3JV3A

Structure of sh3e-dh unit of murine intersectin-1l
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
278
structure length
278
Chain Sequence
GSCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The minimal autoinhibited unit of the guanine nucleotide exchange factor intersectin.
pubmed doi rcsb
molecule keywords Intersectin-1
molecule tags Protein binding
source organism Mus musculus
total genus 105
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3jv3A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3jv3A01
2OI3A 4CC2A 1PHTA 4ZNXA 1NYGA 2O2OA 1MV3A 4F16A 4RTVA 2K7AA 4OMMA 4J9BA 2EGAA 1BBZA 4J9CA 2O9SA 2CH4W 1AOJA 4DEXA 2DJQA 5ECAA 3VS6A 2LZ6B 4IIOA 1SRLA 2LX7A 1YWOA 2DL7A 2ROLA 2K2MA 2VRWB 1WIEA 1FMKA 1SPKA 1PWTA 1NLOC 2KRNA 1OV3A 2AK5A 1GFDA 2IIMA 3PE0A 1X69A 1QCFA 2P4RA 3REBB 4J9EA 5FWCA 2A37A 1YP5A 2D8JA 1FYNA 2L3QA 2ESWA 4JJCA 2JM8A 2KGTA 5L23A 2PZ1A 2DLPA 2HEQA 4RTWA 2NUZA 3M0PA 1BK2A 2X3WD 2O88A 2ED0A 4X1VA 2BZYA 2GNCA 3SHWA 1AEYA 4HVUA 5IHNA 2DA9A 3KFVA 1GCQC 1A0NB 2JTEA 3VS5A 2DL8A 2LMJA 4LNPA 1UGVA 1VA7A 2GBQA 2VWFA 3I35A 1SSHA 2C0IA 3M0SA 1OPKA 4K11A 2J6KA 3QBVB 1JXMA 1RI9A 1TUDA 3VS7A 3TVTA 2RF0A 5IH2A 2D0NA 3ODOA 2FEIA 1W70A 1WYXA 1KIKA 1ABQA 1W6XA 3H0IA 3I9QA 1YWPA 1CSKA 2HSPA 2XMFA 2M0YA 1Y57A 3UF4A 1M27C 3H41A 4OMQA 3R6NA 1GRIA 3UA6A 3NHNA 2CH4A 1X6GA 4OMOA 4E6RA 2YT6A 3SEMA 2DBKA 2CUBA 2KBTA 2ROTA 1KJWA 4RTZA 2YUNA 3JV3A 5FWBA 2AZVA 2DX1A 2C0TA 2X3XD 1UFFA 1JQQA 3EG0A 4Z88A 2L3PA 2B86A 1M8MA 2KROA 1N5ZA 1GBQA 1UUEA 4GYVA 5JHHA 1UECA 2LNHB 2FG0A 2KRMA 1M3CA 4OMPA 2M51A 5IXFA 4LUEA 3EO2A 4AFZC 5I22A 2J6OA 4HVVA 4Z89A 1X43A 3M0QA 3M0TA 4RTUA 4MT7A 1AVZC 2EYXA 1F5XA 1MUZA 3H0FA 1AZEA 2KT1A 2EVRA 2GTOA 1ZX6A 1GCQA 2L3SA 2RQVA 1ZSGA 4RTXA 3QWXX 2VKNA 2SEMA 1OEBA 1WFWA 2YUQA 1H3HA 2MCNA 1YCSB 2A36A 1WXUA 2CT4A 3REAB 2HBWA 1AD5A 1T3LA 2YSQA 1ZLMA 1RLQC 1T0JA 2OAWA 5JHGA 2EKHA 1RUWA 2KR9A 1HD3A 1Y0MA 1NYFA 2CDTA 2JXBA 2O9VA 1K9AA 5I11A 2HDAA 1TG0A 2GTJA 2J06A 2GGRA 1WXBA 4DEYA 1EFNA 2YDLA 3GF9A 2DF6A 3VRZA 3MPXA 2DL3A 4EIKA 2KE9A 4HVWA 1LB1A 1JU5C 1ZUYA 3ULRB 4AFUC 2KNBB 4HCKA 1UG1A 2K6DA 3KSYA 2K9GA 5GJVB 3BJIA 3THKA 4YONA 1JEGA 1WLPB 1QKXA 1M3AA 1WXTA 2J6FA 1I0CA 1JXOA 2FPEA 2Z0QA 1Z9QA 2MOXA 4J9GA 1AWOA 2O31A 3O5ZA 1NLPC 4JJBA 1RJ2A 2SRCA 2BZXA 1PKTA 3LH5A 4ORZA 1RLPC 3UA7A 4AG2C 2CUDA 4FSSA 2FRYA 2RQRA 2EW3A 3T06A 1QWEA 2RQWA 2CSIA 2DM1A 3VS4A 1KI1B 5FI1A 2J05A 1I07A 1UHFA 2KXDA 3M0RA 2RMOA 3PVQA 5HCKA 4RTTA 1KZ7A 3H0HA 4M4ZA 4OMNA 3EG3A 1QLYA 2DYBA 2DFKA 2J7IA 2C0OA 2OJ2A 1U5SA 5IHIA 1CKBA 1X86A 1ZUUA 2EPDA 3TSWA 2EQIA 2RGNB 2KRSA 1K0SA 2AZSA 2ECZA 1YN8A 1PRLC 1PNJA 1UHCA 1VYTA 2AKLA 1U06A 2DBMA 1E7OA 1M3BA 2DRKA 2GQIA 5FI0A 4R0KA 1SHGA 2RQUA 2EGEA 3IQLA 1SRMA 1GFCA 3FJ5A 3NGPA 1XOVA 1CKAA 2DE0X 2RQTA 4JJDA 3C0CA 4HXJA 4LN2A 4ESRA 1DBHA 1NEGA 2BZ8A 2DL5A 2DMOA 3PVLA 4Y92A 1SHFA 3RBBB 2KYMA 1K0XA 2FPDA 4KRTA 1AWWA 1B3QA 3VRYA 4D8DA 1X2KA 1BB9A 4A63B 1VYUA 5IXBA 1BY1A 1PKSA 1FOEA 3CQTA 2KYBA 2ED1A 3M0UA 2DNUA 2LJ0A 1X2QA 3U23A 2EBPA 2KEAA 2KR3A 1ARKA 2V1QA 2H8HA 1W1FA 2DILA 4D0OA 2JW4A 2D1XA 2I0NA 2A08A 3NMZC 1E6HA 3NPFA 4JPBW 2F2XA 2K79A 3EHRA 4IIMA 1Z9ZA 2L2PA 4LE9A 1KSWA 3A98A 5IHKA 2NZ8B 1UJ0A 3ODXA 1TUCA 1UE9A 1SEMA 4AG1C 4JZ4A 1J3TA 1NEBA 1ABOA 2RN8A 2DL4A 2JM9A 2FO0A 2LQWA 1TXDA 2NWMA 1T3SA 5GJWB 3ODWA 1X6BA 1WX6A 4RUGA 2EYWA 2JS2A 1NTYA 2RNAA 3GBQA 3P6AA 2YUPA 1K1ZA 3TSZA 3VS0A 1UJYA 2ABLA 1OOTA 1PRMC 1KFZA 1WA7A 2EGCA 1AWXA 3VS2A 5FW9A 4J9DA 2VVKA 2BTTA 3I5RA 2LQNA 2PNIA 3EHQA 1ZBJA 1AWJA 2G6FX 2KXCA 2F2VA 2PTKA 1V1CA 1OPLA 4QT7A 3VS1A 2DRMA 4WCIA 2CREA 3ZL7C 2EYZA 1BU1A 1X27A 1WI7A 4GZUA 2MIOA 1B07A 2KT8A 4D8KA 2JS0A 4GLMA 1H8KA 1XD4A 2JMAA 1LCKA 4CC7A 1T0HA 2LCSA 1NG2A 2V1RA 2CT3A 3QWYA 2LJ1A 4F17A 2RPNA 4CC4B 2CSQA 2E5KA 2LP5A 1AZGB 4D0NB 1UDLA 3EG2A 3VS3A 2LJ3A 2JMCA 1WDXA 4OMLA 5EC7A 1U3OA 4RTYA 1KZGA 2QDLA 4F14A 3KZ1A 2FPFA 2FRWA 4LUDA 3UATA 1GCPA 1JO8A 4Z8AA 1I1JA 2JT4A 4GBQA 3I5SA 1NM7A 1GL5A 4AFSC 1IO6A 1XCGA 1QKWA 1HSQA 1HJDA 1QWFA 2YUOA 4AFQC 2DVJA 1YNZA 1G2BA 2W10A 1MV0B 2AKKA 3EGUA 2K3BA 1UTIA 4JZ3A 3RNJA 3EG1A 4J9HA 1K76A 4J9FA 1H92A 2ENMA 1G83A 3KY9A 2L0AA 2W0ZA 2HCKA 1S1NA 2A28A 4J9IA 1VYVA 1ZUKA 1GBRA 1K4US 1M30A 2F2WA 2D8HA 4CC3A 2EYYA 1E6GA 4GOUA
chains in the Genus database with same CATH superfamily
1XQHA 2K57A 2O2OA 2K7AA 1BBZA 4FCYA 4J9CA 4BY6C 5FU6B 2M16A 1D3BA 5ECAA 1W2BA 1SRLA 2KVQG 1WIEA 1TH7A 3NFCA 2PUOB 3PT9A 4IUVA 1NLOC 2AK5A 2NUTB 1QCFA 4J9EA 3X25B 3OW2A 2DIQA 5FWCA 2A37A 2XIDA 2L3QA 1NPPA 1VQ9A 2DD5A 5LJ5h 2IVWA 1WHMA 3JAME 2QTVA 3CCRQ 4RTWA 2NUZA 2OTLA 5LL6S 2D0QB 4FIBA 3BDLA 2E6NA 2CYZB 2RD1A 1LOJA 4X1VA 2BZYA 4KH1B 5IHNA 2K5FA 1SKUB 2QQ9A 3JB9H 4EMKC 4OB3B 2JTEA 4M7AG 1V29B 4LNPA 1UGVA 3I35A 9ATCB 2C0IA 2J6KA 1RI9A 1JXMA 4NL2A 2RF0A 1NBEB 4B9XA 1RADB 2FEIA 1W70A 1W6XA 3JB9D 2PVDB 2WSFE 5GANg 1GRIA 3UA6A 1Q86R 2CH4A 4E6RA 2YT6A 4M77G 1BIAA 2L3RA 2QGFB 3FJPA 3HRUA 4C92F 1D1AA 4M7AF 1KJWA 1UGQB 2YUNA 4F7UG 2D8HA 3EGDA 3OYFA 2E4HA 3A8OB 4EPCA 3MEAA 5FLXE 1JQQA 3MP1A 2EJFA 4Z88A 1ACMB 3QDFA 4QQGA 1Q95G 1IREB 5JHHA 3OYGA 1WJRA 5CQYA 4AFZC 2J6OA 3M0QA 4RTUA 2Y4XA 4BE0A 2LDMA 3H0FA 2VGMA 1PD0A 4FT4A 2KT1A 4M77F 4N4GA 5HY6A 5GMKh 2QQRA 1I81A 2VKNA 2YUQA 1WFWA 3CC2A 3HHTB 1H3HA 4O6JA 5LJ5j 1YCSB 2A36A 1LNXA 2I2LA 3FLGA 1AD5A 1T3LA 1WHLA 3DKMA 1QCOA 3LGLA 1I4K1 4KUIA 1BIBA 4C5IA 3J81E 2DETA 4VUBA 5JHGA 1NYFA 4MDXA 2HQXA 2CDTA 4QQ6A 3V8LA 4FU6A 5CAIA 1M8VA 4XU1A 2J06A 1M2VA 3HFOA 3L1AA 3CC7Q 2GGRA 5FRNA 4PJNA 1WXBA 4OGEA 3EGXA 3ASKA 3JCMh 2KI7A 2C06A 1ZA1B 3G4SQ 4C92E 4HVWA 4M7AE 3CPFA 1JU5C 1ZUYA 4A53A 2DERA 4KUDK 1PCXA 4MZMA 1BI3A 1MMAA 2K9GA 2DO3A 3BJIA 3THKA 8AT1B 4YONA 1WLPB 2V8KA 1WXTA 2R5AA 4AMCA 4A54A 2M0OA 2E3HA 2RH2A 1JXOA 4EMKB 2Z0QA 5HK3A 3EAEA 3L42A 4J9GA 2YLCA 4M77E 1Q86C 2XKOC 4KH0B 1K9MR 1VQ6A 1M1FA 3MHXA 1U8RA 3CC7T 3MEUA 4C92C 1VQLT 2EW3A 5GMKj 3T06A 4PJOD 1KI1B 1I07A 2QAZA 2R57A 2DJZA 1Q82R 4PNOA 1OYXA 2DYBA 2DFKA 1N6AA 2J7IA 2EJGA 4A4FA 5D7UA 2MK5A 5IHIA 4KGVB 3CCSQ 4N0AA 3M54A 2P0KA 1N9SA 2DTIA 5KYUA 4JRIA 4XQ3A 2PVOB 2IG0A 1VYTA 5GAMd 1UHCA 3L2WA 2COYA 1U06A 5GAOl 4LDXA 3AHUA 4OB1B 1BYMA 4R0KA 3PIPA 1SRMA 4M78G 4RG8A 4M75A 2RQTA 3CXCS 4LN2A 2DMOA 3RKXA 1TXQA 3RBBB 2KYMA 1B34B 3EG9A 1M4ZA 4D8DA 1BY1A 1PKSA 1FOEA 4A4HA 2KYBA 3ME9A 3S3NA 2EBPA 2KR3A 4KGXB 2M02A 2E6ZA 3CCST 3A5ZB 1WGSA 1VQOQ 1E6HA 3NPFA 2F2XA 4XTUA 3QKJA 2H3JA 2DXTA 2CP5A 2NUPA 1KSWA 1YIJQ 3M4GA 4AG1C 4JS5A 4JZ4A 3JCMV 1J3TA 2WACA 1Q86U 2DIGA 2RHXA 1K9MC 5AT1B 2FL7A 1T3SA 3ODWA 4E7ZA 4RUGA 4JUVA 2JS2A 2RNAA 3GBQA 3P6AA 4LDUA 3JRZA 4C0GA 1D0YA 3VS0A 3A8LB 1UJYA 1OOTA 5C0MA 1KC8R 3GP8A 1Q82C 1VQ8Q 2PNIA 1ZBJA 1AWJA 1G3WA 4C92B 4M7AB 2X4YA 1V1CA 1OPLA 4M75D 3VS1A 4L5GA 4QW2A 6AT1B 1V76A 4QVZA 1X27A 4GZUA 4UC4A 1VQOT 1C1AA 3C12A 3SDZA 2EWNA 3OSSC 1XD4A 2JMAA 1LCKA 4II1A 4C8QC 1NG2A 2V1RA 2CT3A 1YIJT 2LP5A 3CCLQ 2QYZA 2AT1B 2CZ1B 1TSFA 3X24B 1UDLA 2O01E 3EG2A 4M77B 1Y71A 3UPUA 2DK3A 1KZGA 4F14A 2CS7A 4XTXA 1N9RA 5J26A 4LUDA 3UATA 5CVIA 1JJ2S 2XK0A 1JO8A 1Y7XA 1I1JA 2VUBA 4GBQA 3I5SA 1GL5A 4J8OA 1LVKA 1QKWA 3QO3A 1VQ8T 2E65A 1SSFA 1BI2A 2DVJA 1YNZA 1KK7A 3EGUA 5LJ5f 2IPOB 2AHJB 4OMFB 4DOWA 3CBMA 2L0AA 3QDRB 4JRQA 3V8JA 2MWPA 4FW1A 2A28A 3M58A 2MWOA 5GANh 2VB6A 1GBRA 3QZ5B 4CC3A 1D0XA 2X35A 1E6GA 4GOUA 1HK9A 4E47A 3CCLT 1YFNA 2QGGA 3A8GB 4RG2A 3JSCA 2K3XA 2EGAA 1IXDA 4C8QA 1K9MU 1M2OA 2O9SA 2DJQA 3OYCA 4DA4A 1RL2A 4IIOA 3QXEB 1YWOA 2DL7A 3OYNA 2VYTA 1SPKA 2KRNA 1RAFB 3V7SA 4ZTJA 3PE0A 1KC8C 2E41A 4LXCA 1Q82U 1MNDA 2QASA 3CXCP 1YP5A 2A0FB 1QQJA 2DPPB 4JJCA 3QUIA 3PTAA 1YJNQ 2RJFA 3M0PA 3CC7A 2ZZDA 5IT9E 2X3WD 1VQLA 2PQWA 5LJ3e 3SHWA 1KD1U 3PMTA 5CK9A 2DA9A 1QVFA 1QMCA 1A0NB 2EQJA 5GAN8 1M1KU 3CCJQ 3RESA 2VWFA 5KYNA 2E5QA 4E7JA 1TUDA 1VQ4Q 2VASA 2D0NA 3ODOA 5KYXB 4WTOB 4PLIA 5KYYA 1WYXA 3H0IA 3CD6Q 2HQHA 1OZ3A 2LRQA 1CSKA 2XMFA 3I56Q 3QJ6A 1R77A 3VKIA 3R6NA 5GANj 1NPRA 2DBKA 4FW2A 5CIUA 2GF7A 1VOMA 4C0DB 2V8JA 4PJMA 1U1TA 2LCLA 3JCMf 2B86A 2AIRB 4BDYA 1N5ZA 2RHIA 3MJXA 1UUEA 4XTVA 1MMNA 4LUEA 3ZFJA 3LX7A 4Z89A 2EYXA 1F5XA 3I55Q 3AT1B 1MUZA 2V26A 1U1SA 5GAOn 1VIEA 2COZA 2GTOA 4M7DA 2OTJQ 1YHQT 1VQ4T 3GF5A 2RQVA 4RTXA 4J7IA 1DJ7B 2K5IA 1OEBA 1WHGA 3QHSA 3CCSA 1TS9A 1WXUA 2CT4A 3I56T 2HBWA 5LJ3h 1VUBA 2G3RA 1ZLMA 2GQVA 1RLQC 4RCCA 1T0JA 1VQMQ 4RMOA 1KC8U 2OAWA 2EKHA 1NZ9A 3OS2A 4HT8A 1RUWA 2KR9A 3L2UA 3X26B 4FSXA 1QP3A 1JJ2P 2F1LA 1FWZA 1G3SA 2O9VA 2JN0A 1TG0A 2OX7A 3URGA 5AYFA 1EFNA 2DAQA 3CPWA 5GAN5 2DF6A 3MPXA 1K73U 4DBRA 4M78D 2CP6A 1LB1A 5J39A 1YCYA 5GMKe 4OF1A 1NE8A 4AFUC 2XICA 3I55T 1VIFA 2Y4YA 4BD3A 5EG2A 2OTJT 3CCVQ 1JEGA 2MMPA 4J6XA 3OMCA 4YTLA 2HL5C 4C92G 3SWNB 3TEEA 1VQOA 4RCBA 3WVDB 1VQMT 2MF2A 4PJOC 4KBMB 4FYXB 1H641 2O31A 3INZA 1NLPC 3O5ZA 1YIJA 4JJBA 1OQKA 2SRCA 2BZXA 3QYGB 3JCMe 1PD1A 4M7DD 2CZ6B 3UA7A 1TWBA 3QSUA 1D3BB 4FSSA 2FRYA 2DXUA 1QWEA 2CSIA 4X9CA 2FVUA 1UHFA 1I8FA 2CGHA 1AHJB 3QG1A 3H0HA 2D9TA 2L8DA 4OMNA 2QEXQ 1QLYA 2RJCA 4HCBA 4J7FA 2P4TA 5LJ3j 2C0OA 3CCRT 3HSBA 2OJ2A 1VQ8A 3GNFB 1CKBA 3CCVT 1X86A 1YI2Q 2EPDA 2EYQA 2EQIA 3L2QA 1K0SA 2QXFA 1JJ2A 2AZSA 1N27A 2ECZA 1YN8A 1VQNQ 2RI5A 4BI8B 2AKLA 2DBMA 1E7OA 1S72Q 4L6V5 1X75C 4QKUA 3CCMQ 2HAXA 2BE9B 1SHGA 3QPHA 1VQ5Q 5C6SA 3CCLA 3FJ5A 2D6FA 3NGPA 3BW1A 1XOVA 1CKAA 2DE0X 4PJOA 4XK8E 1D1CA 2F5TX 5GAOq 4ESRA 5DLQE 1SHFA 4BY6B 1LJOA 4PJLA 4C5GA 4FYWB 3RIRA 1K0XA 4KRTA 1AWWA 1B3QA 3VRYA 3PIOA 1X2KA 5IXBA 2XHCA 2QK0A 2QEXT 3CQTA 2DNUA 5GMKm 2VXEA 3PNWC 1YI2T 1EIFA 3DB4A 1ARKA 2ZPFB 3EFSA 2YRDA 2V1QA 3P8DA 3EGDB 4D0OA 2HMAA 4Y28E 2A08A 4B9WA 4N0AC 2RHUA 3H6ZA 1FMVA 2NZ8B 1UJ0A 2X4XA 2R5MA 3G1JA 2NLUA 3NTHA 1UE9A 3CCMT 3E19A 3CMEQ 1VQ5T 2COWA 1X6BA 1WX6A 1IRXA 2EYWA 1EX4A 1F1BB 3S3OA 1OZ2A 4M75C 2JNGA 1QVFS 1WA7A 2EGCA 3OYEA 3UWNA 2BE7D 2LQNA 5FU7C 2RM4A 4J6YA 2G6FX 1IGUA 2KXCA 2PTKA 4C8QG 1WHJA 2KY9A 1WJQA 4WCIA 1M2VB 3G4ST 5CKHA 1ZHIA 1Q81R 1TTHB 3EGXB 1PM3A 4GLMA 5GANf 3KXTA 3LWHA 5LJ5d 2LJ1A 1O9SA 4CC4B 4KGZB 1KHIA 3JCMW 2RI3A 3J7AF 3SD4A 3A8MB 5CKEA 3ZBDA 3VS3A 2JMCA 2LC4A 2ZPIB 2QDLA 4IUPA 2FPFA 4C8QF 2FRWA 1WNLA 1KQ2A 3JCMb 1KD1R 5KYWB 1YHQA 2JT4A 1VQ4A 3QZ9B 3PGGA 1M1KR 3D7SB 3CMAQ 2YUOA 3I56A 1D09B 1Y07A 1I5OB 3BY7A 2W10A 3CC4Q 1MV0B 2L5QA 1KQ1A 1UTIA 4JZ3A 4J9FA 5GMKi 1G83A 1QCNA 3RMQA 2JZ2A 4C0FA 4C5EA 1WHHA 2HQEA 2P84A 3GLXA 3JCMQ 3BDUA 1ZUKA 5LJ5g 1RACB 1M30A 5CKDA 2F69A 3SFMA 2OI3A 4CC2A 4A4EA 1PHTA 3OQ5A 1NYGA 4ZNXA 4F16A 1MV3A 4RTVA 4OMMA 3E9GA 3CPWS 2CH4W 2K3YA 1AOJA 3HRSA 4DEXA 3CEYA 3I55A 3C95A 5GAMg 2MI6A 2LQKA 2LZ6B 1HYOA 2RA2A 5KYUB 3OYMA 2QDYB 2ZPEB 2ROLA 2OTJA 1PSEA 2VRWB 2FHDA 1PWTA 2IIMA 4C8QE 1GXIE 3CMAT 3FC3A 3M9QA 1H3ZA 2X51A 3CC4T 1UGSB 1KHCA 1VQMA 2ESWA 2JM8A 5L23A 2PZ1A 5GANe 4OVAA 2HEQA 4M77A 2X4WA 2YLBA 1Q81C 3OYYA 3JB9G 3EFRA 3TQ7P 4TVRA 4F7UA 5FU7B 4FYVB 2ED0A 3EG9B 2GNCA 1I5LA 1AEYA 4HVUA 4XTZA 2DL8A 2LMJA 4DBQA 3JCMd 2GBQA 2HL3A 1RAGB 3HTRA 1SSHA 4ZTFA 3M0SA 4NOYA 4K11A 3QBVB 1M5Q1 1K73R 3WXMB 3G7ZA 3CCRA 5IH2A 1YBYA 2PVGB 1KD1C 1KIKA 3P8HA 3JB9F 3OS5A 4A4KA 2EAYA 5LJ3f 4J83A 1M1KC 3V7RA 2M0YA 2NUPB 1G3TA 1JB0E 3S3MA 1UGRB 4DBFA 4E7SA 2LX9A 4OMOA 1X6GA 1YJWQ 1OI1A 3SEMA 4OP0A 1RI0A 2JOYA 2KBTA 2ROTA 2QA4Q 4RTZA 8ATCB 3TU4K 1QVFP 4C92D 2LT4A 3JV3A 3H8ZA 2AZVA 5FWBA 4M7AD 1IHWA 2X3XD 1UFFA 4QQDA 4IKFA 4ATOA 2Y90A 5GAOp 1GBQA 4GYVA 1UECA 2KRMA 4OMPA 1M3CA 4R55A 2M51A 4XAXB 1BI1A 1G5VA 4HVVA 4R56A 1W4SA 3OY9A 3VYGA 4MT7A 1AVZC 4C5HA 3OYBA 4XU2A 5L8RE 2QG9B 1AZEA 2QEXA 1Q7YR 5KCOA 3DLLA 1ZX6A 3VJPA 4JDSA 4XTWA 2KAFA 4M77D 3QWXX 2ZPHB 4KT0E 3REAB 2O4XA 2K2VA 3CBPA 1YITQ 2BKDN 3VYHB 1YJWT 3OMGA 2DZ9A 4M78C 1HD3A 1Y0MA 1Y96A 2QA4T 2DEUA 3RKWA 1K9AA 4Q5WA 3H9NA 3CCMA 2HDAA 2CP0A 5GAN2 1ZSZA 2HD0A 4IUQA 1Q81U 4F04B 2YDLA 3GF9A 2V8IA 4XU0A 2DD4A 5FU6C 1C0MA 3BE3A 3GOXA 4BI3A 1PSFA 1UG1A 2K6DA 3M56A 3MO8A 1VQ6Q 3KSYA 4ELYC 5GJVB 5D6YA 4A4GA 2DFUA 1K73C 4DQ2A 1M3AA 2J6FA 2QI2A 5D6XA 2RHZA 4M7DC 3G4SA 3OYDA 3OBWA 2MOXA 7AT1B 5A0DA 1YITT 2RJDA 3CPWP 2EQKA 1IB8A 3LW5E 1AWOA 3E9FA 1BKBA 5KE2A 1HXDA 1X6OA 3G71Q 1D1BA 2CP3A 4IUTA 1IZ6A 4J6WA 3TCJA 4C8QB 4QVDA 4JJNK 3LH5A 4AG2C 4PJOF 4M78A 2RQRA 5GAN6 2RQWA 4EDUA 2DM1A 3VS4A 5GAN3 4ZGJB 5FI1A 2J05A 3MP8A 3PVQA 3EFOA 5HCKA 3MP6A 3OA6A 1KZ7A 1FX7A 4M4ZA 5J3BA 2L89A 2A7YA 3RR6A 5CQXA 1U5SA 1YJNT 4Y91A 1Q7YC 4PK4A 2LT1A 2XDBA 1ZUUA 2H3EB 3TSWA 2RGNB 3QBYA 1BI0A 2KRSA 4KULA 4QVCA 1PRLC 1PNJA 2JUFA 1SG5A 2DXBA 4L59A 4E7KA 3CCUQ 1M90U 2NUTA 4NS5A 3CCJT 2GQIA 2KK4A 3Q1JA 2RQUA 4N4HA 3IQLA 3G71T 2DZCA 2GFAA 1RAEB 1VQKQ 1OU9A 4IUUA 1ZBXA 3CD6T 2X9HA 2JTMA 2XD0A 4HXJA 1NEGA 2BZ8A 2DL5A 2NYSA 4PJJA 4Y92A 2VGNA 2FPDA 4CI0C 4ELZC 1BB9A 4A63B 2GFUA 4FYYB 4E7LA 1VYUA 4RKUE 3RMSA 3SWNA 2QQBA 5D6WA 4PJOE 3DB3A 1R0CB 2CZ0B 1QVGS 3U23A 3CMAA 4HCZA 2DVEA 1W1FA 3CC4A 2DILA 3E2UA 3J80E 2D1XA 3NMZC 4LD9K 2E3IA 4ZGEB 3EHRA 4IIMA 1Z9ZA 3EH1A 3M59A 3CCUT 3M4YA 4M75G 3ODXA 3BFMA 3VUBA 1TUCA 3HPWA 1NEBA 1ABOA 2RN8A 4MZTA 2DL4A 2JM9A 2ZAEA 4HA8A 1VQKT 2LQWA 5GANd 1TXDA 1MHNA 1OULA 1WQ7A 2RB6A 3OB9A 4M7DB 1NTYA 2M9UA 4OB0B 4JRPA 2YUPA 3OYJA 1K1ZA 3TSZA 2FZCB 4GLKA 1WPYA 1PRMC 1KQSS 1KFZA 2DKGA 2RO0A 1RAAB 1AWXA 5KCHA 3SB2A 2VVKA 2BTTA 3I5RA 3JCMX 3EHQA 2F5KA 1YJ9Q 4M75F 3OYAA 2F2VA 4X9DA 3QIIA 1VQ7Q 5GAMh 4QT7A 2LVMA 3C4SA 1Q7YU 1K8AU 3A8HB 1R0BG 2EYZA 1UEBA 1BU1A 3M55A 1WI7A 2MIOA 3X20B 4BUGA 4FM4B 4ZGDB 2VXFA 4PLLA 2KT8A 3C94A 5DM7R 2XI9A 4CC7A 3QWYA 4FT2A 4F17A 3N5BB 2E5KA 1SF9A 1C6VX 2FB7A 2BUDA 4MDWA 1WDXA 4Z02A 4ANJA 5EC7A 4AT1B 2FZGB 1P92A 1NJIR 4ZN1A 2EKOA 1GCPA 1WQWA 4BI4A 3MCAB 5GAN7 1TUGB 2PUKB 3TREA 2XDPA 1XCGA 5CKFA 2HNIA 1HSQA 3OSVA 1YJ9T 4AFQC 1G2BA 1VQ7T 2AKKA 2XG8D 2OAUA 5CCAA 4ZN3A 1YJWA 1H92A 3OYLA 2QA4A 2YXYA 5M9OA 4OGCA 2GCXA 3M57A 4EMKA 4M75E 4J9IA 1S1NA 4C0ZA 1VYVA 4F7UF 2ZPGB 3LYIA 3L2ZA 2M1HA 1K4US 3CCEQ 2F2WA 2P0PA 2EYYA 4DOVA 4PKCC 3M53A 2QQSA 4DBHA 4XU3A 4J9BA 3A1PA 3NTKA 3L2VA 1WHKA 2EFIA 2E10A 2HZYA 2P0QA 1VQNT 3FDRA 3VS6A 5GAMj 1JBMA 2LX7A 5IN1A 1M9SA 1S72T 2XU8A 2K2MA 2A3LA 4JLGA 1FMKA 1VQLQ 1R8OB 1OV3A 3MEWA 2E1HA 4MMKA 3CCQQ 1GFDA 1X69A 1ZQ1A 2P4RA 3REBB 2RK1A 1YITA 2D8JA 1FYNA 3G6EQ 3WVEB 3KBGA 1VQPQ 1IHVA 2KGTA 5LJ3d 5GMKl 2DLPA 3VUZA 4PJOB 2LNVA 2LCCA 4PFZA 1BK2A 2EJ9A 3UT1A 3S6WA 1KG1A 2O88A 3JB9I 3CCET 5KYWA 4JS4A 1QVGP 1WZOA 3HRTA 1GCQC 3KFVA 3VS5A 4D6WA 1VA7A 2MAMA 3VV0A 1OPKA 4WF2A 4F7UE 2EIFA 3LWIA 3VS7A 1NJIC 3TVTA 1YJNA 1MNEA 4CRIA 5HK0A 1ABQA 3I9QA 1YWPA 1MMDA 1B34A 2ZCFB 1TOVA 5GAOm 4M7AC 2HSPA 3META 3CMET 4JLIA 3CCQT 1Y57A 3RDVA 1M27C 3UF4A 3H41A 4OMQA 1X01A 3NHNA 2BIVA 2EQMA 3CCJA 3NTIA 3G6ET 2CUBA 1VQPT 5LJ3g 3GPLA 1RAIB 2KSSA 3G71A 1KQSP 3KUFA 2C0TA 3FIFA 3P8BB 2LQ8A 2YHTA 3QYHB 3M5AA 3EG0A 2L3PA 3CD6A 1O75A 1M8MA 1QP2A 2KROA 4M77C 2LNHB 2FG0A 5IXFA 3EO2A 5I22A 1RAHB 1X43A 2HKNA 3M0TA 1RABB 4EMGA 2EVRA 4JRKA 1GCQA 2JTFA 2L3SA 1ZSGA 2CKKA 2SEMA 3QJYA 2MCNA 3RERA 4P5NA 4BB7A 3OYKA 2EQUA 4ME7A 2YSQA 1XTDA 3MKDA 2CP7A 2E70A 1VQ9Q 4C92A 3CCUA 3ER0A 2VC8A 4M7AA 4HT9A 4BACA 2JXBA 2OTLQ 5I11A 1W2BS 5A0GA 2GTJA 1QVGA 2XDDA 1XJWB 5DY9A 2Z0WA 2RHYA 1VQKA 2E12A 4DEYA 1M90R 2FYKA 4M78F 4EMHA 3PMIA 3VRZA 2DL3A 4EIKA 4X34A 1EZZB 2KE9A 1N8RR 3OW2S 2KMTA 3ULRB 4NL3A 4M75B 4M7DG 4LDVA 2KNBB 4HCKA 5CKBA 2JJ9A 1QKXA 3GIBA 1B7TA 1NJIU 1WJSA 1I0CA 2CP2A 1ZA2B 2FPEA 1Z9QA 2X4JA 4IURA 4FL6A 1KQSA 2QQAA 1VQ9T 3MPUB 4BDZA 3L2RA 5KH6A 2K4YA 1QW1A 4M7DF 4N4IA 1RJ2A 2OTLT 5A2QE 3FB9A 1PKTA 4ORZA 3CCVA 1PG5B 1RLPC 4GY5A 4E2FB 1OX8A 2ZGWA 4LDWA 2CUDA 2MYSA 5FROA 5GAOr 1OX9A 2KXDA 3M0RA 2RMOA 4RTTA 1ZSZC 2DXCA 1UB4A 3OS0A 3EG3A 2KQWA 1FXXA 5HKCA 4M78E 1G3YA 2YWWA 1YJ9A 3EH2A 3CC2Q 1D0ZA 3DLMA 1VQ7A 3CBOA 3LLRA 3HL8A 3MEVA 4F7UB 3O8VA 3JCMg 1M3BA 2DRKA 4C0DC 5FI0A 1K8AR 4V2SA 2EGEA 1GFCA 1YI2A 2RJEA 4JJDA 4J5YA 3C0CA 1MGQA 2B8AA 1M90C 5CR2A 1DBHA 3PVLA 1VQNA 3RKYA 3X28B 3FEOA 4M7DE 5GAN4 1N8RC 1S72A 5A0LA 1OU8A 1UGPB 3V7CA 2ED1A 3M0UA 1VQ5A 5GAMf 2LJ0A 2FZKB 1X2QA 2KEAA 3E1SA 3CC2T 2H8HA 4E7HA 2VV5A 2JW4A 4PFOA 5KYXA 2ATCB 2HSEB 2I0NA 4MZPA 4JPBW 1M1GA 1BCOA 2K79A 4LDYA 2CZ7B 2L2PA 4LE9A 2JVVA 3A98A 5IHKA 4LD6A 4HCCA 1SEMA 4PJOG 3CCEA 5DLOA 2FO0A 2DTHA 3LGFA 4PFPA 2NWMA 2DTOA 3OS1A 5GJWB 5KE3A 4PL6A 5I21A 1LPLA 4B6MA 4OB2B 1JRIA 1PC0A 1XNIA 2ABLA 3LH0A 3OYHA 3OYIA 2MPXC 2O4XB 3VS2A 2HKQB 2ZPBB 4J9DA 5FW9A 1W2BP 4HKEA 3CMEA 1FMWA 3CCQA 4MMLA 3V8KA 1Y96B 5I2MA 3JCMP 3SWNC 2DRMA 3ZL7C 2CREA 5I2SA 3JB9J 3OBYA 3G6EA 2QTXA 1VQPA 3T9NA 1B07A 2R58A 2YRVA 1ZSZB 3OW2P 4D8KA 2JS0A 1H8KA 1YHQQ 2LTOA 1T0HA 3R6OA 5CO7A 1BCMA 1G8XA 2LCSA 2PU9B 2RPNA 5FRMA 1VQ6T 2CSQA 1AZGB 4D0NB 2WSCE 2RK2A 1K8AC 4XTYA 2HBPA 1TU0B 2LJ3A 3F70A 4OMLA 5LJ5e 1U3OA 4RTYA 3JCMJ 3KZ1A 2KDSA 4O5VA 1AT1B 1MMGA 2WSEE 4C8QD 4Z8AA 2DYIA 2K5LA 3HFNA 1NM7A 3VU3C 4AFSC 3HKSA 3HP9A 1IO6A 4BE1A 5GAMe 1IGQA 1N8RU 4BE2A 2DEQA 1HJDA 1QWFA 3RUXA 3UDCA 3PFSA 3ZEHA 2K3BA 2E64A 3RNJA 3EG1A 4J9HA 2YRCA 1K76A 5KYYB 2ENMA 4M78B 1QVPA 3KY9A 5IAYA 2W0ZA 3FRNA 4E7IA 2RI2A 2HCKA 3JCMc 3GNGA 3EFOB 2DX1A 3CXCA
chains in the Genus database with same CATH topology
2OI3A 4CC2A 1PHTA 4ZNXA 1NYGA 2O2OA 1MV3A 4F16A 4RTVA 2K7AA 4OMMA 4J9BA 2EGAA 1BBZA 4J9CA 2O9SA 2CH4W 1AOJA 4DEXA 2DJQA 5ECAA 3VS6A 2LZ6B 4IIOA 1SRLA 2LX7A 1YWOA 2DL7A 2ROLA 2K2MA 2VRWB 1WIEA 1FMKA 1SPKA 1PWTA 1NLOC 2KRNA 1OV3A 2AK5A 1GFDA 2IIMA 3PE0A 1X69A 1QCFA 2P4RA 3REBB 4J9EA 5FWCA 2A37A 1YP5A 2D8JA 1FYNA 2L3QA 2ESWA 4JJCA 2JM8A 2KGTA 5L23A 2PZ1A 2DLPA 2HEQA 4RTWA 2NUZA 3M0PA 1BK2A 2X3WD 2O88A 2ED0A 4X1VA 2BZYA 2GNCA 3SHWA 1AEYA 4HVUA 5IHNA 2DA9A 3KFVA 1GCQC 1A0NB 2JTEA 3VS5A 2DL8A 2LMJA 4LNPA 1UGVA 1VA7A 2GBQA 2VWFA 3I35A 1SSHA 2C0IA 3M0SA 1OPKA 4K11A 2J6KA 3QBVB 1JXMA 1RI9A 1TUDA 3VS7A 3TVTA 2RF0A 5IH2A 2D0NA 3ODOA 2FEIA 1W70A 1WYXA 1KIKA 1ABQA 1W6XA 3H0IA 3I9QA 1YWPA 1CSKA 2HSPA 2XMFA 2M0YA 1Y57A 3UF4A 1M27C 3H41A 4OMQA 3R6NA 1GRIA 3UA6A 3NHNA 2CH4A 1X6GA 4OMOA 4E6RA 2YT6A 3SEMA 2DBKA 2CUBA 2KBTA 2ROTA 1KJWA 4RTZA 2YUNA 3JV3A 5FWBA 2AZVA 2DX1A 2C0TA 2X3XD 1UFFA 1JQQA 3EG0A 4Z88A 2L3PA 2B86A 1M8MA 2KROA 1N5ZA 1GBQA 1UUEA 4GYVA 5JHHA 1UECA 2LNHB 2FG0A 2KRMA 1M3CA 4OMPA 2M51A 5IXFA 4LUEA 3EO2A 4AFZC 5I22A 2J6OA 4HVVA 4Z89A 1X43A 3M0QA 3M0TA 4RTUA 4MT7A 1AVZC 2EYXA 1F5XA 1MUZA 3H0FA 1AZEA 2KT1A 2EVRA 2GTOA 1ZX6A 1GCQA 2L3SA 2RQVA 1ZSGA 4RTXA 3QWXX 2VKNA 2SEMA 1OEBA 1WFWA 2YUQA 1H3HA 2MCNA 1YCSB 2A36A 1WXUA 2CT4A 3REAB 2HBWA 1AD5A 1T3LA 2YSQA 1ZLMA 1RLQC 1T0JA 2OAWA 5JHGA 2EKHA 1RUWA 2KR9A 1HD3A 1Y0MA 1NYFA 2CDTA 2JXBA 2O9VA 1K9AA 5I11A 2HDAA 1TG0A 2GTJA 2J06A 2GGRA 1WXBA 4DEYA 1EFNA 2YDLA 3GF9A 2DF6A 3VRZA 3MPXA 2DL3A 4EIKA 2KE9A 4HVWA 1LB1A 1JU5C 1ZUYA 3ULRB 4AFUC 2KNBB 4HCKA 1UG1A 2K6DA 3KSYA 2K9GA 5GJVB 3BJIA 3THKA 4YONA 1JEGA 1WLPB 1QKXA 1M3AA 1WXTA 2J6FA 1I0CA 1JXOA 2FPEA 2Z0QA 1Z9QA 2MOXA 4J9GA 1AWOA 2O31A 3O5ZA 1NLPC 4JJBA 1RJ2A 2SRCA 2BZXA 1PKTA 3LH5A 4ORZA 1RLPC 3UA7A 4AG2C 2CUDA 4FSSA 2FRYA 2RQRA 2EW3A 3T06A 1QWEA 2RQWA 2CSIA 2DM1A 3VS4A 1KI1B 5FI1A 2J05A 1I07A 1UHFA 2KXDA 3M0RA 2RMOA 3PVQA 5HCKA 4RTTA 1KZ7A 3H0HA 4M4ZA 4OMNA 3EG3A 1QLYA 2DYBA 2DFKA 2J7IA 2C0OA 2OJ2A 1U5SA 5IHIA 1CKBA 1X86A 1ZUUA 2EPDA 3TSWA 2EQIA 2RGNB 2KRSA 1K0SA 2AZSA 2ECZA 1YN8A 1PRLC 1PNJA 1UHCA 1VYTA 2AKLA 1U06A 2DBMA 1E7OA 1M3BA 2DRKA 2GQIA 5FI0A 4R0KA 1SHGA 2RQUA 2EGEA 3IQLA 1SRMA 1GFCA 3FJ5A 3NGPA 1XOVA 1CKAA 2DE0X 2RQTA 4JJDA 3C0CA 4HXJA 4LN2A 4ESRA 1DBHA 1NEGA 2BZ8A 2DL5A 2DMOA 3PVLA 4Y92A 1SHFA 3RBBB 2KYMA 1K0XA 2FPDA 4KRTA 1AWWA 1B3QA 3VRYA 4D8DA 1X2KA 1BB9A 4A63B 1VYUA 5IXBA 1BY1A 1PKSA 1FOEA 3CQTA 2KYBA 2ED1A 3M0UA 2DNUA 2LJ0A 1X2QA 3U23A 2EBPA 2KEAA 2KR3A 1ARKA 2V1QA 2H8HA 1W1FA 2DILA 4D0OA 2JW4A 2D1XA 2I0NA 2A08A 3NMZC 1E6HA 3NPFA 4JPBW 2F2XA 2K79A 3EHRA 4IIMA 1Z9ZA 2L2PA 4LE9A 1KSWA 3A98A 5IHKA 2NZ8B 1UJ0A 3ODXA 1TUCA 1UE9A 1SEMA 4AG1C 4JZ4A 1J3TA 1NEBA 1ABOA 2RN8A 2DL4A 2JM9A 2FO0A 2LQWA 1TXDA 2NWMA 1T3SA 5GJWB 3ODWA 1X6BA 1WX6A 4RUGA 2EYWA 2JS2A 1NTYA 2RNAA 3GBQA 3P6AA 2YUPA 1K1ZA 3TSZA 3VS0A 1UJYA 2ABLA 1OOTA 1PRMC 1KFZA 1WA7A 2EGCA 1AWXA 3VS2A 5FW9A 4J9DA 2VVKA 2BTTA 3I5RA 2LQNA 2PNIA 3EHQA 1ZBJA 1AWJA 2G6FX 2KXCA 2F2VA 2PTKA 1V1CA 1OPLA 4QT7A 3VS1A 2DRMA 4WCIA 2CREA 3ZL7C 2EYZA 1BU1A 1X27A 1WI7A 4GZUA 2MIOA 1B07A 2KT8A 4D8KA 2JS0A 4GLMA 1H8KA 1XD4A 2JMAA 1LCKA 4CC7A 1T0HA 2LCSA 1NG2A 2V1RA 2CT3A 3QWYA 2LJ1A 4F17A 2RPNA 4CC4B 2CSQA 2E5KA 2LP5A 1AZGB 4D0NB 1UDLA 3EG2A 3VS3A 2LJ3A 2JMCA 1WDXA 4OMLA 5EC7A 1U3OA 4RTYA 1KZGA 2QDLA 4F14A 3KZ1A 2FPFA 2FRWA 4LUDA 3UATA 1GCPA 1JO8A 4Z8AA 1I1JA 2JT4A 4GBQA 3I5SA 1NM7A 1GL5A 4AFSC 1IO6A 1XCGA 1QKWA 1HSQA 1HJDA 1QWFA 2YUOA 4AFQC 2DVJA 1YNZA 1G2BA 2W10A 1MV0B 2AKKA 3EGUA 2K3BA 1UTIA 4JZ3A 3RNJA 3EG1A 4J9HA 1K76A 4J9FA 1H92A 2ENMA 1G83A 3KY9A 2L0AA 2W0ZA 2HCKA 1S1NA 2A28A 4J9IA 1VYVA 1ZUKA 1GBRA 1K4US 1M30A 2F2WA 2D8HA 4CC3A 2EYYA 1E6GA 4GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI3 A;  4CC2 A;  1PHT A;  4ZNX A;  1NYG A;  2O2O A;  1MV3 A;  4F16 A;  4RTV A;  2K7A A;  4OMM A;  4J9B A;  2EGA A;  1BBZ A;  4J9C A;  2O9S A;  2CH4 W;  1AOJ A;  4DEX A;  2DJQ A;  5ECA A;  3VS6 A;  2LZ6 B;  4IIO A;  1SRL A;  2LX7 A;  1YWO A;  2DL7 A;  2ROL A;  2K2M A;  2VRW B;  1WIE A;  1FMK A;  1SPK A;  1PWT A;  1NLO C;  2KRN A;  1OV3 A;  2AK5 A;  1GFD A;  2IIM A;  3PE0 A;  1X69 A;  1QCF A;  2P4R A;  3REB B;  4J9E A;  5FWC A;  2A37 A;  1YP5 A;  2D8J A;  1FYN A;  2L3Q A;  2ESW A;  4JJC A;  2JM8 A;  2KGT A;  5L23 A;  2PZ1 A;  2DLP A;  2HEQ A;  4RTW A;  2NUZ A;  3M0P A;  1BK2 A;  2X3W D;  2O88 A;  2ED0 A;  4X1V A;  2BZY A;  2GNC A;  3SHW A;  1AEY A;  4HVU A;  5IHN A;  2DA9 A;  3KFV A;  1GCQ C;  1A0N B;  2JTE A;  3VS5 A;  2DL8 A;  2LMJ A;  4LNP A;  1UGV A;  1VA7 A;  2GBQ A;  2VWF A;  3I35 A;  1SSH A;  2C0I A;  3M0S A;  1OPK A;  4K11 A;  2J6K A;  3QBV B;  1JXM A;  1RI9 A;  1TUD A;  3VS7 A;  3TVT A;  2RF0 A;  5IH2 A;  2D0N A;  3ODO A;  2FEI A;  1W70 A;  1WYX A;  1KIK A;  1ABQ A;  1W6X A;  3H0I A;  3I9Q A;  1YWP A;  1CSK A;  2HSP A;  2XMF A;  2M0Y A;  1Y57 A;  3UF4 A;  1M27 C;  3H41 A;  4OMQ A;  3R6N A;  1GRI A;  3UA6 A;  3NHN A;  2CH4 A;  1X6G A;  4OMO A;  4E6R A;  2YT6 A;  3SEM A;  2DBK A;  2CUB A;  2KBT A;  2ROT A;  1KJW A;  4RTZ A;  2YUN A;  3JV3 A;  5FWB A;  2AZV A;  2DX1 A;  2C0T A;  2X3X D;  1UFF A;  1JQQ A;  3EG0 A;  4Z88 A;  2L3P A;  2B86 A;  1M8M A;  2KRO A;  1N5Z A;  1GBQ A;  1UUE A;  4GYV A;  5JHH A;  1UEC A;  2LNH B;  2FG0 A;  2KRM A;  1M3C A;  4OMP A;  2M51 A;  5IXF A;  4LUE A;  3EO2 A;  4AFZ C;  5I22 A;  2J6O A;  4HVV A;  4Z89 A;  1X43 A;  3M0Q A;  3M0T A;  4RTU A;  4MT7 A;  1AVZ C;  2EYX A;  1F5X A;  1MUZ A;  3H0F A;  1AZE A;  2KT1 A;  2EVR A;  2GTO A;  1ZX6 A;  1GCQ A;  2L3S A;  2RQV A;  1ZSG A;  4RTX A;  3QWX X;  2VKN A;  2SEM A;  1OEB A;  1WFW A;  2YUQ A;  1H3H A;  2MCN A;  1YCS B;  2A36 A;  1WXU A;  2CT4 A;  3REA B;  2HBW A;  1AD5 A;  1T3L A;  2YSQ A;  1ZLM A;  1RLQ C;  1T0J A;  2OAW A;  5JHG A;  2EKH A;  1RUW A;  2KR9 A;  1HD3 A;  1Y0M A;  1NYF A;  2CDT A;  2JXB A;  2O9V A;  1K9A A;  5I11 A;  2HDA A;  1TG0 A;  2GTJ A;  2J06 A;  2GGR A;  1WXB A;  4DEY A;  1EFN A;  2YDL A;  3GF9 A;  2DF6 A;  3VRZ A;  3MPX A;  2DL3 A;  4EIK A;  2KE9 A;  4HVW A;  1LB1 A;  1JU5 C;  1ZUY A;  3ULR B;  4AFU C;  2KNB B;  4HCK A;  1UG1 A;  2K6D A;  3KSY A;  2K9G A;  5GJV B;  3BJI A;  3THK A;  4YON A;  1JEG A;  1WLP B;  1QKX A;  1M3A A;  1WXT A;  2J6F A;  1I0C A;  1JXO A;  2FPE A;  2Z0Q A;  1Z9Q A;  2MOX A;  4J9G A;  1AWO A;  2O31 A;  3O5Z A;  1NLP C;  4JJB A;  1RJ2 A;  2SRC A;  2BZX A;  1PKT A;  3LH5 A;  4ORZ A;  1RLP C;  3UA7 A;  4AG2 C;  2CUD A;  4FSS A;  2FRY A;  2RQR A;  2EW3 A;  3T06 A;  1QWE A;  2RQW A;  2CSI A;  2DM1 A;  3VS4 A;  1KI1 B;  5FI1 A;  2J05 A;  1I07 A;  1UHF A;  2KXD A;  3M0R A;  2RMO A;  3PVQ A;  5HCK A;  4RTT A;  1KZ7 A;  3H0H A;  4M4Z A;  4OMN A;  3EG3 A;  1QLY A;  2DYB A;  2DFK A;  2J7I A;  2C0O A;  2OJ2 A;  1U5S A;  5IHI A;  1CKB A;  1X86 A;  1ZUU A;  2EPD A;  3TSW A;  2EQI A;  2RGN B;  2KRS A;  1K0S A;  2AZS A;  2ECZ A;  1YN8 A;  1PRL C;  1PNJ A;  1UHC A;  1VYT A;  2AKL A;  1U06 A;  2DBM A;  1E7O A;  1M3B A;  2DRK A;  2GQI A;  5FI0 A;  4R0K A;  1SHG A;  2RQU A;  2EGE A;  3IQL A;  1SRM A;  1GFC A;  3FJ5 A;  3NGP A;  1XOV A;  1CKA A;  2DE0 X;  2RQT A;  4JJD A;  3C0C A;  4HXJ A;  4LN2 A;  4ESR A;  1DBH A;  1NEG A;  2BZ8 A;  2DL5 A;  2DMO A;  3PVL A;  4Y92 A;  1SHF A;  3RBB B;  2KYM A;  1K0X A;  2FPD A;  4KRT A;  1AWW A;  1B3Q A;  3VRY A;  4D8D A;  1X2K A;  1BB9 A;  4A63 B;  1VYU A;  5IXB A;  1BY1 A;  1PKS A;  1FOE A;  3CQT A;  2KYB A;  2ED1 A;  3M0U A;  2DNU A;  2LJ0 A;  1X2Q A;  3U23 A;  2EBP A;  2KEA A;  2KR3 A;  1ARK A;  2V1Q A;  2H8H A;  1W1F A;  2DIL A;  4D0O A;  2JW4 A;  2D1X A;  2I0N A;  2A08 A;  3NMZ C;  1E6H A;  3NPF A;  4JPB W;  2F2X A;  2K79 A;  3EHR A;  4IIM A;  1Z9Z A;  2L2P A;  4LE9 A;  1KSW A;  3A98 A;  5IHK A;  2NZ8 B;  1UJ0 A;  3ODX A;  1TUC A;  1UE9 A;  1SEM A;  4AG1 C;  4JZ4 A;  1J3T A;  1NEB A;  1ABO A;  2RN8 A;  2DL4 A;  2JM9 A;  2FO0 A;  2LQW A;  1TXD A;  2NWM A;  1T3S A;  5GJW B;  3ODW A;  1X6B A;  1WX6 A;  4RUG A;  2EYW A;  2JS2 A;  1NTY A;  2RNA A;  3GBQ A;  3P6A A;  2YUP A;  1K1Z A;  3TSZ A;  3VS0 A;  1UJY A;  2ABL A;  1OOT A;  1PRM C;  1KFZ A;  1WA7 A;  2EGC A;  1AWX A;  3VS2 A;  5FW9 A;  4J9D A;  2VVK A;  2BTT A;  3I5R A;  2LQN A;  2PNI A;  3EHQ A;  1ZBJ A;  1AWJ A;  2G6F X;  2KXC A;  2F2V A;  2PTK A;  1V1C A;  1OPL A;  4QT7 A;  3VS1 A;  2DRM A;  4WCI A;  2CRE A;  3ZL7 C;  2EYZ A;  1BU1 A;  1X27 A;  1WI7 A;  4GZU A;  2MIO A;  1B07 A;  2KT8 A;  4D8K A;  2JS0 A;  4GLM A;  1H8K A;  1XD4 A;  2JMA A;  1LCK A;  4CC7 A;  1T0H A;  2LCS A;  1NG2 A;  2V1R A;  2CT3 A;  3QWY A;  2LJ1 A;  4F17 A;  2RPN A;  4CC4 B;  2CSQ A;  2E5K A;  2LP5 A;  1AZG B;  4D0N B;  1UDL A;  3EG2 A;  3VS3 A;  2LJ3 A;  2JMC A;  1WDX A;  4OML A;  5EC7 A;  1U3O A;  4RTY A;  1KZG A;  2QDL A;  4F14 A;  3KZ1 A;  2FPF A;  2FRW A;  4LUD A;  3UAT A;  1GCP A;  1JO8 A;  4Z8A A;  1I1J A;  2JT4 A;  4GBQ A;  3I5S A;  1NM7 A;  1GL5 A;  4AFS C;  1IO6 A;  1XCG A;  1QKW A;  1HSQ A;  1HJD A;  1QWF A;  2YUO A;  4AFQ C;  2DVJ A;  1YNZ A;  1G2B A;  2W10 A;  1MV0 B;  2AKK A;  3EGU A;  2K3B A;  1UTI A;  4JZ3 A;  3RNJ A;  3EG1 A;  4J9H A;  1K76 A;  4J9F A;  1H92 A;  2ENM A;  1G83 A;  3KY9 A;  2L0A A;  2W0Z A;  2HCK A;  1S1N A;  2A28 A;  4J9I A;  1VYV A;  1ZUK A;  1GBR A;  1K4U S;  1M30 A;  2F2W A;  2D8H A;  4CC3 A;  2EYY A;  1E6G A;  4GOU A; 
#chains in the Genus database with same CATH topology
 1XQH A;  2K57 A;  2O2O A;  2K7A A;  1BBZ A;  4FCY A;  4J9C A;  4BY6 C;  5FU6 B;  2M16 A;  1D3B A;  5ECA A;  1W2B A;  1SRL A;  2KVQ G;  1WIE A;  1TH7 A;  3NFC A;  2PUO B;  3PT9 A;  4IUV A;  1NLO C;  2AK5 A;  2NUT B;  1QCF A;  4J9E A;  3X25 B;  3OW2 A;  2DIQ A;  5FWC A;  2A37 A;  2XID A;  2L3Q A;  1NPP A;  1VQ9 A;  2DD5 A;  5LJ5 h;  2IVW A;  1WHM A;  3JAM E;  2QTV A;  3CCR Q;  4RTW A;  2NUZ A;  2OTL A;  5LL6 S;  2D0Q B;  4FIB A;  3BDL A;  2E6N A;  2CYZ B;  2RD1 A;  1LOJ A;  4X1V A;  2BZY A;  4KH1 B;  5IHN A;  2K5F A;  1SKU B;  2QQ9 A;  3JB9 H;  4EMK C;  4OB3 B;  2JTE A;  4M7A G;  1V29 B;  4LNP A;  1UGV A;  3I35 A;  9ATC B;  2C0I A;  2J6K A;  1RI9 A;  1JXM A;  4NL2 A;  2RF0 A;  1NBE B;  4B9X A;  1RAD B;  2FEI A;  1W70 A;  1W6X A;  3JB9 D;  2PVD B;  2WSF E;  5GAN g;  1GRI A;  3UA6 A;  1Q86 R;  2CH4 A;  4E6R A;  2YT6 A;  4M77 G;  1BIA A;  2L3R A;  2QGF B;  3FJP A;  3HRU A;  4C92 F;  1D1A A;  4M7A F;  1KJW A;  1UGQ B;  2YUN A;  4F7U G;  2D8H A;  3EGD A;  3OYF A;  2E4H A;  3A8O B;  4EPC A;  3MEA A;  5FLX E;  1JQQ A;  3MP1 A;  2EJF A;  4Z88 A;  1ACM B;  3QDF A;  4QQG A;  1Q95 G;  1IRE B;  5JHH A;  3OYG A;  1WJR A;  5CQY A;  4AFZ C;  2J6O A;  3M0Q A;  4RTU A;  2Y4X A;  4BE0 A;  2LDM A;  3H0F A;  2VGM A;  1PD0 A;  4FT4 A;  2KT1 A;  4M77 F;  4N4G A;  5HY6 A;  5GMK h;  2QQR A;  1I81 A;  2VKN A;  2YUQ A;  1WFW A;  3CC2 A;  3HHT B;  1H3H A;  4O6J A;  5LJ5 j;  1YCS B;  2A36 A;  1LNX A;  2I2L A;  3FLG A;  1AD5 A;  1T3L A;  1WHL A;  3DKM A;  1QCO A;  3LGL A;  1I4K 1;  4KUI A;  1BIB A;  4C5I A;  3J81 E;  2DET A;  4VUB A;  5JHG A;  1NYF A;  4MDX A;  2HQX A;  2CDT A;  4QQ6 A;  3V8L A;  4FU6 A;  5CAI A;  1M8V A;  4XU1 A;  2J06 A;  1M2V A;  3HFO A;  3L1A A;  3CC7 Q;  2GGR A;  5FRN A;  4PJN A;  1WXB A;  4OGE A;  3EGX A;  3ASK A;  3JCM h;  2KI7 A;  2C06 A;  1ZA1 B;  3G4S Q;  4C92 E;  4HVW A;  4M7A E;  3CPF A;  1JU5 C;  1ZUY A;  4A53 A;  2DER A;  4KUD K;  1PCX A;  4MZM A;  1BI3 A;  1MMA A;  2K9G A;  2DO3 A;  3BJI A;  3THK A;  8AT1 B;  4YON A;  1WLP B;  2V8K A;  1WXT A;  2R5A A;  4AMC A;  4A54 A;  2M0O A;  2E3H A;  2RH2 A;  1JXO A;  4EMK B;  2Z0Q A;  5HK3 A;  3EAE A;  3L42 A;  4J9G A;  2YLC A;  4M77 E;  1Q86 C;  2XKO C;  4KH0 B;  1K9M R;  1VQ6 A;  1M1F A;  3MHX A;  1U8R A;  3CC7 T;  3MEU A;  4C92 C;  1VQL T;  2EW3 A;  5GMK j;  3T06 A;  4PJO D;  1KI1 B;  1I07 A;  2QAZ A;  2R57 A;  2DJZ A;  1Q82 R;  4PNO A;  1OYX A;  2DYB A;  2DFK A;  1N6A A;  2J7I A;  2EJG A;  4A4F A;  5D7U A;  2MK5 A;  5IHI A;  4KGV B;  3CCS Q;  4N0A A;  3M54 A;  2P0K A;  1N9S A;  2DTI A;  5KYU A;  4JRI A;  4XQ3 A;  2PVO B;  2IG0 A;  1VYT A;  5GAM d;  1UHC A;  3L2W A;  2COY A;  1U06 A;  5GAO l;  4LDX A;  3AHU A;  4OB1 B;  1BYM A;  4R0K A;  3PIP A;  1SRM A;  4M78 G;  4RG8 A;  4M75 A;  2RQT A;  3CXC S;  4LN2 A;  2DMO A;  3RKX A;  1TXQ A;  3RBB B;  2KYM A;  1B34 B;  3EG9 A;  1M4Z A;  4D8D A;  1BY1 A;  1PKS A;  1FOE A;  4A4H A;  2KYB A;  3ME9 A;  3S3N A;  2EBP A;  2KR3 A;  4KGX B;  2M02 A;  2E6Z A;  3CCS T;  3A5Z B;  1WGS A;  1VQO Q;  1E6H A;  3NPF A;  2F2X A;  4XTU A;  3QKJ A;  2H3J A;  2DXT A;  2CP5 A;  2NUP A;  1KSW A;  1YIJ Q;  3M4G A;  4AG1 C;  4JS5 A;  4JZ4 A;  3JCM V;  1J3T A;  2WAC A;  1Q86 U;  2DIG A;  2RHX A;  1K9M C;  5AT1 B;  2FL7 A;  1T3S A;  3ODW A;  4E7Z A;  4RUG A;  4JUV A;  2JS2 A;  2RNA A;  3GBQ A;  3P6A A;  4LDU A;  3JRZ A;  4C0G A;  1D0Y A;  3VS0 A;  3A8L B;  1UJY A;  1OOT A;  5C0M A;  1KC8 R;  3GP8 A;  1Q82 C;  1VQ8 Q;  2PNI A;  1ZBJ A;  1AWJ A;  1G3W A;  4C92 B;  4M7A B;  2X4Y A;  1V1C A;  1OPL A;  4M75 D;  3VS1 A;  4L5G A;  4QW2 A;  6AT1 B;  1V76 A;  4QVZ A;  1X27 A;  4GZU A;  4UC4 A;  1VQO T;  1C1A A;  3C12 A;  3SDZ A;  2EWN A;  3OSS C;  1XD4 A;  2JMA A;  1LCK A;  4II1 A;  4C8Q C;  1NG2 A;  2V1R A;  2CT3 A;  1YIJ T;  2LP5 A;  3CCL Q;  2QYZ A;  2AT1 B;  2CZ1 B;  1TSF A;  3X24 B;  1UDL A;  2O01 E;  3EG2 A;  4M77 B;  1Y71 A;  3UPU A;  2DK3 A;  1KZG A;  4F14 A;  2CS7 A;  4XTX A;  1N9R A;  5J26 A;  4LUD A;  3UAT A;  5CVI A;  1JJ2 S;  2XK0 A;  1JO8 A;  1Y7X A;  1I1J A;  2VUB A;  4GBQ A;  3I5S A;  1GL5 A;  4J8O A;  1LVK A;  1QKW A;  3QO3 A;  1VQ8 T;  2E65 A;  1SSF A;  1BI2 A;  2DVJ A;  1YNZ A;  1KK7 A;  3EGU A;  5LJ5 f;  2IPO B;  2AHJ B;  4OMF B;  4DOW A;  3CBM A;  2L0A A;  3QDR B;  4JRQ A;  3V8J A;  2MWP A;  4FW1 A;  2A28 A;  3M58 A;  2MWO A;  5GAN h;  2VB6 A;  1GBR A;  3QZ5 B;  4CC3 A;  1D0X A;  2X35 A;  1E6G A;  4GOU A;  1HK9 A;  4E47 A;  3CCL T;  1YFN A;  2QGG A;  3A8G B;  4RG2 A;  3JSC A;  2K3X A;  2EGA A;  1IXD A;  4C8Q A;  1K9M U;  1M2O A;  2O9S A;  2DJQ A;  3OYC A;  4DA4 A;  1RL2 A;  4IIO A;  3QXE B;  1YWO A;  2DL7 A;  3OYN A;  2VYT A;  1SPK A;  2KRN A;  1RAF B;  3V7S A;  4ZTJ A;  3PE0 A;  1KC8 C;  2E41 A;  4LXC A;  1Q82 U;  1MND A;  2QAS A;  3CXC P;  1YP5 A;  2A0F B;  1QQJ A;  2DPP B;  4JJC A;  3QUI A;  3PTA A;  1YJN Q;  2RJF A;  3M0P A;  3CC7 A;  2ZZD A;  5IT9 E;  2X3W D;  1VQL A;  2PQW A;  5LJ3 e;  3SHW A;  1KD1 U;  3PMT A;  5CK9 A;  2DA9 A;  1QVF A;  1QMC A;  1A0N B;  2EQJ A;  5GAN 8;  1M1K U;  3CCJ Q;  3RES A;  2VWF A;  5KYN A;  2E5Q A;  4E7J A;  1TUD A;  1VQ4 Q;  2VAS A;  2D0N A;  3ODO A;  5KYX B;  4WTO B;  4PLI A;  5KYY A;  1WYX A;  3H0I A;  3CD6 Q;  2HQH A;  1OZ3 A;  2LRQ A;  1CSK A;  2XMF A;  3I56 Q;  3QJ6 A;  1R77 A;  3VKI A;  3R6N A;  5GAN j;  1NPR A;  2DBK A;  4FW2 A;  5CIU A;  2GF7 A;  1VOM A;  4C0D B;  2V8J A;  4PJM A;  1U1T A;  2LCL A;  3JCM f;  2B86 A;  2AIR B;  4BDY A;  1N5Z A;  2RHI A;  3MJX A;  1UUE A;  4XTV A;  1MMN A;  4LUE A;  3ZFJ A;  3LX7 A;  4Z89 A;  2EYX A;  1F5X A;  3I55 Q;  3AT1 B;  1MUZ A;  2V26 A;  1U1S A;  5GAO n;  1VIE A;  2COZ A;  2GTO A;  4M7D A;  2OTJ Q;  1YHQ T;  1VQ4 T;  3GF5 A;  2RQV A;  4RTX A;  4J7I A;  1DJ7 B;  2K5I A;  1OEB A;  1WHG A;  3QHS A;  3CCS A;  1TS9 A;  1WXU A;  2CT4 A;  3I56 T;  2HBW A;  5LJ3 h;  1VUB A;  2G3R A;  1ZLM A;  2GQV A;  1RLQ C;  4RCC A;  1T0J A;  1VQM Q;  4RMO A;  1KC8 U;  2OAW A;  2EKH A;  1NZ9 A;  3OS2 A;  4HT8 A;  1RUW A;  2KR9 A;  3L2U A;  3X26 B;  4FSX A;  1QP3 A;  1JJ2 P;  2F1L A;  1FWZ A;  1G3S A;  2O9V A;  2JN0 A;  1TG0 A;  2OX7 A;  3URG A;  5AYF A;  1EFN A;  2DAQ A;  3CPW A;  5GAN 5;  2DF6 A;  3MPX A;  1K73 U;  4DBR A;  4M78 D;  2CP6 A;  1LB1 A;  5J39 A;  1YCY A;  5GMK e;  4OF1 A;  1NE8 A;  4AFU C;  2XIC A;  3I55 T;  1VIF A;  2Y4Y A;  4BD3 A;  5EG2 A;  2OTJ T;  3CCV Q;  1JEG A;  2MMP A;  4J6X A;  3OMC A;  4YTL A;  2HL5 C;  4C92 G;  3SWN B;  3TEE A;  1VQO A;  4RCB A;  3WVD B;  1VQM T;  2MF2 A;  4PJO C;  4KBM B;  4FYX B;  1H64 1;  2O31 A;  3INZ A;  1NLP C;  3O5Z A;  1YIJ A;  4JJB A;  1OQK A;  2SRC A;  2BZX A;  3QYG B;  3JCM e;  1PD1 A;  4M7D D;  2CZ6 B;  3UA7 A;  1TWB A;  3QSU A;  1D3B B;  4FSS A;  2FRY A;  2DXU A;  1QWE A;  2CSI A;  4X9C A;  2FVU A;  1UHF A;  1I8F A;  2CGH A;  1AHJ B;  3QG1 A;  3H0H A;  2D9T A;  2L8D A;  4OMN A;  2QEX Q;  1QLY A;  2RJC A;  4HCB A;  4J7F A;  2P4T A;  5LJ3 j;  2C0O A;  3CCR T;  3HSB A;  2OJ2 A;  1VQ8 A;  3GNF B;  1CKB A;  3CCV T;  1X86 A;  1YI2 Q;  2EPD A;  2EYQ A;  2EQI A;  3L2Q A;  1K0S A;  2QXF A;  1JJ2 A;  2AZS A;  1N27 A;  2ECZ A;  1YN8 A;  1VQN Q;  2RI5 A;  4BI8 B;  2AKL A;  2DBM A;  1E7O A;  1S72 Q;  4L6V 5;  1X75 C;  4QKU A;  3CCM Q;  2HAX A;  2BE9 B;  1SHG A;  3QPH A;  1VQ5 Q;  5C6S A;  3CCL A;  3FJ5 A;  2D6F A;  3NGP A;  3BW1 A;  1XOV A;  1CKA A;  2DE0 X;  4PJO A;  4XK8 E;  1D1C A;  2F5T X;  5GAO q;  4ESR A;  5DLQ E;  1SHF A;  4BY6 B;  1LJO A;  4PJL A;  4C5G A;  4FYW B;  3RIR A;  1K0X A;  4KRT A;  1AWW A;  1B3Q A;  3VRY A;  3PIO A;  1X2K A;  5IXB A;  2XHC A;  2QK0 A;  2QEX T;  3CQT A;  2DNU A;  5GMK m;  2VXE A;  3PNW C;  1YI2 T;  1EIF A;  3DB4 A;  1ARK A;  2ZPF B;  3EFS A;  2YRD A;  2V1Q A;  3P8D A;  3EGD B;  4D0O A;  2HMA A;  4Y28 E;  2A08 A;  4B9W A;  4N0A C;  2RHU A;  3H6Z A;  1FMV A;  2NZ8 B;  1UJ0 A;  2X4X A;  2R5M A;  3G1J A;  2NLU A;  3NTH A;  1UE9 A;  3CCM T;  3E19 A;  3CME Q;  1VQ5 T;  2COW A;  1X6B A;  1WX6 A;  1IRX A;  2EYW A;  1EX4 A;  1F1B B;  3S3O A;  1OZ2 A;  4M75 C;  2JNG A;  1QVF S;  1WA7 A;  2EGC A;  3OYE A;  3UWN A;  2BE7 D;  2LQN A;  5FU7 C;  2RM4 A;  4J6Y A;  2G6F X;  1IGU A;  2KXC A;  2PTK A;  4C8Q G;  1WHJ A;  2KY9 A;  1WJQ A;  4WCI A;  1M2V B;  3G4S T;  5CKH A;  1ZHI A;  1Q81 R;  1TTH B;  3EGX B;  1PM3 A;  4GLM A;  5GAN f;  3KXT A;  3LWH A;  5LJ5 d;  2LJ1 A;  1O9S A;  4CC4 B;  4KGZ B;  1KHI A;  3JCM W;  2RI3 A;  3J7A F;  3SD4 A;  3A8M B;  5CKE A;  3ZBD A;  3VS3 A;  2JMC A;  2LC4 A;  2ZPI B;  2QDL A;  4IUP A;  2FPF A;  4C8Q F;  2FRW A;  1WNL A;  1KQ2 A;  3JCM b;  1KD1 R;  5KYW B;  1YHQ A;  2JT4 A;  1VQ4 A;  3QZ9 B;  3PGG A;  1M1K R;  3D7S B;  3CMA Q;  2YUO A;  3I56 A;  1D09 B;  1Y07 A;  1I5O B;  3BY7 A;  2W10 A;  3CC4 Q;  1MV0 B;  2L5Q A;  1KQ1 A;  1UTI A;  4JZ3 A;  4J9F A;  5GMK i;  1G83 A;  1QCN A;  3RMQ A;  2JZ2 A;  4C0F A;  4C5E A;  1WHH A;  2HQE A;  2P84 A;  3GLX A;  3JCM Q;  3BDU A;  1ZUK A;  5LJ5 g;  1RAC B;  1M30 A;  5CKD A;  2F69 A;  3SFM A;  2OI3 A;  4CC2 A;  4A4E A;  1PHT A;  3OQ5 A;  1NYG A;  4ZNX A;  4F16 A;  1MV3 A;  4RTV A;  4OMM A;  3E9G A;  3CPW S;  2CH4 W;  2K3Y A;  1AOJ A;  3HRS A;  4DEX A;  3CEY A;  3I55 A;  3C95 A;  5GAM g;  2MI6 A;  2LQK A;  2LZ6 B;  1HYO A;  2RA2 A;  5KYU B;  3OYM A;  2QDY B;  2ZPE B;  2ROL A;  2OTJ A;  1PSE A;  2VRW B;  2FHD A;  1PWT A;  2IIM A;  4C8Q E;  1GXI E;  3CMA T;  3FC3 A;  3M9Q A;  1H3Z A;  2X51 A;  3CC4 T;  1UGS B;  1KHC A;  1VQM A;  2ESW A;  2JM8 A;  5L23 A;  2PZ1 A;  5GAN e;  4OVA A;  2HEQ A;  4M77 A;  2X4W A;  2YLB A;  1Q81 C;  3OYY A;  3JB9 G;  3EFR A;  3TQ7 P;  4TVR A;  4F7U A;  5FU7 B;  4FYV B;  2ED0 A;  3EG9 B;  2GNC A;  1I5L A;  1AEY A;  4HVU A;  4XTZ A;  2DL8 A;  2LMJ A;  4DBQ A;  3JCM d;  2GBQ A;  2HL3 A;  1RAG B;  3HTR A;  1SSH A;  4ZTF A;  3M0S A;  4NOY A;  4K11 A;  3QBV B;  1M5Q 1;  1K73 R;  3WXM B;  3G7Z A;  3CCR A;  5IH2 A;  1YBY A;  2PVG B;  1KD1 C;  1KIK A;  3P8H A;  3JB9 F;  3OS5 A;  4A4K A;  2EAY A;  5LJ3 f;  4J83 A;  1M1K C;  3V7R A;  2M0Y A;  2NUP B;  1G3T A;  1JB0 E;  3S3M A;  1UGR B;  4DBF A;  4E7S A;  2LX9 A;  4OMO A;  1X6G A;  1YJW Q;  1OI1 A;  3SEM A;  4OP0 A;  1RI0 A;  2JOY A;  2KBT A;  2ROT A;  2QA4 Q;  4RTZ A;  8ATC B;  3TU4 K;  1QVF P;  4C92 D;  2LT4 A;  3JV3 A;  3H8Z A;  2AZV A;  5FWB A;  4M7A D;  1IHW A;  2X3X D;  1UFF A;  4QQD A;  4IKF A;  4ATO A;  2Y90 A;  5GAO p;  1GBQ A;  4GYV A;  1UEC A;  2KRM A;  4OMP A;  1M3C A;  4R55 A;  2M51 A;  4XAX B;  1BI1 A;  1G5V A;  4HVV A;  4R56 A;  1W4S A;  3OY9 A;  3VYG A;  4MT7 A;  1AVZ C;  4C5H A;  3OYB A;  4XU2 A;  5L8R E;  2QG9 B;  1AZE A;  2QEX A;  1Q7Y R;  5KCO A;  3DLL A;  1ZX6 A;  3VJP A;  4JDS A;  4XTW A;  2KAF A;  4M77 D;  3QWX X;  2ZPH B;  4KT0 E;  3REA B;  2O4X A;  2K2V A;  3CBP A;  1YIT Q;  2BKD N;  3VYH B;  1YJW T;  3OMG A;  2DZ9 A;  4M78 C;  1HD3 A;  1Y0M A;  1Y96 A;  2QA4 T;  2DEU A;  3RKW A;  1K9A A;  4Q5W A;  3H9N A;  3CCM A;  2HDA A;  2CP0 A;  5GAN 2;  1ZSZ A;  2HD0 A;  4IUQ A;  1Q81 U;  4F04 B;  2YDL A;  3GF9 A;  2V8I A;  4XU0 A;  2DD4 A;  5FU6 C;  1C0M A;  3BE3 A;  3GOX A;  4BI3 A;  1PSF A;  1UG1 A;  2K6D A;  3M56 A;  3MO8 A;  1VQ6 Q;  3KSY A;  4ELY C;  5GJV B;  5D6Y A;  4A4G A;  2DFU A;  1K73 C;  4DQ2 A;  1M3A A;  2J6F A;  2QI2 A;  5D6X A;  2RHZ A;  4M7D C;  3G4S A;  3OYD A;  3OBW A;  2MOX A;  7AT1 B;  5A0D A;  1YIT T;  2RJD A;  3CPW P;  2EQK A;  1IB8 A;  3LW5 E;  1AWO A;  3E9F A;  1BKB A;  5KE2 A;  1HXD A;  1X6O A;  3G71 Q;  1D1B A;  2CP3 A;  4IUT A;  1IZ6 A;  4J6W A;  3TCJ A;  4C8Q B;  4QVD A;  4JJN K;  3LH5 A;  4AG2 C;  4PJO F;  4M78 A;  2RQR A;  5GAN 6;  2RQW A;  4EDU A;  2DM1 A;  3VS4 A;  5GAN 3;  4ZGJ B;  5FI1 A;  2J05 A;  3MP8 A;  3PVQ A;  3EFO A;  5HCK A;  3MP6 A;  3OA6 A;  1KZ7 A;  1FX7 A;  4M4Z A;  5J3B A;  2L89 A;  2A7Y A;  3RR6 A;  5CQX A;  1U5S A;  1YJN T;  4Y91 A;  1Q7Y C;  4PK4 A;  2LT1 A;  2XDB A;  1ZUU A;  2H3E B;  3TSW A;  2RGN B;  3QBY A;  1BI0 A;  2KRS A;  4KUL A;  4QVC A;  1PRL C;  1PNJ A;  2JUF A;  1SG5 A;  2DXB A;  4L59 A;  4E7K A;  3CCU Q;  1M90 U;  2NUT A;  4NS5 A;  3CCJ T;  2GQI A;  2KK4 A;  3Q1J A;  2RQU A;  4N4H A;  3IQL A;  3G71 T;  2DZC A;  2GFA A;  1RAE B;  1VQK Q;  1OU9 A;  4IUU A;  1ZBX A;  3CD6 T;  2X9H A;  2JTM A;  2XD0 A;  4HXJ A;  1NEG A;  2BZ8 A;  2DL5 A;  2NYS A;  4PJJ A;  4Y92 A;  2VGN A;  2FPD A;  4CI0 C;  4ELZ C;  1BB9 A;  4A63 B;  2GFU A;  4FYY B;  4E7L A;  1VYU A;  4RKU E;  3RMS A;  3SWN A;  2QQB A;  5D6W A;  4PJO E;  3DB3 A;  1R0C B;  2CZ0 B;  1QVG S;  3U23 A;  3CMA A;  4HCZ A;  2DVE A;  1W1F A;  3CC4 A;  2DIL A;  3E2U A;  3J80 E;  2D1X A;  3NMZ C;  4LD9 K;  2E3I A;  4ZGE B;  3EHR A;  4IIM A;  1Z9Z A;  3EH1 A;  3M59 A;  3CCU T;  3M4Y A;  4M75 G;  3ODX A;  3BFM A;  3VUB A;  1TUC A;  3HPW A;  1NEB A;  1ABO A;  2RN8 A;  4MZT A;  2DL4 A;  2JM9 A;  2ZAE A;  4HA8 A;  1VQK T;  2LQW A;  5GAN d;  1TXD A;  1MHN A;  1OUL A;  1WQ7 A;  2RB6 A;  3OB9 A;  4M7D B;  1NTY A;  2M9U A;  4OB0 B;  4JRP A;  2YUP A;  3OYJ A;  1K1Z A;  3TSZ A;  2FZC B;  4GLK A;  1WPY A;  1PRM C;  1KQS S;  1KFZ A;  2DKG A;  2RO0 A;  1RAA B;  1AWX A;  5KCH A;  3SB2 A;  2VVK A;  2BTT A;  3I5R A;  3JCM X;  3EHQ A;  2F5K A;  1YJ9 Q;  4M75 F;  3OYA A;  2F2V A;  4X9D A;  3QII A;  1VQ7 Q;  5GAM h;  4QT7 A;  2LVM A;  3C4S A;  1Q7Y U;  1K8A U;  3A8H B;  1R0B G;  2EYZ A;  1UEB A;  1BU1 A;  3M55 A;  1WI7 A;  2MIO A;  3X20 B;  4BUG A;  4FM4 B;  4ZGD B;  2VXF A;  4PLL A;  2KT8 A;  3C94 A;  5DM7 R;  2XI9 A;  4CC7 A;  3QWY A;  4FT2 A;  4F17 A;  3N5B B;  2E5K A;  1SF9 A;  1C6V X;  2FB7 A;  2BUD A;  4MDW A;  1WDX A;  4Z02 A;  4ANJ A;  5EC7 A;  4AT1 B;  2FZG B;  1P92 A;  1NJI R;  4ZN1 A;  2EKO A;  1GCP A;  1WQW A;  4BI4 A;  3MCA B;  5GAN 7;  1TUG B;  2PUK B;  3TRE A;  2XDP A;  1XCG A;  5CKF A;  2HNI A;  1HSQ A;  3OSV A;  1YJ9 T;  4AFQ C;  1G2B A;  1VQ7 T;  2AKK A;  2XG8 D;  2OAU A;  5CCA A;  4ZN3 A;  1YJW A;  1H92 A;  3OYL A;  2QA4 A;  2YXY A;  5M9O A;  4OGC A;  2GCX A;  3M57 A;  4EMK A;  4M75 E;  4J9I A;  1S1N A;  4C0Z A;  1VYV A;  4F7U F;  2ZPG B;  3LYI A;  3L2Z A;  2M1H A;  1K4U S;  3CCE Q;  2F2W A;  2P0P A;  2EYY A;  4DOV A;  4PKC C;  3M53 A;  2QQS A;  4DBH A;  4XU3 A;  4J9B A;  3A1P A;  3NTK A;  3L2V A;  1WHK A;  2EFI A;  2E10 A;  2HZY A;  2P0Q A;  1VQN T;  3FDR A;  3VS6 A;  5GAM j;  1JBM A;  2LX7 A;  5IN1 A;  1M9S A;  1S72 T;  2XU8 A;  2K2M A;  2A3L A;  4JLG A;  1FMK A;  1VQL Q;  1R8O B;  1OV3 A;  3MEW A;  2E1H A;  4MMK A;  3CCQ Q;  1GFD A;  1X69 A;  1ZQ1 A;  2P4R A;  3REB B;  2RK1 A;  1YIT A;  2D8J A;  1FYN A;  3G6E Q;  3WVE B;  3KBG A;  1VQP Q;  1IHV A;  2KGT A;  5LJ3 d;  5GMK l;  2DLP A;  3VUZ A;  4PJO B;  2LNV A;  2LCC A;  4PFZ A;  1BK2 A;  2EJ9 A;  3UT1 A;  3S6W A;  1KG1 A;  2O88 A;  3JB9 I;  3CCE T;  5KYW A;  4JS4 A;  1QVG P;  1WZO A;  3HRT A;  1GCQ C;  3KFV A;  3VS5 A;  4D6W A;  1VA7 A;  2MAM A;  3VV0 A;  1OPK A;  4WF2 A;  4F7U E;  2EIF A;  3LWI A;  3VS7 A;  1NJI C;  3TVT A;  1YJN A;  1MNE A;  4CRI A;  5HK0 A;  1ABQ A;  3I9Q A;  1YWP A;  1MMD A;  1B34 A;  2ZCF B;  1TOV A;  5GAO m;  4M7A C;  2HSP A;  3MET A;  3CME T;  4JLI A;  3CCQ T;  1Y57 A;  3RDV A;  1M27 C;  3UF4 A;  3H41 A;  4OMQ A;  1X01 A;  3NHN A;  2BIV A;  2EQM A;  3CCJ A;  3NTI A;  3G6E T;  2CUB A;  1VQP T;  5LJ3 g;  3GPL A;  1RAI B;  2KSS A;  3G71 A;  1KQS P;  3KUF A;  2C0T A;  3FIF A;  3P8B B;  2LQ8 A;  2YHT A;  3QYH B;  3M5A A;  3EG0 A;  2L3P A;  3CD6 A;  1O75 A;  1M8M A;  1QP2 A;  2KRO A;  4M77 C;  2LNH B;  2FG0 A;  5IXF A;  3EO2 A;  5I22 A;  1RAH B;  1X43 A;  2HKN A;  3M0T A;  1RAB B;  4EMG A;  2EVR A;  4JRK A;  1GCQ A;  2JTF A;  2L3S A;  1ZSG A;  2CKK A;  2SEM A;  3QJY A;  2MCN A;  3RER A;  4P5N A;  4BB7 A;  3OYK A;  2EQU A;  4ME7 A;  2YSQ A;  1XTD A;  3MKD A;  2CP7 A;  2E70 A;  1VQ9 Q;  4C92 A;  3CCU A;  3ER0 A;  2VC8 A;  4M7A A;  4HT9 A;  4BAC A;  2JXB A;  2OTL Q;  5I11 A;  1W2B S;  5A0G A;  2GTJ A;  1QVG A;  2XDD A;  1XJW B;  5DY9 A;  2Z0W A;  2RHY A;  1VQK A;  2E12 A;  4DEY A;  1M90 R;  2FYK A;  4M78 F;  4EMH A;  3PMI A;  3VRZ A;  2DL3 A;  4EIK A;  4X34 A;  1EZZ B;  2KE9 A;  1N8R R;  3OW2 S;  2KMT A;  3ULR B;  4NL3 A;  4M75 B;  4M7D G;  4LDV A;  2KNB B;  4HCK A;  5CKB A;  2JJ9 A;  1QKX A;  3GIB A;  1B7T A;  1NJI U;  1WJS A;  1I0C A;  2CP2 A;  1ZA2 B;  2FPE A;  1Z9Q A;  2X4J A;  4IUR A;  4FL6 A;  1KQS A;  2QQA A;  1VQ9 T;  3MPU B;  4BDZ A;  3L2R A;  5KH6 A;  2K4Y A;  1QW1 A;  4M7D F;  4N4I A;  1RJ2 A;  2OTL T;  5A2Q E;  3FB9 A;  1PKT A;  4ORZ A;  3CCV A;  1PG5 B;  1RLP C;  4GY5 A;  4E2F B;  1OX8 A;  2ZGW A;  4LDW A;  2CUD A;  2MYS A;  5FRO A;  5GAO r;  1OX9 A;  2KXD A;  3M0R A;  2RMO A;  4RTT A;  1ZSZ C;  2DXC A;  1UB4 A;  3OS0 A;  3EG3 A;  2KQW A;  1FXX A;  5HKC A;  4M78 E;  1G3Y A;  2YWW A;  1YJ9 A;  3EH2 A;  3CC2 Q;  1D0Z A;  3DLM A;  1VQ7 A;  3CBO A;  3LLR A;  3HL8 A;  3MEV A;  4F7U B;  3O8V A;  3JCM g;  1M3B A;  2DRK A;  4C0D C;  5FI0 A;  1K8A R;  4V2S A;  2EGE A;  1GFC A;  1YI2 A;  2RJE A;  4JJD A;  4J5Y A;  3C0C A;  1MGQ A;  2B8A A;  1M90 C;  5CR2 A;  1DBH A;  3PVL A;  1VQN A;  3RKY A;  3X28 B;  3FEO A;  4M7D E;  5GAN 4;  1N8R C;  1S72 A;  5A0L A;  1OU8 A;  1UGP B;  3V7C A;  2ED1 A;  3M0U A;  1VQ5 A;  5GAM f;  2LJ0 A;  2FZK B;  1X2Q A;  2KEA A;  3E1S A;  3CC2 T;  2H8H A;  4E7H A;  2VV5 A;  2JW4 A;  4PFO A;  5KYX A;  2ATC B;  2HSE B;  2I0N A;  4MZP A;  4JPB W;  1M1G A;  1BCO A;  2K79 A;  4LDY A;  2CZ7 B;  2L2P A;  4LE9 A;  2JVV A;  3A98 A;  5IHK A;  4LD6 A;  4HCC A;  1SEM A;  4PJO G;  3CCE A;  5DLO A;  2FO0 A;  2DTH A;  3LGF A;  4PFP A;  2NWM A;  2DTO A;  3OS1 A;  5GJW B;  5KE3 A;  4PL6 A;  5I21 A;  1LPL A;  4B6M A;  4OB2 B;  1JRI A;  1PC0 A;  1XNI A;  2ABL A;  3LH0 A;  3OYH A;  3OYI A;  2MPX C;  2O4X B;  3VS2 A;  2HKQ B;  2ZPB B;  4J9D A;  5FW9 A;  1W2B P;  4HKE A;  3CME A;  1FMW A;  3CCQ A;  4MML A;  3V8K A;  1Y96 B;  5I2M A;  3JCM P;  3SWN C;  2DRM A;  3ZL7 C;  2CRE A;  5I2S A;  3JB9 J;  3OBY A;  3G6E A;  2QTX A;  1VQP A;  3T9N A;  1B07 A;  2R58 A;  2YRV A;  1ZSZ B;  3OW2 P;  4D8K A;  2JS0 A;  1H8K A;  1YHQ Q;  2LTO A;  1T0H A;  3R6O A;  5CO7 A;  1BCM A;  1G8X A;  2LCS A;  2PU9 B;  2RPN A;  5FRM A;  1VQ6 T;  2CSQ A;  1AZG B;  4D0N B;  2WSC E;  2RK2 A;  1K8A C;  4XTY A;  2HBP A;  1TU0 B;  2LJ3 A;  3F70 A;  4OML A;  5LJ5 e;  1U3O A;  4RTY A;  3JCM J;  3KZ1 A;  2KDS A;  4O5V A;  1AT1 B;  1MMG A;  2WSE E;  4C8Q D;  4Z8A A;  2DYI A;  2K5L A;  3HFN A;  1NM7 A;  3VU3 C;  4AFS C;  3HKS A;  3HP9 A;  1IO6 A;  4BE1 A;  5GAM e;  1IGQ A;  1N8R U;  4BE2 A;  2DEQ A;  1HJD A;  1QWF A;  3RUX A;  3UDC A;  3PFS A;  3ZEH A;  2K3B A;  2E64 A;  3RNJ A;  3EG1 A;  4J9H A;  2YRC A;  1K76 A;  5KYY B;  2ENM A;  4M78 B;  1QVP A;  3KY9 A;  5IAY A;  2W0Z A;  3FRN A;  4E7I A;  2RI2 A;  2HCK A;  3JCM c;  3GNG A;  3EFO B;  2DX1 A;  3CXC A; 
#chains in the Genus database with same CATH homology
 2OI3 A;  4CC2 A;  1PHT A;  4ZNX A;  1NYG A;  2O2O A;  1MV3 A;  4F16 A;  4RTV A;  2K7A A;  4OMM A;  4J9B A;  2EGA A;  1BBZ A;  4J9C A;  2O9S A;  2CH4 W;  1AOJ A;  4DEX A;  2DJQ A;  5ECA A;  3VS6 A;  2LZ6 B;  4IIO A;  1SRL A;  2LX7 A;  1YWO A;  2DL7 A;  2ROL A;  2K2M A;  2VRW B;  1WIE A;  1FMK A;  1SPK A;  1PWT A;  1NLO C;  2KRN A;  1OV3 A;  2AK5 A;  1GFD A;  2IIM A;  3PE0 A;  1X69 A;  1QCF A;  2P4R A;  3REB B;  4J9E A;  5FWC A;  2A37 A;  1YP5 A;  2D8J A;  1FYN A;  2L3Q A;  2ESW A;  4JJC A;  2JM8 A;  2KGT A;  5L23 A;  2PZ1 A;  2DLP A;  2HEQ A;  4RTW A;  2NUZ A;  3M0P A;  1BK2 A;  2X3W D;  2O88 A;  2ED0 A;  4X1V A;  2BZY A;  2GNC A;  3SHW A;  1AEY A;  4HVU A;  5IHN A;  2DA9 A;  3KFV A;  1GCQ C;  1A0N B;  2JTE A;  3VS5 A;  2DL8 A;  2LMJ A;  4LNP A;  1UGV A;  1VA7 A;  2GBQ A;  2VWF A;  3I35 A;  1SSH A;  2C0I A;  3M0S A;  1OPK A;  4K11 A;  2J6K A;  3QBV B;  1JXM A;  1RI9 A;  1TUD A;  3VS7 A;  3TVT A;  2RF0 A;  5IH2 A;  2D0N A;  3ODO A;  2FEI A;  1W70 A;  1WYX A;  1KIK A;  1ABQ A;  1W6X A;  3H0I A;  3I9Q A;  1YWP A;  1CSK A;  2HSP A;  2XMF A;  2M0Y A;  1Y57 A;  3UF4 A;  1M27 C;  3H41 A;  4OMQ A;  3R6N A;  1GRI A;  3UA6 A;  3NHN A;  2CH4 A;  1X6G A;  4OMO A;  4E6R A;  2YT6 A;  3SEM A;  2DBK A;  2CUB A;  2KBT A;  2ROT A;  1KJW A;  4RTZ A;  2YUN A;  3JV3 A;  5FWB A;  2AZV A;  2DX1 A;  2C0T A;  2X3X D;  1UFF A;  1JQQ A;  3EG0 A;  4Z88 A;  2L3P A;  2B86 A;  1M8M A;  2KRO A;  1N5Z A;  1GBQ A;  1UUE A;  4GYV A;  5JHH A;  1UEC A;  2LNH B;  2FG0 A;  2KRM A;  1M3C A;  4OMP A;  2M51 A;  5IXF A;  4LUE A;  3EO2 A;  4AFZ C;  5I22 A;  2J6O A;  4HVV A;  4Z89 A;  1X43 A;  3M0Q A;  3M0T A;  4RTU A;  4MT7 A;  1AVZ C;  2EYX A;  1F5X A;  1MUZ A;  3H0F A;  1AZE A;  2KT1 A;  2EVR A;  2GTO A;  1ZX6 A;  1GCQ A;  2L3S A;  2RQV A;  1ZSG A;  4RTX A;  3QWX X;  2VKN A;  2SEM A;  1OEB A;  1WFW A;  2YUQ A;  1H3H A;  2MCN A;  1YCS B;  2A36 A;  1WXU A;  2CT4 A;  3REA B;  2HBW A;  1AD5 A;  1T3L A;  2YSQ A;  1ZLM A;  1RLQ C;  1T0J A;  2OAW A;  5JHG A;  2EKH A;  1RUW A;  2KR9 A;  1HD3 A;  1Y0M A;  1NYF A;  2CDT A;  2JXB A;  2O9V A;  1K9A A;  5I11 A;  2HDA A;  1TG0 A;  2GTJ A;  2J06 A;  2GGR A;  1WXB A;  4DEY A;  1EFN A;  2YDL A;  3GF9 A;  2DF6 A;  3VRZ A;  3MPX A;  2DL3 A;  4EIK A;  2KE9 A;  4HVW A;  1LB1 A;  1JU5 C;  1ZUY A;  3ULR B;  4AFU C;  2KNB B;  4HCK A;  1UG1 A;  2K6D A;  3KSY A;  2K9G A;  5GJV B;  3BJI A;  3THK A;  4YON A;  1JEG A;  1WLP B;  1QKX A;  1M3A A;  1WXT A;  2J6F A;  1I0C A;  1JXO A;  2FPE A;  2Z0Q A;  1Z9Q A;  2MOX A;  4J9G A;  1AWO A;  2O31 A;  3O5Z A;  1NLP C;  4JJB A;  1RJ2 A;  2SRC A;  2BZX A;  1PKT A;  3LH5 A;  4ORZ A;  1RLP C;  3UA7 A;  4AG2 C;  2CUD A;  4FSS A;  2FRY A;  2RQR A;  2EW3 A;  3T06 A;  1QWE A;  2RQW A;  2CSI A;  2DM1 A;  3VS4 A;  1KI1 B;  5FI1 A;  2J05 A;  1I07 A;  1UHF A;  2KXD A;  3M0R A;  2RMO A;  3PVQ A;  5HCK A;  4RTT A;  1KZ7 A;  3H0H A;  4M4Z A;  4OMN A;  3EG3 A;  1QLY A;  2DYB A;  2DFK A;  2J7I A;  2C0O A;  2OJ2 A;  1U5S A;  5IHI A;  1CKB A;  1X86 A;  1ZUU A;  2EPD A;  3TSW A;  2EQI A;  2RGN B;  2KRS A;  1K0S A;  2AZS A;  2ECZ A;  1YN8 A;  1PRL C;  1PNJ A;  1UHC A;  1VYT A;  2AKL A;  1U06 A;  2DBM A;  1E7O A;  1M3B A;  2DRK A;  2GQI A;  5FI0 A;  4R0K A;  1SHG A;  2RQU A;  2EGE A;  3IQL A;  1SRM A;  1GFC A;  3FJ5 A;  3NGP A;  1XOV A;  1CKA A;  2DE0 X;  2RQT A;  4JJD A;  3C0C A;  4HXJ A;  4LN2 A;  4ESR A;  1DBH A;  1NEG A;  2BZ8 A;  2DL5 A;  2DMO A;  3PVL A;  4Y92 A;  1SHF A;  3RBB B;  2KYM A;  1K0X A;  2FPD A;  4KRT A;  1AWW A;  1B3Q A;  3VRY A;  4D8D A;  1X2K A;  1BB9 A;  4A63 B;  1VYU A;  5IXB A;  1BY1 A;  1PKS A;  1FOE A;  3CQT A;  2KYB A;  2ED1 A;  3M0U A;  2DNU A;  2LJ0 A;  1X2Q A;  3U23 A;  2EBP A;  2KEA A;  2KR3 A;  1ARK A;  2V1Q A;  2H8H A;  1W1F A;  2DIL A;  4D0O A;  2JW4 A;  2D1X A;  2I0N A;  2A08 A;  3NMZ C;  1E6H A;  3NPF A;  4JPB W;  2F2X A;  2K79 A;  3EHR A;  4IIM A;  1Z9Z A;  2L2P A;  4LE9 A;  1KSW A;  3A98 A;  5IHK A;  2NZ8 B;  1UJ0 A;  3ODX A;  1TUC A;  1UE9 A;  1SEM A;  4AG1 C;  4JZ4 A;  1J3T A;  1NEB A;  1ABO A;  2RN8 A;  2DL4 A;  2JM9 A;  2FO0 A;  2LQW A;  1TXD A;  2NWM A;  1T3S A;  5GJW B;  3ODW A;  1X6B A;  1WX6 A;  4RUG A;  2EYW A;  2JS2 A;  1NTY A;  2RNA A;  3GBQ A;  3P6A A;  2YUP A;  1K1Z A;  3TSZ A;  3VS0 A;  1UJY A;  2ABL A;  1OOT A;  1PRM C;  1KFZ A;  1WA7 A;  2EGC A;  1AWX A;  3VS2 A;  5FW9 A;  4J9D A;  2VVK A;  2BTT A;  3I5R A;  2LQN A;  2PNI A;  3EHQ A;  1ZBJ A;  1AWJ A;  2G6F X;  2KXC A;  2F2V A;  2PTK A;  1V1C A;  1OPL A;  4QT7 A;  3VS1 A;  2DRM A;  4WCI A;  2CRE A;  3ZL7 C;  2EYZ A;  1BU1 A;  1X27 A;  1WI7 A;  4GZU A;  2MIO A;  1B07 A;  2KT8 A;  4D8K A;  2JS0 A;  4GLM A;  1H8K A;  1XD4 A;  2JMA A;  1LCK A;  4CC7 A;  1T0H A;  2LCS A;  1NG2 A;  2V1R A;  2CT3 A;  3QWY A;  2LJ1 A;  4F17 A;  2RPN A;  4CC4 B;  2CSQ A;  2E5K A;  2LP5 A;  1AZG B;  4D0N B;  1UDL A;  3EG2 A;  3VS3 A;  2LJ3 A;  2JMC A;  1WDX A;  4OML A;  5EC7 A;  1U3O A;  4RTY A;  1KZG A;  2QDL A;  4F14 A;  3KZ1 A;  2FPF A;  2FRW A;  4LUD A;  3UAT A;  1GCP A;  1JO8 A;  4Z8A A;  1I1J A;  2JT4 A;  4GBQ A;  3I5S A;  1NM7 A;  1GL5 A;  4AFS C;  1IO6 A;  1XCG A;  1QKW A;  1HSQ A;  1HJD A;  1QWF A;  2YUO A;  4AFQ C;  2DVJ A;  1YNZ A;  1G2B A;  2W10 A;  1MV0 B;  2AKK A;  3EGU A;  2K3B A;  1UTI A;  4JZ3 A;  3RNJ A;  3EG1 A;  4J9H A;  1K76 A;  4J9F A;  1H92 A;  2ENM A;  1G83 A;  3KY9 A;  2L0A A;  2W0Z A;  2HCK A;  1S1N A;  2A28 A;  4J9I A;  1VYV A;  1ZUK A;  1GBR A;  1K4U S;  1M30 A;  2F2W A;  2D8H A;  4CC3 A;  2EYY A;  1E6G A;  4GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...