3JV3A

Structure of sh3e-dh unit of murine intersectin-1l
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
278
structure length
278
Chain Sequence
b'GSCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Intersectin-1
molecule tags Protein binding
source organism Mus musculus
publication title The minimal autoinhibited unit of the guanine nucleotide exchange factor intersectin.
pubmed doi rcsb
total genus 105
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00621 RhoGEF RhoGEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3jv3A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3jv3A01
2VWFA 2CDTA 2HSPA 1NM7A 2LJ1A 3GBQA 4GBQA 1AWJA 1PKTA 2A28A 4LE9A 1JXOA 4HVWA 3NMZC 2KRNA 1UTIA 1MV3A 1VA7A 4LN2A 1E7OA 1Y0MA 2AZSA 2JMCA 1QKXA 4GLMA 4GOUA 3M0TA 4J9HA 1ARKA 1KSWA 1LCKA 1Y57A 2H8HA 1PHTA 2GTOA 1DBHA 1HD3A 3I9QA 4CC7A 1XD4A 1S1NA 3SHWA 2O9VA 1X86A 3A98A 3EO2A 2GTJA 2PZ1A 4D8KA 2LNHB 1WX6A 4AFZC 1Z9QA 1SRMA 4IIMA 4CC3A 1GRIA 1VYUA 2BZYA 1QKWA 3QWXX 3EHQA 2DM1A 3EHRA 1WA7A 2D0NA 2P4RA 2YUNA 2RQWA 2DL8A 5ECAA 1K76A 2KYBA 2RGNB 4WCIA 1WYXA 2G6FX 2K3BA 1UUEA 4K11A 2EYYA 4OMLA 2OAWA 3PVQA 2CUBA 1YWPA 2ED1A 4JJDA 1I1JA 1GFDA 1BB9A 2D8JA 4OMPA 2O9SA 2JM8A 4MT7A 5HCKA 2YSQA 2AZVA 2K9GA 4E6RA 2JMAA 2DRKA 4RTZA 3QWYA 1BBZA 4ZNXA 1ABQA 2AKLA 4HXJA 2DF6A 1AWXA 1EFNA 1RI9A 2OJ2A 1K0SA 4GZUA 3EG3A 2EBPA 2ED0A 1JQQA 1SSHA 1WFWA 2DILA 4OMOA 2PTKA 1K1ZA 1B3QA 3ODOA 2VRWB 1TUCA 4JJCA 2RN8A 5FI0A 1KIKA 2YT6A 3H41A 2C0IA 1HSQA 2ROLA 1YP5A 2ABLA 3VS3A 2B86A 1UDLA 2JM9A 3JV3A 2BTTA 1SEMA 1UFFA 1AOJA 2EVRA 5IH2A 2DX1A 2NWMA 1M8MA 2EPDA 4QT7A 1CKBA 2X3XD 3T06A 1WDXA 3FJ5A 1JU5C 1OV3A 3ULRB 2F2WA 2CT3A 2AK5A 3EG2A 2CT4A 1M27C 3H0FA 4AFSC 2L3PA 3SEMA 1QWFA 1ZLMA 4Z8AA 4EIKA 4R0KA 2L2PA 2YUPA 2K79A 4M4ZA 5I22A 1W1FA 1YCSB 1N5ZA 2DBKA 3I5SA 2X3WD 5JHGA 2BZ8A 5FW9A 2L3SA 1MUZA 2KE9A 3VS7A 1BK2A 4LUEA 2KXDA 2EW3A 2C0OA 3M0QA 1OOTA 2CUDA 2M0YA 3VRZA 1GL5A 2HBWA 1M30A 2DL4A 4GYVA 4D0OA 3ODXA 1M3BA 2CREA 2CSQA 2KR9A 1OEBA 2LJ3A 3I5RA 3MPXA 4DEXA 3VRYA 4J9DA 2FEIA 5IHNA 1G2BA 4AFQC 4OMNA 1FYNA 2KR3A 1U5SA 4LUDA 1B07A 2K7AA 4F14A 1UECA 5JHHA 1T3SA 1X6GA 2KYMA 2NUZA 2FRWA 4D8DA 4OMMA 1QLYA 2KRSA 2LJ0A 1UHCA 5I11A 4JZ3A 1XCGA 3UF4A 2DL7A 3VS2A 3VS1A 3VS6A 1KI1B 1UGVA 2CSIA 1PRLC 4LNPA 3REAB 2A08A 2K2MA 2YDLA 1QWEA 4Y92A 2FO0A 3THKA 3EG0A 2DLPA 3H0IA 2KGTA 1ZSGA 1H3HA 1AD5A 5GJVB 4OMQA 1SRLA 1W70A 4A63B 1JXMA 4RTXA 1MV0B 1H92A 3KY9A 1UE9A 2DE0X 2A36A 2GNCA 1AEYA 1T0JA 2KT8A 1K0XA 2ESWA 3EGUA 4Z88A 1NLOC 4Z89A 1LB1A 2YUQA 2JXBA 2EQIA 2PNIA 2KROA 1J3TA 3PE0A 4RTTA 2RPNA 2BZXA 4F17A 3KFVA 2LP5A 1RUWA 1AWOA 1X69A 2DA9A 2GGRA 2MIOA 4DEYA 2FPEA 4JZ4A 1UJ0A 3UA6A 1CKAA 4RTUA 2EYWA 1NEBA 4FSSA 2L0AA 2Z0QA 2EYXA 1IO6A 1YNZA 2VKNA 1QCFA 2L3QA 2HCKA 1PWTA 1TUDA 1YWOA 1OPKA 3CQTA 1RJ2A 3KSYA 2MCNA 5IHKA 2F2XA 3PVLA 1NYGA 1NEGA 4J9CA 2DL3A 1K9AA 5GJWB 4J9IA 4CC4B 2SRCA 1K4US 2D1XA 3UATA 2YUOA 4AG2C 1FMKA 3P6AA 1AZGB 2RQVA 2KT1A 2V1QA 2O2OA 5FWBA 2F2VA 1VYTA 1WI7A 2GQIA 2HDAA 1F5XA 4ESRA 4JPBW 5FWCA 5L23A 3TVTA 1BU1A 1UHFA 2JT4A 4JJBA 1WXTA 3M0RA 3VS0A 2AKKA 1KFZA 2EGCA 3NPFA 2DBMA 1YN8A 1AZEA 2EYZA 2SEMA 1I07A 2DVJA 4RUGA 2FG0A 3GF9A 2JTEA 1WLPB 1U06A 4KRTA 2NZ8B 1PKSA 1SHFA 2RF0A 3M0SA 4J9GA 1KZ7A 4IIOA 1Z9ZA 5IXFA 3EG1A 1JO8A 1GFCA 1GBQA 2DFKA 2O31A 2KXCA 3UA7A 2DMOA 1X27A 4AG1C 1CSKA 2QDLA 2O88A 2HEQA 1WIEA 2FPDA 2JS0A 3O5ZA 4F16A 3H0HA 1E6GA 2DL5A 2CH4W 2K6DA 1ZX6A 1AVZC 5IHIA 2KEAA 1A0NB 4D0NB 3QBVB 1UG1A 3KZ1A 1M3AA 2A37A 4YONA 1W6XA 1SPKA 4J9FA 1HJDA 1G83A 2KRMA 4AFUC 3TSZA 1ZUKA 2D8HA 2RQTA 3ZL7C 4J9BA 1WXBA 3RNJA 4HCKA 1RLPC 2ECZA 1H8KA 3C0CA 5EC7A 3U23A 2W10A 4CC2A 4RTWA 2J6KA 4HVUA 3ODWA 1ABOA 2M51A 2RQRA 1AWWA 4X1VA 2MOXA 2CH4A 4ORZA 4RTVA 2E5KA 2J6FA 2FRYA 1NYFA 2C0TA 1T3LA 2JS2A 3R6NA 3REBB 2VVKA 2OI3A 1TG0A 3BJIA 3M0PA 1VYVA 2J06A 2EKHA 1PNJA 1OPLA 1V1CA 2LX7A 4HVVA 2GBQA 2RNAA 2JW4A 3VS4A 3LH5A 3RBBB 2DJQA 2KNBB 1GCQA 3I35A 2XMFA 2FPFA 2KBTA 3NGPA 3VS5A 2V1RA 2LZ6B 1TXDA 1I0CA 2LCSA 1U3OA 2IIMA 1ZUYA 2LMJA 2RMOA 2DYBA 4J9EA 1PRMC 2ROTA 2DRMA 2I0NA 2J05A 1M3CA 2ENMA 1KJWA 1WXUA 1X2KA 2EGEA 2EGAA 4RTYA 2W0ZA 2RQUA 1GCQC 5FI1A 1JEGA 2J7IA 3M0UA 1KZGA 1X2QA 1ZUUA 2DNUA 5IXBA 1E6HA 1NTYA 1XOVA 1X43A 1UJYA 1FOEA 3IQLA 1X6BA 2LQNA 1SHGA 1GCPA 1RLQC 1BY1A 1ZBJA 1GBRA 3NHNA 1NLPC 2J6OA 3TSWA 2LQWA 1NG2A 1T0HA
chains in the Genus database with same CATH superfamily
2VWFA 3CMAA 4GBQA 1AWJA 1PKTA 3M9QA 4LE9A 4JLIA 3L2UA 4CRIA 1D09B 3QPHA 3G6EQ 2COZA 2M9UA 3E9FA 1Q7YC 3CC2Q 4LN2A 1QKXA 4XTXA 4GOUA 4BI4A 1ARKA 4XTZA 2RI5A 5L8RE 2RJEA 4IUPA 1PHTA 2GTOA 4J6WA 3CBPA 5LJ5d 4FW1A 1S1NA 4LDUA 4LXCA 3CCLA 2RO0A 2O9VA 3A98A 4PJNA 1Q86U 2CZ1B 4Z02A 1K9MU 1UGRB 3C12A 2DO3A 2LNHB 4ZN1A 3CCJA 3CCJQ 4IUQA 3FRNA 1VYUA 2COYA 2HQHA 3QWXX 3JB9F 4OP0A 2EJGA 1VQ6Q 2D0NA 3JCMb 2LRQA 4FSXA 5GANj 2RQWA 5ECAA 2KYBA 5FU6C 2RGNB 2DXTA 2LNVA 1YJNT 2G6FX 3KXTA 1KQ1A 2K3BA 1D3BB 4K11A 1RAFB 2OTJT 1GFDA 1IRXA 2O9SA 2QI2A 3EGXB 3QKJA 2YSQA 3V8KA 2JMAA 4M77F 4M77E 3HRSA 1YITQ 3OA6A 4HXJA 4ELZC 5DLOA 1NPPA 4M7DF 1FMVA 1D0YA 5IAYA 2ZPHB 5LJ5h 4M78E 3JCMQ 2QEXQ 1VQ7T 4HT9A 2Y4YA 3EAEA 1PM3A 1YI2T 3QBYA 3ODOA 1TUCA 3OSVA 4JJCA 2RN8A 4AMCA 5KYUB 3OYFA 4QQDA 3OYMA 1KG1A 3KUFA 3V8JA 3MP6A 2DXBA 5D7UA 5LJ5f 1SEMA 4N4IA 2DD4A 2NWMA 1M8MA 1NE8A 1R0BG 3INZA 1YJ9Q 1QP3A 1WQWA 4PKCC 4PJOA 3QYHB 4KGVB 2F2WA 2CT3A 2AK5A 1LOJA 1Q7YR 2CT4A 1M27C 3SEMA 1QWFA 3A8MB 1WPYA 4EIKA 1VQ7Q 1Y07A 3A1PA 1QVFS 4M4ZA 2EYQA 3NTKA 1VQOA 2RH2A 2DBKA 4WF2A 2HKQB 3VYHB 2L5QA 1NJIC 2D6FA 1MUZA 5LJ3g 4QW2A 2RHXA 2PUKB 4LUEA 4IKFA 2EW3A 1P92A 2CUDA 2M0YA 4L5GA 3VRZA 4OB3B 5D6YA 2HBWA 4GYVA 4D0OA 5KYWB 1KQSA 1MMDA 3PGGA 3RESA 4KUDK 1OEBA 4Y91A 3VRYA 3MJXA 2K5LA 3CC7A 1D0ZA 3E19A 4GLKA 1G2BA 3S3MA 1VQ4A 1VQ4Q 3JCMX 2HKNA 4J6XA 3CC7Q 1NJIR 4F14A 2FRWA 2DERA 2KRSA 4DBQA 2CP5A 1XNIA 5I11A 4JZ3A 1XCGA 4FCYA 1V29B 4NL2A 1UGVA 2F69A 2CSIA 1Y7XA 2A08A 2K2MA 2KSSA 4M7AA 4Y92A 4M78G 3QHSA 5GJVB 4WTOB 1VQ8Q 2D9TA 4A63B 1JXMA 4RTXA 4M7AD 1UE9A 2DE0X 2GNCA 4FW2A 3CEYA 4QKUA 2FB7A 1NLOC 1LB1A 1D0XA 3SWNB 1EIFA 2EQIA 2KROA 4YTLA 5GAN3 2KI7A 3PE0A 4DA4A 5KCOA 4XAXB 2CGHA 4PJOB 2E10A 2GGRA 2FPEA 2F1LA 2QQBA 2PVGB 4RTUA 2NLUA 3VUBA 2K57A 4E7JA 2R58A 4XU1A 4ZTJA 3CMEQ 2L0AA 1NJIU 1FXXA 2EYXA 4F7UA 2VKNA 3I56Q 2HCKA 5GAOl 2XU8A 2QEXT 1YWOA 1OPKA 5LL6S 5A0DA 1RJ2A 3A8OB 2MCNA 2F2XA 4EMKC 2DL3A 3PT9A 2QYZA 5HK3A 4BACA 1YJ9A 1NBEB 1FMKA 3RR6A 3X28B 2KT1A 2V1QA 3UT1A 4BDZA 3URGA 2O2OA 2DPPB 4ME7A 2HDAA 3QJ6A 3PMIA 1RAEB 1RAHB 4M78C 1VQNA 5L23A 3TVTA 1UHFA 4E7SA 2X4YA 3OW2S 5EG2A 2FZKB 2H3JA 2C06A 2DBMA 2HQXA 1ZQ1A 3OYAA 2VGMA 2FG0A 2K4YA 4EMKA 2P0KA 3SFMA 4M7DA 4IIOA 4M75A 4PJOD 1Z9ZA 1JO8A 1VQOT 1X27A 3OMGA 1QVFP 2QDLA 2QK0A 3CCQQ 1WIEA 4F16A 4RKUE 2DL5A 2CH4W 2DZCA 4M7AB 2EJFA 3QBVB 2QDYB 2VXEA 2K3YA 1G5VA 1W6XA 1OX9A 2KRMA 1KQSS 5GAN4 3WXMB 3TSZA 3ZL7C 2EQKA 2K2VA 4XTUA 1HK9A 2EAYA 3RNJA 1XQHA 2Y90A 3C95A 1GXIE 3CC4T 5FROA 4CC2A 2E6ZA 1VQ7A 3CMEA 2VGNA 1MNDA 1OZ2A 3V7CA 5GMKi 4E7IA 4BE2A 1R8OB 2RB6A 3BE3A 1AWWA 4C92F 1SSFA 2HSEB 4RTVA 2J6FA 3HRUA 2CZ6B 2DTIA 3HRTA 2CP6A 1KD1U 1N8RC 1WJSA 1IHWA 1TG0A 5FRMA 3J81E 2DXCA 3M0PA 3FLGA 3M4GA 3QO3A 4M75C 3EH1A 4HVVA 3VS4A 4A4HA 2JW4A 3RKYA 1VQNT 1ZBXA 4HA8A 2GCXA 2HZYA 2RHZA 4JDSA 2V1RA 2LZ6B 1TXDA 2X4WA 2LCSA 1U3OA 1UEBA 3LYIA 2DYBA 1PRMC 4PNOA 2LQKA 1X01A 3MCAB 2DRMA 2NYSA 1BIAA 4E7LA 5KYYA 1WXUA 2W0ZA 4BE0A 5KH6A 3QDRB 1S72A 1LJOA 5IXBA 2JTMA 1XOVA 1OI1A 1FOEA 2CYZB 1R0CB 2IVWA 3IQLA 3PIOA 4DBRA 1AHJB 2QG9B 2BE9B 1RLQC 1RADB 1M9SA 1YJ9T 3GBQA 2OTLT 3M57A 4J6YA 1M2OA 2JTFA 1BKBA 4M7AG 3OBWA 1MV3A 1E7OA 1Y0MA 2JMCA 4E2FB 1Q82C 1PSFA 1U1TA 4BI8B 1KSWA 3WVDB 2HAXA 5LJ3h 2H8HA 4CC7A 4JRPA 1YI2Q 1UGQB 4F7UF 3KBGA 2E41A 2K5FA 2QXFA 1IREB 2BUDA 3EO2A 4OGEA 4M78B 2VYTA 3JCMg 1WX6A 1YFNA 3EFOB 4CC3A 1QKWA 3EFOA 2P4TA 2VUBA 3MHXA 1QMCA 5A0GA 3EHQA 3JCMe 1Q81C 2DM1A 5GAN2 1IB8A 2XI9A 1I5LA 2YUNA 2BIVA 4WCIA 1MHNA 1WYXA 2PQWA 1YBYA 1BI1A 4C92G 1ZA2B 4OMLA 5KE2A 2MK5A 2ED1A 1BB9A 2D8JA 3CD6A 2JM8A 4XU2A 5IN1A 3V7RA 4OVAA 1ZHIA 5FU7C 4M75F 2F5KA 4ZNXA 3QWYA 3OMCA 2OTLA 1ABQA 3VKIA 2DF6A 1SG5A 4C5HA 4R56A 1AWXA 4FYYB 4X9CA 2LX9A 5C6SA 1K0SA 3CCJT 3PMTA 4PJOG 3MO8A 1SSHA 4M75G 2PTKA 4M7DE 5J26A 2JOYA 2I2LA 4M78D 4F04B 3JSCA 2KQWA 4PL6A 4A4GA 1VIFA 4PJOE 1MNEA 2O4XA 4NL3A 2DXUA 1QVPA 5CK9A 2RD1A 3QDFA 3FB9A 3SDZA 4DBHA 3BDUA 5I2MA 1QP2A 2BTTA 1I8FA 2EQJA 1YJWA 3X24B 2DX1A 2VC8A 4KH0B 4L59A 2E6NA 2GFAA 2OX7A 4PJMA 4C92A 3ULRB 2M16A 3H8ZA 2DFUA 1M5Q1 3EG2A 3H0FA 4J7IA 3MKDA 4L6V5 4Z8AA 1WJQA 2DKGA 2CZ0B 2JNGA 2YUPA 4NS5A 5A2QE 1S72T 4O5VA 3CC2A 3I5SA 4F7UE 1IGQA 2BZ8A 5FW9A 3CXCS 5D6XA 4FM4B 4DBFA 3P8DA 4PFZA 2QGFB 3VS7A 1VQNQ 2KVQG 1BK2A 3G71A 4RCBA 1QVGS 2L89A 2DL4A 3ODXA 3CPWP 2CSQA 3CCVT 2KR9A 2MPXC 3L1AA 3MPXA 4JS4A 3HKSA 4AFQC 4OMNA 3UWNA 1FYNA 4J8OA 2KR3A 1U5SA 1B07A 4M7AE 2P84A 5LJ5j 4KUIA 1D3BA 4UC4A 1UHCA 2KK4A 1BCMA 2DL7A 4Q5WA 3VS1A 4O6JA 5GAOq 2LT4A 1KI1B 1G8XA 5KYXA 3CMAQ 2X51A 1MMNA 4LNPA 4RMOA 2YRDA 2YDLA 5KCHA 2FO0A 4OB0B 3THKA 2DLPA 3H0IA 1N9SA 2COWA 1N6AA 2P0PA 1AD5A 4OB1B 2G3RA 3GP8A 4OMQA 1SRLA 4EMGA 1YHQQ 2E70A 1MV0B 1H92A 3RMQA 5CCAA 3CMAT 2KT8A 3GF5A 4Z89A 1O75A 3S3NA 5GANe 2JXBA 4EMHA 1J3TA 4N0AC 2RPNA 2DETA 4F17A 3QIIA 1X69A 2MYSA 5CQYA 2AIRB 2MIOA 4PJLA 3BDLA 4JZ4A 1UJ0A 1QVFA 3CC4Q 2RJCA 3OYNA 4FSSA 5FRNA 2Z0QA 3FC3A 1IO6A 1YNZA 1QCFA 1M1KC 2R57A 2P0QA 1TUDA 3JCMP 5KYYB 2QQ9A 5IHKA 2FL7A 1NYGA 4J9CA 5DM7R 5GJWB 2DK3A 4JRIA 2YUOA 4C0FA 1ZA1B 2HQEA 1AZGB 1RAGB 2RQVA 5CKEA 4PJOF 3CCRT 1Q82U 4MDXA 5FWBA 1WI7A 3CCQT 2WSCE 4ZN3A 1F5XA 4DOWA 1VQOQ 4M75B 2DAQA 4JRQA 3BFMA 1TU0B 1BU1A 1BYMA 3VS0A 2DIQA 2L8DA 1KFZA 1BIBA 4A4FA 1Q95G 1PSEA 1VUBA 2YHTA 4FT2A 4XK8E 4RUGA 4XTYA 4XTWA 5CKHA 1WLPB 3C4SA 2NZ8B 1PKSA 1SHFA 2RF0A 1M1KU 2MMPA 1QCNA 1TWBA 3EG1A 3EGXA 2KXCA 4AG1C 1VQMA 1RI0A 2HEQA 2FPDA 3ER0A 1E6GA 1B34A 1AVZC 3OYGA 2LTOA 1A0NB 4C92E 1UG1A 5GANh 3OYBA 3KZ1A 1O9SA 1Q7YU 4YONA 3AT1B 4ZGDB 4HCZA 4J9BA 3CD6Q 1WQ7A 2CKKA 4FYWB 3DB3A 4MZMA 2PVDB 3NTHA 4AT1B 4JS5A 3C0CA 5EC7A 3ODWA 4PK4A 2H3EB 2LT1A 4QQGA 4M7AF 3OS5A 2HL3A 2CH4A 4ORZA 3OYKA 2E5KA 2QQSA 1C6VX 3QYGB 1V76A 5LJ5e 1NYFA 2C0TA 4N0AA 3R6NA 1KQ2A 3REBB 3RKXA 2M02A 5I21A 3OYJA 4ELYC 4F7UG 3M56A 2J06A 3SD4A 3V8LA 5CKFA 2EKHA 1VQLT 1PNJA 1OQKA 1M90U 1V1CA 3ZBDA 4X9DA 3RBBB 4C8QE 1VIEA 2DJQA 5GMKe 1VQ9T 2KBTA 3RIRA 1I0CA 3LWHA 5CKDA 2LMJA 2RMOA 3BY7A 2KMTA 3QG1A 3CCEA 1D1CA 1U8RA 3HSBA 3CC7T 2ENMA 4C8QA 2EGEA 4HCCA 1JJ2S 1GCQC 1WGSA 1PCXA 3P8BB 1KZGA 1ZUUA 3VV0A 5GMKl 3OYEA 2JZ2A 4KGZB 3G4SA 1E6HA 1YIJQ 1X43A 3G6EA 3PFSA 1N27A 1X6BA 2LQNA 2EKOA 1U1SA 2DTOA 1BY1A 1TH7A 2B8AA 1GBRA 2RK1A 3NHNA 2EJ9A 5GAN5 2GF7A 4FIBA 2LQWA 3J80E 3TQ7P 2LJ1A 1SF9A 2A28A 1M90R 3G4SQ 3SB2A 2KRNA 1UTIA 1VA7A 2AZSA 4GLMA 2MWOA 1Y57A 1UGSB 2LC4A 2JN0A 1DBHA 1G3WA 4MZPA 5J3BA 4R55A 3UPUA 1VQKA 2MI6A 5KYNA 1TOVA 4XTVA 4JJNK 4ZGJB 3HPWA 1TXQA 4C8QG 1JB0E 2V8IA 5HKCA 3H9NA 4AFZC 1Z9QA 2BKDN 1YIJT 3CXCA 1G3YA 3O8VA 2OTLQ 2NUTB 5KYUA 2BZYA 2ZPFB 2XK0A 3EHRA 1VQKQ 1VQ6T 3TREA 3X26B 1K76A 2E3IA 2O4XB 1YITA 4N4HA 3I55A 2RJFA 5C0MA 5CAIA 3JB9G 3G71T 2ZPEB 4M78F 2HNIA 3PVQA 2YRVA 2CUBA 3JCMV 1BI2A 2A7YA 2XDBA 4JJDA 1I1JA 5HY6A 4LDXA 4OMPA 4MT7A 5HCKA 5GAMf 2RK2A 2AZVA 2K9GA 1BI0A 1NPRA 4E6RA 1C1AA 1BBZA 1ZSZB 4OMFB 4Y28E 2AKLA 2YXYA 1VQLQ 5GMKm 1HXDA 4LDVA 3RMSA 3CCRA 1RI9A 3R6OA 2YLCA 4IUTA 2OJ2A 1TSFA 1EZZB 3JB9I 3EG3A 4EMKB 1JQQA 4E7HA 3QXEB 3CPWA 1B3QA 1K73U 2VRWB 4C0DC 1LNXA 3L2RA 5FI0A 4C0GA 2YT6A 2C0IA 1VQLA 3OYLA 2ROLA 1YP5A 2ABLA 2B86A 1UDLA 1NZ9A 2JM9A 3JV3A 1AOJA 2EVRA 1WZOA 2EPDA 2AT1B 5CVIA 2DZ9A 1Y96B 2X3XD 3QZ9B 3OY9A 2VXFA 3DLMA 3JRZA 4M77C 4AFSC 1ZLMA 1M90C 2GFUA 4R0KA 5I22A 2K79A 2JUFA 1D1BA 1YCSB 1N5ZA 1ZSZC 3CCLQ 3JCMf 2YLBA 3P8HA 5JHGA 2R5MA 2FHDA 2XG8D 3RDVA 1DJ7B 2KE9A 2PVOB 5GANf 1OOTA 5CO7A 2E1HA 1GL5A 3HP9A 4JRKA 5LJ3d 1M3BA 2RI3A 2LJ3A 6AT1B 5FU6B 5GAOr 3GLXA 4J9DA 2ATCB 4C0ZA 2PU9B 3I56T 3OYIA 4C8QF 2ZZDA 3EG9A 2K7AA 3FJPA 1FX7A 1N8RU 3ZEHA 3TU4K 2NUZA 4OGCA 4D8DA 4OMMA 2NUPA 2LJ0A 3M5AA 3TEEA 1PD1A 8ATCB 2LCCA 3UF4A 2QA4T 3VS2A 3VS6A 2MWPA 1PRLC 3REAB 4HT8A 4X34A 1QWEA 1VQ5Q 3JCMW 1H3HA 3D7SB 4HCBA 3L2ZA 1W70A 3M58A 3GPLA 1KHCA 1TUGB 3JCMh 2A36A 1AEYA 1T0JA 1K0XA 2ESWA 4ZTFA 3EGUA 2YUQA 3OS2A 1PC0A 1IHVA 3CMET 4RTTA 2M0OA 2Y4XA 2QQAA 2MAMA 5FU7B 1M1GA 2RJDA 2DA9A 3A5ZB 3UDCA 3CCQA 1CKAA 2E64A 3ASKA 3JB9D 2F5TX 1KD1C 1OYXA 3RERA 5LJ3e 2L3QA 4MDWA 3EFSA 3LH0A 2NUTA 5I2SA 3VU3C 1F1BB 1NEGA 1PG5B 1R77A 3FIFA 1VQ8T 1K9AA 4J9IA 2SRCA 1K4US 3OQ5A 2VASA 3UATA 3P6AA 4C5IA 4BUGA 2A3LA 2F2VA 2GQIA 1PD0A 1VQ5A 5GAOm 4M77D 4ESRA 4JPBW 4ANJA 2X35A 3EGDB 3C94A 3HFOA 2JT4A 2BE7D 4JJBA 3E9GA 4C92D 9ATCB 1WXTA 1RAIB 2AKKA 2EGCA 3NPFA 1YN8A 4QVCA 3VUZA 5KE3A 1I07A 3ME9A 1VOMA 1MMGA 2LQ8A 2JTEA 4OB2B 1VQ4T 4J9GA 4C5EA 2E65A 2RI2A 1OU8A 2V8KA 4PLLA 4B9WA 3OS0A 3CCMQ 3FEOA 3CXCP 5IXFA 1N9RA 1EX4A 1GBQA 3HFNA 1BCOA 1H641 4DOVA 3UA7A 1WHKA 2XICA 3L42A 1RABB 2O88A 3GIBA 2RA2A 4BB7A 2JS0A 3O5ZA 3CPFA 3H0HA 2K6DA 3OYCA 2E3HA 1ZX6A 1K73R 4E7ZA 4M75E 4TVRA 4D0NB 1X75C 4PFOA 3MP8A 5GAN8 1M1KR 2HBPA 3E2UA 4ATOA 4PLIA 4BI3A 1M3AA 2A37A 1SPKA 1G83A 1ZUKA 4LD9K 1QW1A 3M55A 1WJRA 2EQUA 2DVEA 4HCKA 5GAMg 3OW2A 3QZ5B 1H8KA 1I5OB 2W10A 4RTWA 2QQRA 3M54A 3OSSC 1ABOA 2M51A 2DEUA 3G7ZA 4QVZA 4X1VA 4M78A 1VQ8A 1MMAA 4C92B 4PFPA 1K73C 1D1AA 1G3SA 2E12A 1KC8U 4M7DB 4V2SA 2ZGWA 3L2VA 1T3LA 2QA4Q 7AT1B 2VVKA 1C0MA 1YJNQ 1VYVA 4FYVB 4M77A 3CCVA 1FWZA 2KAFA 1Q86C 3PIPA 1JJ2P 2GBQA 1YIJA 5LJ5g 3RKWA 2KNBB 3H6ZA 3I35A 2FPFA 2XKOC 3NGPA 3S3OA 2V8JA 1VQ6A 2E5QA 5CR2A 4GY5A 2IIMA 1ZUYA 2CP3A 4XU0A 3CCET 1W2BS 4IUUA 5J39A 4J9EA 3CPWS 1YI2A 1VQ9Q 2KY9A 1YITT 1KQSP 2J05A 3MEVA 3PNWC 3LW5E 1X2KA 2EGAA 4EDUA 5FI1A 1KC8C 2OTJQ 3A8LB 2RHIA 3CCLT 1JEGA 3M0UA 1X2QA 1Q81U 3F70A 1K8AC 1TTHB 1WHGA 1Y71A 3HTRA 4XU3A 4A4EA 4P5NA 5GAOn 3I56A 5CKBA 1GCPA 1M1FA 5D6WA 1W2BA 3I55Q 1NLPC 4MZTA 2J6OA 2DJZA 5KYXB 3CBMA 2CDTA 1WNLA 2HSPA 1NM7A 4BDYA 2DEQA 1JXOA 1SKUB 2XDDA 4HVWA 3OW2P 2EWNA 3NMZC 4MMLA 2DD5A 1B34B 3L2WA 1M2VB 1OZ3A 3CD6T 3ZFJA 4J9HA 3M0TA 4QQ6A 1YHQT 1LCKA 2OTJA 4XQ3A 1I4K1 3OBYA 5DY9A 4F7UB 4KULA 2GQVA 1HD3A 3I9QA 2DTHA 1XD4A 2D0QB 1WHHA 5GAMh 3EH2A 3SHWA 3NFCA 1X86A 5LJ3f 2GTJA 2PZ1A 2LDMA 1VQ9A 3CC2T 4D8KA 3G6ET 2X4JA 2E4HA 3LGFA 1SRMA 4LDWA 4IIMA 2FZGB 1GRIA 4M7DC 4M75D 1OULA 5AYFA 1WA7A 1VQMQ 3GOXA 2CZ7B 3SWNA 2P4RA 2R5AA 2DL8A 1WHMA 4LDYA 1ZSZA 3AHUA 4EPCA 3G71Q 4JUVA 2NUPB 1YJWT 4OF1A 1UUEA 1XJWB 2EYYA 2OAWA 1Y96A 3CCVQ 1YWPA 1XTDA 2CS7A 3Q1JA 3CCRQ 5GANg 5LJ3j 1VQKT 4KT0E 4M7AC 2DRKA 4RTZA 3A8GB 8AT1B 2RM4A 3LGLA 3GNFB 3SWNC 4A4KA 4BY6C 2ZPIB 1EFNA 2X4XA 3TCJA 2WSFE 4GZUA 1YJWQ 1W4SA 4C5GA 2EBPA 2EQMA 2ED0A 2DILA 1WFWA 4OMOA 1K1ZA 5A0LA 5GAN6 5IT9E 2QTVA 1VQMT 2DIGA 1KIKA 3H41A 1HSQA 4KBMB 3I55T 3M53A 4J5YA 3CC4A 3VS3A 2L3RA 3MEUA 1B7TA 1QCOA 1UFFA 5IH2A 1OU9A 3JAME 4CI0C 3G4ST 3JB9J 4LD6A 4QT7A 2XDPA 3EG9B 1W2BP 1CKBA 3T06A 1QVGP 1WDXA 3FJ5A 1JRIA 1JU5C 1OV3A 4FL6A 1RACB 2L3PA 4HKEA 5GAOp 4B6MA 2L2PA 3CCSA 1VQPQ 4E7KA 2A0FB 1W1FA 3FDRA 1YHQA 2X3WD 2L3SA 3DKMA 2EIFA 2KXDA 4PJOC 2C0OA 2VB6A 3M0QA 3JB9H 3DLLA 1M30A 2CREA 2CP2A 4IURA 3OYHA 4DQ2A 3I5RA 4DEXA 4NOYA 2EFIA 2FEIA 4RCCA 3WVEB 4A54A 5IHNA 1HYOA 2PUOB 3S6WA 4M7DG 2YRCA 4LUDA 5GANd 2HD0A 1UECA 5JHHA 3NTIA 1T3SA 1X6GA 2KYMA 3G1JA 1KD1R 1QLYA 1LVKA 1K8AU 3RUXA 2KDSA 2JJ9A 4FT4A 1Q81R 3CCEQ 4B9XA 5HK0A 2QASA 2AHJB 2OAUA 4JLGA 3L2QA 3LLRA 1N8RR 3EG0A 1YCYA 2KGTA 2ZPBB 1ZSGA 3CCST 1M2VA 4QVDA 1UB4A 3QUIA 3GNGA 2WACA 5CQXA 1RL2A 3KY9A 2YWWA 4M7DD 2K3XA 5KYWA 2HMAA 5GAMj 2RHUA 2HL5C 4Z88A 5GMKj 3MP1A 2PNIA 3PTAA 5AT1B 2BZXA 3CCMT 3KFVA 2LP5A 1RUWA 1M8VA 1AWOA 1UGPB 4J7FA 3LWIA 4DEYA 3CCUQ 3CCUT 2QAZA 3A8HB 3UA6A 2EYWA 1NEBA 3QSUA 2M1HA 3OYYA 2K5IA 3X25B 1PWTA 1FMWA 1LPLA 3CQTA 3CBOA 3KSYA 1K8AR 3PVLA 3LX7A 4FYXB 2LCLA 3E1SA 4CC4B 3CCSQ 2D1XA 3X20B 2QEXA 4KH1B 3META 4AG2C 3JCMJ 5GAMe 4C8QC 3MEWA 1KK7A 1VYTA 4BY6B 3M59A 4VUBA 1WHLA 3M4YA 5FWCA 1WHJA 4PJJA 4D6WA 3JCMd 3DB4A 3BW1A 3M0RA 4BD3A 1AZEA 4N4GA 2EYZA 1JBMA 2SEMA 1MGQA 2DVJA 3GF9A 1U06A 4KRTA 3M0SA 1KHIA 5CIUA 1KZ7A 2XHCA 1GFCA 2JVVA 2DFKA 2O31A 2QTXA 3V7SA 2DMOA 2FVUA 4M77B 2CP7A 1CSKA 2ZCFB 2MF2A 1M4ZA 3VJPA 2KEAA 1X6OA 3VYGA 2IG0A 4E47A 1VQ5T 1ACMB 1HJDA 4J9FA 2O01E 4AFUC 5M9OA 1IGUA 2D8HA 2RQTA 4M77G 1QVGA 3N5BB 3HL8A 1VQPT 1WXBA 2X9HA 1YJNA 3CCUA 2DYIA 1RAAB 2XD0A 1RLPC 1QQJA 2ECZA 2QGGA 4C8QB 3EGDA 5FLXE 3U23A 1OX8A 2J6KA 3MEAA 4RG8A 4HVUA 1IZ6A 2RQRA 1G3TA 2WSEE 2CP0A 5DLQE 2MOXA 2RHYA 2VV5A 2FRYA 5GAN7 2QA4A 2JS2A 3OYDA 1KC8R 5GMKh 2OI3A 3BJIA 2XIDA 3T9NA 4IUVA 3OB9A 4FU6A 1K9MC 2IPOB 1OPLA 4BE1A 2LX7A 2RNAA 3LH5A 4RG2A 4A53A 1GCQA 3J7AF 2XMFA 2ZAEA 3JCMc 3VS5A 4ZGEB 1AT1B 3HHTB 2ROTA 4KGXB 2I0NA 1Q86R 1M3CA 1K9MR 1KJWA 4RTYA 3OS1A 1IXDA 2RQUA 1TS9A 2J7IA 1I81A 1S72Q 1JJ2A 1VQPA 4II1A 4C8QD 5GAMd 2DNUA 1NTYA 4J83A 1UJYA 3QJYA 2Z0WA 1H3ZA 3CCMA 2ZPGB 1Q82R 1SHGA 4C0DB 2LVMA 4C92C 3EFRA 2FZCB 1ZBJA 4MMKA 3MPUB 2FYKA 3TSWA 2V26A 5IHIA 1NG2A 1BI3A 1T0HA
chains in the Genus database with same CATH topology
2VWFA 2CDTA 2HSPA 1NM7A 2LJ1A 3GBQA 4GBQA 1AWJA 1PKTA 2A28A 4LE9A 1JXOA 4HVWA 3NMZC 2KRNA 1UTIA 1MV3A 1VA7A 4LN2A 1E7OA 1Y0MA 2AZSA 2JMCA 1QKXA 4GLMA 4GOUA 3M0TA 4J9HA 1ARKA 1KSWA 1LCKA 1Y57A 2H8HA 1PHTA 2GTOA 1DBHA 1HD3A 3I9QA 4CC7A 1XD4A 1S1NA 3SHWA 2O9VA 1X86A 3A98A 3EO2A 2GTJA 2PZ1A 4D8KA 2LNHB 1WX6A 4AFZC 1Z9QA 1SRMA 4IIMA 4CC3A 1GRIA 1VYUA 2BZYA 1QKWA 3QWXX 3EHQA 2DM1A 3EHRA 1WA7A 2D0NA 2P4RA 2YUNA 2RQWA 2DL8A 5ECAA 1K76A 2KYBA 2RGNB 4WCIA 1WYXA 2G6FX 2K3BA 1UUEA 4K11A 2EYYA 4OMLA 2OAWA 3PVQA 2CUBA 1YWPA 2ED1A 4JJDA 1I1JA 1GFDA 1BB9A 2D8JA 4OMPA 2O9SA 2JM8A 4MT7A 5HCKA 2YSQA 2AZVA 2K9GA 4E6RA 2JMAA 2DRKA 4RTZA 3QWYA 1BBZA 4ZNXA 1ABQA 2AKLA 4HXJA 2DF6A 1AWXA 1EFNA 1RI9A 2OJ2A 1K0SA 4GZUA 3EG3A 2EBPA 2ED0A 1JQQA 1SSHA 1WFWA 2DILA 4OMOA 2PTKA 1K1ZA 1B3QA 3ODOA 2VRWB 1TUCA 4JJCA 2RN8A 5FI0A 1KIKA 2YT6A 3H41A 2C0IA 1HSQA 2ROLA 1YP5A 2ABLA 3VS3A 2B86A 1UDLA 2JM9A 3JV3A 2BTTA 1SEMA 1UFFA 1AOJA 2EVRA 5IH2A 2DX1A 2NWMA 1M8MA 2EPDA 4QT7A 1CKBA 2X3XD 3T06A 1WDXA 3FJ5A 1JU5C 1OV3A 3ULRB 2F2WA 2CT3A 2AK5A 3EG2A 2CT4A 1M27C 3H0FA 4AFSC 2L3PA 3SEMA 1QWFA 1ZLMA 4Z8AA 4EIKA 4R0KA 2L2PA 2YUPA 2K79A 4M4ZA 5I22A 1W1FA 1YCSB 1N5ZA 2DBKA 3I5SA 2X3WD 5JHGA 2BZ8A 5FW9A 2L3SA 1MUZA 2KE9A 3VS7A 1BK2A 4LUEA 2KXDA 2EW3A 2C0OA 3M0QA 1OOTA 2CUDA 2M0YA 3VRZA 1GL5A 2HBWA 1M30A 2DL4A 4GYVA 4D0OA 3ODXA 1M3BA 2CREA 2CSQA 2KR9A 1OEBA 2LJ3A 3I5RA 3MPXA 4DEXA 3VRYA 4J9DA 2FEIA 5IHNA 1G2BA 4AFQC 4OMNA 1FYNA 2KR3A 1U5SA 4LUDA 1B07A 2K7AA 4F14A 1UECA 5JHHA 1T3SA 1X6GA 2KYMA 2NUZA 2FRWA 4D8DA 4OMMA 1QLYA 2KRSA 2LJ0A 1UHCA 5I11A 4JZ3A 1XCGA 3UF4A 2DL7A 3VS2A 3VS1A 3VS6A 1KI1B 1UGVA 2CSIA 1PRLC 4LNPA 3REAB 2A08A 2K2MA 2YDLA 1QWEA 4Y92A 2FO0A 3THKA 3EG0A 2DLPA 3H0IA 2KGTA 1ZSGA 1H3HA 1AD5A 5GJVB 4OMQA 1SRLA 1W70A 4A63B 1JXMA 4RTXA 1MV0B 1H92A 3KY9A 1UE9A 2DE0X 2A36A 2GNCA 1AEYA 1T0JA 2KT8A 1K0XA 2ESWA 3EGUA 4Z88A 1NLOC 4Z89A 1LB1A 2YUQA 2JXBA 2EQIA 2PNIA 2KROA 1J3TA 3PE0A 4RTTA 2RPNA 2BZXA 4F17A 3KFVA 2LP5A 1RUWA 1AWOA 1X69A 2DA9A 2GGRA 2MIOA 4DEYA 2FPEA 4JZ4A 1UJ0A 3UA6A 1CKAA 4RTUA 2EYWA 1NEBA 4FSSA 2L0AA 2Z0QA 2EYXA 1IO6A 1YNZA 2VKNA 1QCFA 2L3QA 2HCKA 1PWTA 1TUDA 1YWOA 1OPKA 3CQTA 1RJ2A 3KSYA 2MCNA 5IHKA 2F2XA 3PVLA 1NYGA 1NEGA 4J9CA 2DL3A 1K9AA 5GJWB 4J9IA 4CC4B 2SRCA 1K4US 2D1XA 3UATA 2YUOA 4AG2C 1FMKA 3P6AA 1AZGB 2RQVA 2KT1A 2V1QA 2O2OA 5FWBA 2F2VA 1VYTA 1WI7A 2GQIA 2HDAA 1F5XA 4ESRA 4JPBW 5FWCA 5L23A 3TVTA 1BU1A 1UHFA 2JT4A 4JJBA 1WXTA 3M0RA 3VS0A 2AKKA 1KFZA 2EGCA 3NPFA 2DBMA 1YN8A 1AZEA 2EYZA 2SEMA 1I07A 2DVJA 4RUGA 2FG0A 3GF9A 2JTEA 1WLPB 1U06A 4KRTA 2NZ8B 1PKSA 1SHFA 2RF0A 3M0SA 4J9GA 1KZ7A 4IIOA 1Z9ZA 5IXFA 3EG1A 1JO8A 1GFCA 1GBQA 2DFKA 2O31A 2KXCA 3UA7A 2DMOA 1X27A 4AG1C 1CSKA 2QDLA 2O88A 2HEQA 1WIEA 2FPDA 2JS0A 3O5ZA 4F16A 3H0HA 1E6GA 2DL5A 2CH4W 2K6DA 1ZX6A 1AVZC 5IHIA 2KEAA 1A0NB 4D0NB 3QBVB 1UG1A 3KZ1A 1M3AA 2A37A 4YONA 1W6XA 1SPKA 4J9FA 1HJDA 1G83A 2KRMA 4AFUC 3TSZA 1ZUKA 2D8HA 2RQTA 3ZL7C 4J9BA 1WXBA 3RNJA 4HCKA 1RLPC 2ECZA 1H8KA 3C0CA 5EC7A 3U23A 2W10A 4CC2A 4RTWA 2J6KA 4HVUA 3ODWA 1ABOA 2M51A 2RQRA 1AWWA 4X1VA 2MOXA 2CH4A 4ORZA 4RTVA 2E5KA 2J6FA 2FRYA 1NYFA 2C0TA 1T3LA 2JS2A 3R6NA 3REBB 2VVKA 2OI3A 1TG0A 3BJIA 3M0PA 1VYVA 2J06A 2EKHA 1PNJA 1OPLA 1V1CA 2LX7A 4HVVA 2GBQA 2RNAA 2JW4A 3VS4A 3LH5A 3RBBB 2DJQA 2KNBB 1GCQA 3I35A 2XMFA 2FPFA 2KBTA 3NGPA 3VS5A 2V1RA 2LZ6B 1TXDA 1I0CA 2LCSA 1U3OA 2IIMA 1ZUYA 2LMJA 2RMOA 2DYBA 4J9EA 1PRMC 2ROTA 2DRMA 2I0NA 2J05A 1M3CA 2ENMA 1KJWA 1WXUA 1X2KA 2EGEA 2EGAA 4RTYA 2W0ZA 2RQUA 1GCQC 5FI1A 1JEGA 2J7IA 3M0UA 1KZGA 1X2QA 1ZUUA 2DNUA 5IXBA 1E6HA 1NTYA 1XOVA 1X43A 1UJYA 1FOEA 3IQLA 1X6BA 2LQNA 1SHGA 1GCPA 1RLQC 1BY1A 1ZBJA 1GBRA 3NHNA 1NLPC 2J6OA 3TSWA 2LQWA 1NG2A 1T0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWF A;  2CDT A;  2HSP A;  1NM7 A;  2LJ1 A;  3GBQ A;  4GBQ A;  1AWJ A;  1PKT A;  2A28 A;  4LE9 A;  1JXO A;  4HVW A;  3NMZ C;  2KRN A;  1UTI A;  1MV3 A;  1VA7 A;  4LN2 A;  1E7O A;  1Y0M A;  2AZS A;  2JMC A;  1QKX A;  4GLM A;  4GOU A;  3M0T A;  4J9H A;  1ARK A;  1KSW A;  1LCK A;  1Y57 A;  2H8H A;  1PHT A;  2GTO A;  1DBH A;  1HD3 A;  3I9Q A;  4CC7 A;  1XD4 A;  1S1N A;  3SHW A;  2O9V A;  1X86 A;  3A98 A;  3EO2 A;  2GTJ A;  2PZ1 A;  4D8K A;  2LNH B;  1WX6 A;  4AFZ C;  1Z9Q A;  1SRM A;  4IIM A;  4CC3 A;  1GRI A;  1VYU A;  2BZY A;  1QKW A;  3QWX X;  3EHQ A;  2DM1 A;  3EHR A;  1WA7 A;  2D0N A;  2P4R A;  2YUN A;  2RQW A;  2DL8 A;  5ECA A;  1K76 A;  2KYB A;  2RGN B;  4WCI A;  1WYX A;  2G6F X;  2K3B A;  1UUE A;  4K11 A;  2EYY A;  4OML A;  2OAW A;  3PVQ A;  2CUB A;  1YWP A;  2ED1 A;  4JJD A;  1I1J A;  1GFD A;  1BB9 A;  2D8J A;  4OMP A;  2O9S A;  2JM8 A;  4MT7 A;  5HCK A;  2YSQ A;  2AZV A;  2K9G A;  4E6R A;  2JMA A;  2DRK A;  4RTZ A;  3QWY A;  1BBZ A;  4ZNX A;  1ABQ A;  2AKL A;  4HXJ A;  2DF6 A;  1AWX A;  1EFN A;  1RI9 A;  2OJ2 A;  1K0S A;  4GZU A;  3EG3 A;  2EBP A;  2ED0 A;  1JQQ A;  1SSH A;  1WFW A;  2DIL A;  4OMO A;  2PTK A;  1K1Z A;  1B3Q A;  3ODO A;  2VRW B;  1TUC A;  4JJC A;  2RN8 A;  5FI0 A;  1KIK A;  2YT6 A;  3H41 A;  2C0I A;  1HSQ A;  2ROL A;  1YP5 A;  2ABL A;  3VS3 A;  2B86 A;  1UDL A;  2JM9 A;  3JV3 A;  2BTT A;  1SEM A;  1UFF A;  1AOJ A;  2EVR A;  5IH2 A;  2DX1 A;  2NWM A;  1M8M A;  2EPD A;  4QT7 A;  1CKB A;  2X3X D;  3T06 A;  1WDX A;  3FJ5 A;  1JU5 C;  1OV3 A;  3ULR B;  2F2W A;  2CT3 A;  2AK5 A;  3EG2 A;  2CT4 A;  1M27 C;  3H0F A;  4AFS C;  2L3P A;  3SEM A;  1QWF A;  1ZLM A;  4Z8A A;  4EIK A;  4R0K A;  2L2P A;  2YUP A;  2K79 A;  4M4Z A;  5I22 A;  1W1F A;  1YCS B;  1N5Z A;  2DBK A;  3I5S A;  2X3W D;  5JHG A;  2BZ8 A;  5FW9 A;  2L3S A;  1MUZ A;  2KE9 A;  3VS7 A;  1BK2 A;  4LUE A;  2KXD A;  2EW3 A;  2C0O A;  3M0Q A;  1OOT A;  2CUD A;  2M0Y A;  3VRZ A;  1GL5 A;  2HBW A;  1M30 A;  2DL4 A;  4GYV A;  4D0O A;  3ODX A;  1M3B A;  2CRE A;  2CSQ A;  2KR9 A;  1OEB A;  2LJ3 A;  3I5R A;  3MPX A;  4DEX A;  3VRY A;  4J9D A;  2FEI A;  5IHN A;  1G2B A;  4AFQ C;  4OMN A;  1FYN A;  2KR3 A;  1U5S A;  4LUD A;  1B07 A;  2K7A A;  4F14 A;  1UEC A;  5JHH A;  1T3S A;  1X6G A;  2KYM A;  2NUZ A;  2FRW A;  4D8D A;  4OMM A;  1QLY A;  2KRS A;  2LJ0 A;  1UHC A;  5I11 A;  4JZ3 A;  1XCG A;  3UF4 A;  2DL7 A;  3VS2 A;  3VS1 A;  3VS6 A;  1KI1 B;  1UGV A;  2CSI A;  1PRL C;  4LNP A;  3REA B;  2A08 A;  2K2M A;  2YDL A;  1QWE A;  4Y92 A;  2FO0 A;  3THK A;  3EG0 A;  2DLP A;  3H0I A;  2KGT A;  1ZSG A;  1H3H A;  1AD5 A;  5GJV B;  4OMQ A;  1SRL A;  1W70 A;  4A63 B;  1JXM A;  4RTX A;  1MV0 B;  1H92 A;  3KY9 A;  1UE9 A;  2DE0 X;  2A36 A;  2GNC A;  1AEY A;  1T0J A;  2KT8 A;  1K0X A;  2ESW A;  3EGU A;  4Z88 A;  1NLO C;  4Z89 A;  1LB1 A;  2YUQ A;  2JXB A;  2EQI A;  2PNI A;  2KRO A;  1J3T A;  3PE0 A;  4RTT A;  2RPN A;  2BZX A;  4F17 A;  3KFV A;  2LP5 A;  1RUW A;  1AWO A;  1X69 A;  2DA9 A;  2GGR A;  2MIO A;  4DEY A;  2FPE A;  4JZ4 A;  1UJ0 A;  3UA6 A;  1CKA A;  4RTU A;  2EYW A;  1NEB A;  4FSS A;  2L0A A;  2Z0Q A;  2EYX A;  1IO6 A;  1YNZ A;  2VKN A;  1QCF A;  2L3Q A;  2HCK A;  1PWT A;  1TUD A;  1YWO A;  1OPK A;  3CQT A;  1RJ2 A;  3KSY A;  2MCN A;  5IHK A;  2F2X A;  3PVL A;  1NYG A;  1NEG A;  4J9C A;  2DL3 A;  1K9A A;  5GJW B;  4J9I A;  4CC4 B;  2SRC A;  1K4U S;  2D1X A;  3UAT A;  2YUO A;  4AG2 C;  1FMK A;  3P6A A;  1AZG B;  2RQV A;  2KT1 A;  2V1Q A;  2O2O A;  5FWB A;  2F2V A;  1VYT A;  1WI7 A;  2GQI A;  2HDA A;  1F5X A;  4ESR A;  4JPB W;  5FWC A;  5L23 A;  3TVT A;  1BU1 A;  1UHF A;  2JT4 A;  4JJB A;  1WXT A;  3M0R A;  3VS0 A;  2AKK A;  1KFZ A;  2EGC A;  3NPF A;  2DBM A;  1YN8 A;  1AZE A;  2EYZ A;  2SEM A;  1I07 A;  2DVJ A;  4RUG A;  2FG0 A;  3GF9 A;  2JTE A;  1WLP B;  1U06 A;  4KRT A;  2NZ8 B;  1PKS A;  1SHF A;  2RF0 A;  3M0S A;  4J9G A;  1KZ7 A;  4IIO A;  1Z9Z A;  5IXF A;  3EG1 A;  1JO8 A;  1GFC A;  1GBQ A;  2DFK A;  2O31 A;  2KXC A;  3UA7 A;  2DMO A;  1X27 A;  4AG1 C;  1CSK A;  2QDL A;  2O88 A;  2HEQ A;  1WIE A;  2FPD A;  2JS0 A;  3O5Z A;  4F16 A;  3H0H A;  1E6G A;  2DL5 A;  2CH4 W;  2K6D A;  1ZX6 A;  1AVZ C;  5IHI A;  2KEA A;  1A0N B;  4D0N B;  3QBV B;  1UG1 A;  3KZ1 A;  1M3A A;  2A37 A;  4YON A;  1W6X A;  1SPK A;  4J9F A;  1HJD A;  1G83 A;  2KRM A;  4AFU C;  3TSZ A;  1ZUK A;  2D8H A;  2RQT A;  3ZL7 C;  4J9B A;  1WXB A;  3RNJ A;  4HCK A;  1RLP C;  2ECZ A;  1H8K A;  3C0C A;  5EC7 A;  3U23 A;  2W10 A;  4CC2 A;  4RTW A;  2J6K A;  4HVU A;  3ODW A;  1ABO A;  2M51 A;  2RQR A;  1AWW A;  4X1V A;  2MOX A;  2CH4 A;  4ORZ A;  4RTV A;  2E5K A;  2J6F A;  2FRY A;  1NYF A;  2C0T A;  1T3L A;  2JS2 A;  3R6N A;  3REB B;  2VVK A;  2OI3 A;  1TG0 A;  3BJI A;  3M0P A;  1VYV A;  2J06 A;  2EKH A;  1PNJ A;  1OPL A;  1V1C A;  2LX7 A;  4HVV A;  2GBQ A;  2RNA A;  2JW4 A;  3VS4 A;  3LH5 A;  3RBB B;  2DJQ A;  2KNB B;  1GCQ A;  3I35 A;  2XMF A;  2FPF A;  2KBT A;  3NGP A;  3VS5 A;  2V1R A;  2LZ6 B;  1TXD A;  1I0C A;  2LCS A;  1U3O A;  2IIM A;  1ZUY A;  2LMJ A;  2RMO A;  2DYB A;  4J9E A;  1PRM C;  2ROT A;  2DRM A;  2I0N A;  2J05 A;  1M3C A;  2ENM A;  1KJW A;  1WXU A;  1X2K A;  2EGE A;  2EGA A;  4RTY A;  2W0Z A;  2RQU A;  1GCQ C;  5FI1 A;  1JEG A;  2J7I A;  3M0U A;  1KZG A;  1X2Q A;  1ZUU A;  2DNU A;  5IXB A;  1E6H A;  1NTY A;  1XOV A;  1X43 A;  1UJY A;  1FOE A;  3IQL A;  1X6B A;  2LQN A;  1SHG A;  1GCP A;  1RLQ C;  1BY1 A;  1ZBJ A;  1GBR A;  3NHN A;  1NLP C;  2J6O A;  3TSW A;  2LQW A;  1NG2 A;  1T0H A; 
#chains in the Genus database with same CATH topology
 2VWF A;  3CMA A;  4GBQ A;  1AWJ A;  1PKT A;  3M9Q A;  4LE9 A;  4JLI A;  3L2U A;  4CRI A;  1D09 B;  3QPH A;  3G6E Q;  2COZ A;  2M9U A;  3E9F A;  1Q7Y C;  3CC2 Q;  4LN2 A;  1QKX A;  4XTX A;  4GOU A;  4BI4 A;  1ARK A;  4XTZ A;  2RI5 A;  5L8R E;  2RJE A;  4IUP A;  1PHT A;  2GTO A;  4J6W A;  3CBP A;  5LJ5 d;  4FW1 A;  1S1N A;  4LDU A;  4LXC A;  3CCL A;  2RO0 A;  2O9V A;  3A98 A;  4PJN A;  1Q86 U;  2CZ1 B;  4Z02 A;  1K9M U;  1UGR B;  3C12 A;  2DO3 A;  2LNH B;  4ZN1 A;  3CCJ A;  3CCJ Q;  4IUQ A;  3FRN A;  1VYU A;  2COY A;  2HQH A;  3QWX X;  3JB9 F;  4OP0 A;  2EJG A;  1VQ6 Q;  2D0N A;  3JCM b;  2LRQ A;  4FSX A;  5GAN j;  2RQW A;  5ECA A;  2KYB A;  5FU6 C;  2RGN B;  2DXT A;  2LNV A;  1YJN T;  2G6F X;  3KXT A;  1KQ1 A;  2K3B A;  1D3B B;  4K11 A;  1RAF B;  2OTJ T;  1GFD A;  1IRX A;  2O9S A;  2QI2 A;  3EGX B;  3QKJ A;  2YSQ A;  3V8K A;  2JMA A;  4M77 F;  4M77 E;  3HRS A;  1YIT Q;  3OA6 A;  4HXJ A;  4ELZ C;  5DLO A;  1NPP A;  4M7D F;  1FMV A;  1D0Y A;  5IAY A;  2ZPH B;  5LJ5 h;  4M78 E;  3JCM Q;  2QEX Q;  1VQ7 T;  4HT9 A;  2Y4Y A;  3EAE A;  1PM3 A;  1YI2 T;  3QBY A;  3ODO A;  1TUC A;  3OSV A;  4JJC A;  2RN8 A;  4AMC A;  5KYU B;  3OYF A;  4QQD A;  3OYM A;  1KG1 A;  3KUF A;  3V8J A;  3MP6 A;  2DXB A;  5D7U A;  5LJ5 f;  1SEM A;  4N4I A;  2DD4 A;  2NWM A;  1M8M A;  1NE8 A;  1R0B G;  3INZ A;  1YJ9 Q;  1QP3 A;  1WQW A;  4PKC C;  4PJO A;  3QYH B;  4KGV B;  2F2W A;  2CT3 A;  2AK5 A;  1LOJ A;  1Q7Y R;  2CT4 A;  1M27 C;  3SEM A;  1QWF A;  3A8M B;  1WPY A;  4EIK A;  1VQ7 Q;  1Y07 A;  3A1P A;  1QVF S;  4M4Z A;  2EYQ A;  3NTK A;  1VQO A;  2RH2 A;  2DBK A;  4WF2 A;  2HKQ B;  3VYH B;  2L5Q A;  1NJI C;  2D6F A;  1MUZ A;  5LJ3 g;  4QW2 A;  2RHX A;  2PUK B;  4LUE A;  4IKF A;  2EW3 A;  1P92 A;  2CUD A;  2M0Y A;  4L5G A;  3VRZ A;  4OB3 B;  5D6Y A;  2HBW A;  4GYV A;  4D0O A;  5KYW B;  1KQS A;  1MMD A;  3PGG A;  3RES A;  4KUD K;  1OEB A;  4Y91 A;  3VRY A;  3MJX A;  2K5L A;  3CC7 A;  1D0Z A;  3E19 A;  4GLK A;  1G2B A;  3S3M A;  1VQ4 A;  1VQ4 Q;  3JCM X;  2HKN A;  4J6X A;  3CC7 Q;  1NJI R;  4F14 A;  2FRW A;  2DER A;  2KRS A;  4DBQ A;  2CP5 A;  1XNI A;  5I11 A;  4JZ3 A;  1XCG A;  4FCY A;  1V29 B;  4NL2 A;  1UGV A;  2F69 A;  2CSI A;  1Y7X A;  2A08 A;  2K2M A;  2KSS A;  4M7A A;  4Y92 A;  4M78 G;  3QHS A;  5GJV B;  4WTO B;  1VQ8 Q;  2D9T A;  4A63 B;  1JXM A;  4RTX A;  4M7A D;  1UE9 A;  2DE0 X;  2GNC A;  4FW2 A;  3CEY A;  4QKU A;  2FB7 A;  1NLO C;  1LB1 A;  1D0X A;  3SWN B;  1EIF A;  2EQI A;  2KRO A;  4YTL A;  5GAN 3;  2KI7 A;  3PE0 A;  4DA4 A;  5KCO A;  4XAX B;  2CGH A;  4PJO B;  2E10 A;  2GGR A;  2FPE A;  2F1L A;  2QQB A;  2PVG B;  4RTU A;  2NLU A;  3VUB A;  2K57 A;  4E7J A;  2R58 A;  4XU1 A;  4ZTJ A;  3CME Q;  2L0A A;  1NJI U;  1FXX A;  2EYX A;  4F7U A;  2VKN A;  3I56 Q;  2HCK A;  5GAO l;  2XU8 A;  2QEX T;  1YWO A;  1OPK A;  5LL6 S;  5A0D A;  1RJ2 A;  3A8O B;  2MCN A;  2F2X A;  4EMK C;  2DL3 A;  3PT9 A;  2QYZ A;  5HK3 A;  4BAC A;  1YJ9 A;  1NBE B;  1FMK A;  3RR6 A;  3X28 B;  2KT1 A;  2V1Q A;  3UT1 A;  4BDZ A;  3URG A;  2O2O A;  2DPP B;  4ME7 A;  2HDA A;  3QJ6 A;  3PMI A;  1RAE B;  1RAH B;  4M78 C;  1VQN A;  5L23 A;  3TVT A;  1UHF A;  4E7S A;  2X4Y A;  3OW2 S;  5EG2 A;  2FZK B;  2H3J A;  2C06 A;  2DBM A;  2HQX A;  1ZQ1 A;  3OYA A;  2VGM A;  2FG0 A;  2K4Y A;  4EMK A;  2P0K A;  3SFM A;  4M7D A;  4IIO A;  4M75 A;  4PJO D;  1Z9Z A;  1JO8 A;  1VQO T;  1X27 A;  3OMG A;  1QVF P;  2QDL A;  2QK0 A;  3CCQ Q;  1WIE A;  4F16 A;  4RKU E;  2DL5 A;  2CH4 W;  2DZC A;  4M7A B;  2EJF A;  3QBV B;  2QDY B;  2VXE A;  2K3Y A;  1G5V A;  1W6X A;  1OX9 A;  2KRM A;  1KQS S;  5GAN 4;  3WXM B;  3TSZ A;  3ZL7 C;  2EQK A;  2K2V A;  4XTU A;  1HK9 A;  2EAY A;  3RNJ A;  1XQH A;  2Y90 A;  3C95 A;  1GXI E;  3CC4 T;  5FRO A;  4CC2 A;  2E6Z A;  1VQ7 A;  3CME A;  2VGN A;  1MND A;  1OZ2 A;  3V7C A;  5GMK i;  4E7I A;  4BE2 A;  1R8O B;  2RB6 A;  3BE3 A;  1AWW A;  4C92 F;  1SSF A;  2HSE B;  4RTV A;  2J6F A;  3HRU A;  2CZ6 B;  2DTI A;  3HRT A;  2CP6 A;  1KD1 U;  1N8R C;  1WJS A;  1IHW A;  1TG0 A;  5FRM A;  3J81 E;  2DXC A;  3M0P A;  3FLG A;  3M4G A;  3QO3 A;  4M75 C;  3EH1 A;  4HVV A;  3VS4 A;  4A4H A;  2JW4 A;  3RKY A;  1VQN T;  1ZBX A;  4HA8 A;  2GCX A;  2HZY A;  2RHZ A;  4JDS A;  2V1R A;  2LZ6 B;  1TXD A;  2X4W A;  2LCS A;  1U3O A;  1UEB A;  3LYI A;  2DYB A;  1PRM C;  4PNO A;  2LQK A;  1X01 A;  3MCA B;  2DRM A;  2NYS A;  1BIA A;  4E7L A;  5KYY A;  1WXU A;  2W0Z A;  4BE0 A;  5KH6 A;  3QDR B;  1S72 A;  1LJO A;  5IXB A;  2JTM A;  1XOV A;  1OI1 A;  1FOE A;  2CYZ B;  1R0C B;  2IVW A;  3IQL A;  3PIO A;  4DBR A;  1AHJ B;  2QG9 B;  2BE9 B;  1RLQ C;  1RAD B;  1M9S A;  1YJ9 T;  3GBQ A;  2OTL T;  3M57 A;  4J6Y A;  1M2O A;  2JTF A;  1BKB A;  4M7A G;  3OBW A;  1MV3 A;  1E7O A;  1Y0M A;  2JMC A;  4E2F B;  1Q82 C;  1PSF A;  1U1T A;  4BI8 B;  1KSW A;  3WVD B;  2HAX A;  5LJ3 h;  2H8H A;  4CC7 A;  4JRP A;  1YI2 Q;  1UGQ B;  4F7U F;  3KBG A;  2E41 A;  2K5F A;  2QXF A;  1IRE B;  2BUD A;  3EO2 A;  4OGE A;  4M78 B;  2VYT A;  3JCM g;  1WX6 A;  1YFN A;  3EFO B;  4CC3 A;  1QKW A;  3EFO A;  2P4T A;  2VUB A;  3MHX A;  1QMC A;  5A0G A;  3EHQ A;  3JCM e;  1Q81 C;  2DM1 A;  5GAN 2;  1IB8 A;  2XI9 A;  1I5L A;  2YUN A;  2BIV A;  4WCI A;  1MHN A;  1WYX A;  2PQW A;  1YBY A;  1BI1 A;  4C92 G;  1ZA2 B;  4OML A;  5KE2 A;  2MK5 A;  2ED1 A;  1BB9 A;  2D8J A;  3CD6 A;  2JM8 A;  4XU2 A;  5IN1 A;  3V7R A;  4OVA A;  1ZHI A;  5FU7 C;  4M75 F;  2F5K A;  4ZNX A;  3QWY A;  3OMC A;  2OTL A;  1ABQ A;  3VKI A;  2DF6 A;  1SG5 A;  4C5H A;  4R56 A;  1AWX A;  4FYY B;  4X9C A;  2LX9 A;  5C6S A;  1K0S A;  3CCJ T;  3PMT A;  4PJO G;  3MO8 A;  1SSH A;  4M75 G;  2PTK A;  4M7D E;  5J26 A;  2JOY A;  2I2L A;  4M78 D;  4F04 B;  3JSC A;  2KQW A;  4PL6 A;  4A4G A;  1VIF A;  4PJO E;  1MNE A;  2O4X A;  4NL3 A;  2DXU A;  1QVP A;  5CK9 A;  2RD1 A;  3QDF A;  3FB9 A;  3SDZ A;  4DBH A;  3BDU A;  5I2M A;  1QP2 A;  2BTT A;  1I8F A;  2EQJ A;  1YJW A;  3X24 B;  2DX1 A;  2VC8 A;  4KH0 B;  4L59 A;  2E6N A;  2GFA A;  2OX7 A;  4PJM A;  4C92 A;  3ULR B;  2M16 A;  3H8Z A;  2DFU A;  1M5Q 1;  3EG2 A;  3H0F A;  4J7I A;  3MKD A;  4L6V 5;  4Z8A A;  1WJQ A;  2DKG A;  2CZ0 B;  2JNG A;  2YUP A;  4NS5 A;  5A2Q E;  1S72 T;  4O5V A;  3CC2 A;  3I5S A;  4F7U E;  1IGQ A;  2BZ8 A;  5FW9 A;  3CXC S;  5D6X A;  4FM4 B;  4DBF A;  3P8D A;  4PFZ A;  2QGF B;  3VS7 A;  1VQN Q;  2KVQ G;  1BK2 A;  3G71 A;  4RCB A;  1QVG S;  2L89 A;  2DL4 A;  3ODX A;  3CPW P;  2CSQ A;  3CCV T;  2KR9 A;  2MPX C;  3L1A A;  3MPX A;  4JS4 A;  3HKS A;  4AFQ C;  4OMN A;  3UWN A;  1FYN A;  4J8O A;  2KR3 A;  1U5S A;  1B07 A;  4M7A E;  2P84 A;  5LJ5 j;  4KUI A;  1D3B A;  4UC4 A;  1UHC A;  2KK4 A;  1BCM A;  2DL7 A;  4Q5W A;  3VS1 A;  4O6J A;  5GAO q;  2LT4 A;  1KI1 B;  1G8X A;  5KYX A;  3CMA Q;  2X51 A;  1MMN A;  4LNP A;  4RMO A;  2YRD A;  2YDL A;  5KCH A;  2FO0 A;  4OB0 B;  3THK A;  2DLP A;  3H0I A;  1N9S A;  2COW A;  1N6A A;  2P0P A;  1AD5 A;  4OB1 B;  2G3R A;  3GP8 A;  4OMQ A;  1SRL A;  4EMG A;  1YHQ Q;  2E70 A;  1MV0 B;  1H92 A;  3RMQ A;  5CCA A;  3CMA T;  2KT8 A;  3GF5 A;  4Z89 A;  1O75 A;  3S3N A;  5GAN e;  2JXB A;  4EMH A;  1J3T A;  4N0A C;  2RPN A;  2DET A;  4F17 A;  3QII A;  1X69 A;  2MYS A;  5CQY A;  2AIR B;  2MIO A;  4PJL A;  3BDL A;  4JZ4 A;  1UJ0 A;  1QVF A;  3CC4 Q;  2RJC A;  3OYN A;  4FSS A;  5FRN A;  2Z0Q A;  3FC3 A;  1IO6 A;  1YNZ A;  1QCF A;  1M1K C;  2R57 A;  2P0Q A;  1TUD A;  3JCM P;  5KYY B;  2QQ9 A;  5IHK A;  2FL7 A;  1NYG A;  4J9C A;  5DM7 R;  5GJW B;  2DK3 A;  4JRI A;  2YUO A;  4C0F A;  1ZA1 B;  2HQE A;  1AZG B;  1RAG B;  2RQV A;  5CKE A;  4PJO F;  3CCR T;  1Q82 U;  4MDX A;  5FWB A;  1WI7 A;  3CCQ T;  2WSC E;  4ZN3 A;  1F5X A;  4DOW A;  1VQO Q;  4M75 B;  2DAQ A;  4JRQ A;  3BFM A;  1TU0 B;  1BU1 A;  1BYM A;  3VS0 A;  2DIQ A;  2L8D A;  1KFZ A;  1BIB A;  4A4F A;  1Q95 G;  1PSE A;  1VUB A;  2YHT A;  4FT2 A;  4XK8 E;  4RUG A;  4XTY A;  4XTW A;  5CKH A;  1WLP B;  3C4S A;  2NZ8 B;  1PKS A;  1SHF A;  2RF0 A;  1M1K U;  2MMP A;  1QCN A;  1TWB A;  3EG1 A;  3EGX A;  2KXC A;  4AG1 C;  1VQM A;  1RI0 A;  2HEQ A;  2FPD A;  3ER0 A;  1E6G A;  1B34 A;  1AVZ C;  3OYG A;  2LTO A;  1A0N B;  4C92 E;  1UG1 A;  5GAN h;  3OYB A;  3KZ1 A;  1O9S A;  1Q7Y U;  4YON A;  3AT1 B;  4ZGD B;  4HCZ A;  4J9B A;  3CD6 Q;  1WQ7 A;  2CKK A;  4FYW B;  3DB3 A;  4MZM A;  2PVD B;  3NTH A;  4AT1 B;  4JS5 A;  3C0C A;  5EC7 A;  3ODW A;  4PK4 A;  2H3E B;  2LT1 A;  4QQG A;  4M7A F;  3OS5 A;  2HL3 A;  2CH4 A;  4ORZ A;  3OYK A;  2E5K A;  2QQS A;  1C6V X;  3QYG B;  1V76 A;  5LJ5 e;  1NYF A;  2C0T A;  4N0A A;  3R6N A;  1KQ2 A;  3REB B;  3RKX A;  2M02 A;  5I21 A;  3OYJ A;  4ELY C;  4F7U G;  3M56 A;  2J06 A;  3SD4 A;  3V8L A;  5CKF A;  2EKH A;  1VQL T;  1PNJ A;  1OQK A;  1M90 U;  1V1C A;  3ZBD A;  4X9D A;  3RBB B;  4C8Q E;  1VIE A;  2DJQ A;  5GMK e;  1VQ9 T;  2KBT A;  3RIR A;  1I0C A;  3LWH A;  5CKD A;  2LMJ A;  2RMO A;  3BY7 A;  2KMT A;  3QG1 A;  3CCE A;  1D1C A;  1U8R A;  3HSB A;  3CC7 T;  2ENM A;  4C8Q A;  2EGE A;  4HCC A;  1JJ2 S;  1GCQ C;  1WGS A;  1PCX A;  3P8B B;  1KZG A;  1ZUU A;  3VV0 A;  5GMK l;  3OYE A;  2JZ2 A;  4KGZ B;  3G4S A;  1E6H A;  1YIJ Q;  1X43 A;  3G6E A;  3PFS A;  1N27 A;  1X6B A;  2LQN A;  2EKO A;  1U1S A;  2DTO A;  1BY1 A;  1TH7 A;  2B8A A;  1GBR A;  2RK1 A;  3NHN A;  2EJ9 A;  5GAN 5;  2GF7 A;  4FIB A;  2LQW A;  3J80 E;  3TQ7 P;  2LJ1 A;  1SF9 A;  2A28 A;  1M90 R;  3G4S Q;  3SB2 A;  2KRN A;  1UTI A;  1VA7 A;  2AZS A;  4GLM A;  2MWO A;  1Y57 A;  1UGS B;  2LC4 A;  2JN0 A;  1DBH A;  1G3W A;  4MZP A;  5J3B A;  4R55 A;  3UPU A;  1VQK A;  2MI6 A;  5KYN A;  1TOV A;  4XTV A;  4JJN K;  4ZGJ B;  3HPW A;  1TXQ A;  4C8Q G;  1JB0 E;  2V8I A;  5HKC A;  3H9N A;  4AFZ C;  1Z9Q A;  2BKD N;  1YIJ T;  3CXC A;  1G3Y A;  3O8V A;  2OTL Q;  2NUT B;  5KYU A;  2BZY A;  2ZPF B;  2XK0 A;  3EHR A;  1VQK Q;  1VQ6 T;  3TRE A;  3X26 B;  1K76 A;  2E3I A;  2O4X B;  1YIT A;  4N4H A;  3I55 A;  2RJF A;  5C0M A;  5CAI A;  3JB9 G;  3G71 T;  2ZPE B;  4M78 F;  2HNI A;  3PVQ A;  2YRV A;  2CUB A;  3JCM V;  1BI2 A;  2A7Y A;  2XDB A;  4JJD A;  1I1J A;  5HY6 A;  4LDX A;  4OMP A;  4MT7 A;  5HCK A;  5GAM f;  2RK2 A;  2AZV A;  2K9G A;  1BI0 A;  1NPR A;  4E6R A;  1C1A A;  1BBZ A;  1ZSZ B;  4OMF B;  4Y28 E;  2AKL A;  2YXY A;  1VQL Q;  5GMK m;  1HXD A;  4LDV A;  3RMS A;  3CCR A;  1RI9 A;  3R6O A;  2YLC A;  4IUT A;  2OJ2 A;  1TSF A;  1EZZ B;  3JB9 I;  3EG3 A;  4EMK B;  1JQQ A;  4E7H A;  3QXE B;  3CPW A;  1B3Q A;  1K73 U;  2VRW B;  4C0D C;  1LNX A;  3L2R A;  5FI0 A;  4C0G A;  2YT6 A;  2C0I A;  1VQL A;  3OYL A;  2ROL A;  1YP5 A;  2ABL A;  2B86 A;  1UDL A;  1NZ9 A;  2JM9 A;  3JV3 A;  1AOJ A;  2EVR A;  1WZO A;  2EPD A;  2AT1 B;  5CVI A;  2DZ9 A;  1Y96 B;  2X3X D;  3QZ9 B;  3OY9 A;  2VXF A;  3DLM A;  3JRZ A;  4M77 C;  4AFS C;  1ZLM A;  1M90 C;  2GFU A;  4R0K A;  5I22 A;  2K79 A;  2JUF A;  1D1B A;  1YCS B;  1N5Z A;  1ZSZ C;  3CCL Q;  3JCM f;  2YLB A;  3P8H A;  5JHG A;  2R5M A;  2FHD A;  2XG8 D;  3RDV A;  1DJ7 B;  2KE9 A;  2PVO B;  5GAN f;  1OOT A;  5CO7 A;  2E1H A;  1GL5 A;  3HP9 A;  4JRK A;  5LJ3 d;  1M3B A;  2RI3 A;  2LJ3 A;  6AT1 B;  5FU6 B;  5GAO r;  3GLX A;  4J9D A;  2ATC B;  4C0Z A;  2PU9 B;  3I56 T;  3OYI A;  4C8Q F;  2ZZD A;  3EG9 A;  2K7A A;  3FJP A;  1FX7 A;  1N8R U;  3ZEH A;  3TU4 K;  2NUZ A;  4OGC A;  4D8D A;  4OMM A;  2NUP A;  2LJ0 A;  3M5A A;  3TEE A;  1PD1 A;  8ATC B;  2LCC A;  3UF4 A;  2QA4 T;  3VS2 A;  3VS6 A;  2MWP A;  1PRL C;  3REA B;  4HT8 A;  4X34 A;  1QWE A;  1VQ5 Q;  3JCM W;  1H3H A;  3D7S B;  4HCB A;  3L2Z A;  1W70 A;  3M58 A;  3GPL A;  1KHC A;  1TUG B;  3JCM h;  2A36 A;  1AEY A;  1T0J A;  1K0X A;  2ESW A;  4ZTF A;  3EGU A;  2YUQ A;  3OS2 A;  1PC0 A;  1IHV A;  3CME T;  4RTT A;  2M0O A;  2Y4X A;  2QQA A;  2MAM A;  5FU7 B;  1M1G A;  2RJD A;  2DA9 A;  3A5Z B;  3UDC A;  3CCQ A;  1CKA A;  2E64 A;  3ASK A;  3JB9 D;  2F5T X;  1KD1 C;  1OYX A;  3RER A;  5LJ3 e;  2L3Q A;  4MDW A;  3EFS A;  3LH0 A;  2NUT A;  5I2S A;  3VU3 C;  1F1B B;  1NEG A;  1PG5 B;  1R77 A;  3FIF A;  1VQ8 T;  1K9A A;  4J9I A;  2SRC A;  1K4U S;  3OQ5 A;  2VAS A;  3UAT A;  3P6A A;  4C5I A;  4BUG A;  2A3L A;  2F2V A;  2GQI A;  1PD0 A;  1VQ5 A;  5GAO m;  4M77 D;  4ESR A;  4JPB W;  4ANJ A;  2X35 A;  3EGD B;  3C94 A;  3HFO A;  2JT4 A;  2BE7 D;  4JJB A;  3E9G A;  4C92 D;  9ATC B;  1WXT A;  1RAI B;  2AKK A;  2EGC A;  3NPF A;  1YN8 A;  4QVC A;  3VUZ A;  5KE3 A;  1I07 A;  3ME9 A;  1VOM A;  1MMG A;  2LQ8 A;  2JTE A;  4OB2 B;  1VQ4 T;  4J9G A;  4C5E A;  2E65 A;  2RI2 A;  1OU8 A;  2V8K A;  4PLL A;  4B9W A;  3OS0 A;  3CCM Q;  3FEO A;  3CXC P;  5IXF A;  1N9R A;  1EX4 A;  1GBQ A;  3HFN A;  1BCO A;  1H64 1;  4DOV A;  3UA7 A;  1WHK A;  2XIC A;  3L42 A;  1RAB B;  2O88 A;  3GIB A;  2RA2 A;  4BB7 A;  2JS0 A;  3O5Z A;  3CPF A;  3H0H A;  2K6D A;  3OYC A;  2E3H A;  1ZX6 A;  1K73 R;  4E7Z A;  4M75 E;  4TVR A;  4D0N B;  1X75 C;  4PFO A;  3MP8 A;  5GAN 8;  1M1K R;  2HBP A;  3E2U A;  4ATO A;  4PLI A;  4BI3 A;  1M3A A;  2A37 A;  1SPK A;  1G83 A;  1ZUK A;  4LD9 K;  1QW1 A;  3M55 A;  1WJR A;  2EQU A;  2DVE A;  4HCK A;  5GAM g;  3OW2 A;  3QZ5 B;  1H8K A;  1I5O B;  2W10 A;  4RTW A;  2QQR A;  3M54 A;  3OSS C;  1ABO A;  2M51 A;  2DEU A;  3G7Z A;  4QVZ A;  4X1V A;  4M78 A;  1VQ8 A;  1MMA A;  4C92 B;  4PFP A;  1K73 C;  1D1A A;  1G3S A;  2E12 A;  1KC8 U;  4M7D B;  4V2S A;  2ZGW A;  3L2V A;  1T3L A;  2QA4 Q;  7AT1 B;  2VVK A;  1C0M A;  1YJN Q;  1VYV A;  4FYV B;  4M77 A;  3CCV A;  1FWZ A;  2KAF A;  1Q86 C;  3PIP A;  1JJ2 P;  2GBQ A;  1YIJ A;  5LJ5 g;  3RKW A;  2KNB B;  3H6Z A;  3I35 A;  2FPF A;  2XKO C;  3NGP A;  3S3O A;  2V8J A;  1VQ6 A;  2E5Q A;  5CR2 A;  4GY5 A;  2IIM A;  1ZUY A;  2CP3 A;  4XU0 A;  3CCE T;  1W2B S;  4IUU A;  5J39 A;  4J9E A;  3CPW S;  1YI2 A;  1VQ9 Q;  2KY9 A;  1YIT T;  1KQS P;  2J05 A;  3MEV A;  3PNW C;  3LW5 E;  1X2K A;  2EGA A;  4EDU A;  5FI1 A;  1KC8 C;  2OTJ Q;  3A8L B;  2RHI A;  3CCL T;  1JEG A;  3M0U A;  1X2Q A;  1Q81 U;  3F70 A;  1K8A C;  1TTH B;  1WHG A;  1Y71 A;  3HTR A;  4XU3 A;  4A4E A;  4P5N A;  5GAO n;  3I56 A;  5CKB A;  1GCP A;  1M1F A;  5D6W A;  1W2B A;  3I55 Q;  1NLP C;  4MZT A;  2J6O A;  2DJZ A;  5KYX B;  3CBM A;  2CDT A;  1WNL A;  2HSP A;  1NM7 A;  4BDY A;  2DEQ A;  1JXO A;  1SKU B;  2XDD A;  4HVW A;  3OW2 P;  2EWN A;  3NMZ C;  4MML A;  2DD5 A;  1B34 B;  3L2W A;  1M2V B;  1OZ3 A;  3CD6 T;  3ZFJ A;  4J9H A;  3M0T A;  4QQ6 A;  1YHQ T;  1LCK A;  2OTJ A;  4XQ3 A;  1I4K 1;  3OBY A;  5DY9 A;  4F7U B;  4KUL A;  2GQV A;  1HD3 A;  3I9Q A;  2DTH A;  1XD4 A;  2D0Q B;  1WHH A;  5GAM h;  3EH2 A;  3SHW A;  3NFC A;  1X86 A;  5LJ3 f;  2GTJ A;  2PZ1 A;  2LDM A;  1VQ9 A;  3CC2 T;  4D8K A;  3G6E T;  2X4J A;  2E4H A;  3LGF A;  1SRM A;  4LDW A;  4IIM A;  2FZG B;  1GRI A;  4M7D C;  4M75 D;  1OUL A;  5AYF A;  1WA7 A;  1VQM Q;  3GOX A;  2CZ7 B;  3SWN A;  2P4R A;  2R5A A;  2DL8 A;  1WHM A;  4LDY A;  1ZSZ A;  3AHU A;  4EPC A;  3G71 Q;  4JUV A;  2NUP B;  1YJW T;  4OF1 A;  1UUE A;  1XJW B;  2EYY A;  2OAW A;  1Y96 A;  3CCV Q;  1YWP A;  1XTD A;  2CS7 A;  3Q1J A;  3CCR Q;  5GAN g;  5LJ3 j;  1VQK T;  4KT0 E;  4M7A C;  2DRK A;  4RTZ A;  3A8G B;  8AT1 B;  2RM4 A;  3LGL A;  3GNF B;  3SWN C;  4A4K A;  4BY6 C;  2ZPI B;  1EFN A;  2X4X A;  3TCJ A;  2WSF E;  4GZU A;  1YJW Q;  1W4S A;  4C5G A;  2EBP A;  2EQM A;  2ED0 A;  2DIL A;  1WFW A;  4OMO A;  1K1Z A;  5A0L A;  5GAN 6;  5IT9 E;  2QTV A;  1VQM T;  2DIG A;  1KIK A;  3H41 A;  1HSQ A;  4KBM B;  3I55 T;  3M53 A;  4J5Y A;  3CC4 A;  3VS3 A;  2L3R A;  3MEU A;  1B7T A;  1QCO A;  1UFF A;  5IH2 A;  1OU9 A;  3JAM E;  4CI0 C;  3G4S T;  3JB9 J;  4LD6 A;  4QT7 A;  2XDP A;  3EG9 B;  1W2B P;  1CKB A;  3T06 A;  1QVG P;  1WDX A;  3FJ5 A;  1JRI A;  1JU5 C;  1OV3 A;  4FL6 A;  1RAC B;  2L3P A;  4HKE A;  5GAO p;  4B6M A;  2L2P A;  3CCS A;  1VQP Q;  4E7K A;  2A0F B;  1W1F A;  3FDR A;  1YHQ A;  2X3W D;  2L3S A;  3DKM A;  2EIF A;  2KXD A;  4PJO C;  2C0O A;  2VB6 A;  3M0Q A;  3JB9 H;  3DLL A;  1M30 A;  2CRE A;  2CP2 A;  4IUR A;  3OYH A;  4DQ2 A;  3I5R A;  4DEX A;  4NOY A;  2EFI A;  2FEI A;  4RCC A;  3WVE B;  4A54 A;  5IHN A;  1HYO A;  2PUO B;  3S6W A;  4M7D G;  2YRC A;  4LUD A;  5GAN d;  2HD0 A;  1UEC A;  5JHH A;  3NTI A;  1T3S A;  1X6G A;  2KYM A;  3G1J A;  1KD1 R;  1QLY A;  1LVK A;  1K8A U;  3RUX A;  2KDS A;  2JJ9 A;  4FT4 A;  1Q81 R;  3CCE Q;  4B9X A;  5HK0 A;  2QAS A;  2AHJ B;  2OAU A;  4JLG A;  3L2Q A;  3LLR A;  1N8R R;  3EG0 A;  1YCY A;  2KGT A;  2ZPB B;  1ZSG A;  3CCS T;  1M2V A;  4QVD A;  1UB4 A;  3QUI A;  3GNG A;  2WAC A;  5CQX A;  1RL2 A;  3KY9 A;  2YWW A;  4M7D D;  2K3X A;  5KYW A;  2HMA A;  5GAM j;  2RHU A;  2HL5 C;  4Z88 A;  5GMK j;  3MP1 A;  2PNI A;  3PTA A;  5AT1 B;  2BZX A;  3CCM T;  3KFV A;  2LP5 A;  1RUW A;  1M8V A;  1AWO A;  1UGP B;  4J7F A;  3LWI A;  4DEY A;  3CCU Q;  3CCU T;  2QAZ A;  3A8H B;  3UA6 A;  2EYW A;  1NEB A;  3QSU A;  2M1H A;  3OYY A;  2K5I A;  3X25 B;  1PWT A;  1FMW A;  1LPL A;  3CQT A;  3CBO A;  3KSY A;  1K8A R;  3PVL A;  3LX7 A;  4FYX B;  2LCL A;  3E1S A;  4CC4 B;  3CCS Q;  2D1X A;  3X20 B;  2QEX A;  4KH1 B;  3MET A;  4AG2 C;  3JCM J;  5GAM e;  4C8Q C;  3MEW A;  1KK7 A;  1VYT A;  4BY6 B;  3M59 A;  4VUB A;  1WHL A;  3M4Y A;  5FWC A;  1WHJ A;  4PJJ A;  4D6W A;  3JCM d;  3DB4 A;  3BW1 A;  3M0R A;  4BD3 A;  1AZE A;  4N4G A;  2EYZ A;  1JBM A;  2SEM A;  1MGQ A;  2DVJ A;  3GF9 A;  1U06 A;  4KRT A;  3M0S A;  1KHI A;  5CIU A;  1KZ7 A;  2XHC A;  1GFC A;  2JVV A;  2DFK A;  2O31 A;  2QTX A;  3V7S A;  2DMO A;  2FVU A;  4M77 B;  2CP7 A;  1CSK A;  2ZCF B;  2MF2 A;  1M4Z A;  3VJP A;  2KEA A;  1X6O A;  3VYG A;  2IG0 A;  4E47 A;  1VQ5 T;  1ACM B;  1HJD A;  4J9F A;  2O01 E;  4AFU C;  5M9O A;  1IGU A;  2D8H A;  2RQT A;  4M77 G;  1QVG A;  3N5B B;  3HL8 A;  1VQP T;  1WXB A;  2X9H A;  1YJN A;  3CCU A;  2DYI A;  1RAA B;  2XD0 A;  1RLP C;  1QQJ A;  2ECZ A;  2QGG A;  4C8Q B;  3EGD A;  5FLX E;  3U23 A;  1OX8 A;  2J6K A;  3MEA A;  4RG8 A;  4HVU A;  1IZ6 A;  2RQR A;  1G3T A;  2WSE E;  2CP0 A;  5DLQ E;  2MOX A;  2RHY A;  2VV5 A;  2FRY A;  5GAN 7;  2QA4 A;  2JS2 A;  3OYD A;  1KC8 R;  5GMK h;  2OI3 A;  3BJI A;  2XID A;  3T9N A;  4IUV A;  3OB9 A;  4FU6 A;  1K9M C;  2IPO B;  1OPL A;  4BE1 A;  2LX7 A;  2RNA A;  3LH5 A;  4RG2 A;  4A53 A;  1GCQ A;  3J7A F;  2XMF A;  2ZAE A;  3JCM c;  3VS5 A;  4ZGE B;  1AT1 B;  3HHT B;  2ROT A;  4KGX B;  2I0N A;  1Q86 R;  1M3C A;  1K9M R;  1KJW A;  4RTY A;  3OS1 A;  1IXD A;  2RQU A;  1TS9 A;  2J7I A;  1I81 A;  1S72 Q;  1JJ2 A;  1VQP A;  4II1 A;  4C8Q D;  5GAM d;  2DNU A;  1NTY A;  4J83 A;  1UJY A;  3QJY A;  2Z0W A;  1H3Z A;  3CCM A;  2ZPG B;  1Q82 R;  1SHG A;  4C0D B;  2LVM A;  4C92 C;  3EFR A;  2FZC B;  1ZBJ A;  4MMK A;  3MPU B;  2FYK A;  3TSW A;  2V26 A;  5IHI A;  1NG2 A;  1BI3 A;  1T0H A; 
#chains in the Genus database with same CATH homology
 2VWF A;  2CDT A;  2HSP A;  1NM7 A;  2LJ1 A;  3GBQ A;  4GBQ A;  1AWJ A;  1PKT A;  2A28 A;  4LE9 A;  1JXO A;  4HVW A;  3NMZ C;  2KRN A;  1UTI A;  1MV3 A;  1VA7 A;  4LN2 A;  1E7O A;  1Y0M A;  2AZS A;  2JMC A;  1QKX A;  4GLM A;  4GOU A;  3M0T A;  4J9H A;  1ARK A;  1KSW A;  1LCK A;  1Y57 A;  2H8H A;  1PHT A;  2GTO A;  1DBH A;  1HD3 A;  3I9Q A;  4CC7 A;  1XD4 A;  1S1N A;  3SHW A;  2O9V A;  1X86 A;  3A98 A;  3EO2 A;  2GTJ A;  2PZ1 A;  4D8K A;  2LNH B;  1WX6 A;  4AFZ C;  1Z9Q A;  1SRM A;  4IIM A;  4CC3 A;  1GRI A;  1VYU A;  2BZY A;  1QKW A;  3QWX X;  3EHQ A;  2DM1 A;  3EHR A;  1WA7 A;  2D0N A;  2P4R A;  2YUN A;  2RQW A;  2DL8 A;  5ECA A;  1K76 A;  2KYB A;  2RGN B;  4WCI A;  1WYX A;  2G6F X;  2K3B A;  1UUE A;  4K11 A;  2EYY A;  4OML A;  2OAW A;  3PVQ A;  2CUB A;  1YWP A;  2ED1 A;  4JJD A;  1I1J A;  1GFD A;  1BB9 A;  2D8J A;  4OMP A;  2O9S A;  2JM8 A;  4MT7 A;  5HCK A;  2YSQ A;  2AZV A;  2K9G A;  4E6R A;  2JMA A;  2DRK A;  4RTZ A;  3QWY A;  1BBZ A;  4ZNX A;  1ABQ A;  2AKL A;  4HXJ A;  2DF6 A;  1AWX A;  1EFN A;  1RI9 A;  2OJ2 A;  1K0S A;  4GZU A;  3EG3 A;  2EBP A;  2ED0 A;  1JQQ A;  1SSH A;  1WFW A;  2DIL A;  4OMO A;  2PTK A;  1K1Z A;  1B3Q A;  3ODO A;  2VRW B;  1TUC A;  4JJC A;  2RN8 A;  5FI0 A;  1KIK A;  2YT6 A;  3H41 A;  2C0I A;  1HSQ A;  2ROL A;  1YP5 A;  2ABL A;  3VS3 A;  2B86 A;  1UDL A;  2JM9 A;  3JV3 A;  2BTT A;  1SEM A;  1UFF A;  1AOJ A;  2EVR A;  5IH2 A;  2DX1 A;  2NWM A;  1M8M A;  2EPD A;  4QT7 A;  1CKB A;  2X3X D;  3T06 A;  1WDX A;  3FJ5 A;  1JU5 C;  1OV3 A;  3ULR B;  2F2W A;  2CT3 A;  2AK5 A;  3EG2 A;  2CT4 A;  1M27 C;  3H0F A;  4AFS C;  2L3P A;  3SEM A;  1QWF A;  1ZLM A;  4Z8A A;  4EIK A;  4R0K A;  2L2P A;  2YUP A;  2K79 A;  4M4Z A;  5I22 A;  1W1F A;  1YCS B;  1N5Z A;  2DBK A;  3I5S A;  2X3W D;  5JHG A;  2BZ8 A;  5FW9 A;  2L3S A;  1MUZ A;  2KE9 A;  3VS7 A;  1BK2 A;  4LUE A;  2KXD A;  2EW3 A;  2C0O A;  3M0Q A;  1OOT A;  2CUD A;  2M0Y A;  3VRZ A;  1GL5 A;  2HBW A;  1M30 A;  2DL4 A;  4GYV A;  4D0O A;  3ODX A;  1M3B A;  2CRE A;  2CSQ A;  2KR9 A;  1OEB A;  2LJ3 A;  3I5R A;  3MPX A;  4DEX A;  3VRY A;  4J9D A;  2FEI A;  5IHN A;  1G2B A;  4AFQ C;  4OMN A;  1FYN A;  2KR3 A;  1U5S A;  4LUD A;  1B07 A;  2K7A A;  4F14 A;  1UEC A;  5JHH A;  1T3S A;  1X6G A;  2KYM A;  2NUZ A;  2FRW A;  4D8D A;  4OMM A;  1QLY A;  2KRS A;  2LJ0 A;  1UHC A;  5I11 A;  4JZ3 A;  1XCG A;  3UF4 A;  2DL7 A;  3VS2 A;  3VS1 A;  3VS6 A;  1KI1 B;  1UGV A;  2CSI A;  1PRL C;  4LNP A;  3REA B;  2A08 A;  2K2M A;  2YDL A;  1QWE A;  4Y92 A;  2FO0 A;  3THK A;  3EG0 A;  2DLP A;  3H0I A;  2KGT A;  1ZSG A;  1H3H A;  1AD5 A;  5GJV B;  4OMQ A;  1SRL A;  1W70 A;  4A63 B;  1JXM A;  4RTX A;  1MV0 B;  1H92 A;  3KY9 A;  1UE9 A;  2DE0 X;  2A36 A;  2GNC A;  1AEY A;  1T0J A;  2KT8 A;  1K0X A;  2ESW A;  3EGU A;  4Z88 A;  1NLO C;  4Z89 A;  1LB1 A;  2YUQ A;  2JXB A;  2EQI A;  2PNI A;  2KRO A;  1J3T A;  3PE0 A;  4RTT A;  2RPN A;  2BZX A;  4F17 A;  3KFV A;  2LP5 A;  1RUW A;  1AWO A;  1X69 A;  2DA9 A;  2GGR A;  2MIO A;  4DEY A;  2FPE A;  4JZ4 A;  1UJ0 A;  3UA6 A;  1CKA A;  4RTU A;  2EYW A;  1NEB A;  4FSS A;  2L0A A;  2Z0Q A;  2EYX A;  1IO6 A;  1YNZ A;  2VKN A;  1QCF A;  2L3Q A;  2HCK A;  1PWT A;  1TUD A;  1YWO A;  1OPK A;  3CQT A;  1RJ2 A;  3KSY A;  2MCN A;  5IHK A;  2F2X A;  3PVL A;  1NYG A;  1NEG A;  4J9C A;  2DL3 A;  1K9A A;  5GJW B;  4J9I A;  4CC4 B;  2SRC A;  1K4U S;  2D1X A;  3UAT A;  2YUO A;  4AG2 C;  1FMK A;  3P6A A;  1AZG B;  2RQV A;  2KT1 A;  2V1Q A;  2O2O A;  5FWB A;  2F2V A;  1VYT A;  1WI7 A;  2GQI A;  2HDA A;  1F5X A;  4ESR A;  4JPB W;  5FWC A;  5L23 A;  3TVT A;  1BU1 A;  1UHF A;  2JT4 A;  4JJB A;  1WXT A;  3M0R A;  3VS0 A;  2AKK A;  1KFZ A;  2EGC A;  3NPF A;  2DBM A;  1YN8 A;  1AZE A;  2EYZ A;  2SEM A;  1I07 A;  2DVJ A;  4RUG A;  2FG0 A;  3GF9 A;  2JTE A;  1WLP B;  1U06 A;  4KRT A;  2NZ8 B;  1PKS A;  1SHF A;  2RF0 A;  3M0S A;  4J9G A;  1KZ7 A;  4IIO A;  1Z9Z A;  5IXF A;  3EG1 A;  1JO8 A;  1GFC A;  1GBQ A;  2DFK A;  2O31 A;  2KXC A;  3UA7 A;  2DMO A;  1X27 A;  4AG1 C;  1CSK A;  2QDL A;  2O88 A;  2HEQ A;  1WIE A;  2FPD A;  2JS0 A;  3O5Z A;  4F16 A;  3H0H A;  1E6G A;  2DL5 A;  2CH4 W;  2K6D A;  1ZX6 A;  1AVZ C;  5IHI A;  2KEA A;  1A0N B;  4D0N B;  3QBV B;  1UG1 A;  3KZ1 A;  1M3A A;  2A37 A;  4YON A;  1W6X A;  1SPK A;  4J9F A;  1HJD A;  1G83 A;  2KRM A;  4AFU C;  3TSZ A;  1ZUK A;  2D8H A;  2RQT A;  3ZL7 C;  4J9B A;  1WXB A;  3RNJ A;  4HCK A;  1RLP C;  2ECZ A;  1H8K A;  3C0C A;  5EC7 A;  3U23 A;  2W10 A;  4CC2 A;  4RTW A;  2J6K A;  4HVU A;  3ODW A;  1ABO A;  2M51 A;  2RQR A;  1AWW A;  4X1V A;  2MOX A;  2CH4 A;  4ORZ A;  4RTV A;  2E5K A;  2J6F A;  2FRY A;  1NYF A;  2C0T A;  1T3L A;  2JS2 A;  3R6N A;  3REB B;  2VVK A;  2OI3 A;  1TG0 A;  3BJI A;  3M0P A;  1VYV A;  2J06 A;  2EKH A;  1PNJ A;  1OPL A;  1V1C A;  2LX7 A;  4HVV A;  2GBQ A;  2RNA A;  2JW4 A;  3VS4 A;  3LH5 A;  3RBB B;  2DJQ A;  2KNB B;  1GCQ A;  3I35 A;  2XMF A;  2FPF A;  2KBT A;  3NGP A;  3VS5 A;  2V1R A;  2LZ6 B;  1TXD A;  1I0C A;  2LCS A;  1U3O A;  2IIM A;  1ZUY A;  2LMJ A;  2RMO A;  2DYB A;  4J9E A;  1PRM C;  2ROT A;  2DRM A;  2I0N A;  2J05 A;  1M3C A;  2ENM A;  1KJW A;  1WXU A;  1X2K A;  2EGE A;  2EGA A;  4RTY A;  2W0Z A;  2RQU A;  1GCQ C;  5FI1 A;  1JEG A;  2J7I A;  3M0U A;  1KZG A;  1X2Q A;  1ZUU A;  2DNU A;  5IXB A;  1E6H A;  1NTY A;  1XOV A;  1X43 A;  1UJY A;  1FOE A;  3IQL A;  1X6B A;  2LQN A;  1SHG A;  1GCP A;  1RLQ C;  1BY1 A;  1ZBJ A;  1GBR A;  3NHN A;  1NLP C;  2J6O A;  3TSW A;  2LQW A;  1NG2 A;  1T0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...