4R A;  2MOX A;  2EVR A;  3VS3 A;  1OPK A;  1NYG A;  2FPF A;  4HXJ A;  1V1C A;  1KSW A;  2NUZ A;  2A37 A;  4HCK A;  2EYW A;  4RTT A;  3QWY A;  2DNU A;  2DVJ A;  3T06 A;  2EGE A;  1X43 A;  5IXF A;  2RPN A;  4CC2 A;  2I0N A;  3REA B;  4RTX A;  1SHF A;  2CH4 W;  3H41 A;  3GF9 A;  1VYU A;  2DL5 A;  4GOU A;  5GJV B;  1AWJ A;  2RQV A;  1WFW A;  4D0O A;  2KRM A;  1Z9Z A;  1AOJ A;  2RQT A;  3REB B;  4GLM A;  2DYB A;  3EO2 A;  2J6K A;  1B3Q A;  3VRY A;  1X69 A;  1QKW A;  1AVZ C;  2GBQ A;  3H0F A;  5IHK A;  2DL7 A;  2CRE A;  1SSH A;  2EPD A;  5JHH A;  2BZX A;  2YDL A;  4J9B A;  1IO6 A;  2SEM A;  4AG1 C;  2DRM A;  1ABQ A;  5IH2 A;  1OOT A;  2VWF A;  1PKT A;  1KZ7 A;  1T3L A;  2LJ0 A;  2EGA A;  1UGV A;  4HVU A;  1XOV A;  1OPL A;  2JS0 A;  4D0N B;  2L3P A;  1U5S A;  3I5S A;  5JHG A;  1KZG A;  2KXC A;  3UA6 A;  2PNI A;  1GCP A;  2AZV A;  2YUO A;  1T0H A;  2FPE A;  2JMA A;  4GYV A;  1QWE A;  2D8J A;  4LUD A;  1EFN A;  2A28 A;  2O31 A;  2JM8 A;  2KBT A;  1G83 A;  4RTW A;  5FW9 A;  4RTU A;  1GFD A;  1ZLM A;  2VKN A;  4DEX A;  1AZG B;  2O9V A;  3M0S A;  4J9C A;  4AFS C;  1KIK A;  4RTY A;  3I35 A;  3KSY A;  2J6O A;  2CH4 A;  1KI1 B;  3H0H A;  3UF4 A;  2LQW A;  1MV0 B;  1H3H A;  2XMF A;  1SRL A;  1ZUU A;  2KE9 A;  2YUQ A;  3SHW A;  5HCK A;  2LJ3 A;  2RQU A;  2LQN A;  2JW4 A;  3QWX X;  1VYT A;  2ESW A;  1U3O A;  1GBQ A;  1X2K A;  2IIM A;  3M0Q A;  2CUD A;  2DE0 X;  1ZBJ A;  2BZY A;  3VS5 A;  2NWM A;  3M0R A;  2EW3 A;  1RI9 A;  2CT4 A;  2DL3 A;  1ZX6 A;  1BY1 A;  1UE9 A;  2J6F A;  1JXO A;  1X6B A;  2GQI A;  3NGP A;  1WLP B;  2RGN B;  2DRK A;  2ROL A;  4J9D A;  2LJ1 A;  3MPX A;  1YWO A;  1K4U S;  1BB9 A;  4OMQ A;  1X6G A;  2KEA A;  2FO0 A;  4OMM A;  2DJQ A;  3TSW A;  2K79 A;  2JS2 A;  1WYX A;  2HDA A;  3ODO A;  2DF6 A;  1FYN A;  1TUC A;  2W0Z A;  1QLY A;  1SPK A;  1AWO A;  1I07 A;  2HCK A;  3R6N A;  2KR3 A;  4MT7 A;  2RMO A;  4AFQ C;  4Z89 A;  1NM7 A;  1WXB A;  1AD5 A;  4ESR A;  2LNH B;  1AEY A;  4JJC A;  2EBP A;  2GGR A;  2EKH A;  2JTE A;  3IQL A;  5FWB A;  2QDL A;  2O9S A;  2V1Q A;  3M0U A;  5EC7 A;  3VS7 A;  2L2P A;  2YUN A;  1RUW A;  1RLQ C;  4J9G A;  5IHI A;  2CUB A;  2DBK A;  1K76 A;  4DEY A;  2C0T A;  2HEQ A;  2ECZ A;  3FJ5 A;  1U06 A;  2D0N A;  2CT3 A;  1XCG A;  1SEM A;  4OMO A;  1YCS B;  4JJB A;  1QKX A;  4EIK A;  1GL5 A;  4YON A;  1UG1 A;  3PVQ A;  2FG0 A;  2L3S A;  3ULR B;  2KYM A;  1Y57 A;  1UDL A;  1UTI A;  2MCN A;  1XD4 A;  2RN8 A;  1NLP C;  1MV3 A;  2L0A A;  1FMK A;  2LP5 A;  1UFF A;  2PZ1 A;  2CDT A;  3PVL A;  4J9I A;  3BJI A;  1E7O A;  2FEI A;  1GBR A;  4RUG A;  1M30 A;  2OI3 A;  1HSQ A;  1TG0 A;  4IIO A;  2K6D A;  1WXU A;  1PRM C;  1J3T A;  1WDX A;  2CSI A;  4Y92 A;  1PRL C;  3CQT A;  1K0X A;  1I1J A;  1ZUY A;  2KRN A;  2J06 A;  4J9H A;  1AWX A;  3EHR A;  4RTV A;  2DM1 A; 
#chains in the Genus database with same CATH topology
 3BDU A;  1Q7Y R;  1WJQ A;  2BUD A;  4DBR A;  3CCV Q;  3JCM b;  3EG1 A;  1PSF A;  2PVO B;  3OYF A;  1PM3 A;  1T3S A;  4J9E A;  1JO8 A;  1NEG A;  3M59 A;  2EQI A;  4WF2 A;  2LCC A;  3AHU A;  3JB9 G;  1Q7Y U;  4M7D D;  4BE1 A;  1K9M C;  5KCO A;  1UEC A;  3CCL Q;  1NZ9 A;  2DD4 A;  2K4Y A;  4J6W A;  1OX9 A;  1N5Z A;  1YCY A;  2K2M A;  3OA6 A;  2RK2 A;  1NBE B;  1I0C A;  3ODX A;  1OZ3 A;  3VUZ A;  1IRE B;  3RER A;  3RMS A;  3VS1 A;  4OVA A;  1HK9 A;  1FMV A;  5KYY B;  4D8K A;  1UGQ B;  1AT1 B;  2DEU A;  1G3T A;  1VA7 A;  3NPF A;  5CQY A;  5I11 A;  3G71 A;  2OAU A;  1WHK A;  3GBQ A;  3L2R A;  1M1G A;  1D0Y A;  3A1P A;  2NUT A;  2DIQ A;  5KCH A;  2E41 A;  1M9S A;  1E6H A;  3V8K A;  4FYX B;  3RKY A;  3JCM W;  1MND A;  4N4H A;  1KQ1 A;  4C8Q A;  2EYX A;  3BE3 A;  5GMK h;  3WVE B;  1M3B A;  1DBH A;  3CD6 Q;  2ROT A;  2J7I A;  3I56 T;  2JUF A;  1G5V A;  2BTT A;  1T0J A;  4XQ3 A;  2LC4 A;  2X4W A;  2YUP A;  3CMA T;  5LJ5 h;  2G3R A;  1JJ2 P;  1PNJ A;  3SWN A;  2FYK A;  2PTK A;  3V8J A;  4HKE A;  1VQ9 T;  4K11 A;  2JVV A;  2ZPI B;  1WXT A;  1W1F A;  2R57 A;  1K0S A;  1BBZ A;  3DKM A;  3DB3 A;  2K3Y A;  1Y71 A;  5J3B A;  1JU5 C;  1WHM A;  1H8K A;  5HY6 A;  4II1 A;  5FRM A;  2QEX A;  4LE9 A;  2YRC A;  3THK A;  4NS5 A;  1UGR B;  3CC7 A;  3UA7 A;  1X01 A;  1WHL A;  4ANJ A;  4N0A A;  3OYJ A;  4BE2 A;  3FB9 A;  2G6F X;  3MEV A;  3I56 Q;  2E3I A;  3CMA Q;  2GNC A;  5DY9 A;  2OTJ A;  4LDU A;  2HBW A;  2YRD A;  1CKB A;  2X51 A;  5J39 A;  1SKU B;  4CC3 A;  1FX7 A;  4A4G A;  4AMC A;  1VQ9 Q;  3LWH A;  2F2W A;  2VGN A;  4PKC C;  1BCO A;  3INZ A;  4IIM A;  4M77 G;  2OTL T;  3RDV A;  4CC4 B;  2M02 A;  1M2V B;  2MWP A;  2P84 A;  1X86 A;  1S72 A;  4DBF A;  2MI6 A;  1JEG A;  3JB9 F;  2DLP A;  3TVT A;  1K9M R;  2Z0W A;  3JCM V;  1GRI A;  3HRS A;  5KYY A;  1VQL T;  4QVC A;  4M7D E;  1TOV A;  1JQQ A;  1OEB A;  1K9M U;  2LX7 A;  5EG2 A;  5GMK l;  4FU6 A;  2L3Q A;  3M0T A;  4KGZ B;  2RK1 A;  5GAN h;  3VYG A;  2SRC A;  4C92 B;  4C5G A;  5CCA A;  4M4Z A;  2XI9 A;  3HRU A;  2OTL Q;  2HAX A;  2QQS A;  1F5X A;  4EMK C;  1RI0 A;  3NFC A;  1TWB A;  2QQR A;  4N4G A;  2RJF A;  5IHN A;  1QVP A;  1OU8 A;  1ZHI A;  3PIO A;  1ZA1 B;  4M7A G;  2X3X D;  4BI4 A;  1NE8 A;  2QK0 A;  2GFA A;  3OW2 A;  2C0I A;  2DEQ A;  2RJC A;  4LNP A;  1PKS A;  1R0B G;  2XDD A;  5GAO p;  5A2Q E;  1YWP A;  4M77 B;  3PFS A;  4XU2 A;  2YSQ A;  5GAM h;  2XKO C;  1QW1 A;  2RQR A;  1VQM T;  2JTM A;  2MWO A;  4FL6 A;  4C92 F;  1PCX A;  1NPP A;  4CC7 A;  2FRY A;  2P4R A;  2COY A;  3VS3 A;  2FPF A;  4IUT A;  1V1C A;  4M78 F;  3JCM J;  4O5V A;  2A37 A;  4PLL A;  2EYW A;  2DNU A;  2DVJ A;  5CKF A;  4E7L A;  3PNW C;  2ZGW A;  3GIB A;  1X43 A;  2JTF A;  5GMK e;  3MPU B;  3ME9 A;  2I0N A;  3REA B;  1KQS S;  2CH4 W;  3URG A;  1M2V A;  2EJF A;  3SD4 A;  2DL5 A;  4QQD A;  4JRQ A;  4NL3 A;  3NTK A;  3UPU A;  3JCM X;  4D6W A;  1S72 Q;  1AOJ A;  2KDS A;  3REB B;  2DYB A;  4M77 F;  1UGS B;  3EO2 A;  2J6K A;  4BB7 A;  1AVZ C;  2GBQ A;  3ZEH A;  1VQM Q;  4J7I A;  3G6E A;  3H0F A;  2CRE A;  1Q95 G;  5JHH A;  2CGH A;  2K3X A;  2Y90 A;  1IO6 A;  3PGG A;  2DRM A;  1R77 A;  1ABQ A;  1RAD B;  4M7A B;  5D6Y A;  3M4G A;  4C92 A;  5I21 A;  2XD0 A;  1W2B A;  2DTH A;  4E2F B;  4C92 D;  2XDP A;  2YHT A;  1C6V X;  1XOV A;  1QVG P;  1OPL A;  4M78 D;  1N27 A;  2KY9 A;  3A8G B;  1C0M A;  3CCJ T;  2PVD B;  4L6V 5;  1KZG A;  2KXC A;  3QDR B;  2PNI A;  4GYV A;  2V8I A;  3OYA A;  1EFN A;  3V7S A;  1KK7 A;  2JM8 A;  1ZBX A;  3JCM P;  5FW9 A;  3S3O A;  1ZLM A;  3G1J A;  4M77 A;  4J5Y A;  2O9V A;  5LJ3 f;  4LXC A;  3I55 A;  1IHW A;  3C4S A;  4MDX A;  3J7A F;  3I35 A;  4F7U G;  4NL2 A;  3UF4 A;  1KI1 B;  5LJ3 d;  2XID A;  3SHW A;  3QYG B;  2LJ3 A;  2HD0 A;  2LQN A;  3WVD B;  3OYB A;  2Y4X A;  3M0Q A;  2DE0 X;  1YHQ A;  3HSB A;  3X24 B;  3CCJ Q;  1R8O B;  4B9W A;  2CT4 A;  4KUI A;  1BY1 A;  2YLB A;  2J6F A;  3NGP A;  2V8J A;  3CPW P;  2HKQ B;  2LJ1 A;  5DM7 R;  4YTL A;  3SWN C;  1YWO A;  3ASK A;  1BB9 A;  3QHS A;  3TSW A;  5GMK i;  2DET A;  4OGE A;  2DXU A;  3A5Z B;  2DF6 A;  2QI2 A;  1BKB A;  5LJ3 e;  1BI1 A;  3PMT A;  1M90 C;  1BI3 A;  1TUC A;  1QLY A;  4E7I A;  1AWO A;  3ZBD A;  1OYX A;  1N9R A;  2RD1 A;  4MT7 A;  4KH0 B;  2LQK A;  3EGD B;  3P8D A;  3MO8 A;  1MGQ A;  1WXB A;  1NJI C;  1AD5 A;  2BKD N;  1AEY A;  2HNI A;  1F1B B;  4KGV B;  5HKC A;  1BCM A;  2BIV A;  3L2Z A;  4OP0 A;  5FWB A;  3G6E Q;  3CC4 A;  4LDW A;  5D6X A;  5EC7 A;  4M7A A;  4N0A C;  3TQ7 P;  5CVI A;  1V76 A;  2DBK A;  2VXE A;  2ECZ A;  4IKF A;  2HQH A;  1U06 A;  2CT3 A;  1XCG A;  1K73 U;  4BD3 A;  1OU9 A;  4FSX A;  5GAN 7;  4M7D G;  4ZTF A;  3ULR B;  2KYM A;  4F7U B;  1B7T A;  4DBQ A;  3M55 A;  1BYM A;  6AT1 B;  1YJN T;  4GLK A;  1NLP C;  1KQ2 A;  3EH2 A;  4OB2 B;  4C92 E;  1MNE A;  3HRT A;  4J9I A;  2DTI A;  3BJI A;  2WSC E;  1UEB A;  2LNV A;  1QVG A;  3EGX B;  4M78 E;  4KGX B;  1HSQ A;  4O6J A;  2D6F A;  3UWN A;  2CP5 A;  1J3T A;  1PRL C;  1ZUY A;  5I2S A;  2KAF A;  1M8V A;  1N9S A;  3MEU A;  5HK0 A;  5FLX E;  5LJ5 g;  4X9D A;  1EX4 A;  2X35 A;  2EYZ A;  3EHQ A;  2BZ8 A;  3JV3 A;  1D09 B;  2D1X A;  1KFZ A;  4F7U F;  4M77 E;  1YJN Q;  2WAC A;  4FIB A;  1N6A A;  2MAM A;  1N8R U;  2XU8 A;  1G3Y A;  3TEE A;  1M3C A;  1CKA A;  1YJW A;  4C0D B;  2A7Y A;  2E6Z A;  4PJM A;  3RIR A;  3LW5 E;  3QBV B;  2DA9 A;  4CI0 C;  1W70 A;  2M9U A;  4FCY A;  1CSK A;  1I5O B;  3KFV A;  3KUF A;  3QBY A;  3SB2 A;  2J05 A;  4M7D B;  3CPW A;  3EGD A;  3S3N A;  1ZUK A;  3LH5 A;  2RB6 A;  4Z88 A;  1Q82 C;  1M90 R;  1WX6 A;  4PNO A;  4LN2 A;  1WJS A;  1VUB A;  3MCA B;  1ZSG A;  3EG9 B;  5GAN 6;  2EWN A;  2FB7 A;  2V26 A;  4J7F A;  1NJI R;  3H9N A;  2ZPH B;  4L59 A;  4ZN3 A;  3EFR A;  3ZFJ A;  1QCO A;  3OYH A;  1LB1 A;  1VYV A;  3BFM A;  1UHC A;  4QVZ A;  5KH6 A;  2KK4 A;  1VQN A;  2AK5 A;  1LVK A;  4OML A;  4C5I A;  4E6R A;  1VQ7 A;  2JT4 A;  4F7U A;  2ABL A;  2EQK A;  2ZPB B;  3CC2 A;  3DLL A;  3JSC A;  3CCS A;  2CZ1 B;  4RCC A;  1NG2 A;  1ZSZ B;  5GAN g;  3EGX A;  3CCV T;  4BUG A;  1WNL A;  2IG0 A;  1NEB A;  2FRW A;  1ABO A;  2DL4 A;  4HVV A;  5IXB A;  3GNG A;  4MMK A;  2JNG A;  1I8F A;  3CCL T;  2HZY A;  2DFU A;  4GBQ A;  3EG3 A;  1QVF A;  2EGC A;  4C92 C;  1NPR A;  1FMW A;  3A8H B;  4HCC A;  2YT6 A;  1OUL A;  4AFU C;  2DXB A;  4RMO A;  4OB0 B;  2KR9 A;  2W10 A;  2COW A;  2O88 A;  1YP5 A;  3OYC A;  5KYN A;  4ZNX A;  1HJD A;  4IUV A;  5GAM g;  3VS6 A;  1YJW Q;  1QVF S;  5DLO A;  3V8L A;  4DQ2 A;  3L2Q A;  4M7D A;  3CXC A;  3OSV A;  3QXE B;  3UDC A;  1Y07 A;  4M77 C;  1YNZ A;  1LOJ A;  1ZQ1 A;  3UT1 A;  1UUE A;  4F16 A;  2F1L A;  3CD6 T;  2M0O A;  4JJD A;  4XU1 A;  2DZ9 A;  1LNX A;  3EG9 A;  3F70 A;  3A8L B;  2EFI A;  4BI3 A;  1BI0 A;  4AT1 B;  4L5G A;  1Q82 R;  2XHC A;  2DXT A;  2R5M A;  2PVG B;  3C0C A;  4RG2 A;  1B07 A;  3P6A A;  1D0X A;  2M1H A;  1AWW A;  1UJY A;  3ODW A;  3G4S A;  1Q82 U;  2FL7 A;  3X26 B;  3QSU A;  2LCS A;  1G2B A;  2NYS A;  1GCQ A;  1O9S A;  3EG2 A;  4ORZ A;  2OJ2 A;  4HCB A;  5FRN A;  2L3R A;  3X28 B;  1ZSZ A;  4OMP A;  4IUU A;  2JJ9 A;  4FYY B;  1OV3 A;  1TUD A;  1X75 C;  2AZS A;  1M8M A;  4F7U E;  1WA7 A;  1HYO A;  4IUP A;  1E6G A;  4R56 A;  2DL8 A;  4M7A C;  5HK3 A;  4E7J A;  3PTA A;  3OYN A;  2EVR A;  1NYG A;  2NUZ A;  4A53 A;  1M1F A;  3L42 A;  2RA2 A;  8AT1 B;  4C92 G;  3OQ5 A;  3T06 A;  3L1A A;  5IXF A;  4M78 G;  2RPN A;  5C6S A;  2L89 A;  4CC2 A;  2H3J A;  4RTX A;  2E12 A;  2K57 A;  3GF9 A;  1WGS A;  4GOU A;  5GJV B;  1M4Z A;  1WFW A;  2DVE A;  3G71 T;  4D0O A;  2RQT A;  1Z9Z A;  5GMK m;  2K5F A;  1X69 A;  4HCZ A;  2P4T A;  1Y96 B;  4LDV A;  5IHK A;  2EPD A;  2YDL A;  1K8A C;  4F04 B;  1M1K C;  3M57 A;  5IH2 A;  2FZC B;  2VXF A;  3GPL A;  4PK4 A;  4Y91 A;  4LDY A;  2LCL A;  3PIP A;  4PJJ A;  5CR2 A;  2X4X A;  2ZPG B;  1VQ6 A;  4ZGE B;  5GAO l;  2LQ8 A;  2RI3 A;  1U5S A;  4ZGD B;  5CKB A;  2R5A A;  3M9Q A;  1ACM B;  4JLI A;  1GXI E;  3VV0 A;  3GF5 A;  7AT1 B;  3G71 Q;  5AT1 B;  3M4Y A;  2YUO A;  2FPE A;  2JMA A;  1QWE A;  2E70 A;  2E3H A;  4LUD A;  2QEX T;  2A28 A;  4JRK A;  2HKN A;  2R58 A;  3CC7 T;  1G83 A;  3OYL A;  4RTW A;  4M78 B;  1GFD A;  2QXF A;  2MMP A;  3V7R A;  1WHH A;  1VIE A;  2KMT A;  3JCM h;  3HP9 A;  4EDU A;  1H3H A;  2OTJ T;  1ZUU A;  2KE9 A;  4XK8 E;  2YUQ A;  2RQU A;  1XQH A;  3QWX X;  2ESW A;  4MZM A;  1UB4 A;  1X2K A;  4QKU A;  2CUD A;  1ZBJ A;  2BZY A;  4PJO F;  3M0R A;  2ZCF B;  1RI9 A;  1KHC A;  5LJ5 f;  1JJ2 A;  1S72 T;  4KT0 E;  4DOV A;  1JXO A;  2HL3 A;  3OYY A;  3VU3 C;  4B6M A;  1IB8 A;  1YIT A;  3EH1 A;  2QEX Q;  1K4U S;  4OMM A;  2FO0 A;  4ZN1 A;  2DJQ A;  3M53 A;  5LJ5 d;  3CC7 Q;  2K79 A;  3VUB A;  3FIF A;  1WYX A;  2HDA A;  1JB0 E;  5GMK j;  5GAN 3;  4BDZ A;  1SPK A;  3JRZ A;  3HHT B;  1I07 A;  2HCK A;  4BAC A;  3OW2 S;  4JJN K;  2KR3 A;  3KXT A;  2DPP B;  1YJ9 A;  1SSF A;  2E1H A;  4JJC A;  3X25 B;  2EBP A;  2OTJ Q;  3R6O A;  1PG5 B;  4JUV A;  1D1C A;  2GF7 A;  2JTE A;  1IRX A;  1YFN A;  1QP3 A;  2QDL A;  2O9S A;  4KBM B;  2YUN A;  3LX7 A;  1RUW A;  1RLQ C;  4J9G A;  5LJ5 e;  3OYD A;  5IHI A;  1YI2 A;  2DO3 A;  4WTO B;  4DEY A;  2C0T A;  4DBH A;  1K8A R;  1SEM A;  4OMO A;  1K73 C;  3QZ9 B;  1QKX A;  2EQM A;  4XU3 A;  1M1K R;  3PVQ A;  3HPW A;  3PMI A;  4BY6 B;  4XAX B;  3EAE A;  4PJO D;  4A4K A;  1Y57 A;  1UTI A;  1TUG B;  1PD1 A;  1K8A U;  1Q81 U;  2RN8 A;  4C0D C;  1MV3 A;  1M1K U;  2L0A A;  1FMK A;  2LP5 A;  5A0G A;  3V7C A;  4R55 A;  4XTV A;  2CDT A;  2RO0 A;  1E7O A;  2D0Q B;  1GBR A;  3HFO A;  4M7D C;  4M78 A;  3VJP A;  3AT1 B;  4Y92 A;  1K0X A;  2KRN A;  3HTR A;  5KE2 A;  2ZPE B;  4OF1 A;  4JS5 A;  2QQ9 A;  5GAN f;  3I5R A;  5IN1 A;  1FOE A;  4M75 D;  3BDL A;  3J81 E;  2COZ A;  5FWC A;  2QTV A;  1JXM A;  3D7S B;  2K9G A;  1W2B S;  5GAN d;  2YXY A;  5KYU B;  4JS4 A;  1LCK A;  2F2V A;  4PJN A;  1B34 B;  3OYI A;  1VOM A;  2ZAE A;  4E7Z A;  1N8R C;  2JM9 A;  1SRM A;  1TTH B;  3PE0 A;  3OSS C;  3EG0 A;  3H0I A;  3JB9 I;  1RAG B;  1GCQ C;  4EMH A;  3NMZ C;  3O8V A;  1TS9 A;  1VIF A;  3G6E T;  3MHX A;  4JPB W;  3RKX A;  2CZ0 B;  5CO7 A;  4Z8A A;  1ZSZ C;  3U23 A;  2OAW A;  4P5N A;  4R0K A;  5GAN e;  3ER0 A;  2HSP A;  3KY9 A;  1M2O A;  2C0O A;  5LJ3 j;  1JBM A;  5GAM f;  1WIE A;  3QO3 A;  1EZZ B;  1Y7X A;  3M56 A;  4J6Y A;  4C0Z A;  1KG1 A;  1M3A A;  5GAM d;  3CCM A;  4AG2 C;  4BE0 A;  1M27 C;  3M5A A;  3TSZ A;  2KT8 A;  4ZTJ A;  2DJZ A;  2RNA A;  1YI2 Q;  2VUB A;  2V1R A;  3H8Z A;  2KT1 A;  2P0P A;  2EKO A;  3LGL A;  2QA4 A;  1SHG A;  2FVU A;  2EYQ A;  4XTY A;  2QYZ A;  1BIB A;  4VUB A;  3S3M A;  3CCU A;  1K73 R;  4LDX A;  4ATO A;  2LMJ A;  5GAM e;  2LT4 A;  3I55 T;  1PC0 A;  2DD5 A;  2KYB A;  2DIL A;  4OGC A;  3JCM c;  2DZC A;  1RAF B;  4JZ4 A;  2X3W D;  2AKL A;  2ED0 A;  3RMQ A;  5KYW B;  4PJO E;  2O4X B;  1K9A A;  2WSF E;  3MP8 A;  1VQO A;  2PUO B;  4C0G A;  2Y4Y A;  1Z9Q A;  2QTX A;  3UAT A;  2RF0 A;  1VQP A;  1RL2 A;  4E7K A;  1YHQ T;  1Q86 U;  2KRS A;  1OI1 A;  1RJ2 A;  1FXX A;  3RUX A;  2DK3 A;  3CBM A;  2F2X A;  2EQU A;  2RI5 A;  1GFC A;  3QUI A;  2JMC A;  5KYU A;  2EQJ A;  3RKW A;  1B34 A;  4PFP A;  1H64 1;  2HQE A;  2X4J A;  3C94 A;  3I55 Q;  2FZG B;  2M0Y A;  4OMN A;  4F14 A;  5I2M A;  2KQW A;  2AHJ B;  1N8R R;  2CZ7 B;  5IAY A;  2ED1 A;  4X1V A;  1QVG S;  2AKK A;  2JXB A;  2ZPF B;  3CC4 T;  1VQK A;  3TU4 K;  1YHQ Q;  1RAC B;  3L2V A;  2VAS A;  4A54 A;  1I5L A;  2FHD A;  3O5Z A;  4FM4 B;  4DOW A;  3QYH B;  1K1Z A;  1WHG A;  2CYZ B;  1O75 A;  2P0Q A;  5C0M A;  2A36 A;  2BE7 D;  1VQ5 A;  5L23 A;  1S1N A;  3G7Z A;  2LT1 A;  2BE9 B;  3CCM Q;  2QAS A;  2OX7 A;  5IT9 E;  2DMO A;  1A0N B;  1M5Q 1;  3FLG A;  4FSS A;  1MMN A;  2K3B A;  1YN8 A;  3OS5 A;  4KH1 B;  2QG9 B;  2KNB B;  3EGU A;  2QGF B;  3VS2 A;  1QMC A;  3E9F A;  2VC8 A;  2LZ6 B;  4C5H A;  3JAM E;  3CC4 Q;  2KGT A;  1Y0M A;  3CCU Q;  1U1T A;  5FI1 A;  3HL8 A;  2KXD A;  1UJ0 A;  2LX9 A;  4OB1 B;  5M9O A;  4JDS A;  1BU1 A;  1H3Z A;  2NZ8 B;  3L2W A;  3CPW S;  5KYW A;  2O4X A;  2L8D A;  3LLR A;  4RTZ A;  2RI2 A;  1TSF A;  1G3W A;  1W4S A;  1D3B B;  2VRW B;  2GQV A;  1KJW A;  2JZ2 A;  2DX1 A;  3VRZ A;  1VQP Q;  1OPK A;  4HXJ A;  1KSW A;  3CME A;  5A0D A;  2CP2 A;  4HCK A;  3QWY A;  3FJP A;  1YJW T;  2EGE A;  3JB9 H;  1TU0 B;  3OMG A;  1BIA A;  4RKU E;  3OS2 A;  3H41 A;  2EJG A;  1G8X A;  1VYU A;  5FU6 B;  1OZ2 A;  3JCM g;  1U1S A;  2KRM A;  4C8Q B;  4GLM A;  3BY7 A;  2DAQ A;  5DLQ E;  1QKW A;  2NLU A;  4M78 C;  4FW1 A;  3JCM Q;  3PT9 A;  5KYX B;  1X6O A;  2O01 E;  2BZX A;  3M58 A;  4QQG A;  4MZT A;  1TXQ A;  3C12 A;  3MP6 A;  2FZK B;  4OB3 B;  4C5E A;  3VYH B;  4QQ6 A;  4XU0 A;  1VQN T;  2LJ0 A;  1VQ7 T;  4V2S A;  4HVU A;  2QDY B;  4RCB A;  3CC2 T;  1KD1 C;  1VQ5 Q;  2JS0 A;  3FEO A;  3CCE A;  3MP1 A;  5J26 A;  3CCS T;  1IZ6 A;  5JHG A;  1PSE A;  3I56 A;  1GCP A;  2AZV A;  4C8Q F;  3CMA A;  2VGM A;  2D8J A;  3J80 E;  4MML A;  4EMG A;  2QGG A;  2O31 A;  1VQ9 A;  4FW2 A;  4FYV B;  1AHJ B;  3CXC S;  2NUP B;  3MKD A;  4DEX A;  1AZG B;  4KUD K;  4AFS C;  1KIK A;  1D3B A;  1VQN Q;  3OS1 A;  2CH4 A;  3H0H A;  1VQ7 Q;  2B8A A;  2MF2 A;  3CC2 Q;  5HCK A;  1VYT A;  2IIM A;  1OX8 A;  4Q5W A;  2V8K A;  2EW3 A;  2P0K A;  3CCS Q;  3CME Q;  9ATC B;  4PFZ A;  1ZX6 A;  1UE9 A;  1YIJ A;  4BY6 C;  3WXM B;  3SFM A;  2E10 A;  5CIU A;  4PJO G;  5GAO r;  1G3S A;  1U8R A;  2RM4 A;  1X6G A;  4LD9 K;  2PU9 B;  2JS2 A;  3E9G A;  4FT2 A;  3N5B B;  3ODO A;  4MZP A;  2OTL A;  1FYN A;  2HBP A;  2W0Z A;  3CCE T;  3X20 B;  2HMA A;  3OB9 A;  4C8Q D;  5FU7 B;  4IUQ A;  3OW2 P;  3FDR A;  4Z89 A;  2GCX A;  5KYX A;  2LTO A;  5KE3 A;  4ESR A;  2LNH B;  1VQL A;  2DTO A;  1WQ7 A;  3P8B B;  2WSE E;  3VS7 A;  1KQS P;  2L2P A;  5GAO m;  4QVD A;  2HQX A;  1MMD A;  1WJR A;  2CUB A;  5FRO A;  4M75 G;  3OY9 A;  2C06 A;  2HEQ A;  3FJ5 A;  3G4S T;  1YCS B;  4JJB A;  2XIC A;  2LRQ A;  3CCR A;  1KHI A;  4QW2 A;  3QJ6 A;  2L3S A;  5D6W A;  1UDL A;  1BI2 A;  1MHN A;  1Q81 C;  4IUR A;  3CCE Q;  1KD1 R;  3QG1 A;  5GAN 4;  1YIJ T;  1HXD A;  4ELZ C;  2PZ1 A;  3P8H A;  4RUG A;  1M30 A;  2OI3 A;  1KD1 U;  2K6D A;  2NUP A;  1YBY A;  2CS7 A;  1QCN A;  2ATC B;  4PJO B;  1I1J A;  4J9H A;  1AWX A;  3EHR A;  4N4I A;  1LJO A;  2EJ9 A;  4RTV A;  2B86 A;  3MJX A;  3G4S Q;  3GLX A;  4FT4 A;  1SF9 A;  4GZU A;  1NTY A;  3QPH A;  3OYM A;  1VQM A;  1UHF A;  1PHT A;  1X27 A;  2D8H A;  1HD3 A;  2E4H A;  5CKH A;  4Z02 A;  1W2B P;  1XTD A;  5I22 A;  3GNF B;  2RQW A;  2CKK A;  2HL5 C;  4TVR A;  3VS4 A;  1YIJ Q;  3EFS A;  2CZ6 B;  2CP7 A;  4M75 B;  3CCR T;  2F5T X;  3CCQ A;  1ARK A;  2RHU A;  4XTW A;  2M51 A;  4QT7 A;  2O2O A;  2DKG A;  1NLO C;  4J8O A;  4PFO A;  4E7H A;  2PUK B;  4AFZ C;  2E5K A;  1RAB B;  2K5I A;  2D9T A;  3LWI A;  5LJ3 h;  2IVW A;  2GTJ A;  2KVQ G;  1VQL Q;  5CAI A;  2EIF A;  1I81 A;  1VQ6 T;  5D7U A;  4C8Q E;  1IXD A;  3QII A;  3JB9 D;  4JLG A;  2H3E B;  3OYE A;  3MEA A;  5LJ5 j;  1Y96 A;  1JJ2 S;  5A0L A;  1TXD A;  1WZO A;  1WI7 A;  3QKJ A;  3A98 A;  4M75 F;  3CCR Q;  4Y28 E;  1KQS A;  1LPL A;  1PWT A;  3M54 A;  1XJW B;  2K5L A;  3OYG A;  3CCJ A;  3GOX A;  2RHI A;  2RJD A;  3KBG A;  2CP0 A;  4HVW A;  5GAN 8;  1Q81 R;  1RLP C;  2AIR B;  4WCI A;  3QZ5 B;  1H92 A;  1D0Z A;  1RAI B;  4XTU A;  3CCQ T;  4JZ3 A;  4PJO A;  2E65 A;  1VQ6 Q;  2KSS A;  2E64 A;  1RAE B;  1Q86 C;  2QQA A;  3DB4 A;  3RBB B;  3RNJ A;  2KRO A;  5GAN 2;  3EFO B;  3ZL7 C;  2EYY A;  1YIT T;  2K7A A;  1MMA A;  2H8H A;  1IHV A;  2CSQ A;  3M0P A;  1RAA B;  1SG5 A;  4JRP A;  2DFK A;  4LUE A;  4MDW A;  2ZZD A;  2FPD A;  2MYS A;  1AZE A;  4KRT A;  2A0F B;  4NOY A;  2RHZ A;  2K2V A;  3HKS A;  3I9Q A;  4M75 A;  3FRN A;  1YJ9 T;  2DBM A;  2A3L A;  4XTX A;  5ECA A;  5GJW B;  3E19 A;  3CCQ Q;  2RHY A;  2VYT A;  4F17 A;  2Z0Q A;  2E6N A;  4A63 B;  4A4H A;  1YI2 T;  3JCM f;  2MK5 A;  1IGU A;  5GAN j;  2E5Q A;  4D8D A;  2VV5 A;  1YIT Q;  1QQJ A;  3JCM d;  1NYF A;  2MIO A;  1I4K 1;  2CP3 A;  4C0F A;  3NHN A;  2ENM A;  2IPO B;  4M7A F;  4M77 D;  3QJY A;  1X2Q A;  3MET A;  2JN0 A;  1YJ9 Q;  5GAO q;  1IGQ A;  4KUL A;  1QCF A;  5FU6 C;  2JOY A;  2A08 A;  1VQ8 A;  2VVK A;  3E1S A;  4J9F A;  4C8Q C;  2GTO A;  3JCM e;  1YJN A;  3A8O B;  3SEM A;  3LGF A;  1QWF A;  4HA8 A;  3Q1J A;  3VS0 A;  2AT1 B;  5GAM j;  1R0C B;  4E7S A;  1MUZ A;  5FI0 A;  1JRI A;  2YRV A;  3HFN A;  1W6X A;  3KZ1 A;  3NTH A;  1KC8 C;  1BK2 A;  2MOX A;  2EAY A;  1PD0 A;  2CP6 A;  1WPY A;  3EFO A;  5AYF A;  1D1A A;  4PL6 A;  4RTT A;  1C1A A;  1Q86 R;  1QP2 A;  2HSE B;  4EMK B;  4RG8 A;  2F69 A;  1SHF A;  1WQW A;  2MPX C;  2M16 A;  4M7A D;  4HT9 A;  1AWJ A;  2RQV A;  2DIG A;  3CBP A;  1B3Q A;  3VRY A;  3DLM A;  2RH2 A;  1VQ8 T;  1P92 A;  2DL7 A;  1SSH A;  2PQW A;  3CCM T;  4XTZ A;  4J9B A;  3OBY A;  2SEM A;  4AG1 C;  1OOT A;  4M75 E;  1XNI A;  2VWF A;  1PKT A;  1KZ7 A;  1TH7 A;  2XK0 A;  3A8M B;  1MMG A;  4CRI A;  1T3L A;  2EGA A;  1UGV A;  2QA4 T;  1QVF P;  3TCJ A;  4ZGJ B;  3LYI A;  2DXC A;  5CK9 A;  3CCU T;  3OS0 A;  4D0N B;  2L3P A;  4HT8 A;  2LDM A;  3GP8 A;  3I5S A;  5GAN 5;  3E2U A;  3UA6 A;  3OMC A;  4UC4 A;  2XDB A;  1VQ4 A;  1T0H A;  2F5K A;  3L2U A;  3FC3 A;  4ELY C;  3LH0 A;  1DJ7 B;  3S6W A;  1VQ8 Q;  2XG8 D;  2KBT A;  3H6Z A;  1VQO T;  1Q7Y C;  5FU7 C;  2DYI A;  1VQP T;  4C8Q G;  2VB6 A;  4ME7 A;  2QQB A;  4RTU A;  3CXC P;  2VKN A;  1WHJ A;  3M0S A;  4J9C A;  3QDF A;  3CPF A;  3CCV A;  3MEW A;  4RTY A;  4FYW B;  3KSY A;  2J6O A;  5CQX A;  2LQW A;  1MV0 B;  5L8R E;  2QA4 Q;  2XMF A;  1SRL A;  3RR6 A;  2JW4 A;  1ZA2 B;  1U3O A;  1GBQ A;  5LL6 S;  3VS5 A;  1EIF A;  2YLC A;  2NWM A;  3C95 A;  3CCL A;  3T9N A;  3TRE A;  3BW1 A;  2DL3 A;  3SDZ A;  1D1B A;  1KC8 R;  4EMK A;  1V29 B;  1X6B A;  2GQI A;  1WLP B;  4OMF B;  2RGN B;  2DRK A;  2ROL A;  4J9D A;  4LD6 A;  3MPX A;  4B9X A;  4OMQ A;  4JRI A;  2KEA A;  4A4E A;  2QAZ A;  1VQO Q;  3VKI A;  1KC8 U;  2DER A;  1M90 U;  1VQK T;  2X9H A;  3RES A;  3R6N A;  2LVM A;  5CKE A;  1FWZ A;  4AFQ C;  2RMO A;  2RHX A;  1VQ4 T;  1NM7 A;  4J83 A;  1NJI U;  4PJO C;  2GGR A;  2EKH A;  3IQL A;  4M7A E;  1VQ5 T;  2V1Q A;  3M0U A;  2NUT B;  4EPC A;  4M7D F;  2L5Q A;  8ATC B;  4PLI A;  3CEY A;  1OQK A;  2YWW A;  1K76 A;  3CD6 A;  2KI7 A;  2D0N A;  5CKD A;  4X34 A;  4EIK A;  1UGP B;  1GL5 A;  4J6X A;  4YON A;  1UG1 A;  1RAH B;  2FG0 A;  3NTI A;  4BDY A;  2MCN A;  4GY5 A;  3SWN B;  2I2L A;  1VQK Q;  1XD4 A;  4DA4 A;  4E47 A;  5LJ3 g;  4M75 C;  3OBW A;  1UFF A;  4X9C A;  1VQ4 Q;  3PVL A;  3JB9 J;  4BI8 B;  2FEI A;  1TG0 A;  2RJE A;  4IIO A;  4PJL A;  1WXU A;  1PRM C;  2GFU A;  1WDX A;  3OYK A;  2CSI A;  3CBO A;  3CQT A;  5GAO n;  2J06 A;  3CME T;  4A4F A;  2X4Y A;  2DM1 A; 
#chains in the Genus database with same CATH homology
 2B86 A;  3I5R A;  3EG1 A;  1FOE A;  4GZU A;  1NTY A;  2EYZ A;  3EHQ A;  5FWC A;  1JXM A;  2BZ8 A;  3JV3 A;  1T3S A;  1UHF A;  4J9E A;  1JO8 A;  1NEG A;  2EQI A;  2K9G A;  1PHT A;  2D1X A;  1X27 A;  2D8H A;  1HD3 A;  1KFZ A;  1LCK A;  2F2V A;  5I22 A;  1UEC A;  2JM9 A;  1SRM A;  1N5Z A;  2K2M A;  2RQW A;  3VS4 A;  3PE0 A;  1M3C A;  3EG0 A;  3H0I A;  1CKA A;  1GCQ C;  1I0C A;  3NMZ C;  3ODX A;  3QBV B;  2DA9 A;  1W70 A;  1ARK A;  3VS1 A;  4JPB W;  2M51 A;  4QT7 A;  1CSK A;  4Z8A A;  2O2O A;  4D8K A;  3KFV A;  3U23 A;  1NLO C;  2OAW A;  2J05 A;  4R0K A;  2HSP A;  3KY9 A;  1VA7 A;  4AFZ C;  1ZUK A;  2C0O A;  3NPF A;  2E5K A;  3LH5 A;  5I11 A;  4Z88 A;  3GBQ A;  1WIE A;  1WX6 A;  2GTJ A;  4LN2 A;  1ZSG A;  1M3A A;  4AG2 C;  1E6H A;  1M27 C;  3TSZ A;  2KT8 A;  1LB1 A;  2EYX A;  2RNA A;  1M3B A;  1VYV A;  1UHC A;  2V1R A;  1DBH A;  2KT1 A;  2AK5 A;  2J7I A;  2ROT A;  4OML A;  4E6R A;  2BTT A;  1T0J A;  1TXD A;  2YUP A;  1WI7 A;  1SHG A;  2JT4 A;  3A98 A;  1PNJ A;  2ABL A;  2PTK A;  1PWT A;  4K11 A;  1WXT A;  1W1F A;  2LMJ A;  1K0S A;  1BBZ A;  4HVW A;  1NG2 A;  2DIL A;  2KYB A;  1JU5 C;  4JZ4 A;  1H8K A;  2X3W D;  2AKL A;  1RLP C;  2ED0 A;  4WCI A;  4LE9 A;  1NEB A;  1H92 A;  3THK A;  1K9A A;  2FRW A;  4JZ3 A;  1ABO A;  3UA7 A;  1Z9Q A;  3UAT A;  2DL4 A;  2RF0 A;  4HVV A;  5IXB A;  3RBB B;  4GBQ A;  2KRS A;  3EG3 A;  3RNJ A;  1RJ2 A;  2G6F X;  2KRO A;  2EGC A;  3ZL7 C;  2F2X A;  2EYY A;  2GNC A;  2K7A A;  1GFC A;  2JMC A;  2YT6 A;  2H8H A;  2HBW A;  4AFU C;  1CKB A;  2CSQ A;  3M0P A;  4CC3 A;  2DFK A;  2F2W A;  4LUE A;  2KR9 A;  2W10 A;  4IIM A;  2O88 A;  2FPD A;  1AZE A;  4CC4 B;  4KRT A;  1YP5 A;  4ZNX A;  1X86 A;  1HJD A;  3I9Q A;  1JEG A;  2DLP A;  3TVT A;  2M0Y A;  4OMN A;  3VS6 A;  4F14 A;  1GRI A;  2DBM A;  2ED1 A;  1JQQ A;  4X1V A;  5ECA A;  5GJW B;  2AKK A;  2JXB A;  1OEB A;  4F17 A;  2Z0Q A;  1YNZ A;  4A63 B;  1UUE A;  4F16 A;  2LX7 A;  3O5Z A;  4JJD A;  1K1Z A;  2L3Q A;  3M0T A;  4D8D A;  2A36 A;  2SRC A;  1NYF A;  5L23 A;  1S1N A;  2MIO A;  3C0C A;  4M4Z A;  1B07 A;  3P6A A;  2DMO A;  3NHN A;  1A0N B;  1AWW A;  1UJY A;  2ENM A;  1F5X A;  4FSS A;  3ODW A;  2K3B A;  1YN8 A;  1X2Q A;  3EGU A;  2KNB B;  2LCS A;  1G2B A;  1GCQ A;  5IHN A;  1QCF A;  3VS2 A;  3EG2 A;  4ORZ A;  2A08 A;  2OJ2 A;  2LZ6 B;  2X3X D;  2KGT A;  1Y0M A;  2VVK A;  5FI1 A;  4J9F A;  2GTO A;  4OMP A;  2C0I A;  2KXD A;  1UJ0 A;  3SEM A;  1OV3 A;  1QWF A;  1BU1 A;  4LNP A;  2NZ8 B;  1TUD A;  1PKS A;  3VS0 A;  2AZS A;  1M8M A;  1YWP A;  4RTZ A;  2YSQ A;  1WA7 A;  2RQR A;  1MUZ A;  5FI0 A;  2VRW B;  1E6G A;  1KJW A;  1W6X A;  2DL8 A;  2DX1 A;  3KZ1 A;  4CC7 A;  1BK2 A;  2FRY A;  3VRZ A;  2P4R A;  2MOX A;  2EVR A;  3VS3 A;  1OPK A;  1NYG A;  2FPF A;  4HXJ A;  1V1C A;  1KSW A;  2NUZ A;  2A37 A;  4HCK A;  2EYW A;  4RTT A;  3QWY A;  2DNU A;  2DVJ A;  3T06 A;  2EGE A;  1X43 A;  5IXF A;  2RPN A;  4CC2 A;  2I0N A;  3REA B;  4RTX A;  1SHF A;  2CH4 W;  3H41 A;  3GF9 A;  1VYU A;  2DL5 A;  4GOU A;  5GJV B;  1AWJ A;  2RQV A;  1WFW A;  4D0O A;  2KRM A;  1Z9Z A;  1AOJ A;  2RQT A;  3REB B;  4GLM A;  2DYB A;  3EO2 A;  2J6K A;  1B3Q A;  3VRY A;  1X69 A;  1QKW A;  1AVZ C;  2GBQ A;  3H0F A;  5IHK A;  2DL7 A;  2CRE A;  1SSH A;  2EPD A;  5JHH A;  2BZX A;  2YDL A;  4J9B A;  1IO6 A;  2SEM A;  4AG1 C;  2DRM A;  1ABQ A;  5IH2 A;  1OOT A;  2VWF A;  1PKT A;  1KZ7 A;  1T3L A;  2LJ0 A;  2EGA A;  1UGV A;  4HVU A;  1XOV A;  1OPL A;  2JS0 A;  4D0N B;  2L3P A;  1U5S A;  3I5S A;  5JHG A;  1KZG A;  2KXC A;  3UA6 A;  2PNI A;  1GCP A;  2AZV A;  2YUO A;  1T0H A;  2FPE A;  2JMA A;  4GYV A;  1QWE A;  2D8J A;  4LUD A;  1EFN A;  2A28 A;  2O31 A;  2JM8 A;  2KBT A;  1G83 A;  4RTW A;  5FW9 A;  4RTU A;  1GFD A;  1ZLM A;  2VKN A;  4DEX A;  1AZG B;  2O9V A;  3M0S A;  4J9C A;  4AFS C;  1KIK A;  4RTY A;  3I35 A;  3KSY A;  2J6O A;  2CH4 A;  1KI1 B;  3H0H A;  3UF4 A;  2LQW A;  1MV0 B;  1H3H A;  2XMF A;  1SRL A;  1ZUU A;  2KE9 A;  2YUQ A;  3SHW A;  5HCK A;  2LJ3 A;  2RQU A;  2LQN A;  2JW4 A;  3QWX X;  1VYT A;  2ESW A;  1U3O A;  1GBQ A;  1X2K A;  2IIM A;  3M0Q A;  2CUD A;  2DE0 X;  1ZBJ A;  2BZY A;  3VS5 A;  2NWM A;  3M0R A;  2EW3 A;  1RI9 A;  2CT4 A;  2DL3 A;  1ZX6 A;  1BY1 A;  1UE9 A;  2J6F A;  1JXO A;  1X6B A;  2GQI A;  3NGP A;  1WLP B;  2RGN B;  2DRK A;  2ROL A;  4J9D A;  2LJ1 A;  3MPX A;  1YWO A;  1K4U S;  1BB9 A;  4OMQ A;  1X6G A;  2KEA A;  2FO0 A;  4OMM A;  2DJQ A;  3TSW A;  2K79 A;  2JS2 A;  1WYX A;  2HDA A;  3ODO A;  2DF6 A;  1FYN A;  1TUC A;  2W0Z A;  1QLY A;  1SPK A;  1AWO A;  1I07 A;  2HCK A;  3R6N A;  2KR3 A;  4MT7 A;  2RMO A;  4AFQ C;  4Z89 A;  1NM7 A;  1WXB A;  1AD5 A;  4ESR A;  2LNH B;  1AEY A;  4JJC A;  2EBP A;  2GGR A;  2EKH A;  2JTE A;  3IQL A;  5FWB A;  2QDL A;  2O9S A;  2V1Q A;  3M0U A;  5EC7 A;  3VS7 A;  2L2P A;  2YUN A;  1RUW A;  1RLQ C;  4J9G A;  5IHI A;  2CUB A;  2DBK A;  1K76 A;  4DEY A;  2C0T A;  2HEQ A;  2ECZ A;  3FJ5 A;  1U06 A;  2D0N A;  2CT3 A;  1XCG A;  1SEM A;  4OMO A;  1YCS B;  4JJB A;  1QKX A;  4EIK A;  1GL5 A;  4YON A;  1UG1 A;  3PVQ A;  2FG0 A;  2L3S A;  3ULR B;  2KYM A;  1Y57 A;  1UDL A;  1UTI A;  2MCN A;  1XD4 A;  2RN8 A;  1NLP C;  1MV3 A;  2L0A A;  1FMK A;  2LP5 A;  1UFF A;  2PZ1 A;  2CDT A;  3PVL A;  4J9I A;  3BJI A;  1E7O A;  2FEI A;  1GBR A;  4RUG A;  1M30 A;  2OI3 A;  1HSQ A;  1TG0 A;  4IIO A;  2K6D A;  1WXU A;  1PRM C;  1J3T A;  1WDX A;  2CSI A;  4Y92 A;  1PRL C;  3CQT A;  1K0X A;  1I1J A;  1ZUY A;  2KRN A;  2J06 A;  4J9H A;  1AWX A;  3EHR A;  4RTV A;  2DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...