3JV4B

Crystal structure of the dimerization domains p50 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
ASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Transcription factor RelB
total genus 16
structure length 115
sequence length 115
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv4B00
3DPBA 3E2HB 2HN7B 1RUKH 1VFAB 3LRHA 3V6FA 4I0PD 4P49A 1JYVA 3U9PH 2Z31C 1YYLH 4Y4KC 2VDML 2NY6C 4L4TE 3MRPB 4FTVA 1JGUH 4P2YA 1DR9A 3ARZA 2DQHL 3DXAA 4NWUL 3SKMB 5I75C 5CJOL 3LS4L 1HHKB 4JFFA 1IAKA 4ZAKA 1RUMH 1X9QA 2W0PA 3VFNB 2J8UE 3SDXB 1PQZB 1S78D 3MBEB 3BUTA 3WDJA 3RY6C 1NGXB 5GSVA 3C08L 3GSNH 5DUBB 2P8MA 4JO2L 5EOQL 1JZ3A 2CGRH 3VFWB 4M1DH 5FO7B 3DSFH 3KVQA 2NXZC 1DVFA 3MLXL 4S0TD 3IU4L 1JZ4A 4G6JL 1KCVL 1X6NA 4S1DD 3NCCB 4GAJH 4I0CC 4W4OC 1A14H 3NAAL 3MRBB 4I3SL 4LVHB 4DGIH 3T3PF 1QSED 1RUPH 1OP3H 2DQEL 3IDGA 1AGFB 2AV1A 2G60H 1I7ZA 2IAMB 2B39A 4L8DA 3MRHB 4OQ1A 3MBED 3MXWH 5SV3A 1X5LA 3KHOA 4EI6A 3GSNA 3I6LD 3FAXA 4ACPA 3MFFA 5IQ9A 4AIOA 2DIJA 4FMFA 1KGCD 4F80A 4Y7MA 3LVEA 1GJIA 3TNMA 4RFNC 2EC9T 1A21A 1CFSB 3HPJB 3PP3K 1QHPA 2DQGH 4QRRB 5D93B 3SJVE 4OZIA 4OKVA 2VLKA 4Y16A 3IETA 5D1ZA 3MZGB 3PWNA 1AGEB 3CDYA 1PKOA 3GBMH 3IDYB 3OR7B 3CGTA 5C6PB 3FONA 3QEQD 2QHLA 1NC4A 4UT9L 5DRNA 2GJZB 1DDHA 2WP3T 4LLAA 4I3GA 2APTA 3KAAA 2ZCLL 5HYQB 3T2OA 2HJLA 1ORQB 4HC1A 4NZUH 5F7LB 3AC0A 2GUOB 5D7KE 3PL6C 1YMHB 4GW1A 2XA8H 1PX4A 5JIHA 3OKOB 4MX7B 3DYPA 1OD7A 4OGAD 3BGAA 4PJFA 2Y7QB 3QNXB 2DLIA 3FQNB 2JCCA 3MOBL 2BNRE 1I9IL 2ADIB 1JWSB 1QSFB 3VDCA 2VAAB 3IFPA 4N0UE 1W8OA 3WLWD 3F12B 4PJDE 4M1GL 3ECBA 1G0YR 5I66B 4Z7UA 5IVOA 1UWXH 2PCPB 4LSVH 3R8BB 3VG9B 3WFHA 4APQA 4X4YA 5EBLA 5AG8A 4P2OC 1O7VA 1OGAE 4PJHA 3WNLA 4EI5D 2R0LH 4YFEA 3BWAA 4ONGH 4UINH 4M8QB 4PTTB 4TUJB 1NBVH 4LVNB 1UJ3A 4CVXB 1I3GH 4QXGH 2V7NB 4RSVA 4QRUB 1MREH 2XWJA 4NBZB 5JXAH 4QOKD 3EIFA 3FB8A 3VRJB 3V6FB 4N1HB 5DTFB 1QR1B 4NM4L 5K9JH 3T2NL 1KB9J 1WZLA 3VCLB 2AK4A 3RWEB 5JOPE 1F90H 3D25A 3MPCA 4LRNH 1CFVL 1A9EA 1AGBA 1KLUA 5ICXA 3P11H 1NGYB 1BIIB 4JEGB 5IB3A 3LN5B 3JUYA 4LLQA 4NKMB 4UDUB 5KAQF 4PS4L 3FT4B 1U3HD 1LO3H 3TH3T 3K81A 4IIQA 5GZOD 1EFXD 5D2LE 5DO2C 4NRZB 3MRQA 4XNUH 1D9KA 5J12B 4X7TB 4PJDA 4CMHB 3FO9B 4PLJC 1PX3A 5D9SB 4CMHC 4TPRH 3D39A 3AU1A 1G9ML 3FFCB 3QQ4A 1BJ8A 3ZKND 1KPUB 2YZ8A 1JGLL 1NCBL 5DK0B 5ID1B 1ES0B 5JW4R 1X6LA 4X4ZA 1OSPL 2AEPL 1NCTA 3GKWL 2CLRB 3OJDB 4D0CA 2R0ZL 3MRRB 4ODHH 3RIFF 3MXVL 2HKHL 3DI3B 4YHML 4W6XB 3LKOA 1NANI 4TUOB 2YN5A 3PF2A 5IBLD 5KANI 4L8DB 3DX9A 3WIFA 5B39A 3FB7B 4XB7A 3KYMB 4AENB 3STZB 1DZBA 4YHNA 2DRUA 3MJ8B 1AGDA 2XG5A 1UG9A 5ESVA 2AXHA 5IMOA 4DVRL 5D7LE 1CDYA 1A4JB 2QQNH 5HI4C 3KPTA 4DZ8A 4BKLB 2JJTA 1HSAB 3N06B 2XG4A 4L5FH 3T0XA 5HYFA 1J86A 1OP3K 1CICD 4OT1L 5H37G 3KYKH 3VGAB 3DRTA 4GW4A 1BBDL 3FHQA 1NCUA 2ITDB 4GKOA 1N4XL 4PYGA 4L4TB 3ULUE 1HYRC 3VD3A 3HI6L 4MA8L 4PY8J 1TJIL 2ORBH 1FO0H 4YX2H 5FCUH 1MJJA 4BQCA 4LBEA 4LAJH 4WCYH 3UPAA 4JB9H 1A4KB 3WJJC 1G6VK 2YD9A 4JO4H 3H7BB 5GXBB 5DC0A 4YFLI 2A9NH 4AQOA 2VZSA 4C57C 2XRAH 3BP5A 2F74B 2YD1A 1YQVL 5KOMC 3P4LA 4U6XB 4X9IA 1SMAA 1CTOA 2R1WB 2CUMA 3LRGA 1ITBB 5AG9A 4URTB 4JG0L 2DD8L 4G7YH 4QY8A 5F6IC 2VJXA 1MCWW 4BH7A 2I9TA 4UT6L 2R8SH 2F54E 3G6JA 3MRMA 4GT7A 4Z7VA 1PZUB 1JPTL 1FZMB 1CE1H 4X98A 3DUUB 2AERT 3RA7L 4Y16C 4B50A 1ZHKA 1DUZA 1FH5H 1HXYA 1S7SA 3OQ3B 5DQDL 4WW1B 1KCSH 3SO3C 5EO9B 1ZA6B 2DWEA 4PRPD 5BJTA 5GS1A 1UACL 2R1YB 3PQYD 5D6CB 5MHSE 1CK0H 2ZKHH 4RA0C 3ILQC 2Z31A 4UMGA 5T1KB 3JBG7 2YWZA 1MCPH 4FXGB 2APWA 1FL5A 3C6LD 5TPWL 2V2TA 3TZVC 1U36A 3CDCA 4MCYA 5BO1H 4OCWL 1MAMH 2JK5B 4L5FL 3TVMB 3IJSA 2EO9A 4KDTC 2H1PL 2C1OB 3PHQB 1UYWL 1WEJL 4LIQL 4J3VA 4OZHE 3P4MB 1RJZA 3HCVA 4HT1L 4X80L 5AZ2L 4H5SB 5C0AD 4HXAL 3VFMA 1FNEA 5F7EL 1KFAH 1I4FA 3U1SH 2DD8H 3A0OA 4G7YL 1I9JL 2D03H 4Z0XA 3F62A 4L8BA 5ENWA 4U3HA 3GBNH 4NQDD 4X6CB 2OXHA 5TDOA 1Q94B 4QXUH 4PRBB 1EFQA 1YPZA 1Z3GL 4QHKI 5K59F 5K59E 3AMKA 2WBKA 3BKMH 1TTFA 2E9BA 1FL6B 3FL7A 5KVDL 4BH8B 3WFDL 1H8SA 1Z5LB 5A1AA 5DJZA 5HI5D 1KJ2A 3X11B 4XPTL 1RULH 2COQA 4MA1C 4XP1L 2BSRB 5I1DB 1IT9H 1NBZB 2R29H 3UC0H 3ARBC 5D7LA 1G1YA 2BVOA 1CD0A 1NCCL 4P2RD 4H20H 1AGDB 5ESVB 3MJ8A 2NYYD 4QOKB 1JGLH 3GJFA 4JJ5B 4DGYL 3MA7B 5I15H 1QFWH 1OTSD 1NJ9B 2NY4B 4ZFOB 2AV7B 1UKTA 2JIXD 3CMGA 4IMKC 1WWAX 1A6VH 3WJLA 4HWBA 4YPGA 3KJ4C 2GIYA 5AUMA 3L3OB 1R3JB 4P23C 5IHUL 3MNVB 4N5ED 5FOJA 4U1GB 5GGQL 1DUYA 2V2WB 1AXSB 4E0RA 2AW2A 4P2RE 2ERJB 3HMWH 2AS5M 5IVZA 4UINL 3ZYIA 3T65B 1TFHA 1XAUA 1I8LA 4YHLH 4P3CL 4HWNA 5F7MC 3HNSH 2Y07H 3SDCB 5CLTA 3MOQA 2YPVL 2OI9C 1CLCA 4PJIF 1F3JB 4XBPA 4NPYB 3QQ9D 4MJIA 2Z91A 2OSLB 3S88H 2ZUQB 4JKWA 1J8KA 1KENL 5EU6A 2B1HH 4X7CC 5GISH 1LEGA 1K2DB 2B0SH 5DRZA 5I1KH 2DL2A 5CAYB 4Z7OE 3VXNB 2XTLA 4NJAH 4OI8A 4JKMA 2D7QA 3GMMA 3NOIA 1EHAA 4K8RL 2JJSC 5DYOB 3OPZL 4X6DE 1CT8A 4PJEF 3HAEB 5FM5M 4OLXL 4JFQA 4K71C 1BQHA 3RUGF 2VC2L 2ICCA 1E4XL 1KTDA 1F2QA 3TIDB 5B3NA 5L9DH 4WNQA 2IQ9L 1U91A 5MERA 2YPKA 1LD9B 2NZ9D 5GRWA 3ESUF 1K3IA 4M8VA 1INEL 1BGXH 3Q1SH 3T0ED 3FFCE 3AAZB 1S3KH 1EPFA 1ZOXA 1WZKA 3VGEA 5F3HA 1JZ8A 3F12A 3X12B 3L9RB 3EYUL 5LBSH 5KSAB 5C07E 1QSFA 4ELME 1PJ9A 3V6BR 4PJ5B 4H1LH 2G75B 1M6OB 4Z7WF 1C16B 1E28A 4PJXB 2EDKA 1OM3L 3T2PA 4KKAD 4NQEE 4BFEA 2QQKL 4C59B 3MV7A 3HMXA 1SJXA 1SJEB 1Y6KR 3BSZH 2X4RB 4G6FB 1RZFH 1QD0A 1Q0YH 4CMMB 4X5XB 4ZUSA 5E5MA 4HEME 5JQ6L 5J56B 2DDQH 5C3TA 1S7XB 1TVHA 3QI9D 1CLOH 4J4PD 2RHEA 5E94A 4QRTA 3SCMC 3KDMA 1A2YB 2APXA 2G9HB 3MRRA 3CU7A 4JLRA 4UAOB 4IDJH 3T0AA 4NC1C 1XR8B 4M02A 5F9WC 4C56D 5DJZB 2LU3A 5HDBE 3WSQH 3X3FH 4JFEE 3QCUH 4P46A 1YMMD 2IGFL 1FL6A 1C5CL 4PP2A 4NJAL 5FA3A 1G9NC 2YN3A 1WICA 1XCTB 4NGHL 3AU1B 3MYZA 3VFVB 5EZIL 4JY4A 4U31A 1ZWIA 3T0VA 3SE9L 5TDOB 5GPRA 3B2VL 1A4JA 4PP1C 1ND0B 3DV6A 4Y1AE 1SM3L 4YDVA 2Z93B 5IMOB 4L3EE 2A73A 4ELKB 3JWDH 3ARGB 4P57A 1F6AA 4TOYL 1KTRL 4WU7A 5KVMC 1TJGH 4UILL 1AGEA 4MA7H 2NW2A 3BP4B 4I77L 4O2FB 3HE6D 3T1FB 4KROB 4JDTH 4L1DA 1QUNA 4HCRL 4NYLB 1MNUH 1MCCA 2XZCH 3VXQB 5E24E 5J1AB 1IJ9A 5EUOE 5T1DL 4FFVC 4EXKA 5D71L 1A6TB 4BK5A 4EUPB 4MA1B 4P5TA 1RQ5A 3QYCA 4LKXB 1ED3B 4XMLL 1E27A 4LDLB 3U0WL 1IGCL 32C2B 3NZHL 4N8CL 3RGVC 2UWEE 2M8XA 2R2HA 3NCFB 2JIXB 2RB8A 4HIJA 4LARH 4WHYH 4KRPD 3CU1A 3DGCR 2XNAB 2VXSL 1RIHH 4LSTH 1PKQE 1TXKA 2X4OB 3D87B 4XCYB 3QIBD 4ZFGH 2OZ4A 4UDTB 4MGXA 1XIWB 4NWTL 5GGSB 3LKPA 4MJ6A 3G6DL 4AIZB 1AHWB 1FCGA 1RI8A 3HAEA 1XR9B 3MR9A 4LSPH 5ALBL 4FQIH 4PRPE 3PQYE 1M05B 4KWUA 1HHGA 4WV1B 4Y5VB 4EEEA 1T1XA 4FQQA 2N4IA 4LSUL 4MWFB 1X44A 3BPCA 1XR9A 1AKJD 2EYSA 1I9EA 3JV4B 1MEXL 4M7JL 4Q9QH 3TN0D 3BP5B 2IH3A 4M8QA 3O3DA 4DZBA 4JHAL 3O8XC 1A22B 3WNNA 4M6AA 3ARUA 4O4YH 1Z2KA 3HNSL 4Q9CA 5FGCE 3UEZA 2O61A 2V17H 4UU9B 1KC5H 4PV9B 5TJWK 5A43C 3EZJB 1A6ZA 2DTMH 4Y4KA 3QPXH 1FG9C 4F8QA 3O2DL 2EIDA 5JHLH 4NNYA 1CXLA 4YIQB 1HHGB 3NCYP 2BHYA 4F58H 4ODTH 1TIUA 5I1KL 3I6KA 2NXYB 1MJ8L 3B9KC 1A7PH 1AO7B 3LHPH 2VWEE 4LARL 4KGJA 1U8IB 3PE9A 3DV4B 4P5MB 1P84K 4LRIA 3QUXC 1A0QH 2YA2A 4XP5L 5CIPB 1EXUA 3INUH 5KSUB 3NIFF 5C9JA 1DBJH 2EICA 5IHUH 1NQBA 2XZAH 2J4WH 3E3QE 4PJEE 1MLBA 2UYLB 3EYFA 4PG2C 2Z8WC 5HI3D 2DTSA 3LEXB 2A9ML 1OLZA 2FL5A 4HGMA 4G7VL 4BFBD 4PG9B 4Y19B 1FNSH 2EDYA 2MFNA 2CMRL 3EHBD 4RAUA 4HS3A 3STBA 2H32B 3SCMB 1YEEL 3HZVA 4OB5H 4AY0A 1A7OL 4DWHA 4PJIE 1LDPL 3O6ML 4K94L 1J0KA 2FBJH 1MHEB 3WN5C 3TNMB 5LGJA 1YEDB 4LHUA 2KZ1B 4F7EB 3RDTC 3IKKA 1S7QB 2J3SA 3KPRE 4GSDL 4N9OB 3TO2A 1R3IH 5D7IA 1MCPL 3SQBA 4F33B 3QIWB 4X5WB 1AKJB 2H3NA 1IGTA 3QUYA 2JJWA 4MB3A 4EXPX 4TUOA 3SE9H 3LKOB 3DURA 1I8KB 1CDCA 3DHJA 4JPKL 1NCAL 5MP6L 3KPMA 1AI1L 4BZ1H 4TSBL 3MRIA 5BMFL 4HUVB 2X10A 3X13A 3F6IA 2HJFA 5ILTL 4PJBF 5FF6A 3S37H 4LSQL 4CBPA 1QKZL 2O5XH 3C9NB 4HLZH 2X9YA 1DTUA 4U1NA 4QRRD 3WUWG 3EO0A 4LGRB 3SY0A 3LMJH 4JG1L 5EZOL 5C09A 4NHUB 3PDOA 5IWLA 4JFHE 3FTGB 3SKNB 4CADA 3B6SA 5C07D 4LP5A 2NY0D 2ZUXA 2PYEA 4JO4L 3QPQD 4JVUA 3UBXA 3WFEH 1ED3A 1YEIL 3O3AA 3VXOA 2RJMA 35C8L 1TTUA 1J1OL 3T0EE 3AXLB 2FJFB 3G6JB 5ADOL 1G6RA 4WO4D 1CVSC 2PR4H 3VGGA 3RQ3A 4P2QB 1KIPB 2ED7A 4Y4HC 4D8PA 1ACZA 3FN0L 1YMHA 4XNYH 4PG2A 3VXNA 4OQTL 5E9DE 1VEPA 1RHFA 1BZQK 4KHXL 3RY5A 2EEDA 4RRPG 4Z95L 3KPSD 1AR1D 5D7JC 1UXSA 4I8DA 4ODSL 4OLYH 2YPLD 2PXYA 1LK3H 5DI8B 1E6JL 3C60B 1UM6L 4M7LH 4U1JB 4ISVB 1VKXA 4NRXA 3T8XB 4C4KO 3QXWA 5J06A 4U1GC 3O8XD 2X70A 3LRSB 1CT8B 4QT5A 3UTOA 1KNOA 4WTXA 1JIBA 1IC5H 2DBLL 4EBQH 3O9WB 2OP4H 4WGVB 1WF5A 1J7VR 5FYKH 3F7RA 4NHCL 4BK4A 3MLSH 1CG9A 4JDZA 5IUSA 2FECI 3NH7L 4EDXA 5I8KL 1U58B 5ETUB 4DGVL 1B4JL 4G3YL 3KPPA 1JK8B 4NFDA 4PJ7A 1S8DA 3ARBB 4FS0A 3ARYA 1CF8L 4LSVL 5FKPA 4XWGH 1UJTA 4P2QD 1KTLB 2CRZA 2H3NB 2HJKA 5JW5B 4KKCD 2FGZA 5HHOA 2XIDA 1M7DB 2EDOA 1QRND 2EH7L 1FQ9C 3I50H 3DX8A 3QXVA 4ZQKB 3CAFA 3P30H 3KXFA 1CDBA 3CK0L 4LCCA 1YEDA 4HD9A 3KS0H 5KG9B 1PY4A 1DVFB 3WKMH 5DK0A 1NPUA 1F4WL 5GHWL 3QIUC 5I74C 2HVKB 4MJID 1YPZB 3MA7A 2Y06L 3OXSA 4F7TA 2NY1C 5J6HB 3MROB 4F7PA 4O5LL 5E8PA 5EBWA 2W0FB 2AI0H 1OPGL 5TE6L 1SY6H 3BPLB 2N7BA 3RPIA 4Z7WB 1NBZA 4IIQB 3D5OF 4LOUC 2A6JA 5ITBH 5DK2B 4MZ3A 3PUCA 1YEFH 4G9FB 3MUGA 3T04D 1GGUA 2XACC 5TFSL 3MLWL 3MV8D 1IC4H 4JM4L 1QG3A 1T2QH 1FPTL 3QUXD 1G9MH 1QLRA 3CFDA 3NFNA 2DB8A 4NO0A 4R96A 2WWMD 3F8UB 4MJIE 3DUHA 5C09E 3OR6A 4CU6A 1BZ9A 4LVHC 3RVXC 3RVTC 4ZNEE 3ULVL 1LO2L 4U7MA 3MCG1 5CUSH 4R4BA 1W72A 2D7OA 4FFWC 3G5ZB 5GGSY 3KYNB 4OF6A 5H94A 2QHRH 5D8JL 1YMMB 1G7JB 5DJCA 2HP4A 4JKKA 5DQ9A 3SKNA 2WIMA 1IGFH 3L95A 2ATPA 5I8CA 1UVQB 1W0VA 5AEAA 2AXGA 3L5XL 4L4TD 1QEWA 1T6VN 3T65A 5AYQA 1I8IA 2BERA 1RD6A 4E5XA 5KAQG 2BRRH 4BSVA 2W0KA 4Y19D 3S5LG 4OIIH 3OKLA 1OAQH 1N26A 3C9NA 4XI5D 3OKLB 4Y4HD 5I30H 3QDGE 3J8F7 5EULV 5LAXA 3IXAB 5T1KA 1NLBL 4FNLL 2GYSA 2IMMA 2R23A 5BZDA 3W0WB 3CC5A 2NY6B 5F7NC 4B5EA 5CGMA 2NY3D 4Y4KB 3HC4H 3N1QC 4UB0L 1NDGB 5GRVK 1MAJA 2O26U 4UU9A 4FFVD 2OJEA 3BAEH 4HJGB 4U0QB 2UVFA 3B3IB 5I2IB 3IGAA 1I7UB 5ACLA 2NY0B 3MJ9H 3DUUA 5C71A 1A4KA 4P59L 5C0EA 1YN6B 4DZBB 1WBZB 4XXCC 4XNYL 1X4ZA 5T3ZL 2ITCB 1NCDL 2BOCA 3CSGA 1H8NA 3QIBB 1BEYH 4P3WA 3EDDA 3Q48A 1J1OH 3N1PC 1RMFL 2D7MA 2LQRA 5EU3B 3EJZD 1ZA3B 2VXSH 4Y5XB 3D85B 3JXAA 1LNUA 2VXVH 2WV3A 4JY5L 3DO7B 4KMTH 1MF2L 1DANT 3HUJE 4HFUL 3VRIA 2E9JA 2JB6A 1Q94A 3LPFA 4LPUA 4P2OD 2ADFL 4WO4A 1I9RL 2W0FA 3GSNL 3QAZC 5B38A 4MYWB 1I4FB 4HZAA 3K8MA 3TN0C 3W11D 3OKMA 3NTCL 3BMVA 4H5SA 3QFJE 2YZ1A 5HI4D 1CGWA 1IARB 1JNHB 2BXZA 3S7GA 3GMQA 4PJ5E 4G6JH 1OAZL 3D18B 4LRNL 5KSUA 5E6ID 5IFHH 4NCDA 5IB1B 3EDJA 5E5UB 2X44D 1KCUL 5E4EB 4MCYB 2IALA 3W5MA 4JDVB 2R2CA 3GHEH 1YYML 4WWKA 3IT8D 5DDHB 1FZJB 1V3JA 4DOHE 3JWOC 4WUKH 4AEHL 3PGFL 1GGIL 3ZT7A 3HR6A 1CE6A 1OAUL 1CTNA 3KLAA 2D3VA 3V5HA 3BSZL 3MCLH 4P57B 4BZYA 2F53A 2NMSA 3UTQA 1IVLA 2B7DT 3SDXA 4NQDE 5LQBH 4OFPA 5C1MB 2HT3C 2VN4A 4IJ3C 4JGMA 3Q5TA 1QRKA 3A67L 3HR5B 2OTWB 2AJUL 4P4KA 3H9SE 1S7UA 4RGMC 4F9PC 3V95A 4QRSB 3IU3A 3UTTD 3VXTA 1FDLH 4X4MA 4DN3L 1Q9WA 2ADFH 4YDJA 2VH5L 4KJQC 4HH9B 5DLMH 3O4LB 3ARDD 1WBYA 2IGFH 1R5VB 3FZUC 1YJDC 4D0DA 4HWZA 3FCTA 2QTEA 4LQ1A 4NT6B 1AP2A 4BFIA 1VADA 2GSIA 4P99A 4LCWB 5CSZB 1IMHC 5BVJA 1X5KA 4NFBA 5B4MD 5F7EH 4RGNC 2G2RB 2ZUVA 4KUZH 4JO2H 4QNPE 3BH9A 2B5IC 5AAMA 5CZVH 4HS6A 4R90L 4LBEB 2CXKA 2OL3H 5JXED 4APQB 3ARVA 3IS0X 5E8EA 3ARFA 1KJVA 4PJGF 5E8EB 1EHLL 2W9DH 4GLRH 2J88L 4Y5YB 3SY0B 1CFVH 1UCBH 3D9AH 1P6FA 1ZSDA 4PGDA 3M45A 1KIPA 4ZNCD 1LP9F 5D96B 5HDQH 4U6YB 1RAMA 5C0IA 1KJ2L 3LEVH 1JTTA 1OHQA 4LLWA 4HULB 2ADGB 3QDMB 4H0HB 3O3AB 4NZRL 1V7ML 3FO2A 3F65A 5I1AA 3GMMB 3BQUB 4M03A 3L3DB 4OCRL 1L9NA 3MLUH 4NQDB 2VXTH 4PJFE 4TQEH 3W9DA 4YHLL 4X4YB 1PEWA 1FSKC 2PCPA 3BKCL 2Y4SA 1ORSA 4G8FB 3ARFB 2X4QA 5GZNC 2OQJB 3MV01 5I30L 4JZNA 1HOCA 4KPHH 5EWIL 3KPSE 2GITA 3CSYA 2YPKB 5DRXB 1XCQA 3ARDB 4Z0BL 4JN2B 5DD6B 3CX5J 1OT2A 5GS0L 3GSOA 3FQNA 1JWMA 4OFIA 5C7XH 4UT6H 2R8SL 3EYSH 4NZUL 2NLJA 1ZT7A 4HV8A 5CJQL 4H8WC 4YDLB 4POUB 2GJJA 4UUJB 2LTQC 5IMMA 3H7LA 1MSPA 4PFEA 1KJ3H 4NQCD 1CZ8H 4WFHE 3QXTA 4XHQA 3JTSA 1XT5A 2NR6D 2GKIA 1NBQA 1CFQA 4LGPB 2G5BB 2CUIA 4OZHB 3FRPG 1ZE3C 3SGJC 5HHVL 3T3ME 2NTFB 3UYOD 1CBVL 3MNZB 5D5ME 5HHOB 1JNHA 3GNMH 4XPBH 3EJJX 1WSST 3HUJB 3VFUA 1HSBB 2VNCA 5CGYD 3OKMB 1B2WL 5KN5B 3C5ZD 4LSTL 5LGJB 3WUZA 1KCRL 2B0SL 5JZ7C 4WDIB 1L7IH 5DDHA 4PJ7B 5I76B 3V8CA 4X6FA 1Y6NR 4M3JA 2AJVL 1KPVB 5IB1A 1RUAL 1KFAL 4BH8A 4LKCA 2BHUA 5JHDA 4R4NC 5I1EL 5ANME 5FA4B 1U92A 3HC0B 4ZFFB 1RJLB 3H9SA 5DS8B 4UNVA 1EUUA 5C2BL 1UYWH 2BSTA 3QHTC 3Q3GB 1UB6A 2YD3A 4H0IA 3L1OH 2XYCA 4NKQB 3UTZB 3N0PB 1FNAA 4HIEB 5E00B 3N1FC 3EJYD 3N9GH 2ZG3A 4G3YH 4DK6A 5MEPB 4AZ8A 1U8NA 3SKJL 5E6IB 4OGYL 2AJSL 4ZODA 3QNYB 3ARGC 1LK2B 2W9LA 2Z8VC 2NY0C 3BD5A 3FO1A 3HE7C 1W0YT 4HWZB 3GIZL 4NM8L 3VWKB 5F9OH 4UQ2A 2R56L 1NKRA 4JRXD 3FOMA 3BKML 4HHAA 5D1XA 2Q7YA 1WIOA 4AEFA 1L6XA 3ROLA 4Q0XL 2HLFC 4M61B 1I8KA 4KKLD 5HGDA 4S1RH 4PJFF 4R3SA 2NY7H 3HZKA 2HAZA 1GSMA 3CLFH 1MAML 1AR1C 3MV9B 4BA8A 4XBPB 1TCRB 3QDGD 1NFDB 2F9BT 4GS7C 1JPSL 4WI2A 3MOAH 1F4WH 1S9WB 5C09B 2IPUK 5CILL 1W72H 2R23B 2XXMB 3EOTH 3ULVC 4JGJA 2GK0A 4LFHG 2NY2B 1AHWA 3X14A 2CJUH 1LWRA 4BSVB 2JB5H 1FYTA 2JE8A 2P43B 1EO8H 5H8DA 3NCMA 4OD3H 1OWRM 3CPLA 3MUY1 4WW1A 1EEZB 4ZNEA 5DJAB 5F3BB 3IB4A 3RVTD 5E2UL 3RVXD 4NBXB 4KZDL 5BS0B 4OAWB 1KG0A 4OJFH 4PV8A 1U8PB 3TCLA 2FEEI 3MRMB 1U8MA 3VG0H 3LN4B 3LEYL 1SYVB 5DMJB 3MUZ1 4JFDD 3VGFA 2IQ9H 4MD4B 5CD5C 1MFAL 5IFJB 4JO3L 3E6HA 1JGEA 4JRYE 4XNZC 4QYOA 4Y2DC 5D2LA 1OGTB 4MXWH 4QHNB 2NY1B 1FGNL 3WNMA 3HKFA 2V7HB 4XCFL 3VFUB 4ZQKA 1U8OA 2GEEA 3NIGF 2IPKB 3CFIC 2NW3A 3MLRL 5ICZA 3ZKMC 2LAGB 5IKCA 4X7SL 1KXQE 1JGVL 5IFAH 4YQXL 3TYFA 2Q86B 3RGVA 5JXEA 4KKAC 4QHNA 1BECA 5CGYC 3TN0A 5GRVL 4LVOB 4I13B 3KPRB 3VWJA 4M1CC 5CBEA 3LPGA 5T5FL 2F15A 4K94H 2EH8L 5EN2B 4QRPE 2B5IB 4N0UB 3QQ4B 2CR6A 5I15L 2VLRB 4K2UH 4HWEH 4ODVL 5CINH 3LB6D 3FB7A 1FE8L 3X3GH 2Z4QA 2IC2A 1PYWB 2X7LB 2BDNL 4ZPVA 1TVBB 4M62H 1K8DA 5AYUL 1TCRA 2AVGA 1B0GA 1XGQA 1GPOH 3O9WD 3KLDA 4U1SB 1DLFH 5B8CA 1AQDB 3RVUD 5F71A 3TO4A 3MRFA 2IWGA 3KYNA 4PJ8D 3G5ZA 3FQWA 5C0AB 4QCIA 1I9RH 3H9SD 4K07A 5AD0A 2ESVB 4KK8C 1A7RH 1A7QL 1F45A 4LDEB 2VQTA 2DLFL 3C6LC 2QKIB 2Z8SA 4M6OL 2A0LD 5JDJA 1XF4A 3BH8B 1XH3B 2DJUA 2ARWA 2I26N 3TBWA 3ZTJG 5F7YC 2CDGA 1DBBL 5MERB 4HQQL 2X4OA 4R26H 3VFPB 4NPYA 4NUJA 2XNAA 3FTGA 1S5IL 4OD1H 3RHWF 1QFWM 1KXTB 3ROLB 3IDMA 5ICYA 4NQDA 2EH7H 4HGKC 4L4TA 3P4NA 1CDGA 1IM3B 4YDIH 1T1ZA 5FCUL 2AEQH 4ZOBA 1QYGH 1FFPA 1ZHBA 3FQRA 4PRIB 3VXOB 2JJVA 3HPLA 1QLEL 2ZSWB 4XVJL 4M7LT 2P5EB 3PHOB 3IFOA 4NQED 5HPOA 2CQVA 3T0EA 2CRMA 3ZKSD 4NIKB 5ESAA 3L3GB 3FZUD 2ZJSL 4I9WD 4U4BA 1T2JA 3MV8B 2LV4A 4IOIA 4MXQC 2XN9E 4G9FD 5HVHB 2DMBA 3TBYA 3I75A 3MV8A 4WJ5A 4JHBA 3CFBA 4L9LA 2VLRD 4S11A 3UTPE 4ETQA 1L0YA 2I9LA 2B4CH 3VD5A 4CVZB 5IEHB 5ANMA 5L2JA 2UWEB 1FG2B 3M07A 4PJ9C 3V2AR 4R26L 5HJ3B 5EB9A 1U8QB 2JB5L 2AQ3A 1NAMH 3K2MC 1EH9A 5KSAA 2IQAB 1IAOB 5IKCB 5GISL 2EE2A 1JFQL 5F3HB 3K4ZA 4NO0D 1L6ZA 4LCCC 4XAWH 4QRTB 3QUXA 1VKXB 2YUXA 2VDPH 1IFHL 3LEXA 1RZIA 3I2CL 2V5RA 5C0RH 2V7HA 1CE6B 4Z7OF 4S1SL 1NAKH 4JZJC 2XTJC 2DM4A 2NY7L 3P4MA 4OGAC 5JOPD 2EDHA 3P0GB 4OV6F 1I3RA 4PLOB 1LO4H 1D7FA 2VL5B 2FR4B 5CZXC 1KCUH 2DLTA 1FJ1B 3ES6B 4CN1A 3PV6B 1Z9OA 4DUXA 2DLHA 4NNPH 1MCIA 1IBGH 8CGTA 4ZAKC 3SGKC 3GB7B 1DEEA 5BZWA 4PRNB 4WUKL 4AEHH 5GGUA 4NKOB 5CEYA 3IDGB 2VZUA 3DX6A 4U3XA 3ZYOA 4J23A 2P5ED 1AO7D 2RCSH 2QLVB 2EXWC 2J4WL 2E27L 1CLOL 1BOGA 1JN6B 1JV5B 1JL8A 3TM6A 1SVCP 3WLWC 5T1DH 4YQXH 3QB7C 3UC0L 3UO1H 1F4AA 3QCUL 3SBWA 3H9YA 4G8GD 1XF4B 5F8RC 1MJUL 2HJFB 2WLZA 3QULB 1KCRH 3BHBA 3L3OA 4MX7A 1JYNA 1P53A 3UTTA 4LSRL 4UIKL 4PY8I 5K9QG 1KJVB 1LEGB 5LCVL 2ZCHH 2VLJB 5BXFA 1FGNH 3ULUL 4HMDA 4QLRA 1FVCB 2Y36L 5BVJB 2E7HA 1I1YA 1HXMB 1FV1A 1NC4B 4YHPB 1A6WH 2PYED 5E9DA 5EC1A 1M7IA 4PBVC 3PDGA 3S4SG 4NO0B 1RUQL 1JYWA 5EFIA 5LAXB 4U1LA 3NCEB 1NLBH 1FVEA 4XXCA 2F74A 1XGTB 4QTHB 4Z77B 5DF0A 2FYYA 5D7IE 2HMIC 2XFXA 1MFDL 1QBLH 4PRPA 3B2UD 2PNDA 5ADPH 3A6OA 2BVYA 3P4OA 4AH2A 4Y1AB 5FYLD 4WU5A 3BKCH 1T3FB 4I4WA 4LMQE 1U9KA 3BKJH 1R3HA 3AUVA 3SEPA 1IM9B 4ZOCA 3HRZA 5GS2D 3SGEH 3DETC 4XVSH 4XMPL 4JFEB 3BN3B 3HG1A 2FX8H 2FSEB 2B4CC 4WFGE 3QH3A 5I1GH 3KJ6L 4H1LB 5HDQL 2ADJB 4LHUG 1EGJH 1CGSL 4P9HL 1YA5A 5JOFB 2FX7H 3PIQA 3CDFA 3ULVD 3ZSSA 4QWWC 5FYLE 3S5LA 2IBBA 3NN8B 3MA9L 2BNQD 3BKYH 4XGZB 5DA4A 4YIQA 2X2YA 1RIUH 1A6UH 1UZ8A 3W82A 3WUWB 3WYRA 2PN5A 2UZIH 3CXDH 3KDMB 3DVFA 5EOQH 2DI8A 4LVOC 2D7NA 5KSVA 1YN6A 3EO9H 4OZHA 5J6HA 2W9DL 4JHWL 4POZD 4EI5A 4FHBD 3GM8A 4D3CL 5I17A 3VFVA 2HH0L 2IAMD 4YHIB 3U4EA 1RZ7L 3N85H 4O2EA 5IOPA 5HYSB 5FA3B 3GMNB 3K0WA 4QTIH 4I2XA 1UKSA 3MZTA 3DMMC 3P3YA 2XY1A 4H88L 5DJ8B 1AD9A 2YS4A 3FB8B 4KMTL 4IM8A 3TT3H 3BGMA 5E94B 4WW2B 3LZFH 4WTWA 4Z9KB 1NEZB 4U7SA 3G5VA 1YNTA 4MS8D 5DWUL 2MNUA 3A6CL 1CIUA 4XNZB 2IPTH 1BIIA 4S1QL 5A2LH 3BESR 2FIKA 3TZVA 5JPNB 4OF0A 3OKNB 4PJ5D 1VA9A 3GBNL 3Q3GA 2GJ6A 3BH9B 1FGVH 3BKJL 4YHMH 4X6CE 3DIFA 4MAYC 1JBJA 4MQSB 2Y1VA 3QULA 3GB7A 3B8SA 1A1OB 1S9VB 3RUGE 2RCSL 1PKQA 1RUAH 4K3GA 3V5DB 2R9HD 4X6DF 1R5WA 2V2XB 3RVVD 1JZ7A 3AMLA 4CRPA 1U8HA 4JHWH 1F6FB 5J8OA 3O4LA 4HH9A 5IMLA 4IRSD 2WUBL 2YMXL 2YXMA 5I0DA 1KOAA 1P1ZB 3NFSH 2OJZL 5JPNA 2WM0A 1BVKA 4NP4H 3MNWA 1YEGL 2YPLE 2P24A 1VHPA 3PGDA 1H3XA 2FHCA 1GC1L 3QWRA 4JQVC 4JFQB 5B3JF 4L8SB 3WS3B 1FFNA 2EC8A 2PW1B 1SEQL 1FN4A 4HPYL 1VFBA 2XKSA 4KUCF 1JGDB 1U8HB 4C83A 2VDPL 4JZJB 2VWEC 1EAPA 3BP7A 1UM6H 3BW9B 1T0NB 4N9GA 4L4VE 1BD2E 1QFWI 2RFXA 3TBTB 1UA6H 4JREC 5CP3H 2F54B 2FEEL 4WI5A 3NMEA 5DQJB 2BNRB 2ERJC 4P5TD 2FO1A 3D0VA 4B53A 4Z18A 4JG0H 3RFZC 4MXVE 2I9LB 4LL9A 5J1TC 3G6DH 3O2DA 5E8OA 5I1IL 3DVNB 5KSBE 1BQUA 1B0WA 3HA0A 1P9MA 1BD2B 1KBGH 1NBYA 5F8QC 5EORH 3ZE1F 2HJKB 1A7RL 4U0RC 3MV7D 4YH6A 3B9KB 2X4PA 5D1QB 3DARA 5ESAB 2NTFA 1N6QL 2OR8A 3MSPA 1WQVT 1AD9B 3V52H 3G6AB 2VXUH 3ABZA 4EDXB 5T3XH 3JTSB 4PLJD 1YEFL 3L3JA 1U41A 3CFBB 4L9LB 3JWOH 1T0MB 2I07A 3RTQC 4EN3B 4JFZL 4GRLB 1UWEH 1XGUB 1KTLA 1MI5B 3PWJA 4QRQB 5E1AB 5EO0A 4OZ4A 3SDDD 1TJHH 2BVQA 1CQYA 4NRZA 4LEOA 1LE9A 4WRLA 3UMTA 4PJAF 1CFBA 5D7LB 5ENWB 4ZTOL 2E6JA 2ESVD 3GKWH 3RL1A 1U8OB 1QA9A 5B22A 4RWHA 1KT2B 3WIHA 1MCDA 3RNKB 3R1GH 1CQKA 4OQTH 1MUJB 1LNUB 3M1BB 3BDYL 3S5LB 4JFOB 3MV8E 4IEFB 4RISH 3MXVH 2H2SD 4K7PY 5C0GB 3ZO0A 5E08H 2RBLA 1BF8A 2JK5A 4ALAH 3I02A 1BWWA 2P4AB 2JJTC 5DJ6A 4GAYA 2XWTA 2CMRH 4I0KA 3U9UB 4ZUTA 3ZE2E 3REWB 1S7RB 4L3AA 1KIRB 3QJHA 4AQ1B 2EZ0D 4CU8A 1OD9A 2X9WA 1AQDA 4IRJB 3DIFB 3QUYD 4U1KB 3H9HA 3MXWL 3F6LA 3LKRA 2CKBH 3ULVH 2QADB 5HHMD 3BDBA 5KVGL 4TULL 3U46B 1PYWA 5AAWA 1AY1H 2Z4QB 3GI9L 4XNXH 1HHJA 2EE9A 4JCLA 4EOWL 3T0EC 1UH2A 4YO0B 3PWNB 5LKNA 2AJVH 3CVHH 2XY2A 3DVIA 3IETB 1A6PA 5ILTH 4WEBL 5F96H 4E0RB 1YEHL 4HW6A 3FQWB 1FSKB 3MC0A 1WAAA 3MNVA 4I18C 1RK1B 4HKXB 2EE6A 2A6IA 4JRYD 1BQLH 1MIEH 3BN9D 5I8CB 2ZG1A 3L95B 4XPBL 3OKNA 3TIEB 4O5LH 3MUGB 3L5IA 1DLHA 4XVUD 3DRQB 32C2A 1E27B 2J5LB 1EMTH 1A6AB 4NCC2 4OSUL 3QSKB 5LWYL 4MXVF 4YGVA 5AWNH 1YC8A 4HJJH 1N6VA 1IEHA 3L3KB 2HFFB 1ZEAL 5HY9B 2MMXA 1MH5B 3WO4C 3WHE0 4HDIB 4OGXH 2RAMA 3E6HB 5LGHL 3GMPB 1PVHA 5FDYA 5CEZL 5TFSH 4GMSL 3NZ8A 3VFOA 4AYFA 5I8EA 4X9FA 3SGDH 1FFRA 5GQBA 4JE4B 1REIA 2BOCB 2W59A 4KJYB 2YA1A 3BPNB 4I3RH 5KS9B 5C0EB 1ZGLA 4G80B 5TPWH 5H37H 1J1PH 3HE6C 1MFBH 4YE4L 2AQ1A 3LEYH 3NN8A 3EOTL 1KUMA 2EDLA 5GGVY 4Z8FH 1S8DB 3GI9H 4M6NL 4Y1AA 2VDLH 2UY7A 4RWYL 1JGEB 1IGFL 4KKBC 3NPSB 5EPMB 7CGTA 3S3JA 1G9EA 1EV2E 1ACYL 2CXGA 3PWPA 5DJDA 5HGHA 2X4PB 1BBJB 5D1QA 5HGBA 2H9GA 5SWZB 3T4YA 3VD7A 2WUCH 1H9VA 5DUBA 4JRYB 1A6WL 3BZEA 3L7EA 1YY9D 3ROOA 1PQZA 2YK1H 5ISZD 3MJGX 2DAVA 4N90E 1QHOA 1W8NA 2YMXH 1DFBL 1ND0A 3DV6B 3K2UL 3T08A 5CIPA 4ZXBD 2A9MH 1ZWIB 1U3JA 2APVA 2RQ8A 2YXFA 2PF6A 4XC3L 5HPMB 1G1CA 2DYPD 2R29L 1LHZA 4P46B 3LKNB 4GS7B 4BSWB 2EIBA 4NSKA 3A6BH 3A67H 3H0TB 1D9KB 1O5DT 3QNZB 3KPRD 4OD2B 2KL6A 4MD0A 1KELL 4G9FA 1QSFE 3VXRE 5E08L 1U8NB 2X41A 4XAWL 3C6LA 2GI7A 3RRQA 1MFNA 3VG0L 3IJHB 5DD3L 3SDXE 2YSSB 1GVIA 5CSGA 2Q3AA 2WBJD 3KYOA 4YHKL 2W9EH 3BHBB 2DIAA 3VWKA 5MP6H 5KJRL 3RZCC 1IL1B 5D7LD 1OARL 4HPOL 4DUWA 1NCWL 2EH8H 1T1ZB 3UBXB 2DIBA 3B5TA 4LVEA 2XQBL 2XPGB 3GDBA 4WIQA 4IRZH 3UJTH 4Q9BA 5SWSA 5KVFH 4XMKL 2Q8AH 3V6OA 2IMNA 1UQSB 3U30C 3ARGA 5DRWB 4U1NB 3WEXB 4U1HA 4MS8C 4RAVB 2D7TL 4I0PB 5DRNB 3EOBB 2GSIB 1QTYT 2IH1A 4HAGA 4M7KL 3HMXL 1E4JA 3FONB 3FQXB 2VC2H 5SWQB 1PFCA 3SOBH 2BNRA 1IEBA 2D9CA 2C3WA 1I7RA 4JFXA 5GIRB 1H5BC 2XN9B 1RU9L 1CIDA 2CKBB 3RWGA 4LCIH 4OIAA 3C5SA 3O9WA 2P5WE 4HUWB 4CVZA 2VERN 4RQQB 5F97E 2DYPB 2WANA 5IK3A 5CP7B 5JORB 4HG4J 3UX9B 3ARED 4DQOL 4RFNB 3EOBA 4MNGB 4OLYL 5GJTL 2IADA 5FOBA 4K3DL 1P7QA 4EKXA 5EUOA 3BVNB 1G6RL 2CO7B 5MENE 4OLWL 1UWGH 5C9JB 2QQKH 4YDLC 1QSVA 2AK4B 3RWEA 5FEBA 3LQAC 3WKNA 4J1UB 1BP3B 4Q97A 1EHLH 1HZHL 4CDHA 4R90H 1I3UA 5I8OH 5IEHA 1U8IA 1KN2H 3QH3B 1AC0A 1QSEB 1HH6B 2H6PB 1J10A 1AO7A 4KRNA 2IFGA 3OSKA 1UCBL 3CJJA 5JA9A 1CXHA 3E8UL 1GL4B 5HTSA 3OAZH 3Q6FA 3VA6A 4RMWA 3MBEA 4XP9L 4X5XA 1S5IH 2C5DC 1G7IA 3GFUA 4FN0A 4KTEL 5HHME 4YEEA 2BVUA 2NW3B 2XKUA 2I24N 5FHBL 5TF0A 1DBJL 1J8HB 1P6AB 4E41B 1HYSD 2ESVE 2ILLA 3D69B 3INUL 3OV6A 1JHTB 5D96C 1T7VA 2HWZH 1A5FL 1T22B 2VITA 4G6KH 2HKHH 3L5WB 3MBXL 3BGMB 4XNMB 1PG7X 4IMKA 4IOFC 5IG7B 3CFEB 4IS6A 2P8MB 2GJ6E 3BZFA 1X5XA 3LIZL 2HFTA 3QHFL 3L7FA 1NGWB 4RGNB 3F5WB 1I7TA 4F7CA 4NFCA 2AJZB 5HHNA 3RZWA 5DUMH 3HZKB 4W6WB 4EN3D 3MLXH 4I5BB 5D1XC 1CGUA 4I5BA 3RWIB 4X0KA 3VGAC 3G5VB 5IB5A 1WWBX 4KQ3L 3UTTB 1NMCB 2QV2A 1CXEA 3OTTA 5EC2B 4ODVH 5CINL 3DSNA 4OKDA 4IHOA 4Z7UF 1UWEL 4OB5L 5IVZB 1P9MC 2DI9A 4P5TB 2OMNA 2VLRA 4NWUH 5GGQH 1A6TA 3F7PC 3ELAT 4LAQL 5GGRY 1A1MB 2VDNL 4H8WH 3QRGH 3VXQA 5E6IA 4NZDA 4YHKH 3RZCD 1CICB 3ZDYE 2P47B 1W0VB 1T1WB 4GO6B 5GJSL 2BCKB 3RVUC 2JIXA 3T4AB 5FM4A 2NW2B 2R2HB 3EFFA 3QUML 3MV9A 1KCSL 1RJYB 2VISA 1A64A 1AD0A 5FKAB 2F58L 5CJBA 3SJVA 4OZIE 4DK3A 5E4EC 2QADD 4ZS6C 1KF9B 5HGDB 2BFVH 2BOBA 4LLDA 5SX5K 5GRYA 2FX9H 3MLTA 4MA3A 4G9DA 3V4UH 2EYRB 4L29B 4PJAB 2MCPL 4L3CA 5DQDH 3BEWB 5HYSG 4O4YL 2W07A 3BZ4B 3G9VA 3Q5OA 4DOHB 5DHYA 5ADPL 1WFUA 1MHCA 1UXWA 1YC7A 1RZJL 3FO0L 2X40A 2IADB 1CICC 2XA8L 5CKGA 4ZXBB 3RTQD 3TV3L 1JPGA 4AT6A 3N50A 2YKLL 3LN4A 4WU5B 1I9JH 2D03L 1FFOB 5JMOC 5J1SC 1NMAH 3H9ZA 2XKNB 4UZGA 4X99A 3SQOH 1ZHLB 5I8EB 4ZXBA 4KRPC 3VRIB 5I2IA 1CFQB 4L9DA 3VXUA 3MGOA 4Q0XH 4KH2A 1F58L 5D5MA 1YUHB 2DM2A 1P84J 1RJZB 1BAFL 5KOVC 4XVTL 4AIXA 1T5XB 3LQAH 5EFIB 1NFDE 1RIVH 1NCNA 3NIDE 1MWAH 5HHXH 1HQRA 1DLFL 2EDJA 3MRQB 2C3HA 4D9QD 1S3KL 1RZ8B 4OFDA 4D0BB 4D9LL 4L8BB 5JR1H 3JWDC 2BK8A 2AKRB 4G8EB 3DMMA 3QR2A 3ZT5A 4LIQE 4LHUD 3QEQE 3STLB 3HCVB 5L2KE 2CDFB 3NIFE 3E1F1 2F5BL 3DX6B 3MV7B 4PJDF 2C1OA 2FBOJ 3PHQA 4GMSH 4OGZA 5F7FA 3U7YH 3P9MA 4WUUB 2G5BA 5FUZH 4Z7NE 3GSUA 2XQYG 3FT3A 1T5WA 4XNMA 5IG7A 5HYJE 1CL7H 5D7SL 5FYJE 2XICA 4WEMB 4XWGL 4U6TA 4FQXB 4LIQH 1N3NA 4HKZA 5C8JB 4MVBC 3VGDA 1KCKA 4V1DA 4QXWA 3W0WE 5ELIA 3O11A 5IVXB 4I2XE 4XBGA 1NAKL 5T1LB 1ZLVH 2Y07L 3MLRH 3IDYC 1DQTA 1K3ZA 4Z8FL 3BGFC 5K9KA 2FATH 2D0GA 3VXSB 5C6WH 3S6CA 3CFJB 3JVGC 3PDDA 1VADB 2XWTB 3ULVE 1DBML 1HEZB 4FQCL 1Q0XH 5M94B 3RWDA 3BO8A 4NZTL 4IRJC 4LU5L 3QEHA 2H2PD 2DMCA 2F5AH 3V52L 5EOCH 2UZYB 4IIQC 5DVLA 3OGOE 1HQ4A 5IV2B 1UACH 1OCWH 2V5TA 4YWGL 4JFZH 2B1HL 4MJIB 4KU1A 4Y5YA 1EJ6A 3OWEA 5I8OL 1RHHA 4X5LA 3PDOB 2CRIA 1OAKH 1HZHH 2EDEA 4NHUA 4WI9A 1MCSA 3FRPA 2Q1EA 1QYGL 4FTVE 3VGHA 4AEIL 4G9FE 3L5XH 3IFNH 2ITDA 5GGVH 4KI5D 4KJPD 5INDA 3I9GH 4ZSOA 3SGJA 1EDQA 4HT1H 3OKEA 3PABB 2O5YH 1FG2A 2E3VA 5DVNA 2EYRA 2P5EA 3BJLA 4HJJL 1ZLWK 1ZHNB 1EAJA 2MCG1 3TA3B 1GAFH 2BSSA 2E7MA 1AIFB 2GUOA 1CLYL 3VFSA 3KPSB 5F7WC 4PRDB 4I0PA 5BO1L 1YPZF 3BP7B 4Z7UE 3T3MF 4LCYA 5KVEL 1VFUA 5FKAA 3BAEL 1NFDF 1BD2A 1ZT7B 1GGYA 2DLFH 2GJZA 4UIMB 2NX5D 3F7QA 1QFHA 3V5KB 3VJ6B 1FBIH 1F6LL 4RQQA 2CKBL 2VQ1B 3SE3C 1WUNT 3PHOA 3RP1A 3GMPA 5DRXA 3C5SB 5HHPB 4U0RB 3V7AG 1RZKC 3HPLB 4JZNB 4XP6L 1ITCA 2VZ3A 1MQ8A 1U42A 4K8RH 4YX2L 3CUPB 2PO6D 3WHE1 2PTUA 3CD4A 3QZWG 5AZEH 5C0JA 3ULUD 1H3TA 1CK0L 2ZKHL 4LPCA 5B4MC 4FQ2H 2A77H 2GSGB 4CVXA 1DQJB 1UJ3B 2V2TB 4NO3A 5EO1A 1U8MB 1H3UA 4TNVF 3DX7A 4NRXB 3T8XA 2ZUYA 3T09A 1IM9A 3GSXB 3UJJL 5IB3B 2EYTA 1MLBB 3EYFB 1TZHB 1S7WA 5B38B 4RMVA 3CH8A 1HILB 4JFED 1AGBB 1Z9MA 3BYTA 1Y0LA 5DR5H 4WO4B 3FRUA 1OWWA 1WC7A 3B83A 4F37F 3WFCL 2AEPH 3F58H 1O0VA 5IGXH 3T2QA 5DGRA 3LKQB 4HKZB 1MNUL 4PRHB 3V0VB 2IAND 4OFYD 5D72H 4XXDA 5C0BA 4Z76A 2C9AA 1DL7H 4MSWA 1DSFH 4NDMB 4QEGA 3D6GA 4HLZG 4M1DL 3D69A 5DJ8A 4ZTPH 5JOEA 3KYOB 2RIKA 2R0KL 3GMLB 2Z9TA 4LPWA 3LSOB 4XCCH 4YR6A 1IAKB 5FYJH 4PRIE 1IC4L 1CBVH 2FIKB 3GIVA 4PGEA 2ICEB 3OB8A 3UYRL 2DN7A 2D0FA 4WY7L 1S7RA 2AJZA 1UH4A 4N0UA 3BIKA 4XP1H 3EFDH 4M61A 2VXQL 1J12A 4MJ2A 2GFBB 3O8XA 2AAVA 3OR6B 2ZWLT 3CVHL 2E7LC 2DLEA 4LHUB 3MRIB 4HUVA 1X5HA 5C0GA 1YYMH 3HE6B 1CDJA 2VLKB 3IU3B 3VXTB 1LK2A 5DR5L 4LCUB 1H15A 1HSAA 2ICWA 3CH1A 3DYOA 1NC2D 2FX8L 1VFOA 1O7SA 2PO6B 3MGTA 4ELMA 2H2PC 5AUMB 1JN6A 1NBVL 3REVB 2AXGB 4PB0H 1NLDL 1WFTA 1OSZA 3WN5B 3F7VA 3BQUC 4TVPE 1JUFB 3MLVL 3LPWA 43C9A 3VFOB 1G7JA 1U6AH 1C12B 5C0AE 4PGZA 5JR1L 4Y88A 4LKXA 3GJEA 4WO4C 1V3LA 4KK9C 5CCKH 4OCNC 4Y89A 4JQVA 2AABL 1K4DA 5DJXA 2CJUL 4Z77A 3FQXA 4X83A 4LLDB 4HCRA 1U8JB 2PKDA 4EDWL 1GC1H 3X14B 5F7UA 4MCZB 4TSAL 1IKNC 1P7KA 2EKSA 1GGBL 3MODH 1KC5L 3TT1L 1NBYB 5E9DB 2CO6B 1OTUD 5C08E 5KS9A 1ZGLB 1L9MA 4ZUUA 2ITCA 3K1DA 3QDHA 1WBZA 4OLXH 4Y8DC 1DBKL 4ONFL 1ZHKB 1XZ0A 4UDUA 3BKYL 4P5MA 4TVPH 5IBTL 2BMKA 2ZOLA 4CL7A 5DD0H 2IPTL 4S1QH 3QUZC 4ZUVB 2Y36H 2VDKH 1ZA3A 2QADC 2R56H 4ENED 2R0LL 3PV7A 5DTFA 5DZNA 4XP4L 1EK3A 5GS0H 5L2JB 2DQFB 1KCVH 2DQJH 4GH7B 1A6ZB 2BFVL 5L8KB 4Q9RL 3I6GB 5JDSA 3JSSA 1HHKA 1TVHB 2OZ4L 1T22A 2VITB 5KVFL 3UBXG 3GBLA 4NQSA 1U3HB 3CDGA 1B4RA 1U3HA 3CDGB 3RKDD 4KKCC 4YDKH 5HD8D 5CD3B 2X4UA 4ZUTB 4OZGE 1R3LB 4WTZG 4MD0B 2DWEB 5BJTB 1UFUA 3SJVD 3O6FB 3L7FB 4LDOB 5CILH 1FHGA 1JK8A 4YHOL 4JAMB 3JWOL 43CAB 2V5MA 4TSBH 1NKOA 4PRNA 1AQKL 1D6EA 2E5EA 4QHMA 1QRNE 2DDQL 4GG8A 5EBMA 5EBMB 3M1BA 4QRPD 4XHJD 5FYJU 2NY1D 5T5FH 1KPVA 1KLGA 1LEIA 3B9DA 4YFDB 4HIXH 1XFPA 4ODUA 1GHFL 3GK8L 3LQAL 3UXFA 5FUCE 5I73C 5JIIA 2DM7A 1UADC 1S9YB 3TZVB 4U1KA 1WITA 4RISL 4PYHA 1GGTA 5DUML 1CN4A 1MCWM 2G2RA 3MA9H 4D3CH 4PB9L 4L4VD 4WW2A 4RAHA 4XCCL 1XH3A 4P3DA 5FK9B 5FF6B 1WZ1H 1HIML 2F19H 4PJCF 2CGRL 2DMKA 3N9GL 5KW9L 3HFMH 4R97C 4QNPF 4K55A 1LO0L 2PYFB 4Y16B 3ESVF 3T1FA 4L3EA 3FB5A 1D9KD 3WE6B 3BP4A 4HFWB 2P49B 5B21A 5E0QA 2J8OA 3G5YA 1J0ZA 5TQ2L 2NY2D 4Z7NF 1FP5A 5BOZG 5TGBA 3U79A 1OTTD 5IQ9B 1E6JH 1OSZB 1QSZA 2OZ4H 4M93C 3WN5A 5FUOL 4HSQA 2CK0H 2EDWA 4PGBB 1VEMA 4KMLB 3O2WL 2R0WL 2R4RH 5DRWA 5GZND 2H1PH 4HBCL 3DYMA 2FEDD 4P4RA 4C56E 1PZ5B 1NGZA 2GITB 3GMOA 2EEAA 3CH1B 1AO7E 1EERB 2DQHH 3C09C 4RFEA 1FCCA 4ZOAA 3QA3B 5C08B 4L3EB 5JPMB 4OIIL 4CNIA 1EAPB 3QEUA 3MLZL 1SBBA 5EU7C 1ZVYA 5HY9A 3MLYL 1KBGL 3NH7H 3MV11 3QWOB 5FM8A 5I1AB 3U9PL 4PUBH 1OF2B 3HI5H 5CEXB 4EUPH 4LAQH 4GRMA 3RL2B 1FFPB 2VLME 5INDB 5FGCB 4P23A 3Q5YA 5F1SA 1ZK9A 4HCRH 1AGCA 2XN9D 3CSYB 4LSSH 4R97B 1KNOB 1OAXL 4LRIC 5EBLB 1T66C 5T1KD 1JPTH 3L3GA 2P5WA 4YWGH 4OGXL 1LD9A 4KRPB 1SEQH 4OQTA 3Q2CA 3ARQA 4OM0L 4PRPB 1TVDA 5JTWA 2GY5A 3DV4A 3FO2B 3MRPA 4FTVB 1F8TH 1U58A 3M8OH 4LEXH 4ENEC 2DQUL 3D3VA 4F57L 3NACL 5CCKL 5CJ8A 5T3ZE 4ZXBC 5AWNL 5DEFB 5JZ7D 4AMKL 1GOHA 3K74B 2MQCA 15C8H 1MFCH 5IB4A 1CCZA 1F2XK 3G5XB 5IW3A 3D2UB 4IRZL 3UJTL 3QXUA 5MI0C 2FB4L 5SWZE 3MJ9A 1NMBL 4JFFB 4PJXE 1R3LA 2AI0L 5DEZA 4HK3J 2A74B 3BWAB 4NOBA 4YPJA 3RDTA 4M62L 3MMEB 1XGPA 1CLZL 3L5HA 1IFHH 4NO3B 5EO1B 1MCFA 4J6RL 3WIIL 1DQJA 5FFLA 3TJEH 1JTOA 1KB5A 3O11B 7FABL 5I16B 5IVXA 5EU4A 3BT2H 3IJSB 1MCNA 1U93A 1WBXA 3ILPA 4ODBD 4BELD 3WXWL 3WBDA 1VENA 1KN4H 1BLNA 1P4LB 5A2KH 4ZO6A 2FWOB 5AD0B 2GCYA 4PJHE 3TEUA 4PRHA 3GSUB 4PD4K 4TOYH 5I17B 1ZLSH 3TO4B 3QHZH 2FLRT 3IS1X 2ZPKH 2VIRB 4ZPTA 4X9BA 2OM5A 2QSTA 3LKRB 3KLHC 2Z31D 4H88H 2X7LA 3SE8H 3OJVC 4HGWB 3AS3A 4TSCL 1F4HA 2IJ0C 3MRDB 4NQCB 5DHVB 3CX5K 4WWKB 4HHAB 5D1XB 4PRHD 4PJBA 3OR7A 2XWBB 3HRPA 3HAEH 3O41B 5DD0L 2P46B 1RZKL 3IXTB 1HKLH 5J3HD 4HH8A 4ORGA 5TH2B 2VRAA 2NZ9C 4U2YA 4XP9H 1VSCA 1JFQH 3H7BA 3RAJL 1YNKL 3TH2T 1J11A 1F02I 5DVMA 3PL6B 4Y4HB 4JM2B 4NNXB 3SDDC 2EDXA 1GRWA 4NZJA 4J3UA 3HS0B 4GG6A 4OAWA 5DQJA 5EU6D 1H15B 2ICWB 3WFBH 3MCKB 5KSBA 5SX4I 1Z0NA 5SX5H 2JJSA 1Z9LA 3TIEA 1G7LA 2Z0BA 3EDFA 3TVMD 5C0DA 3DTXA 3OKEB 3PABA 4APQD 4ETQB 4JFEA 4QXTB 3FMGL 1MFBL 3ARRA 2DM3A 4NO5A 1U8PA 2ZJSH 3HMXH 2NY6D 3VFMB 1NEUA 1S7TB 2ZOKB 4NN7B 3HUJA 4Q2ZB 5EO9A 2V9TA 4PV9A 2R0WH 5E8OB 2O5XL 1NC2B 4RIRA 4GQ9L 3DNKA 1EXUB 3KPPB 3KG5A 1KB5H 5TDNA 4KV5F 3NVQA 3AY4C 1S5HB 5DVKA 5L8JB 4Z7VB 2AXFA 4NN5B 2D31B 4M7KH 4MDJA 5BW7A 1TLKA 3HNVL 3JTTA 3AFLA 5ACZA 1II4E 3MTRA 3V6OE 4PJ9A 3WD5H 3BEVA 2W65B 1MI5E 2P45B 3OBAA 5A40E 3VD9A 4IDLA 1P4BH 3CFKB 3AAZA 3HI1B 4UNUA 2F19L 3PJSA 3DGGB 3MRLB 3QG6B 1BBDH 2F58H 5E5MB 3S8WA 2R2BA 4OF5A 3FN0H 4KY1H 1QLFA 1KYOK 1LDPH 4ZOEA 3MBEC 4OZFB 3VI4E 3UTTE 3VH8A 1T83C 3EJZC 5CS7A 3VI3E 3F58L 3I02B 3PWJB 4QRQA 1HINH 1U92B 5ABDE 4ZDHA 4R2GB 1T5WB 5DD3H 5FO9A 4M93B 3WHXA 4LCCB 3RNKA 5DHVH 3OAZK 4CDGC 4QOKE 4MNHB 5CMAA 2UUDK 4WI3A 1EVTC 2A83B 1FIGH 5DJYB 3WNOA 3EYOB 1T6WA 4KVCL 4HLJA 4Q58C 1LO4L 1OOAA 4FQ1L 4ZUWB 4CAGA 2X4SB 3OXSB 4F7TB 4NKOA 1N5AB 1YY8A 4K7PL 1A3LH 3HC0A 4OLZL 4ZFFA 3FN9A 1VGKB 3FCTB 4D0DB 3FQUB 3H3PH 4Q9RH 2QSVA 1N64H 4XAKE 4PJBB 4ODWA 1HHIA 1GOGA 5CBAA 3DWTA 4JRXB 5I1CH 2B2XH 3KPMB 4B7IA 1MI5D 1DFBH 1U95B 3FFCD 4P23D 4X7FC 3DXAD 1TETH 3QZWB 1YECH 3UAJC 3SDAA 3HG1E 3QUYC 4OGYH 4ZO8A 4XNUL 4NO2B 3S34L 1ZVSB 3BD3A 4O58L 5AZ2H 1LVEA 5F1OB 1P4BL 1MFCL 2CLZA 3EAKA 3QXDB 4L8SA 4F33A 3EFFB 4MNGA 1F3JA 1TDQA 4JCMA 5E2WH 2YA0A 1N8ZB 3D3VE 3P4OB 4OLUL 1YYLL 3REVA 3RUGA 3S36X 5MENB 2NY5C 3MJ9L 1I75A 1U0QA 1AHWC 3MNWB 4UBDC 2PO6A 4ELMB 3G5YB 5IHLB 1PLGL 4PR5A 5C07B 4FABL 2RFXB 5DMIH 5EZJA 4CVUA 3QPQC 4DN4H 1T0PB 3LH2H 1JVKA 4MNQA 5IT2H 2J1KA 4XRCA 3C60D 3IJYA 1HHHB 3ZKXB 1VFBB 3TYGL 2VLKD 3O0RL 1ZKAA 4FQJL 4MQTB 4QT5B 1F11B 4JANB 3WS3A 4CU7A 5IEKB 3TJEL 3TWCL 4TUJA 4PJAE 4FQIL 4NUJB 4OM1H 3P2TA 2VUOA 3RTQA 3RAJH 2E9IA 2J88H 4K8RC 4MD5A 2D9QB 1HWGB 4I4WB 4Q9QL 2OQJA 4MNQD 4X4XA 3D25B 5HYJB 3OHXA 3TVMA 4YXHH 5D1QD 2QHRL 5D8JH 1MHPL 5A2FA 1WGOA 3BPNC 4HUMB 1UKQA 2KKQA 3O3BB 3QPXL 4P2OB 3CZJA 5C0FA 3VFWA 4OF8A 2HRPH 3QEQB 5D71H 1DVFD 1WLHA 4JAMA 2K9UA 3NFSL 1RJCA 2CDFA 3GM0A 3L1OL 1CDUA 1QLFB 4DGYH 3ZL4L 3ISWA 3RIFK 4Q6IB 4WENB 2R2BB 1HKLL 2HVJA 1GIGH 4KFZC 4K3JL 5IJKA 3D0LB 2J6EH 2ICWJ 5T1MB 1J0HA 4Y5YC 3WV0A 2ZUUA 3OF6D 3GBML 2NY5L 2J5LC 4XCFH 3KYAA 1HWHB 1HQRB 1OAYH 2XZZA 4YAQA 4YHYC 3UZQA 4IS6B 2IFFH 2YPLA 4H26B 4HX1A 3BX7C 3HZVB 4G8GE 1RIUL 3MRJB 4HIHA 3WFZA 4HWEL 4K2UL 4OCLC 3TP4A 1ADQA 3V4VH 1XGQB 5D7IB 3TO2B 1P5VA 1ZLUK 2AK1L 2BDNH 2VR9A 5JNYA 4KRLB 3SKJH 1RUKL 2EXYD 1CGYA 5FYLL 1T21A 2W60A 4Y2DB 1YMMA 1GZQB 4JKPL 4WHCA 3O2DH 5JHLL 3FB5B 2BVOB 4Z78B 5GGRA 4AM0A 1IAMA 3M17B 4MAYA 3I3BA 1BF2A 1E4KA 1VFMA 4ODWB 2NXYD 4TTDD 4KV5E 4EIGB 1B0RA 3MO1B 3HFML 1V3MA 4NM4H 3NFNB 4KMQA 2J6EL 1UA6L 4O51B 2VLJE 1P69B 3GJEB 4U1MA 3U83A 1NUFA 1DE4B 4U1HB 1AD0B 1KEGH 2W60B 4Y2DA 3S37X 1IGYA 5FV1L 4ZAKD 4IOIB 5DO2D 4O00A 3HNTH 3MQIA 4X99B 2QR0A 1GGCH 3U2SA 2GW5A 4AH2B 1JMXA 4LQFL 4DTGH 1BJ1J 2EDNA 1FVCA 5I1LB 1FYTB 3RWHA 5EOTB 2E7BA 4OCSH 4H0GA 2ZSWA 5DXWA 4DW2H 4A6YA 1S7VB 1HQ4B 1WZMA 5IIEA 4ZYKA 1ZEAH 4FQQB 1M1SA 1T1XB 1B9ZA 4ZO9A 5T3XL 5I6XC 2IBZY 4F3FB 1S9WA 1CZ8L 1W0WA 4L9LC 3IDMB 1QO3A 1TCMA 3LKPB 1Q0YL 5JW4N 4DN3H 2O61B 3OJMB 4M4PA 1JHKL 1TZGL 4KUCD 1SVZA 1I7UA 2Z31B 3VDAA 2GHWB 1RIVL 2ZSVB 1DJSA 3V9FA 4PIRF 3RIAF 2NX5A 4KRMB 4RDQF 4M6ML 1UVQA 3K8KA 2X4QB 3VA2C 2J8UB 1LEKB 1PW3A 2J8HA 4R6UA 1ADQL 2EYSB 4K9EH 5CJXC 3W9DB 3GSVA 4YFLF 5D1ZC 4RMRA 1ZGLM 5KW9H 5D2NE 2MSPA 1SEBB 2LVEA 1J8HE 3RVWD 2DJ4A 3GSRA 4RBPK 2BMKB 2ZOLB 4K3DH 2C4FU 3WXVH 1DQLL 5F89B 4JDTL 3LKSA 2AEWA 1WK0A 2GQHA 4X8JB 5FGBA 2NXZD 4U2ZA 3X12A 4JM4H 4UV7L 4PBWD 3UPCA 2B20A 1HNGA 4C55A 2ID5A 1Y0LB 5H35A 1VEOA 1ZTXL 1FYHB 5I6XB 1S7WB 1V3KA 1TZHA 4N68A 3V4UL 1YDPA 4UQ3A 1KPRA 1GGIH 3TA3C 1NGYA 5FA4A 5IJVA 1BBJA 3LAFA 5HGBB 5CD5D 4GKZA 1IZJA 3MRCB 4O9HH 1RIHL 2NY3B 2J6EA 3QG7H 4W4NA 1I3RB 4L4JA 5JO5A 4G5ZL 2XI9A 5E8NB 3FOLA 3ALPA 1CFNA 4QF1B 2F53E 1QLRB 1FORL 2H45A 1FL3A 3CFDB 25C8L 3HLAA 4LPYA 2CIKA 3L5WA 4F7MB 4MNGE 1IGCH 3QDJB 1JHTA 1T21B 2X09A 4BKLA 2A6JB 1NGQH 3ET9F 5J3HC 5DT1H 4N5UA 4X6CF 1LO3L 3RPIB 2X1QA 1M7DA 4OCYH 1CD1A 4F7PB 2F53B 2YRLA 2DLGA 2Z35B 4NRYB 1BM3H 4NC2B 1F90L 4OLEA 3WIIH 2R69L 1JI1A 4RMTA 3WFCH 3HLAB 4RWYH 4O51A 3QI9B 2Y5EA 4WFFE 3C08H 1E6OL 3X13B 1B0RB 5L7XL 3E6FB 4GLRI 2AK4D 4ZFZA 3EGSA 1JJUA 4DZ8B 4YPGB 1NCDH 4Z7VF 1FPTH 3MYJB 4R8WL 5HYIA 2Z92B 2ZUWA 3QIUB 4KKBD 4G6AD 1A7PL 3D9AL 4WI8A 1NUDA 2ATKA 5FXCH 1IM3A 2GJ6D 4XPFL 1DLHB 5ICYB 5FUOH 1UGNA 1PY9A 1EEUA 1FLRL 3ZHDA 1ORSB 4G8FA 4OBRA 3OG6B 5F21B 3LS4H 3D3VD 4GKSB 2VO5A 3IFOB 4KK8D 2AJXL 4W81A 4YUEL 2UZXB 4WNQB 4OI9A 4JO1L 1GIGL 3TBTA 1RFDL 5LCVH 2BVEA 1SHMA 4KI5C 3B5GA 3RDTD 3CK0H 3R0NA 3DBXA 3HZYB 5CIPH 3L9RA 1P7HL 3IAPA 1VB9A 4UTBL 3ARTA 4J3XA 1WT5C 3VFRA 4YJZL 2R2EA 1OAXH 2EYTB 3IGAB 1AJ7L 1CDIA 1IGML 2ZSVA 3U4BL 1XCQB 2C4FT 3TIDA 2VR5A 2HTLC 2DBJA 2IG2L 1HOCB 3SKOA 5DJAA 1BQHB 5DFWH 2E8ZA 2AK1H 3PWLB 4YC2C 4FQ2L 2BNUA 1SJVA 4RGMB 5BZDB 5HXMA 2VDLL 1QR1A 3LKSB 1TJIH 2P5WD 3QEQA 2HN7A 5L6YL 3MLSL 2FO4A 1BFOA 4UBDD 2CKNA 4IJ3B 3JWNC 2OTUA 4BZ1L 4P48A 1FNGA 1J0IA 3HHRB 1D5BA 3VFNA 1YNKH 5HGGS 1LEKA 1T4KB 4LEOB 1OLLA 1PD6A 3QCVH 3SKMA 1SYSA 4PJGB 4DN4L 1HDMA 4S1SH 4QRRE 1BJMA 4R0LC 5E1AA 3BZEB 4JRYA 2VE6B 4FZ8L 3BZDA 2MPAL 1W2KT 2C26A 4QOKA 3TJHD 1NCAH 1NGPL 4OD2A 4JDVA 3GUTB 2FJGB 1PGRB 5J12C 2AJ3A 4F7EA 3DJ9A 5I18H 3O2VL 3AS2A 4E41D 3H3BC 4HQQH 1WAAF 2JELH 5TF1H 2YPVH 1G0DA 3TN0B 1U6AL 3MUJA 1AY1L 2E27H 3UROR 5HPMA 5SWZD 5KS9E 2K1MA 1T1YA 4FOMA 5J11C 3U4EB 1GZQA 1X7QB 4JY6A 3NFPA 3QUYB 5DK2A 4RAUB 1MCOH 4TRPL 2GY7B 3GHEL 4Z7WA 1DDHB 2YC1A 5C0RL 3UTZA 4OCXH 4EI6B 2A83A 1UB6B 2FD6H 2BSTB 3MCLL 1J05A 1T20A 4QXUL 3QDJA 3MRJA 1KB5L 4HIHB 3IDXL 3VW3H 2LVCA 3VRLF 3QIWC 3MRKA 3GMRB 4LLUB 5EOCL 3BE1L 4QRRA 3GJFH 1CFSA 2BJMH 3HPJA 2PUQT 4UV4H 1HINL 3BD4A 1IE5A 4PTUB 1IC5L 3TBVB 4HUUA 5F9AC 3WCYA 4JFDE 4N8VA 5ERWB 4DGVH 4X80H 3DVGB 3FQUA 5DEGA 1Q72L 2FGWH 5FYJD 4O2FA 2IH1B 1MLCA 5DJ2A 5FYKL 3GSNB 1CF8H 4B0MM 4ERSL 2B4CL 5E70A 5ECJE 4KKLC 1C12A 2R4SH 3OX8A 3AS1A 1TNMA 2ZCKH 2VUYA 1DSFL 4XPAL 5GGVL 1IRAY 1EEZA 5SWSB 4Y16D 1A47A 1SMOA 1T1WA 3C2AL 4PGCA 4WFGD 4BYHA 3FB6A 1E4WH 4U49A 2O5ZH 4Y4FA 4RCAA 1XGYL 4LLWB 3BW9A 3D85A 4XNQA 1B4JH 5C0IB 4BH7B 2GK0B 5IMMB 5DFTA 1X5GA 4LHJB 3HC4L 1M7IB 5HYEA 5EC1B 2VXQH 3C6SB 4NCC1 4XCEA 1DBKH 4ONFH 1BD2D 4YDIL 4MJ6B 4AIZA 5KZCD 3VI4F 3EYQD 5K9OB 1BFVH 1A6AA 1T89A 5FECB 1DUZB 3ZDXF 1G7MB 1S7TA 2ZOKA 4JN2A 5CD3A 4UV4L 1BOYA 5E2WL 5FECA 4OCMC 5F72S 4IRSA 4D0BA 2E8YA 4N8PA 2X4RA 4MZ2A 5HDBF 1C5BL 1OTUC 1LP9B 2VDRL 4X6EB 2DQFA 4HC1L 1N6QH 5DMIL 5IB4B 5TQ0L 5DEFA 4M5ZH 3S3PA 2ARJB 2NY4D 3BE1H 1KIQB 3D3VB 1J0YA 4GXUN 4B41A 1S5HA 2AQ2A 2ZCLH 4X6BA 2P8LA 1FNFA 1P4IL 3P0VH 4OCSL 4XMLH 3U0WH 3MREA 3S3SA 3RL1B 1IAII 4C56A 1KJMB 4YNYB 4BQ8A 1LE9B 1DN0B 2OTPA 4OZIF 1G7IB 2YKLH 2YUVA 3KYMA 2XZCL 3GKZA 1UZ8B 3WUWA 3ROOB 1FAIH 4Y2OA 1LP9E 3V7AE 2IPUG 2FBJL 1KSRA 3PWVA 4HWBL 4U6VL 4JFPB 3R1GL 5F1IA 3RKDC 3X3GL 1BZ7B 2X4TB 1CVRA 2XZQH 1VPOH 1QBBA 1ZS8A 1FJ1A 4ODXA 5DJ6B 4QRPA 2CLRA 1B2WH 2VTFA 2HT4D 3SDDB 5EIIB 5ID1A 4Q6YA 4ODXB 2YD7A 3WD5L 2MTPA 3VWKD 3RWJA 4PB9H 5D1XD 4G6KL 3DURB 4MQXC 1K9TA 3CLEH 2RR3A 1MUJA 4AENA 3FO9A 5D9SA 1IGTB 1I8MB 3HR5A 2J8UF 4J3TA 5T33L 2M26A 3WDIA 3ETBF 4RRPA 2HH0H 3WXWH 3QDME 4KY1L 2BZDA 1S7XA 1QFPA 3EYOA 1QKZH 5DJYA 1EEYA 1M7XA 4XNXL 1G9NH 3SDAB 3NFPB 1ZLSL 1ES0A 2WWKT 5D1ZB 3SE4A 2FWOA 1RK0B 1D3CA 4S1DC 5EUKB 4UV7H 2VSDA 4M43L 2V2WA 2KQNA 5JXAL 4DKFL 5LG1A 2N1KA 5SWQA 3BN9C 1OY3B 1RZFL 5HVGB 5E7FA 1MQKH 4JQIH 4ZSOB 3LDBB 1ZAGA 1EHNA 1I1YB 4JFDB 3WEXA 2P48B 1D9KC 3V8OA 5GRUL 4AMKH 1YJDH 4NQVB 2MHAA 2X89A 4RBPH 4HKJA 1EO5A 2VLLB 4L8SC 5IMLB 4YBQD 4HMCA 4Z7VE 3NIGE 2XQYK 2VABB 4LCIL 2FYYB 5GJSH 2V5SA 5FGBC 4MHHI 3QDMA 4DW2L 5GJTH 5D7JA 5GRXG 4YLQT 5SWSD 4DQOH 2IEPA 3QRGL 3ZKQD 3AVEA 1TNNA 4LSSL 4N5EC 2DQCH 3EO9L 4JZJA 1IM9D 2CSPA 2EKJA 2NZIA 4PJHB 1UEYA 5B39G 2B1AH 2P5EE 2WNGA 4OIBA 1FN4B 4P46D 3QEGL 1X5ZA 2F54D 1KEGL 2A1WL 1RURH 5EU6B 4MD5B 2FATL 3NA9L 3DECA 3NPSC 4HJGA 5E2VH 3DGGA 3MRLA 2OTUB 3AB0B 3QG6A 4LQFH 4AJ0A 4DTGL 3AB0C 1WTGT 4KZDH 1MQKL 3VFRB 4J3WA 3ZSTA 1CU4L 3PP4H 3IAGC 5I1CL 2NPLX 1R5IA 3O2WH 3RU8H 4JFFE 2ED8A 3JTTB 4M43H 5L0QB 1FFQA 4WW2C 4WUUD 3G6JF 1IQDB 4IRJD 4L3ED 3EOAB 1FRGL 4KZEH 1I1AB 3PGCA 1M71A 5FUCC 3TV3H 1B3JA 3MBXH 1KT2A 3FKUS 1QA9B 3BWUC 5A3IC 1A5FH 5IHBA 1OAKL 3ZE0F 3DI2B 5BMFH 4I77H 1RFDH 4J3OC 4AK1A 4NNPL 1BQSA 5EO0B 5BVPH 2HVKA 2I07B 4EN3A 2Y72A 1OGAB 1FZJA 4U7KA 3RWJB 1OAYL 3SCMA 3VWJB 3TBSB 3LDBC 3HAEG 4HIIA 3V0WH 3GMNA 3MFFB 3GMQB 4KAQL 5HYSA 3QO0A 4FFZL 5KTEL 4OFVA 4LCWD 4PREA 1NJ9A 3AS0A 3PP4L 3UZVB 3VWKC 2A73B 4ELKA 5D7SH 3QUXB 3QIWA 4X5WA 5K33A 2VAJA 1CLZH 1LE5B 3MROA 3PWPE 5DGQA 4P9MH 4OFKA 4AL8L 5FUZL 2A6KA 1QBAA 2NY4C 4U6VH 4L8CA 4Z0BH 1X7QA 4JY6B 1Z5LA 1XCTA 4HFWA 3KPOB 4LSUH 3O41A 4LLMB 4P5KB 1IL1A 2BNRD 4OCWH 2MOVA 4YBHA 1WV7T 3DROB 3VGBA 4DCQB 3RWDB 3I84A 1MRDH 3U6RA 4HC1H 4WI4A 4P3DB 5FK9A 1WIUA 3IJHA 3S36H 3BT2L 1RVFL 3AM8A 3B43A 3SJVB 3B2VH 1KG0B 5K9KB 2CDGB 2VLJA 5HGAB 3RWFB 3T4AA 1DCLA 4BQ6A 2EZ0C 5DQ9B 3L3IA 5CWSB 5E95B 1ZANH 5CEZH 5DZLA 3LQMA 4V1DE 2QKIA 3W0WA 2DQIL 4UTAL 1M4KA 4BZ2H 3VXRA 2WIIB 3MR9B 3SQOL 4E42B 1C16A 5DHXB 1U3HC 3O45B 1F58H 3KS0J 1IAIL 1IGIH 1V7NL 4ZO7A 1ZA6A 4J2XA 4GQ9H 2KPNA 4NKIH 4R7NB 2SEBA 3HC3H 4IRSB 2P8PA 5DJ0B 3S34H 4OZGF 3IDIB 2DQCL 2EKSB 2AKRA 4XWOD 4RGND 1UXSB 1WWWX 4HXBL 5F89A 1OVZA 3TYGH 3QUZB 1YNLH 1A9EB 3RL2A 3MLWH 3UJIL 5T33H 3C6SA 4XCEB 1HE7A 1Q72H 4PY7B 3HN3A 2Z8RA 1R3KB 3L3HA 4XTRD 4XZUB 4FABH 1AR2A 4C58B 2OR9H 4K3EH 4LSDA 5E2VL 1T5XA 4K7FA 2JTDA 4EUPG 1Q1JL 3ALXA 1WFNA 1NFKA 1ZT4A 3P9LB 4RX4A 5DD1H 4P4KC 1VCAA 1Q8MA 4JM2F 5FB8A 3ZKMD 1ONQA 1J8HA 3U0TA 3QJFA 2HLAB 2Q8BL 5F96L 5JW5A 3J7HA 4OZ4B 4F8TA 4BM7A 2CLVB 4CGTA 2FHBA 5FKPB 4JGUA 2ZNXA 5IR1A 3I85A 4GRLA 4IBLT 4WHYG 3ARSA 4PP2B 3DXAE 4TULH 4UAOC 3P0YH 3KPOA 1KN4L 2QEJA 5CBEB 2XXCB 5JO5B 2H8PA 5C0CA 1PEZA 5IQ7H 3Q6GL 25C8H 2YUZA 1XF3B 3M17A 4QRPB 3SBWC 3F7YB 1B6DA 1UCTA 3ZMRA 5F1IB 3EYUH 5LBSL 2ZUSA 1DQDL 5TQ0H 4XMKH 3KR3L 1FDLL 2W9EL 2HKFL 1GHFH 5L88H 3Q1SL 4MB4A 3T0DA 5FAAA 3R8QA 4HIIB 4G42B 1JP5A 2OP4L 5INCB 2A6IB 2R0KH 2B1AL 1DP0A 3LIZH 2X4NA 1NCCH 3C8HA 4W70A 4MAYB 1VGEH 3ZYJA 5GGRB 3QFJA 1ZT1A 4TUKL 2VDOL 3VXMD 2C7UA 5B3JE 1MCKA 2PTTB 2IANB 4I48A 3L5JA 1JGDA 4IDJL 4DEPB 4MB5A 4EOWH 1GZPA 2D4FA 2PW1A 4QHKJ 1G7PB 4KHTL 3I50L 4LLVB 1KYOJ 1JNLL 5JW3H 3U0PA 2WBJA 1T83A 1NFDA 3UTPD 4BQBA 1FE8H 3RWFA 4LF3A 2A0LC 3VFPA 1C08B 2PYEB 3MRHA 1GYAA 2OL3A 1G84A 1XGRB 4CADB 4RFOH 4GFTB 2G5RA 4XPAH 1MY7A 2A6DA 2VXTL 4FZEH 3CPLB 5C92A 3VXPB 1HCFX 4NC0B 3K4DA 4D8PB 3L3DA 5I8KH 5MEOB 2KH2B 2RGSA 5I18L 3K46A 4PRIA 1K2DA 4JM2C 4JPVH 1UB5A 3ARGD 1EGJA 4PRAB 1EIBA 4PJFB 4HF5H 1G9MC 3P4NB 5IBLC 3WO3B 3EW3B 3MODL 4Y5XC 4D94A 2EDDA 4P5TC 1UJ3C 1CI5A 4UIMA 2B2XL 2VLRE 4MJ5B 2MJWA 1AXTH 2JCCE 2ZG2A 1MI5A 4EDWH 2FD6L 5CEZD 5IMKB 3HNTL 1T0MA 1YZZA 4NC1E 2Y5TB 1JE6A 2AJXH 3KYKL 4P23B 3HB3C 4EQ2A 4P2OA 1BJ1H 3EDEA 4GRLD 4MJ4A 1OAQL 1GGBH 3BP6A 3BPCB 1QSEA 1RU9H 3NGBB 4XBEH 3PNWB 1OT1A 2VDRH 3MRGB 5IB2A 5EA0H 5C0JB 5BRZD 2Q6WA 5T5NF 4ZUVA 3GI8H 4HKBB 3UPRB 1OQOA 3LV3A 3IKCB 4JB9L 4LCWE 3S97C 3MGOB 2AJUH 2DKUA 5FDWB 2ORBL 4EI5B 3L6FB 3BDYH 1FIEA 3W9EB 5KSVB 5JNYB 2BY2A 1JZ2A 2OL3L 4UT7L 4BUGA 1MRDL 5J9PA 4XCNA 5LXGL 1I7ZB 2IAMA 4JY4B 3H9SB 5DS8A 3KLAB 5JHDD 1IQDA 1UM5L 1A14L 2K3TA 3NAAH 4LKCB 2JJUA 2O5ZL 1FL3B 4QHLB 3QEHB 2IALB 2UWEF 3KGRA 1A9BB 4V2BA 3TGXA 2WZPD 4EVNB 2DQEH 4KTDH 1JF6A 3GUTA 1EEQA 2BRQA 3UYRH 2EIZA 1A2YA 4PG9A 4Y19A 2X89D 4HPYH 4YXKL 2WWKO 2JF1A 4G8IA 4NQEA 4X9HA 2HTKD 1BIHA 2AV7A 3D0LA 3T0WA 5D93C 1AGFA 2AV1B 1QNZH 5E56A 5IQ7L 3GIVB 1HYSC 1SYSB 4PJGA 1WT5A 4YDVB 3O3EB 4V1DB 2GTZB 4JRXA 3VRLE 3GGWA 4CKVX 4MNHA 1IKNA 4PRHE 1N3NB 2WINA 1R5WB 1S78C 2V2XA 4F57H 4YBQC 1PKQB 3JV6A 4OZGB 5I71B 4FMKA 4GG8B 5GS0C 2Q7NA 3HE6A 3FFDB 1NUGA 2VKXA 5C7XL 4IHOB 1P2CA 3OZ9H 5BRZB 3MV9E 3WKML 1S9KC 5BQ7B 1RZJH 1BM3L 3ULSA 5CP3A 2QSQA 1FV1B 1UM5H 1HXMA 2AP2A 4HAFA 5GGSA 3U1SL 3ARXA 3QQ3A 1YEEH 4WCYL 4E9LA 2MPAH 2N7AA 2OL3B 1C1EH 5CSBA 5C6TL 2NQCA 5IROC 1IILE 3THMH 1ODAA 5H2BA 3JV4A 1MRFL 5IEKA 3V4PL 2KBGA 2HG5B 4MWFA 5DYOA 1A7NL 1H3PL 3C09B 5I75B 1P2CB 4OLVH 3C5JA 4OT1H 1UWGL 3IXAA 5MEND 2ADGA 4FQJH 1IEAB 3GSRB 5ITFB 2VDQL 5IHZA 1GAFL 1H3VA 5DRZB 2APBA 5F9DC