3JV4B

Crystal structure of the dimerization domains p50 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
b'ASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 16
structure length 115
sequence length 115
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv4B00
4Y4FC 4DK3A 4HH9A 4MDJA 2ARWA 4X6FB 2AKRA 3PL6D 3U7YH 3FMGH 3RIAK 1TVDA 5I66A 3SCMC 1J88A 3N50A 1ZLUK 4E41E 1OLZA 4ZFGH 4MXQC 1MCSA 2BVUA 4RAVB 5J12C 3O3AA 5JXEC 1YY9C 5CSZA 4GH7B 5DFWH 1KLUB 3PE9A 5T3ZH 1SMOA 2YUXA 4OUOA 3FQTB 4KTEH 1QQDA 5I16B 2OTWB 2K3TA 4NQEE 3L3JA 1BJ8A 1XF2B 4LSVH 5D72H 4AQ1B 4ZAKC 4LEOA 2R8SH 1UJTA 2C3XA 1L0QA 3ARDD 3ARRA 3AY4C 2P8MB 3ROLB 3SE3C 2ZG2A 5GGRB 5DJCA 3T04D 3H9HA 3OJMB 1HH6A 1CXEA 3KS0H 3IDNB 2G60H 5AD0B 3MLWH 3CAFA 5FFLA 3B8YA 3CZJA 5EU5A 4GBXD 4G8FB 2IADA 3VXMA 3G5XB 5E6IA 5ICXB 2ZSWB 4NP4H 2GHWB 5AEAA 2GK0A 5C0ND 3EDEA 3OB8A 3PGCB 5E94A 1EHLL 1EHXA 4G6JH 4PJIA 4OI7A 4ELKB 4F9LA 2OQJA 4TTGA 1HQRA 2QBWA 1FZKB 4DVBB 5LCVL 4NQDB 2WUBH 1HSAB 1INQB 4Z95H 5FIEA 3JVGA 4X6FA 1N6VA 1YEDB 3DHMA 3BPOB 5DJ2B 4NHCL 3QR2A 3V6FB 1CF8H 4NKMA 1ZLVK 4JY6A 1OAKL 3BAEL 3FONB 4N9OB 3CUPB 2C4XA 3VWKB 1RULH 1G9NL 3GIZH 2VE6B 4KTDL 4I0CC 2J8UF 1J8KA 1KLUA 2BHYA 2DMKA 3D85B 2B1HL 4XBPB 5D7KE 5I16A 1VACB 3GJFB 4HF5H 4C83B 4TUOB 1AJ7L 3UBXG 3EKCA 1QNZH 2HT3C 1TMCB 4MXWH 3ZYJA 5T1MB 4MAYB 1OWRM 2P8MA 4LASL 4TVSa 3ROLA 1EEYB 4WWKA 2BRRH 5GGRA 1CVSC 5LXGH 1MPAL 2ZNXA 4X7FC 2LFGA 3IDNA 5AD0A 4LHUB 3KWWB 3P0YL 5DWUL 4ESKA 3QEUA 2NW3B 1FO0L 3PJSB 4G8FA 4L4VD 3G5XA 4RWHA 2ZSWA 1YMME 3O4LD 1PX3A 2EDHA 3PGCA 3FO1B 2DQCL 4GXUN 5MI0B 4Y4FB 2V17H 4ELKA 1I8LA 3ZHLA 5HYQA 5KZCB 2LU3A 3K4ZA 4DVBA 4NQDA 3BN3B 1HSAA 4KI1A 1A6VL 1YEDA 2FEEI 5DJ2A 1ZGLA 3V6FA 1JGEB 1U8QB 1HKLH 4HX1B 1J87A 2BJMH 5J12B 4K3JL 5GS0L 4HJJH 5JW3H 2BRQA 1GJIA 5EO1B 4XNQB 5AWNH 3FQWB 5FEBA 1MAKA 3CUPA 3U7WH 1GZPB 5EUOE 2CMRH 4YDVB 4MCZB 5JHDE 5F1SA 2H1PL 5I1EH 4KRLB 4F7CB 5FYJH 3D85A 4XBPA 1UWGH 4ZAKB 3MXWL 5ETUB 3GJFA 2EDJA 4X6CA 4TUOA 1G9MC 3LS5H 3VXUD 4RMWA 5T1MA 4MAYA 1H15B 4OF8A 1EEYA 2APWA 1W72H 4U0QB 2OMNA 1NBYB 2DQGL 3RA7L 1PW3A 3TPKA 4LHUA 5BVPL 3KWWA 5JQ6L 5GGTA 1KIPB 3HI1B 3PJSA 5I8OL 4HV8B 2XXMB 1BM3L 4LCWD 3FO2A 3MRNB 5CP7B 5I1AB 5J1TC 4RFOL 5AZ2H 4Y4FA 4P2RB 3K46A 2WM0A 4NFDA 1RUQH 2NY7H 5D5MF 5C07A 3S4SB 3WDHA 3ETBF 5CWSB 1CDUA 2P1YA 3C5JB 4D9LH 3SCMA 5C0RH 3RI5F 3MRKA 1JGEA 1U8QA 2ED9A 4HX1A 4RFNB 5LKNA 2D0HA 3D2UB 3WKML 2ED7A 5FYKU 4LDEB 5EO1A 1VKXA 1J11A 3FQWA 1RUAL 3GHBL 5JXED 3RIAF 4EVNB 3Q6GH 1EFQA 4YDVA 3S37L 4MCZA 4K2UH 4P2YA 2ICWA 5C9JA 4ODUA 4F7CA 2R1XB 3NOIA 1Z9SA 4ZAKA 5ETUA 1ZXQA 3W11D 4Z7QE 2Z91A 2AABL 3AY4A 3C2AL 3SE3A 1I8KA 4WEBL 4DN4L 4GAJH 4JRYB 4NO5B 5DFTA 3T4AB 4BKLB 5FKPB 1EERB 2D0GA 3U9UB 1NBYA 3SOBL 2PYED 4CJ0A 1LE5B 2X9XA 1XR8A 4QRPE 3IKKA 2CSPA 3SE8H 4NM4H 4F15C 1JGVL 5DK0B 1R3IL 2VABB 2DN7A 3G08A 1KIPA 3HI1A 4K7FA 3U6RA 5J9PB 5CP7A 4LP4A 3V0VB 2HFFA 4XP9H 5I1AA 3ECBA 3GK8L 3GMNB 2RQ8A 1BPVA 3ELAT 4P2RA 4X4MA 1J8HB 2A6DB 4HEME 4Y4HB 4Y8DC 1S9XB 4X5WA 5CWSA 3C5JA 1KBGL 4JFEE 4P48A 3C60B 1FNEA 1NMCC 3FRPA 1NGPH 3D2UA 4XNYH 4YPJA 5F9OH 3HN3A 2Q1EA 1DSFL 3LY6A 1RUKH 5IF0B 3BPLB 1KGCD 4OFKA 43C9A 3KPSB 5FO7B 1DBAH 4WEUD 2F8VA 3ZTNL 3L3DB 3T3PF 1DQDL 1A6TB 2EKJA 4UV7H 5F3HB 2R0WL 2CKBH 4JRYA 4NO5A 4BKLA 3T4AA 4Z18A 4HS6B 5DK0A 2VABA 2B1AL 4B50A 5FYLE 5BCAA 5IB2B 4JZJC 3ROOB 2CJUH 3V0VA 2DQHL 4RGND 3GMNA 4EUPH 3R0NA 1AR1C 2YPVH 5GRZA 3X14B 4Y5YC 2A6DA 2X4RB 3VA2C 2VMFA 2FJGA 1JHKH 1OAYH 1S9XA 1MCFA 3WIHL 4QY8A 1CR9H 3GDBA 5JDJA 3MR9A 1MEXL 4PD4J 3LOWA 4FN0A 2R29H 3LEYL 4TPRL 3KGRA 1ADQA 1KJ2L 2VDQL 5D70L 3TT1L 5E7BA 1LEKA 2ZUTA 2R1WB 3SDCB 3EYSL 4PJ9B 3MBXL 5IF0A 2XZQL 4TULL 3ZDZF 5C0BA 4JRXE 1G7HB 3KPSA 5FO7A 2V2XB 3DSFL 3TWCH 1TNNA 2YD9A 2C7UB 4GW1B 3N0PB 2OMBA 1U36A 2E8ZA 3IAPA 1A6TA 4Q74A 4BK5A 5F3HA 3OAUH 4J2XA 1I3UA 3UO1H 4HS6A 3SGKC 4NN5B 4XPGL 4XHQA 3TP4A 1JL8A 1QG3A 1PQZB 2YPLD 4Q58C 2ZCLH 2DMCA 3EFDL 5IB2A 1YEGH 3PWUB 3ROOA 4G6KL 4PJXF 4LIQE 4HC1L 4TUKH 5DUML 4DZBB 3X14A 3S7GA 3RUGF 1MCHA 4IOFD 2HT4C 1JZ8A 2X4RA 3QJFA 4WJ5A 5DVOA 3KNBB 4U3HA 5IBUG 4ETYA 3MBED 4NN7C 2YUWA 4NKOB 4A6YH 1UCTA 1XH3B 1DBJH 1JYXA 1NMCB 3SKUD 1FC2D 1O7SA 5MHSE 2ZJSL 2XWBB 1HE7A 5FXCH 1G84A 3GKWH 3N1PC 2F53D 4JFDD 3NGBC 2PUQT 2R1WA 4OM0H 3PDOA 3QB7C 3QHTC 4PJ9A 2P5WA 1GGBL 4WI6A 1ZTXH 4HIIA 3T0DA 3TBYB 3NPSC 1G7HA 3QISA 3HI6L 1WZ1H 4GW1A 5C0CE 4EI6A 4N0YL 2AJVH 1J86A 1Q9WB 1WZMA 5IVXA 3K81A 3O45B 4PJ8D 3PWLB 2OZ4A 3HCVA 5HGDA 4LNRB 2R0KH 2WUCL 5EPMB 1T0MB 1GHFL 2G5RA 4U6VH 1PQZA 3KXFD 4WU7B 1OSPH 4U2YA 2WBJD 1IC7H 1F90H 2QR0A 4Y5YB 3X17A 3PHQB 2PF6A 1A7RH 4DZBA 4OZIB 1IKFH 4LSQH 25C8H 2BVOB 3IT8D 4L8BB 1Q1JL 1N7ML 3VRLE 3KNBA 1DLFL 1QSZA 5LQBH 3DGGB 5KSAC 4NKOA 1XH3A 4PJHF 2IGFL 4XGZB 2XWBA 1IAMA 4JG1L 2NY5L 5EOQL 4BH8B 5DD6B 2HA1A 4WFFD 2XN9E 4LARH 2IF7A 1DEEB 1MNUL 4X7SH 5JIIA 1J1OH 2MQCA 1QBBA 4PLKD 3TBYA 2QADD 1QSEB 5LGHL 3IFLL 5TQ0H 3DMMB 4V1DE 4PGZA 4JJHA 1P5VA 3OZ9L 5CP3A 1GC1L 2QSTA 4QYOB 2X5PA 3WJJC 3O45A 3PWLA 1AC6A 2MHAB 4Q9RH 4PRHB 4LNRA 4Q97A 5EPMA 2FJHB 1OP3K 3LEXA 1T0MA 2ENYA 4P4KC 4UT7H 1T5XB 4MNGB 3WE6B 1HWHB 1RJCA 2UZIL 3MV9A 4L3EE 4WU7A 3ARSA 4NO3A 1S7VB 3L3OA 4AENB 5T3ZD 3MLVH 3B3IB 4Y5YA 4YEFA 5JIHA 1TPXC 3ZE0E 4NN7B 2BVOA 1HK6A 4XCCH 1FVDA 4KH2A 5IB1B 4KK5D 1UCBL 2R2HB 3DGGA 4FQIH 4XNMB 3WDJA 4BFGA 5I8CB 1K8DA 4JHWL 4ZYKA 1MAJA 3ZO0A 5C86A 3T0AA 3PGDB 1QEWB 1KPVB 4XGZA 5HHVL 4JCMA 4FNLL 2PNDA 1Q0XL 5J6HB 3T2NH 4L1DA 1DEEA 3NPSB 4UIMB 5KOVC 4G6AC 1L7TH 3K1DA 2XNAB 3RJDA 1QSEA 3FCTB 4TSCH 5MEQB 3FAXA 1Q8MA 4L5FH 1EAJA 3K7UA 1NAMH 1MLBB 4TSAH 4QYOA 5I1CL 2FGWL 3TIDB 3SGKA 2MHAA 2J4WL 4PRHA 5DD5L 4YXLL 2FJHA 3VXRD 1T5XA 4HJ0C 2K7QA 4UB0H 3WE6A 1X5XA 4FA8A 1HCVA 5C0AB 1S7VA 4AENA 4S0TD 3NH7L 3B3IA 4UU9B 3P0VL 1G6RB 5D1QD 4S1QH 3CMOH 5I30H 4CNIB 1IGJB 5KSAB 4NUGH 4NN6B 5IB1A 2V7NB 2NY6B 4XNMA 5I8CA 4XBEL 2BSTB 3D0VA 3U9PH 4PGJA 1F8TH 1KCLA 4KPHH 3PGDA 3WYRA 5D1XD 3EYFB 2YRZA 3OGCB 4ZS7H 5I1KL 1RZJC 3IDYB 3VU2A 4NT6B 5HYSG 4GRWH 1U8LB 1H3TA 3VFWB 5IEHB 4UIMA 4CDHA 3NCYP 3DROB 3UYRL 4R8WL 2XNAA 3T0XA 3LB6C 3FCTA 3DUUB 1NKRA 4YHYC 5MEQA 5BO1L 2W65B 1E6OH 4AM0B 2E6QA 3NZHL 2WNGA 2WWKO 1MLBA 3O6LL 4ERSL 3TIDA 2ORBH 4PFEA 5D7IB 1D7FA 3TPUB 2YZ8A 4YGAB 3X3GL 5GS2H 4KJQD 2ADFH 1ZT7B 3G5VB 3U0WL 2X1QA 4M48H 3I6LD 1BQHB 2GTWB 1DDHA 1TPXB 5AAWA 5FYJD 4UU9A 5C1MB 1G6RA 5JW5B 1U8KB 5JR1L 3WXVH 3KLDA 4WTXA 3X12B 3TVMD 1IGJA 2DD8L 3OX8B 5KSAA 5TE7L 1PG7L 3OSKA 2V7NA 1WBYB 3QFJE 2BSTA 1U3HB 3GB7B 4P9ML 3F58H 4LLDB 1T20B 2DI9A 4Z8FH 1GPOH 2RCSL 2VLKE 3EYFA 5IG7B 2F15A 3OGCA 5IB4B 3DX8B 1RD6A 2F74B 4GW4A 4NT6A 1U8LA 4GAFB 2A9ML 3GMPB 4APQD 1WWAX 2EDQA 1XGTB 2C1PB 2ITDA 4MS8D 1T6VN 3R06B 1BBJB 3KYKL 2X9WA 4ELMB 5IFJB 2A6KB 3GO1H 2DWDB 3S88L 2QQLL 3RWIB 2MQ0A 1QVOB 1YEFH 5JW4N 4XPBH 1N3NB 1BD2D 1PEWA 2W65A 3RDTC 3WJJA 3NA4A 4AM0A 2MQ3A 1X5AA 5DRWB 3B9VA 4BQ9A 3BN9D 1X6LA 5L9DL 1Z6JT 4P9HH 4C54A 2JJVA 5D7IA 4P4KA 3TPUA 5AZEL 1BECA 3EDJA 1WZKA 4GG6F 1OGAD 5ESQB 1ZT7A 3G5VA 1AXTL 4NZRL 3HR6A 3NZ8B 1BQHA 2GTWA 2GJ6D 1XIWC 5DD1L 4YWGH 1LO0H 1JNNL 2DLIA 5JW5A 1U8KA 4KHXH 3V4VL 2VDPH 4D0DA 2XQYG 4WCYL 1MHPL 3IDXL 3LRHA 5E9DB 1RUPL 4RFEB 2B39A 3VMNA 4OZGE 5T1DH 3TT3L 1WBYA 2IAMD 1T2XA 3GJFK 4WW2C 3GB7A 4DTGH 1T20A 2R39A 5MERA 3TFKD 5EZOL 5IG7A 3QWOA 1NAKH 2DQJH 3DX8A 1V8HA 1LO2H 4POUB 4OFVA 5HHQB 3TH4T 3NN8B 3VH8A 1N4XL 3GMPA 4XAWL 2OTPA 5SWZD 3MV8B 1XGTA 4G6AD 3EOTH 4K3EH 4MWFA 4YHYB 3R06A 4TSBL 5IFJA 2A6KA 4JFFD 4HGKC 2DWDA 4LCIL 3MZTA 1OM3H 1QVOA 2Q7NA 2WQRA 2ZWLT 5L6YH 1N3NA 4FG6D 1LVEA 2JTDA 1NJ9A 4TTDC 3PWPD 4U1GC 2P5ED 3CSPA 3CNKA 3L9RB 1J9CT 5HHPB 5LG1A 5AYUL 1CG9B 1DE4B 1L7IL 5B3JF 5L2KE 3B9AA 4HHAB 5GGTL 4Z7NF 1GCFA 4PG9B 1U8NB 1FBIL 3BRFA 4MJ6B 3NZ8A 4ZSOE 7CGTA 2ZPKL 4PV8B 3T0ED 1WLHA 4LLMA 2B8OT 2V9RA 4XVJL 3D0LB 1QBMH 3QUXC 2WAHA 3V52H 4LF3A 4RFEA 5CCKL 5GGQH 5DQDH 3CH8A 4EXKA 4X5XA 4MCYA 2J12B 5CEZE 3WS6C 3UC0H 3BH8A 2YKLL 4XVSH 4ZOEA 4NO2B 2D3VA 4ISVB 5KG9B 3NN8A 1PAMA 4UILL 2DQFB 5IUSA 3MV8A 3VI3E 3F12B 2BNQB 3DVGB 4CL7A 4MGXA 5ISZB 5I1JH 4NJ9H 3RDTB 2Z8VC 1LQSR 3LV3B 4DW2H 5E08H 1F3JA 4YHKH 3WNMA 4K7PH 4JAMB 4NFBA 3RL2B 4NGHH 1HILA 1LO5A 5DQJB 3VXSD 3L9RA 1NUFA 2AV7A 4LPUA 5DLMH 3G6JE 3WEXB 4QRUB 1REIA 1DE4A 4JO3L 5KVGL 4OV6F 4MA8L 1AD9A 4PJIF 4OLVH 1LEIB 3W2DL 1LP9B 1XIWB 4OSUL 1P7HL 3IF1B 1U8NA 1FE8L 4CMMB 3D3VE 4G9FB 4MJ6A 2YOCA 4PIRF 4BM7A 2YA1A 4DGVL 3U0TB 3PXJA 1MCPH 4PV8A 4YZFE 2VXVL 4YBLC 2IALB 3D0LA 3RGVC 5F8QC 1INDL 4WW2B 3BXNB 5I1GL 4Q9QL 5TH2B 3LH2L 4KROC 3OKOA 3GRWH 1BVZA 3SGJC 1T03L 4ODVL 4M7KH 4FXGB 4KZEH 2UUDH 3QPXH 4NO2A 4ISVA 1MF2L 5KG9A 1K4CB 2NXZC 3MREB 2NY2C 2DQFA 3U4BH 1ZHNB 1AE6L 2PW1B 4KRNA 2VL5B 1T1XA 3F12A 1W2KT 2BNQA 3DVGA 4FZ8L 1PKOA 3RDTA 3LV3A 3SEPA 1HOCB 1T1ZB 4FXKB 4U1GB 4PJ7B 4JAMA 1XGUB 3RL2A 4ONFH 4YUEH 5IQ7H 4ONGH 5DQJA 4Y16C 5GGSY 1HH9B 3BIBX 4K8RH 4ZOCA 1NH6A 3TLRA 3WEXA 4QRUA 3IRZA 2X4UB 3HZYB 1LEIA 3SN6N 1LP9A 1XIWA 3CFDA 3IF1A 4GMTL 4CMMA 2IWGA 4X7DC 1CFNA 4KKBC 3U0TA 4BQ6A 5MEOB 2IALA 1S9WB 4AH2A 5FA4B 4NUJB 4WW2A 3TNNA 2EDFA 3BXNA 1CFTB 1Q9LA 2LVCA 2GJJA 3I2CL 5I0ZA 3PQYE 1D6VH 1FFOB 3EUUA 5E5MA 4FXGA 4E0RB 4OCYH 2AJYL 4X6CF 5FYLH 4JREC 1K4CA 3MREA 4BFIB 3TA3B 4OCRL 1ZHNA 2PW1A 4HPOL 4HFWB 2VL5A 4XWGH 1VPOL 1G9ML 1JJUA 1OB1B 3U1SL 3LN4B 4YHOH 5IHLB 4KK6C 1HOCA 4FXKA 5EA0H 4PJ7A 1UZ6F 4MQ7B 2DIBA 3FB5B 3I85A 5ILTH 1HH9A 3UEZA 3PGFL 1JPTL 1BZQK 1J5OH 35C8L 4M7LH 1FYTD 1LGVA 4M5ZH 5FA3A 5B4MC 2OYPA 4GLRH 4JHAL 4N8CH 3HZYA 5IB3B 2MKLC 3T0VA 1EEQA 5D5ME 1JPSL 4YBLB 3W39B 3QUXA 4K9EC 5B39B 2G75A 3RGVB 1FDLH 1EMTH 5DFVD 3GSNL 2BMKB 3QQ9D 3DSNA 1AQKH 1S9WA 3DXAD 5FA4A 1MJ7L 2LU7A 2VDLL 4M6OH 4NUJA 4OQTH 2Z8SA 1CFTA 3WS6A 4OD2B 5CGYD 2B4CH 4KQ4H 4MVBC 4XI5D 2V9TA 4JFHD 4Q6IC 1IM9B 1FFOA 4L8CB 4XBGA 1YMHB 2NXZB 3HG1D 2NXYD 2NY2B 2OS7A 3I84A 3UTTB 4DUWA 5CINH 2ESVE 3N85L 1IZKA 4FP8H 3O2VH 4L4JA 1T83C 1IFHH 1RIVH 4LIQH 3U2SB 2FNBA 2SEBB 4HFWA 2FR4A 1CK0H 1X44A 2HFGH 2KQMA 2IBBA 4Y16B 1ORQA 1T2QL 2CQVA 5D1ZC 3SKJH 4MQ7A 4XCNB 2QV2A 5F6HJ 3LMJH 4Y19D 5TDOB 2EXYD 3KYNA 4G3YL 3WFCH 4J12A 5CEXB 1FNHA 2Z0BA 5FGBC 3HC4H 2UWEB 5IB3A 4FTVE 5IP4A 1JHTA 4NQCB 4HWEL 1S7RB 1BQLL 3L3GB 4Z7VE 2I9LB 1J0HA 3W39A 5C0IB 5B39A 1NAMA 2J8HA 1P1ZB 3RGVA 1G0DA 4Q7DA 3ZL4L 1GGCL 3C6SB 4QTIL 4R96B 3O2WL 3BT2H 1X4ZA 3NCJL 4OD2A 5FHBL 2I07B 1QKZH 3SGJA 4KROD 4AK1A 5D71L 1TQBC 4R4FL 1C1EL 1IM9A 1YNKL 1XCQB 5E8DL 1Y6KR 2OR7A 4LSTL 3UTTA 4XWOD 1PSKH 4IOIB 4O58L 5E2TH 3MLRL 3U0PB 1EDQA 3R1GH 2EH8L 4NQEB 3EJYC 1RK0B 5EU6D 3U2SA 2VTFA 5IB5A 1GOGA 2SEBA 3FFCB 3V4PH 1FZOB 4QTHB 3BZDA 4QXTA 5GGVY 3U7YL 4Y16A 4OCMC 1X4YA 4ODWB 4QHKI 4RA3A 1ZEAH 4ZFGL 1RZKH 1TZHB 1I1RA 2IH1B 5ANME 5TDOA 5IV2B 3ORJA 1MCOL 3LIZL 1KCKA 3O4LB 3STZB 5CEXA 2IPKB 5IEKB 2VZ1A 1TJGH 3IAGC 1JWMB 1MQKH 2UWEA 1VFUA 4NQCA 2A38A 4GKSB 5DK3A 4LSVL 5DZNA 5D72L 3L3GA 4H88L 2I9LA 2R8SL 4NRXB 3MPCA 3IXAA 1P1ZA 3JWOH 4H26A 4WUUE 3ESVF 4QO1A 2BSED 4OLZH 2G60L 2FHBA 3D6GA 3C6SA 2P4AB 3MLWL 5TE6H 4R96A 1AIFA 2Z92B 2BHZA 4QT5B 3SDYL 4Q6IB 4E41D 1I9RL 2WWMC 3ZDZE 1WIOA 4NP4L 3IFNH 5GS2D 5JHLH 3VFOB 2HTLC 4ZFFA 4LGPB 1CI5A 1XCQA 3QO1B 5J11C 3ARGC 2G9HB 4IOIA 1QFPA 1G1CA 3U0PA 4S1DC 2RR3A 4NQEA 3WO3B 1AD0B 1RK0A 4ODBD 5B22A 2WLYA 3KPRE 3UJJH 2Y06H 2WUBL 2DAVA 3FFCA 1FZOA 1E28A 2IANE 5D1ZB 4KK6D 4ALAH 1CF8L 1WK0A 1DBMH 2O5ZH 4ODWA 1GGIH 3RWFB 5CSBA 2BNUB 1TZHA 2IH1A 5IV2A 3EYUH 2NQCA 3GIZL 5KANI 4YHML 3O4LA 1IM3A 5IEKA 1M6OB 3RUGE 1JWMA 3U30C 5E00A 4OGAD 5CUSH 4DVRH 3QDJE 4HF5L 2Q8BH 4GKSA 3LKNA 2NX5E 1ZLWH 4MXWL 2AI0H 4NRXA 2DI8A 1BOGB 3JTSB 1JNHA 1V3LA 5LXGL 2R15A 4K8RC 1KCUL 3V0WL 3QUMB 5F88B 2Z92A 4QT5A 1TQBB 4Q6IA 3WSQL 2DKMA 2VISA 4XTRD 2X4PB 3H7LA 1CGSH 4YPGB 3VFOA 1JPST 1T83A 2A83B 2CLVB 2XKNB 1JHLH 5BOZG 1I4FB 4NM8H 2G9HA 2V17L 4O2CA 2EIZB 1AD0A 2AJZB 5D7KD 4BYHA 1UKTA 4LBEA 2UY7A 3FQRB 4P46D 1YNTB 5D1ZA 4B7LA 4NQVB 1B0RB 5A43C 4JG0H 1HKLL 4QCIB 4I18B 1RJZB 5CJBA 5DA0B 4HJJL 3RWFA 5JW3L 2BNUA 5DGRA 4JM4L 5TDNB 3GBNH 1AO7D 3U7WL 3UP1A 2E27L 2F54D 2VN4A 5FGBA 3FB8A 1YMMA 2EYSA 4JFQB 3TO4D 3ARPA 1M6OA 5I1EL 5FYJL 1UWGL 4K94H 5I1IL 2AK4E 1MCBA 4PGBB 1ACZA 3OKLB 1A7OL 1G6RL 5HD8D 5BRZD 5EN2B 3JTSA 4U6YA 4RISH 4E5XA 4PBVC 4M8VA 1WJ3A 1LDPH 1XF5A 2CDGB 3QUMA 3B4NA 4HG4K 1IEAA 3K4DA 1MFCH 3ZLQC 4NPYA 2J6EA 5J11B 4YR6B 3RZWA 3AUVA 4YPGA 2A83A 2CLVA 2XKNA 3LZFH 3UYPA 5AZ2L 1I4FA 5JHDD 1ZHLB 1RUQL 2EIZA 2VAAA 2NY7L 2AJZA 1EUUA 3DLQR 1FH5H 3FQRA 1YNTA 3GEWB 3QEQE 5C0RL 1B0RA 5JLZB 4OF7A 5F7LB 5E95B 2J1KA 4I18A 3ILQD 3OAYK 4L9LC 2FIRT 5TDNA 1LK2B 4NOFA 4M1CC 4WHCA 5JIKA 4NCC1 2ZSVB 1PFCA 5FUCE 3ZKXC 3NPZB 3Q6GL 4BSJA 2AQ2A 4Z0BH 2XKSA 5DMGC 4LVHB 1T1WA 3QIWC 3TBWB 2DS4A 4OZHB 3OKLA 1TJHH 4ODHH 2Q87A 1CGVA 1KOAA 1RK1B 5DEFB 4G6FD 1T66C 4EDXB 4XC1H 5FDWB 4GAJL 5FOJA 4I48B 1I1AD 3KPLA 3L7EB 5T1KD 2J3SA 1NCUA 1EO5A 2BP3A 3SE8L 4NM4L 3JTTB 3L6FA 3BPCB 1BX2A 1FG2B 3VGGA 4R4ND 4YR6A 1N0LA 4XT1C 1A6ZB 4I77H 4XP9L 4DKEH 3RVXD 4KWUA 3ARGD 4KI5E 1WIPA 3T08A 3JWNC 1WFNA 4RMTA 1ZHLA 1EO7A 2CDEB 1H3PH 5JXAH 5IT2H 1HNGA 5IFHH 4OIAA 4NRZB 2ARJQ 4S1RH 3GSQB 4PJEE 1S9VA 5F93C 5JLZA 1NGPL 3EJJX 5IHBA 4KC3B 5HI3D 2B7DT 5F9OL 2E9BA 1LK2A 2B2XL 2YPLB 4FHBD 4QRPD 4WO4C 1NEUA 1RUKL 5IESH 3UBXB 2ZSVA 3GIVA 1N0XH 1D6EB 4HK0B 4RSVA 5CZKA 4EOWH 5F1IB 2VYRE 2Y6SC 1DBAL 1YEIH 4XCEA 1RJLB 3TBWA 1JI2A 3BP4B 2ADIB 3BRGC 3VW3H 3VGAB 4LRIC 4MQXD 1KCVH 5HPOA 1R5IA 2FX9H 3HAEH 1F4XH 1RK1A 5DEFA 3B9KD 4EDXA 1LEGA 5FDWA 5T5NF 2BOBB 3DWTA 2CKBL 1PZUB 2XWTB 4HFUH 3PV7A 1BREA 4JFEA 3B43A 4OZFB 5IVZB 5M95B 3L7EA 3MJ9A 3GSUA 1JYVA 3T77B 2QQKH 3TNMB 2CUHA 3BPCA 5J3HD 1FG2A 2D7QA 5BXFB 3RVVC 2MPAH 4IRSC 1SY6A 2CJUL 4H25B 3FKUS 3QI9D 5FF6A 2B0SH 2YPVL 3QPQD 1DANT 2H8PA 3CZFB 5E2UH 1NQBA 4HCRA 1JHKL 1OAYL 3JWOC 5TF1H 3B2VL 3RKDD 2BSSB 2VUOA 1KNOA 1CR9L 1V7MH 1KENL 4NRZA 1FN4B 4PJ8B 5ICYB 3GSQA 5DYOB 4L9LB 2M8XA 2R29L 2GTZB 1MAMH 5CEZH 3K8KA 1QRNE 2R23B 3KXFB 4ZS6D 2VDRH 3UBXA 4HK0A 2WBJB 1D6EA 4ZFOB 3QIWB 2E8YA 5F1IA 5FYLD 5CZXD 5DI8B 3DOSA 4QOKE 1YDPA 2VLRE 5CIPH 1RJLA 3TYGH 2ADIA 2DL9A 3STBA 3BWUC 2O93L 4JKPH 4UMGA 1WV7T 3HR5B 1D5IL 3P4MB 4NJAH 5EH1A 3OAUL 4KDVA 2VAJA 2LABA 4DOHE 2DF3A 5C0GB 3ARTA 3H3BC 1M7DB 5IVZA 5E0QA 1P2CB 5IW6B 4BUGA 3TNMA 2ZCLL 3QDGB 1HXYA 3S36X 3CVHH 5A2LH 5BXFA 1YEGL 1B2WH 4MXVF 4H8WC 4JRXA 4TUKL 1T6WA 4H25A 3VCLB 3SDXE 1IGCH 1KULA 3CZFA 5KVFH 1DANU 1FORH 1IQDB 4LPYA 4MJ4A 1DQJA 3OAZK 1L6ZA 3UTSE 3P4OB 4A6YL 4OQTA 1U91B 3QDMB 1NBZB 5D7IF 1FN4A 5ICYA 2OL3H 1PKQB 5DYOA 4L9LA 4PREA 4N9GB 2GTZA 5IK3B 4GG6E 2RIKA 1FGNH 2GEEA 4OM0L 3FOMB 2R23A 1CL7H 3W0WE 2YWYA 1NGYA 2WBJA 1S7UA 1UVQB 1ZTXL 3QIWA 4JO2L 2D4FA 5DI8A 1IGIH 5F71A 1KN2L 1HWGB 2LAGB 1WZ1L 1J05B 4U1SB 2AJVL 2EDWA 4Y88A 1JE6A 5A1AA 1JWSB 1UFUA 3HZMB 4M1GH 5F9WC 3HI5L 1PBYA 2R0KL 5T33H 2DDQH 2HH0L 1RQ5A 1P2CA 2XN9B 5IW6A 4IRSB 4U6VL 4G9DB 1WZLA 3QDGA 1IC7L 1F90L 2O5YH 4F57H 3P30H 4NWTL 3VCLA 2GFBB 4QWWD 4F33B 1I3RB 1IKFL 2Q8AH 3L95B 3U4AA 4LSQL 5C0CA 25C8L 1HN1A 2DRUA 5F1OB 5CLWA 5K93A 5FM4A 3BP5B 5LVEA 4EN3D 1JGDB 3P4OA 2VXTH 4LSUH 3U4EB 2OJEB 1NBZA 3QDMA 4LFHG 3QFDB 2E9WA 4JFZL 3HRZA 5B3JE 2OJZH 1PKQA 5I71C 5IK3A 4Z7NE 2UY6A 3TZVC 4OLWH 3QIBD 4LSSH 4LARL 3FOMA 1G9EA 4XPAH 4Z0XB 4TVPH 1VA9A 4X7SL 1J1OL 2A73A 4LSPH 5D1QB 4WTZG 1OP5K 3O6FC 5TQ0L 4LRIA 4MLSA 3L5XL 4PP1D 4RGOL 4BZ1H 2XTLA 1J05A 4U1SA 3ULVE 4LCCC 1JF6A 3O2DH 4Y2DD 1NSNL 1CQYA 1GL4B 1F4WL 3TN0D 1MSPA 1JWSA 4Q9RL 5DEZA 4ZO6A 1WC7B 2GSIA 3CFJB 2XN9A 4UBDD 5JOFB 4IRSA 3DYPA 4G9DA 4LVNC 5M7QA 3VGEA 5IBTH 2VZ3A 3H0TB 3MLVL 3EZ8A 1UB6B 1I3VA 2GFBA 4F33A 3CFBA 3S4SG 1A7QH 3L95A 1TVBA 4L3AA 4JM2C 4V1DD 4XCCL 4ZO8A 3VXME 3BP5A 3OR6B 3FN9A 4FQ1H 4FQIL 3VFVA 1PEZA 3U4EA 3WCYA 2OJEA 1A47A 1OF2B 1MHCB 3QFDA 3RIFK 5HHOD 4JGUA 2FO4B 3Q5TA 1FLRL 3T3MF 3ZTJH 4BQBA 3T4YB 1YEKL 1ZLUH 2NZ9D 3T2NL 4Z0XA 3VRIB 2IJ0C 3VG9C 2XT1B 4L3ED 5C6TH 1L7TL 1EBAA 3NFPB 3U7AA 4J3WA 1ZA3B 4TSCL 5KVEH 2PXYC 4KKCD 4R6UA 4PGCA 4L5FL 3SDDC 1NAML 1AGDB 4TSAL 2ICWJ 3EW3B 3TBTB 4JFOA 3MRLB 4MNQE 5FDYA 4PGDA 4YFDB 3A0OA 1CT8B 1WC7A 1KIRB 3CFJA 3RTQD 4XXDA 4UB0L 5JOFA 4NBZB 3BE1L 2W0FB 5IBUB 3H0TA 4AY0A 3T2OA 1UB6A 1JZ6A 4S1QL 3CMOL 1OAKH 3S96B 4P49A 5HPMA 5DQ9B 2X1PA 3GMQB 4NUGL 5JMRA 4MHHI 4PYGA 3OR6A 7FABH 1ZK9A 5I71B 3U9PL 1MHCA 4KPHL 1F2QA 3TZVB 3EYVB 3IJSB 3HE6C 3GUTB 1LP9F 2FO4A 1AJ7H 2F19H 4AEIL 2F5AH 3CSYB 2E6PA 1EIBA 1ZLVH 1GGTA 2KQNA 3O6FB 5FUOH 5H35A 3HE7D 5HI5C 4LCCB 5DWUH 2H6PB 1IEBA 2NY0D 4WW2F 2ERJC 1E6OL 3FQNA 3HHRB 4ZO7A 3GJEB 1AGDA 3OQ3B 2WV3A 2DM7A 4WHTB 4CW1B 3MOBH 2ORBL 3TBTA 1X9QA 4XC3H 3MRLA 1SBSH 3OJDB 4LVNB 3MRQB 1CT8A 1QSVA 1KIRA 3HZVB 1NUDA 2ADFL 3R8QA 3JV4B 2YUVA 4M48L 2W0FA 1J12A 1DN2A 2MOVA 4M7JL 3O11B 2EDYA 2VKXA 3QNXA 4JM2B 2AXJA 4K3JH 3WXVL 4PJ7F 3AC0A 1UZ6E 1BHGA 4WGVB 1KTRL 2JB6B 5DQ9A 1VFMA 1X3DA 4OQ1A 5T3XE 3GMQA 4KDWA 4FFVD 5FV1L 3SGDH 3G5YB 2P5EB 4BSWA 1MCWW 4W6YB 3IFOA 5E6ZA 3TZVA 1WTLA 4HAFA 5FUZL 4Z8FL 1GPOL 2IFFH 3IJSA 2AXFB 3GUTA 1G7IB 2D0FA 3V5HB 3V8OA 3EBAA 3CSYA 4W4OC 3O6FA 3S98A 4JEGB 3RWCB 2DQGH 1RIUH 3RA7H 3GO1L 2PXYB 1L9MA 3WFZA 3LVEA 5F7KC 1YPZE 3SDAB 1B88A 2DIJA 3SDDB 4LCCA 1YEFL 2H6PA 4K9EL 5F44A 1KUMA 2XG5A 3F65A 4ZUTB 5D96C 4OZGB 1MJJB 1MVUB 3QFJA 4QHMB 3U83A 4WHTA 4CW1A 5F7MC 3QH3B 3S35X 4G80A 4P9HL 3OBAA 3OJDA 3BKJH 4JKKA 3VA6A 5H37H 2VLKD 1JGLH 3JV4A 1QPXA 4XNUL 5FV2A 2C3VA 4IDLA 3TBVB 4YWGL 4UDUA 1LO0L 4NC0B 4KHXL 1BEYH 4JM2A 3WKMH 4MA1B 5ID1B 12E8H 5E8PB 1ZANH 4OFYD 5K9OB 4IM8A 2JB6A 1MY7A 4FQXD 3H3PH 5T1DL 4OAWB 3NIDE 2PW2B 1U42A 3G5YA 3S37H 3HE6B 1A1OB 1ITCA 4EQ2A 4GAGH 2DYPB 4P2RE 3DIFA 2AXFA 1NAKL 1G7IA 5L2KB 1J18A 3V5HA 5C2BH 1LO2L 3L5IA 1JWUA 4WEBH 4DN4H 5HI4D 2R2CA 3RIFF 3EOTL 4K3EL 5IMOB 3RWCA 3SOBH 4PJGB 2PXYA 4JKMA 3SDAA 4G7YH 3W9EA 3SDDA 3V7AE 1R3IH 5L6YL 2P46B 4OZGA 1MVUA 4QHMA 2OX5A 5DEGB 4R9HA 4GS7B 4ZTPH 1B9ZA 4QRQB 2QHRL 3ARBC 1CTNA 2VDNH 3W5MA 3T2QA 2RFXA 3MMEB 4Q0XH 1CXFA 1U8OB 4KUCD 1UXWA 3TJEH 5DUBA 2YWZA 4POYA 1CDCA 4F2MB 4XMLL 4LVEA 3TBVA 2X41A 4JRYE 4MAUH 4LEXH 3FO9B 1FL3B 2GSGA 5E8PA 5K9OA 1SJHA 5EG6C 4HKJB 1MUJB 3TYFB 4Z77A 4PJBB 3REWA 5GGQL 4KK8C 5DQDL 5HYSB 4OAWA 4XCFH 1MJ8H 5FK9A 2PW2A 1KXVC 4NOBA 5C09B 3HE6A 1A1OA 3G6JB 5FKAB 5FGRA 5BOPA 2XTJD 2DYPA 1D9KD 2UWEF 1J8HE 3P9WB 4XVSL 3Q48A 5IJKC 4JPIB 5L2KA 3MJ8B 4RNRB 4AEHH 2IEPA 3ZTNH 5BV7C 2YD3A 5GZNC 4BSVA 3VXQB 5CBAB 1P7QD 2R0WH 1RZ8B 3P4NB 3ILPA 5IMOA 1N59A 1JZ3A 4PJGA 4ODXA 2FX8H 2JJWA 3FO0H 4YHKL 3R8BB 1P6FA 1URLA 3T0BA 5B8CC 4K7PL 2B1AH 4NGHL 4I0PD 4NRYB 3QXTA 4R3SB 1IGML 5DEGA 5DLML 4B0MM 3KPSE 4QRQA 3L3KB 3LD8C 5CEZD 3MMEA 4OLVL 4F58L 5C70A 3RZCC 3MXVH 2H26B 1U8OA 5HVHC 1FL5B 1P69B 1WITA 1HIML 3Q5YA 1I75A 3LEYH 4X4YB 2UUDK 3Q2CA 4TPRH 4EZMA 1MCPL 3FO9A 3LRSB 1FL3A 4JRWA 1B6DA 5D7SH 1KJ2H 3WKNA 1RY7B 1WSST 4HKJA 1D5BB 2EIDA 1MUJA 1JVKA 3EYSH 2KUTA 5FYKE 4QHLB 4PJBA 5DD0H 4CN4A 15C8H 1JFQH 2XZQH 5HYSA 5C09A 1OTTD 1FYTB 3G6JA 4PG2A 5FKAA 3GRWL 1ZGLM 1I7UB 4YFLF 1CFSB 3BD5A 1P9MC 1N26A 4JPIA 4W4OA 3MJ8A 3QPXL 1WBXB 4KXZI 3FHQA 1KFAH 2H45A 5CBAA 2WW8A 1HKFA 4HIXL 4LPCA 3P4NA 4XP1H 5IFAH 1N5YL 3D3VD 5J06A 4X4XB 4XPTL 5I8EB 1M05B 1F3RB 4IIQC 2LE9A 1F97A 5GS1C 4K3GA 4NRYA 4ONFL 5IQ7L 4ONGL 2R56H 2QEJA 3ARBB 4K8RL 4HC1H 4RDQF 5DUMH 4HS8H 1D5XB 3DI2B 1VEOA 4UIKH 3L3KA 2BNRD 3FQUA 4JPVL 4LHJB 1HHIA 3D69B 2H26A 4U49A 1FL5A 3MA9H 4N0FB 5GZOC 1QACA 5E8OB 3G9AB 4XXCA 4X4YA 5KAQF 3IDMA 4MYWB 1ITBB 4FFWC 4HCRL 2VQTA 4O51B 1PG7W 3H8NA 5F89B 3MRFB 1OCWL 4QHLA 4WV1C 1OD9A 1FVEB 2FO1A 5IMKB 2GW5A 1I7UA 1KXTB 5BV7B 1CFSA 2FZ3B 3C08H 3B2UC 4OCYL 4PRDA 4ZXBD 1WBXA 5FYLL 4L4TD 5CBEB 1FZJA 2HT2D 1OTUD 4X4XA 4XWGL 5I8EA 4NBXB 2NTSP 1M05A 4OT1H 1MCCA 4YC2C 4JJ5B 4YHOL 1KB5B 2R4RH 4RWYH 5EA0L 4WDIB 4WWID 1OQOA 3ARBA 1J5OL 1QA9B 3LD8B 4M7LL 1U0QA 1D5XA 3CGTA 1RURH 5IWLC 3LKOA 3RZCB 4M5ZL 5KANG 3PQYD 1I7TB 4WUKL 1Q1JH 4N8CL 4O2FB 4TVPD 3ZKNC 3D69A 1QFUH 2BVPB 4N0FA 4X99B 3CCHB 1JNJA 3HC0B 4IBLT 3PWNB 3OPZL 5E8OA 3QHFH 4GT7A 1S7WB 5K9QI 1IAIM 1FDLL 1EMTL 3V79C 4XP5L 1A8JH 2EDRA 4O51A 3AMKA 5JOEA 4JLRB 3AGVA 5I9QC 2OP4L 4M6OL 5F89A 3NABH 1V7NH 3MRFA 4KK8D 4N0CD 4OQTL 3I6GB 5F96H 1CD9B 4MD5B 2B4CL 2A74A 1FVEA 3VD7A 1C7SA 1NC2A 5J57B 5IJKA 5IMKA 3SKOB 4OZIE 4YFEA 1T21B 3OZ9H 2ZOKA 4ZNEE 1MCRA 4KMQA 2X4NA 5CINL 4OV5B 4CADB 3O2VL 1IFHL 4OUUB 4LIQL 4YGVA 4IIQB 5CBEA 4Z7VB 4CN1A 1PYWB 3MRGA 3U48A 1UADC 3ZT5A 1CK0L 5B8CA 3J7HA 3BD4A 1J1PH 4JJ5A 5CD5C 1JIBA 4NYLA 2HFGL 3OKMB 5GQBA 3L7FB 3SKJL 3QIUD 4OF3A 1UWXK 1YJDH 3BJLA 3RHWK 1A1NB 3LMJL 2VSCA 1QA9A 1PZ5A 3MX0A 1QSEE 4HG4J 3MSPA 3RZCA 4U3CA 1AGEB 1U6AH 1I7TA 3HC4L 2FATL 4O2FA 2ESVA 4Z7QF 5ALCH 2BVPA 4X99A 5HDLA 3CCHA 4JN1H 1OP3H 4TRPL 3EDKA 1C16B 2N7AA 1U8HB 3PWNA 4PRHE 4HDIA 4FNLH 1CGYA 1S7WA 4GUPA 1Q0XH 5D9SB 4WV1B 4NQTA 1U58B 5A3IC 4MNGE 4PRNB 3V0AC 3I6GA 4V2CB 3MC0A 1UH3A 4MD5A 1CE6B 4YLQT 1QKZL 4BH7B 1A14H 4WFHE 4P2OD 2ARJB 5EFIB 3SKOA 4JY4B 1T21A 4KKAD 1Z5LB 4N5EC 5KSUB 1JK8B 2C26A 4I4WB 4PJAE 1PSKL 4OV5A 4CADA 5E2TL 4OZHF 2ZCKL 3R1GL 2FGWH 2HMID 3D5OF 4FTVD 4IIQA 4Z7VA 2I27N 2J4WH 5DHYB 4MNHA 4YXLH 3V4PL 3ALXA 4NFCA 4J3VA 5E5RB 3OKMA 3NCEB 2PO6C 1BZ7A 1HHGA 3BISA 1ZEAL 4HWZB 1U93B 1RZKL 1A1NA 5JORB 4KU1A 1NGXA 1R3JB 1JCKA 2FEDC 2VZVA 2AJXH 4E42B 1MQKL 2FYYB 4CVXB 2Z8WC 5K33A 5KN5B 5I76B 1FNLA 1C16A 3KPRB 3KG5A 1S7QB 1U8HA 5ESAB 4P46B 3JWOL 5I1KH 5I9QB 3RNQB 4WV1A 4P23D 4OLZL 1ZGLP 4PRNA 5TE6L 2DOCA 3E6FB 3CFCH 3EJZC 5C0AE 3H42H 4HIEB 1KC5H 1CE6A 2GAZB 4HAGA 3UYRH 4R8WH 2F54B 4BH7A 2ARJA 3IFNL 5EFIA 3WHXA 4JY4A 4C57C 5JHLL 5TQ2L 2PYFB 3TO4B 1Q0YH 4IJ3C 5IGXH 4DEPC 5KSUA 4DAGH 1JK8A 5FUCC 4I4WA 3NZHH 1NBVH 2ZOLB 3FT2A 5ICZB 2X10A 2BK8A 5JZ7D 5DHYA 2Y06L 1TLKA 3DUSB 3OXSB 1ES0A 5ADPH 3CXHK 3X3GH 3TBSA 1VFOA 5DGQA 4ALAL 4WUUD 3SBWC 1NGWB 3GKZA 1DBML 2O5ZL 1GGIL 1AQDB 4HWZA 3DPBA 1U93A 5IWLA 3P73B 4RMUA 2EE9A 3TF7C 5JORA 1S7TA 5DVKA 3EYUL 5JR1H 2J5LC 4MXVE 1R3JA 4Y7MA 1ZSDB 2DLGA 2DD8H 4GRMB 4MB3A 5JQHC 4KRPD 2VXUH 3F7PC 5H94B 4E42A 1PG7H 2PTTA 2FLBT 4H8WL 4RQQB 3C9NB 2FYYA 4CVXA 4DVRL 4Y4KD 5I76A 5KN5A 2Q8BL 4KI5C 4X9HA 4JDVB 4M02A 5JO5B 2MWCA 3KPRA 1S7QA 1HHJB 5D7IE 1MJUH 4RA0C 5ESAA 1NEZB 4M3KB 4P46A 5F8RC 3RNQA 5J6GB 4M7LT 2IAND 4IRJD 2A9MH 2H2SD 3C5ZC 3E6FA 5EBLA 4C56D 3MFGB 4MX7A 3M1BA 1A2YB 2QQLH 1T22B 2P42B 1CICC 4WY7H 2NY3D 1CGSL 3MRMB 2BZDA 2PYFA 1NCNA 2X09A 3CFIC 1JHLL 4YHZH 1A5FL 1BLNB 3BKMH 1JNLH 1QFWI 4LLQB 2P7TB 4ONHB 3STLB 3IRPX 3QDJA 2ZOLA 3WFDH 4KK9D 2AEQH 1EH9A 2Y5TB 4PRPD 4BFBD 3MOQA 4U6HB 3BMVA 2NX5D 3DUSA 3OXSA 4M5YL 2PO6B 5AZEH 2ICES 4ONOA 5GRYA 4JG0L 1NGWA 3K2UH 5T1KB 4DWHA 3DRQA 1AQDA 3P73A 2QL1A 3V95A 3QG6A 3GBNL 5E2JA 1FPTH 4ELME 3IFPB 3S9DB 1ZSDA 3BDBA 5H94A 4LCYB 3RHWF 1X5LA 1SEQH 5DURB 1M4KA 2VZOA 3C9NA 1JTPA 1QSFB 3MCLH 4K94L 3TT3H 3ARVA 4N0UB 4JN2A 4N5UA 5IR1B 5JO5A 4HW6A 2AP2A 1HHJA 3NAAL 4PJDB 1RZGB 4RISL 5D6DC 8FABB 2BSRB 5J6GA 3ZYIA 1LDPL 4XAWH 1BP3B 4GOSA 3RWJB 3VMOA 1Q9KB 1ZVHA 4DEPB 1A2YA 3GJFH 5A16A 3MRMA 1ACYH 4AYFA 3CC5B 2NPLX 5E9DE 5EB9A 4E9LA 3LZFL 5E8EA 4N90E 1U92B 2P7TA 4LLQA 3EOAB 4FQCH 4ONHA 4U7MA 3STLA 3ZZ1A 1Q9OB 5AYUH 4OF5A 2Y5TA 1UM4L 2AK4D 2NYYC 3DX6B 4PB0H 4R26H 4U6HA 1FH5L 4HLZG 3SY0B 2JCCB 2PO6A 1E4WH 5GGTH 2I9TA 4MSWB 3DVNA 1FBIH 3BIKB 1SJEB 3WFHB 2AEPH 4X98B 1EJ6A 2J5LB 2LTQC 3K3QA 5IROC 3MV8E 4CU6A 2NY1C 4I9WE 5HHMD 4GXVH 1A02N 5MENB 4P2QE 5HYJB 3RNKB 4LCYA 3S34H 1QSFA 2Z4QB 3SO5A 1WT5C 5IR1A 3FQXB 4XC1L 1RZGA 1PLGH 1L4IA 1YN7A 8FABA 1RAMA 2BSRA 1VSCA 5MEPA 3QEQD 1HQ4B 1KF9B 1LHZA 5DO2C 4UT9H 3RWJA 3WBDA 4X6DB 1QZ1A 1NDMA 5DMJB 5EC1A 1Q9KA 2AQ3A 2VWEC 1F4YL 1ZV5A 2ADJA 2WIIA 1HSBB 4I77L 2W0KA 3CC5A 4DKEL 3QUZB 1J0ZA 1M1SA 3ZE0F 1ERNA 2B20A 1U92A 4X7CC 3C8KB 3EOAA 2QTEA 1N6UA 1Q9OA 5IMMB 1H3PL 3PP4H 5JXAL 5IT2L 3NIFF 3DX6A 2BXZA 4O9HL 5IFHL 3SBWA 4G8GB 4S1RL 2JCCA 3W2DH 3FB7A 4OSUH 2ZUUA 4MSWA 4CBPA 3KYOA 3BIKA 1SJEA 3WFHA 4X98A 1U2CA 4LQFL 1IAIH 4X4ZA 1FFNB 4R2GC 2BNQE 5MENA 2X4QB 5IESL 5ISZE 1N0XL 2H32B 5EZLB 1OW0C 3QEGH 5HYJA 4PLJC 5AAMA 3O81A 2DLTA 1INDH 3RNKA 3MV7E 1JN6B 4Q9QH 5GSVB 2Z4QA 2IBZX 5E99H 3OGOE 3VW3L 3BP6B 3PWJB 4I3SH 2FX9L 4XHJD 1F4XL 5F97E 3BQUC 4PJEA 1LP9E 1MF2H 3HUJB 1K3IA 1HQ4A 4G9FE 4HUMB 1AE6H 3K4AA 3MROB 4WI7A 3V2AR 1QRNB 1NMBH 1CICA 2QQKL 3VWJD 2EICA 2MPAL 5I1LB 1WCBB 4GQ9H 1FFQA 4NKQB 4CRPA 5HSFA 1Q38A 4QOKB 3QUZA 2B0SL 1BQUA 1NC4B 5E2UL 4HS3B 5IMMA 4Z5RB 3BZFB 3IS0X 5E1AA 4NDMB 1H0DB 3SJVE 1EVUA 2G5BA 2NY4D 3NVQA 3ULVC 4G8GA 3MLXH 1WF5A 3AS0A 3DETC 2NY1B 4D9QD 4KJPC 4XP4H 3JV6B 4AEEA 1MAML 2X70A 3WLBB 4OFDA 3INUH 1MLCB 5CEZL 3DUHA 4OI9A 4Y1AD 4A2LA 1FFNA 2NR6D 4UQ2A 1KYOK 2VDRL 4LU5H 3FN3A 2W9EL 2VLLB 2RHEA 2H32A 5EZLA 1U8IB 3H9SD 3SDXB 3BEWB 3FOLB 4PJ7E 3DURB 1JN6A 4M3JA 5GSVA 5D2LB 1MRDH 5C08B 3TYGL 3I2CH 5D6DA 3QUYD 2I60H 4JKPL 5I19H 3BP6A 3PWJA 3DECA 1ADQH 4NJAL 4F9PC 1T1YB 2R1YB 3RL1B 3HUJA 4RDQG 4RX4D 3MROA 4YO0A 4HPOH 1QRNA 1G9MH 2UZYB 3MFFA 1F5WA 3CVHL 3NCYS 5L0QB 1B2WL 1WCBA 4JGJA 2Y7QB 1AH1A 4QOKA 2VLRA 1SYVB 4LSDA 1NC4A 1IGCL 3PGFH 5KVFL 2HJFB 1FORL 1AKJB 4Z5RA 1CDGA 3BZFA 3CFEA 4YH6A 2V7HB 1CU4H 5DJDB 4MHHG 4NDMA 2FSEB 1GOFA 3PIQB 5CKGA 3N1GC 4C4KT 4FMFA 3BSZH 2KKQA 4H1LG 5FYKH 1MVFA 5IROA 5DSCB 2IFGA 3WLWC 3S37X 4X9IA 2R0LH 3JV6A 2VLJB 1HCFX 2WANA 3AM8C 3I6KB 3WHE0 3WLBA 3WO4B 1MLCA 1BZ9B 1V3MA 2VLLA 3UZVB 5KVDH 1U8IA 4JM2F 3FFDA 3SDXA 3BEWA 3FOLA 1IGIL 1WT5A 3DURA 1FNGB 5GIRB 4NHUB 4JCLA 1UH4A 3GNMH 5DRXB 5D2LA 5C08A 1TTFA 2JKXA 3BQUB 2DQUL 5FOBB 2C4FT 3UTSD 3Q6FB 3OKNB 1XGYH 1T1YA 3ET9F 3FB6B 2R1YA 3T09A 4POZD 4M1GL 3RL1A 2DDQL 5DO2D 5TPWL 1E4XH 3I3EA 3LPFA 2CK0H 3DYMA 5ACLA 2O5YL 4F57L 2R9HC 1ZE3C 1B4JL 3P30L 2Y7QA 1CBVH 3BPOC 1SYVA 3PNWB 4PJFB 4U1MB 2OZ4H 4OZGF 2HJFA 3GMOB 1AKJA 1W8OA 3ARQA 3VDBA 5HGBB 2XQYK 2V7HA 3OKEB 1GSMA 5FB8B 5JNYA 5DJDA 4CKVX 1FSKC 3VWKC 2FSEA 3PIQA 4QRSB 1R24B 4LDOB 4KUZH 5JMOC 2OJZL 2D7TH 5D7JC 1XF4A 3VDCA 2VLJA 1BQLH 4OLWL 3QNYB 3OKKB 1OW0A 1TFHA 2NTFB 3VFUB 1BZ9A 2X89D 4XPAL 1RUMH 3ZE1E 3OF6D 1GGCH 4O00A 2Y07H 3OWEA 2CH8A 1FNGA 3O9WC 4NHUA 5FHBH 3WV0A 3LS4H 5BJTB 2WK2A 3BQUA 2HFEB 4ENED 3ZKMC 2XZAH 1C1EH 1ETZB 3MRJB 2GI7A 1DQQB 1YNKH 5FOBA 1ZKAA 1CD1B 2Q7YB 2C4FU 3Q6FA 4LSTH 4CVZA 4L9DA 3FB6A 4R0LC 4O58H 3WIFB 4M43H 4NQCE 5MI0C 5HJ3A 4XVUC 2APBA 2BY3A 4WHYG 1DP0A 5IHZB 4Y8AA 5IBTL 1MHHB 4PJGF 4QGTA 5CP3H 3QZWB 3W81A 3RWGA 4N0RA 1Y6MR 4YXHH 1GOHA 1KG0B 3PNWA 2VC2L 4G6MH 3BO8B 1A7QL 2NY0B 4U1MA 4JFXB 4D94A 1DVFC 1N64H 2BOCB 3GMOA 3MGOB 4U1IB 5K9KA 4YHNB 3DJ9A 1MCOH 4H0GA 3LIZH 3UAJD 3OKEA 4FQ1L 3TC9A 4QRSA 1R24A 1SMAA 5GGUB 3GSXA 5SX4H 1WICA 4MNQB 2H2PC 3TM6A 1NCWH 1DL7H 2V5SA 3L5HA 5GXBB 4H88H 3QNYA 3VI3F 1BF2A 3FFCE 3VFUA 4CJ1A 1LO3H 1RJYB 1KTDB 5C6TL 4MD4B 3SDYH 5KVEL 1VB9A 4PJBF 2HTKD 1I9RH 5T1LA 4F9PA 4L4VE 3G6JF 3LQZA 3VXMD 3MRJA 3MUJA 3O4LE 3EHBC 1DQQA 5E6ID 3UJIH 1CD1A 2Q7YA 4YBQD 2GK2A 3WIFA 4KGJA 5F3BB 4NO0B 3ULUF 2EDNA 1XGPB 2D03H 3FZUD 2XKUA 4BFEA 1DR9A 2MCPH 5IHZA 1MHHA 2CIIB 3IYLW 4YZFF 3PG2A 1KG0A 3KDMB 4NQSB 3BO8A 1TVHB 4JFXA 1FSKB 2BOCA 3MGOA 4RAVA 4RFNC 4U1IA 3NMEA 5CS7A 4YHNA 1ZT4B 4HEPG 5C7XL 4YHMH 1KN4L 7FABL 5D7JB 3VI4F 4U0RC 4OB5L 5EOCL 1QHOA 2J88H 5GGUA 3AM8A 3FQTA 3U46B 4MNQA 1A3LH 2OTWA 3PXHA 1XF2A 2F19L 4HIJB 4WU5B 3VXUE 1NFDB 2F5AL 3VFNB 3I3DA 1RJYA 3RX5A 1KTDA 3BIAX 3PWVB 3O9WB 5FUOL 1MCKA 4M6AA 2CKNA 1KCUH 4WWKD 3V0WH 4MD4A 1VDGA 3IDIB 3WSQH 3VG0L 2EXWD 4FQXB 4HXBL 5ICXA 5J1AB 3MLSL 4R0LB 4OZFG 3AREB 3BESR 1BFSA 2VN7A 3MOBL 2CDFB 1JUFB 4XC3L 5E4IA 1SBSL 5E4EC 4NO0A 2JIXB 3LHPH 1X5JA 2QSQA 2HLFD 4JO4H 5F3BA 1FZKA 3IU3B 1XGPA 2AGJH 3RVTC 4Y4HC 1INQA 1OAXH 3KPQB 4NQDD 1CXLA 2CIIA 5GJSL 1DQMH 5INCB 1DVFB 1YPZB 4S11A 4M62H 3KDMA 1L0YA 5SWSB 4QHUB 4JM4H 2DBJA 3C60C 5HBBA 3FONA 1TVHA 5C0FB 1TETH 3CD4A 5FM8A 2E27H 3VWKA 2UZXB 5F9AC 2AERT 2VE6A 3D87B 3DTXB 4S1SL 5DK2B 1DBKH 5D7JA 1CDHA 2IH3B 3BPLC 1G7QB 1RVFH 1WFUA 2IFFL 5BQ7B 5I1IH 1YNLL 1VACA 4WRLA 4C83A 4UAOC 3D85D 1A7OH 1G6RH 4HIJA 4WU5A 1NFDA 5KS9E 1W0WB 1DQLH 3VFNA 3PWVA 2AS5M 3O9WA 1RIUL 3D18B 4MAYD 3VMPA 2NCMA 2YRLA 2R2BB 3QBTB 2NW3A 4J3UA 4LHUD 4FQXA 2QSCH 1NPUA 3KPTA 2WZPD 3BEVB 1J0KA 4R0LA 3RBSA 2HJLB 3AREA 3DYOA 3FO1A 1UGNA 3SQBA 2CDFA 3S6CA 1MELA 3CXDH 3BKJL 2JIXA 3L5JA 1CQKA 3BVNB 4Y4FD 1JGLL 1HINH 3IU3A 4Z7WE 4UUJB 5KZCD 1P7QB 5E5UB 5C07D 3KPQA 2AJ3B 3ZYZA 3P4LA 3MGAA 3RY5A 2D4DA 2X4OB 2GJZB 1I1YB 5INCA 3SCMD 1DVFA 1YPZA 1BEYL 4MXQD 12E8L 1ZANL 5SWSA 1IVLA 4QHUA 1Q72H 4XNQA 1ULVA 2JLLA 5C0FA 4U0RB 1UKSA 1RSFA 1GZPA 2D7MA 1T89C 1YY9D 2F9BT 3QP3A 3DTXA 3H3PL 3W9DB 3UPRB 5DK2A 3SDCC 1KGCE 4JZOB 2IH3A 4PJ9C 1IILE 1X5KA 3FJTA 4GAGL 2OBGA 2M1KA 1G7QA 5D6CB 5D2NB 1K5NB 4HKBB 2H2PD 4CU7A 4WTZA 5BS0B 4ZAKD 5C2BL 4PS4H 1JF5A 1KV3A 2V5YA 2O5XH 3OAYH 5IW1B 1H15A 3GZKA 4K23L 3MRPB 2LU4A 1X5HA 2R2BA 3FN0H 4G7YL 4NN5C 5DD3H 4YHIB 1Z0NA 4HV8A 4QXGL 3TIEB 5L8JB 3MRNA 2C3GA 1IGFL 2UV3A 4P5TC 4AJ0A 5BZDB 2HJLA 4EI5B 5E4EB 4ZTPL 4DUVA 2VDNL 3V7MA 2JF1A 3AS2A 1JRHI 3EIFA 4Q0XL 3BVNA 4P2RD 4OZHE 5CJXC 2X42A 4NBYB 3S4SA 2JK5B 3TJEL 4Z7VF 2A2QT 3QRFM 2AJ3A 1WQVT 4MAUL 3GMRB 2GJZA 1I1YA 4LEXL 2FHCA 5K9QG 5GHWH 2B2XH 3D2UD 1FYHB 2NMSA 4NKDB 3W9DA 4EVNA 2HVJB 3UPRA 4XCFL 1MJ8L 2V9QA 4JZOA 1UM5H 2FX7H 3N06B 5DMIH 3BW9B 2VKWA 1FNAA 4UAOB 2X4SB 1MWAB 4GLRI 2R1XA 5D6CA 1K5NA 4HKBA 1R3LB 3V9FA 5BS0A 1Z9MA 2HT3D 4AEHL 1FFRA 4EIGB 5IW1A 1RI8A 1HYSC 5FKPA 3U9UA 1LE5A 4JRYD 2FX8L 4LLWB 2YSSB 3MUHL 4LLYB 2AXGB 3FO0L 4YHIA 1RZJH 2YPLE 3FHAA 3IAQA 1RPQA 5J9PA 4P0DA 4RMQA 3CX5K 5KSVB 5BZDA 4EI5A 4NZUH 5CJ8A 1J8HA 4Y4HA 1MIEH 3AU1B 3B2VH 3MXVL 2EZ0C 1G1YA 3F62A 3F7YB 1KENH 4L4TB 1XAUA 1PG7X 2EEAA 4OKVB 4KMLB 3C60A 4Y89A 1AGBB 1XGQB 1J0IA 2W07A 4ZUUB 5D7SL 1C5BH 3T1WA 5LWYH 2FL5B 1FAIL 4NKDA 4U4BA 1G9NC 1H9VA 5DD0L 15C8L 1JFQL 5DJYB 4TNVK 4AT6B 5LJYH 3AFLA 5C0BD 2X4SA 3BD3A 1MWAA 5I1DB 3O3UN 3KPSD 3D39B 3FT3B 1R3LA 3DMMC 2ZG3A 3L3DA 1D5IH 1KFAL 5ENWB 2P8LB 4XP1L 5IFAL 4PP2B 3C8DA 2EEBA 4LLWA 2YSSA 4LLYA 2AXGA 4QHNB 5AUMB 2Y4SA 2ZUSA 4LKXB 4P5TB 3KXFE 2GITB 1X5FA 2R56L 5FYKD 4XRCB 4HS8L 5KSVA 1WFTA 1U8MB 4UIKL 4XAKE 4JR9L 4MDIB 4BUHA 3CH1B 1MCLA 3AU1A 4HLJA 3KYAA 3MA9L 3ARFC 1M71B 2CO7B 3ESUF 4HMDA 3HC3L 3EO9L 4OKVA 3GBML 1AGBA 4XPFH 4ZUUA 5ELIA 5GS0C 1T89A 4WFFE 1MFBH 2FL5A 3SDCA 3CXHJ 1C08B 3QDGE 5JW4Q 1FJ1B 4JO2H 3KHOA 3OAZH 2P5WD 2R4SH 4AT6A 3BKCH 5L7XH 2P8PB 2V2XA 1CCZA 1KN2H 3QEHB 3CDGB 5I1DA 1MH5B 3HKFA 2C7UA 3EO0B 3D39A 4FQPA 3FT3A 3MNZB 4D3CH 3C08L 4PPTA 4LLUB 1SVCP 4HUVB 3QDME 2P8LA 4PP2A 5EU3B 4X5LA 1AY1H 1KJMB 1PKQE 3HI5H 5IBLC 4OT1L 4X9FA 1NCAH 3HNVH 2HH0H 4QHNA 5AUMA 2R4RL 4RWYL 4LKXA 5JPMB 2LV4A 4P5TA 3SE4C 2GITA 5T3ZE 3PWUA 4KVNH 4XRCA 4NWTH 1U8MA 1EUTA 1RURL 4X7TB 5CJXA 4JKWA 4ZTOH 2D31B 3CH1A 3TCXA 1VFAB 1JYNA 1T80A 3LEVH 5CSGA 3ZSSA 3LDBB 1QFUL 3UXFA 5CJ5A 1M71A 2XY1A 4NN6C 4JFZH 3ZSTA 2NY6C 4BZ2H 3QHFL 4EQ3A 1BAFL 2Q3ZA 5HDBF 1F02I 1C08A 3IDYC 3NABL 1V7NL 5F96L 5J4MA 3KLHC 4HBQA 1FJ1A 2NNAB 3VFSB 4N68A 3JXAA 2P8PA 3BRDA 3QEHA 3MRDB 2Z31C 5GGRY 2FCBA 3BZEB 3L5XH 3EO0A 4RGOH 3MNZA 1EBPA 4U2ZA 4LLUA 1Q9WA 3HLAB 4FQ2H 6FABH 1NSNH 2A9NH 4HUVA 1F4WH 3TJHC 3IKCB 1HYSD 4YX2H 5EU3A 1KJMA 1NANH 1FO0B 2R69H 5EZIL 4PRIB 5EBWB 1J1PL 4P23B 1OP5H 1MRFL 4PLOB 3R0MA 4QRRB 3AB0B 1MOEA 4D9RE 3CDYA 1YJDL 3MV9D 4MZ2A 5I74C 3PHQA 1INEH 1AR1D 4OZIA 4AEFA 3C6LC 1U6AL 4ZNEA 1GGUA 3ARFB 2VXQH 3LPWA 4PJAB 4L8BA 1VFAA 3QAZC 5I73B 4I0KA 5ABDE 1CD0A 5ALCL 1WEJH 3F7RA 4JN1L 3NIFE 2FB4L 2A0LC 2JCCF 2I5YH 1U3HC 1FLRH 4BH8A 4PJCE 2NW2B 4WFGD 5DD6A 2CO6B 4CAGA 1YEKH 3IU4L 4PGEB 1JF1B 3JV0A 4HD9A 1XGRB 5HDOA 1TXKA 4P59H 3VFSA 4G43B 2AJSH 4XNZC 1A14L 3DMMA 4KI5F 1ONQB 3OG6B 1QSED 4UOW0 3BZEA 3TGXA 5E1HB 1P7KB 4U6XB 2BERA 4TNVF 1IJ9A 3HLAA 3WIIH 2WBKA 3IKCA 4TQEL 4KAQH 5FAAA 4PJEF 2FJFB 1FO0A 1EO8L 4PRHD 4PRIA 5EBWA 3VGBA 4MNGA 2D9CA 1Z3GH 1QFOA 4QRRA 3QXWA 3QXDB 5LBSH 3BE1H 4X6DF 3I6LE 1FIEA 4EBQL 5JA9A 3P40A 3VFPB 3KR3H 4AL8H 4GRLC 2AJXL 2NY3B 2HT4D 4JVPA 4PJXB 4WI5A 4KY1L 3ARFA 4PJAA 2W0LA 3FAWA 3GMLB 2R2HA 4HMEA 1OP9A 2IBGA 2YC1B 1U8PB 1U95B 2VJXA 4X9BA 1QEWA 1KPVA 3P9LB 2DKUA 4YQXH 1B6UA 1R5WB 5DJAB 3WS3B 5JTWA 3UTZB 4AEIH 4AIOA 2NW2A 5J6HA 3ULVL 1QYGH 4PGEA 2A6IB 1JF1A 5INDB 3CFCL 1A6WH 3H42L 4X6EB 1XGRA 3QHZH 1KC5L 3C87A 3PHOB 2Z31B 4G43A 1ONQA 4KJYB 2YD4A 1Q0YL 1BD2E 5IGXL 2RJMA 1P7KA 2VR5A 4UDTB 4DAGL 1NBVL 1RFDH 2Z9TA 2MTPA 4PBWD 4PR5B 1HHHB 4I2XB 1BVKB 5ADPL 2FJFA 2H3NB 3VFRB 3SE4A 3HUJF 1KACB 2VO5A 2CD0A 4XP6H 1SJXA 5HHXH 1F2XK 2DJ4A 5I74B 3QXDA 1D5ZB 2XRAL 5C0AA 3SKNB 5I15H 3JWDH 2E7HA 2GJ6E 1CDJA 4R90L 4M7JH 3HNSH 3C6LB 3KLAB 3VFPA 3QAZB 3O3BB 1UZ8B 1LE9B 1X4XA 4CNIA 4C58B 2DQTH 5TDPB 3QDAA 2VXUL 3KAAA 2ATKB 2APVA 5KSAD 3GMLA 1J7VR 3GFUA 1U3YA 2YC1A 3UJTH 2DQEH 1U95A 3T0WA 5FUZH 3P9LA 1MJUL 1CE1H 4HZAA 1R5WA 5DJAA 3WS3A 3V8CA 4ZUSB 1S7XB 3VFWA 5IEHA 5INDA 4XNZB 4LOUC 5CEYB 4X6EA 3DROA 1V05A 5HHMB 3PHOA 2Z31A 4OTXL 4HUKB 4BELD 4DUXA 4JFFE 5TE4H 4ZG1A 3SDXF 3DUUA 4M9PA 5FM5M 4K9EH 3QT2A 4WY7L 2XV6B 4KJYA 1KYOJ 3CSBA 4UDTA 4YHZL 2MSPA 3BKML 5D2LF 1EEUA 1JNLL 1MQ8A 1VADB 3PWPE 4KJWC 2P5EE 3WFDL 4WFEE 1AFVH 2AEQL 4JE4B 4PR5A 4JVUA 2PN5A 4I2XA 1BVKA 1XZ0B 1WCQA 2H3NA 3VFRA 2EC9T 5C8JB 4P4KD 2OK0H 2DBLH 1YYLH 4DJMA 1FRGL 1V3KA 3K2UL 4ZUVB 4XNUH 1KCSH 2ZNWA 4GRLB 1GXEA 1FPTL 5ACMA 3C6LA 3KLAA 4ZOAA 4ACPA 3T0EE 1F6FB 1UZ8A 3O3BA 1LE9A 4G8IB 3X12A 1VEMA 3O8XC 3OX8A 5MP6H 1S78C 5TDPA 3D9AH 1SEQL 2ATKA 3MCLL 3X11B 2VNCA 1U3HA 3RP1A 4HJGB 4LLDA 2UVEA 2Q6WB 4J3TA 3EAKA 1EFXB 5IB4A 2F74A 4NWUH 4ZUSA 1S7XA 4FQJH 4QNPF 2C1PA 3BDXA 3MRRB 1BBJA 4LAQL 1RZ7L 4ELMA 4J4PC 4P2QB 3RWIA 2YMXL 1CGXA 1ACYL 1QD0A 4PY8J 5DRWA 1VADA 3D25B 4FQCL 1OTSC 2QHRH 4PB0L 3OKDB 4R26L 3QUMH 4XB8A 1XZ0A 1CIUA 5C8JA 1E4WL 2EC9U 3MJ7B 4HJ0D 2DKSA 2J6EH 5ESQA 3QCUL 4ZUVA 4B7IA 2AEPL 4OFIA 4XMLH 2X9YA 4GRLA 4GXVL 1W0VB 4PJGE 3VWJB 1F6LL 3NCMA 4MJIB 1ZWIB 1A22B 1VENA 2DLHA 3OMZA 3WIHA 5E9DA 4ZDHB 1F42A 3S34L 3ULVF 3X11A 2AEWA 3WUWB 4PJ5B 5CMAB 4HJGA 1ZA6B 1J0YA 4H0HB 4M93B 3DGCR 2Q6WA 2NY4B 3AMLA 1EFXA 1PLGL 3A6CL 2DQDL 1FNSH 5HHQA 2HG5B 3GSWB 4UT9L 5F70A 3C2SA 3RVWC 2PR4L 3HB3C 3MRRA 5HY9B 1IKNC 4Y1AB 3TA3C 1CL7I 3MV8D 3LB6D 3U36B 1P84J 1QRKA 4P2QA 3H9SB 4O02H 4HZLB 2VLMD 3MCG1 3MV7B 4H20H 4F37F 4PJBE 1IGMH 1ZS8B 3D25A 5C09E 2D7PA 5HHPA 1CG9A 3PP4L 1IZJA 5FGCE 4F58H 3DI3B 4I3GA 2AJUH 3A6OA 4HHAA 2QKIB 4PG9A 3ULUE 5IQ9B 5HHNB 2F5BH 4WHDA 1IAIL 1HIMH 1S8DB 1KCRH 3QQ4B 3DO7B 1W0VA 3O8XB 3KYMB 2FGZA 3PDGA 4MJIA 3QEGL 2EEDA 4DK6A 3L1OH 3PL6C 4ZDHA 3X3FH 2E9IA 1PGRB 4X7EC 4CU8A 4X6BB 3NCFB 4OCLC 5E99L 4PJ5A 1ZA6A 4JQVC 1YQVL 3VI4E 4I3SL 3SJVB 3GSRB 5GRVK 1CXHA 4U1NB 4KQ3L 2ENSA 1CGUA 1MHEB 2XQBL 2HG5A 4HIXH 1N5YH 3QQ3B 1NMBL 5HY9A 1A0QH 1XEDA 4XPTH 2CRMA 2FD6L 3UYOD 5ISZA 3U36A 1WGOA 3O6ML 2BNQD 5I18L 3ARDC 4GQ9L 3RDTD 1SM3H 4HZLA 4YXKH 4Z7OF 1K3ZA 3MV7A 4Y5VC 2VH5H 4KJWD 1ZS8A 5GRUL 5E2WH 5SV4A 1FYTE 1XT5A 4GBXC 3F5WB 3MJ9H 1BMGA 1T04B 4IMLB 4JPVH 4QKXB 3MLXL 1IC1A 5D7LB 2QKIA 3KPMB 5C0NC 4XP4L 4H5SB 4G9FA 5IQ9A 3ZDYF 5HHNA 1SY6H 4JFPB 4C4KO 1XIWD 1S8DA 3INUL 3ZT6A 3MCKB 2W59A 3QQ4A 3DO7A 3O8XA 5C0EB 4LU5L 4RGMC 5EOCJ 3NFSL 4HCRH 1WUNT 2R2EB 4Z9KB 3WL9B 4U1KB 3DXAE 3QWRA 1OCWH 2QQQA 1GYAA 5TH2A 5E8NB 4X6BA 4YAQB 1SHMA 1MRDL 1F4AA 1DEDA 4OKDA 3H9YA 2I60L 5I19L 3IDGB 1ADQL 3SJVA 3GSRA 2I25N 2G2RB 1KEGH 4U1NA 3HG1E 4MB5A 3JWDC 3WNKA 1MHEA 2K9UA 3RU8H 1NFDF 1WBZB 1IARB 3GM8A 4J4PA 4HQQL 3VE0B 1J1XH 1TTUA 4UT6H 5BVJB 1P4BH 1T1ZA 4DKFH 1A3QA 2FIKB 1XGUA 3RVUC 4TTDD 5JOPD 4I8DA 1MI5D 4Y19E 4GFTB 3IVKB 4HGWB 2YXMA 3OXRB 2YZ1A 1CU4L 2E5EA 4OZFH 1P4IH 3E3QC 4M1DH 3F5WA 3P9MB 4IMLA 1T04A 2WINB 4JANB 2HAZA 3AS1A 4WUKH 3BSZL 2X4UA 5FYKL 5D7LA 4PBXA 4AG4H 1ZLSH 3NCBB 4H5SA 2R0LL 1UYWH 2BDNH 4JFPA 3OPZH 2EE2A 3MCKA 1BVLB 4S10A 1AI1H 5C0EA 4XP5H 3PL6B 5MEOA 1IT9H 1QFHA 3QUXD 1YPZF 4MDJB 5KVDL 2AKRB 1NFKA 2R2EA 3WL9A 4U1KA 2OP4H 3AAZB 1YN6B 1DFBH 4G5ZH 5E8NA 3GNML 1NEZG 4YAQA 1R0AH 1N5AB 1CDBA 2G2RA 5I17B 4I13B 4EEEA 4E0RA 1XGYL 1A6UH 1IKNA 4BFIA 5L88L 3TA3A 1E4XL 3WNPA 1UB5B 1WBZA 1QQDB 2CK0L 3VE0A 3L3JB 1ZVYA 3ARDB 3TEUA 4LEOB 2WBWB 1OB1A 1VHPA 3LN4A 5BVJA 4Y5VB 3WUZA 3ZDXF 3MUY1 4JDTH 5DJCB 1CBVL 1BOYA 3FB5A 2ILLA 3CVIH 2OZ4L 4GBXB 2OTUB 3NIDF 3VJ6B 3IVKA 4HGWA 3OXRA 3KPNB 2IADB 3P9MA 4JANA 2WINA 4RBPK 2FATH 2X7LB 3BGFB 4KUZL 3MRBB 2D7TL 1A7PL 2YEZB 4TRPH 4RGMB 2OQJB 5DDHB 1BVLA 1UWXH 2KH2B 1RUML 3CLEH 1GH7A 2EO1A 2BMKA 3PL6A 3RGVD 4HKZB 2Y07L 3AAZA 2XPGB 1YN6A 4JQVA 4NKMB 3BOVA 1VEPA 3LS4L 2QJDA 3DX7B 5J8OA 4JY6B 4NNPH 2XWJB 1N5AA 3SGDI 3PHSA 5EDXA 2XZAL 4L8CA 3MYZA 3B83A 1YMHA 4LGSB 5F1NB 1KT2B 5I17A 1IM9D 1PX4A 2NXZD 3QYCA 2VR4A 4XH2B 2NY2D 2ZCKH 4M43L 3F8UB 3UTTD 1QPPA 1UB5A 2OLDA 1I7RB 3E2HC 3SO3B 3W11C 4AQOA 5DMYA 2Y25A 3ARDA 2N1KA 5DHVB 4J8RB 5JUEH 1CYGA 4Y5VA 2OM5A 5L8KB 5EIIB 3CSGA 1NMAH 4WWKB 3CU7A 4YXHL 2XIDA 4Y16D 2E7CA 4XCNA 1KXQE 4G6ML 4CMHB 4I3RH 3N9GL 2XY2A 4GBXA 4LP5A 1N64L 3NIGE 1K8IB 2OTUA 4I18C 3VJ6A 2BY0A 4L4VB 5DA4A 3QEUB 4ODTH 4P99A 3KPNA 3B5GA 2QQNH 3HMXA 4LKCB 2X7LA 4HWBA 1RU9L 1UJ3B 3HPLB 3MRBA 4V2BA 1T7VA 1CDIA 2YEZA 5KBNC 1NCWL 1DL7L 5F6HI 1S7RA 5HYQB 4KKBD 4NQCD 5DDHA 4P5KB 5C0IA 3NA9H 5DT1H 1ODAA 1WAAE 1LO3L 1L9NA 2DLFL 5EU7E 4HKZA 1ZGLB 1OY3B 2XPGA 3MZGB 2I07A 3DX7A 3LN5B 2XWJA 1XF3B 5DRZB 1T5WB 5TQ2H 3UJIL 4LDLB 5F1NA 1KT2A 4XH2A 2Y1VA 1I7RA 3VXUB 2D03L 4NQED 4LMQI 4X6CB 5J56B 4QTHA 2MCPL 4YHPB 3BWAB 5DHVA 4J8RA 1VCAA 3FFCD 1NCTA 5EIIA 3RVUD 4H1LB 3VD4A 3Q1SH 2Z35B 1AO7E 1K8IA 2F54E 4LCWB 4L4VA 1BGXH 5B4MD 3BKYH 2VQUA 1F13A 3STZA 2IPKA 2ATPB 2EDDA 3FO2B 4LKCA 4J3XA 2J88L 4H8WH 5DC4B 5FCSH 1UJ3A 3HPLA 3CX5J 4S2SB 1A3LL 4RGNC 1IGTB 1MFDH 4LVHC 1KLFA 2YXFA 3TV3H 4OGXH 1T7XA 2V5TA 3VGHA 5BRZE 2DJUA 4P5KA 5C07B 5CGMA 4RZCB 3CMGA 1UEMA 3E6HB 1IMHC 3SCMB 1NL0H 3MRKB 1MFEH 1JZ5A 4MVBD 1LILA 3SE9H 5SV3A 3LN5A 5J1SC 1VKXB 3CU1A 1LDSA 1XF3A 5DRZA 4OF0A 1T5WA 3QO1A 1A5FH 3E2HB 3FRUB 3T65B 1T7WA 2ICWB 5C9JB 4ODUB 4JO4L 3LHPL 1K85A 3VXUA 2AGJL 5KS9B 2Z91B 1FCGA 1OAXL 3UPCA 4M5YH 4YHPA 1I8KB 3BWAA 1OGTB 2PYEB 1DQML 1C5DB 5D1ZD 3D48R 4H1LA 3RAJH 4M62L 2CK2A 1I7ZB 1TETL 1XR8B 2Z35A 3WD5H 4LCWA 4RCAA 1QOKA 3G08B 1DBKL 2W9DH 4G7VH 4K7FB 3U6RB 4NIKB 1F3DJ 1S9YB 2ATPA 1RHFA 3OB0K 2QHLA 1YMMD 2HFFB 4IDJH 1DJSA 1RVFL 3ECBB 4S2SA 43CAB 1IGTA 2BY1A 4Z7WB 4IOFC 3NAAH 5T5FH 1BOGA 3HS0B 5HDQL 1DQLL 5DMKB 3VGAC 4X5WB 3WNOA 4RZCA 3MBEC 2N56A 1NCBH 3E6HA 4JVWA 2CLZB 2DI7A 5F88A 1FNEB 5HDBE 3QCTL 1NGQH 4HBCH 4MA7H 1JTOA 2QSCL 2EYRB 5JXEA 5GGVH 2X4PA 1TJIH 3VFGH 4TNWK 43C9B 3FRUA 1K9TA 1QSFE 1G7LB 3T65A 3CXDL 3EJYD 3GI9H 4N0UE 3T8XB 1HINL 1UM4H 1DZBA 3GSOB 5KS9A 4H0IA 4PJDE 1EXUB 1A6PA 1UACL 4NQVA 1OGTA 1MIML 2P45B 2PYEA 4KV5F 4PJ8C 1C5DA 1CLOH 4QCIA 1RJZA 5SX5K 1JZ2A 1Q72L 2AVGA 2V5MA 5C0JB 1I7ZA 1BFTA 4QF1B 3V6BR 3NCCB 4F7EB 5J7CC 4JFQA 3RX7A 4OZIF 1S9YA 5FO8B 4RGNB 2WBJC 1IL1B 1IRAY 2BCKB 1EGJH 2EDEA 4PGBA 43CAA 3JBG7 1HHKB 4Z7WA 4PS4L 5EN2A 1IGYB 2FJGB 5C71A 2O5XL 3HS0A 5DMKA 5AG9A 3E1F1 2JCCE 4QY8B 1BIHA 2JB5H 1RMFH 3MR9B 1FV1B 2CDGA 4GSDL 2CLZA 3FN0L 5ADOH 3LQMA 5DD3L 5HVWA 1DUZB 2WWMD 1LEKB 2CRYA 2EYRA 2Q86B 5MENE 3MACL 1F4YH 5DR5H 2JJUA 2HTLD 2AV1B 5HYJE 4R7NB 3OL2A 5C0BB 4PLKC 1OAZH 4BQCA 4S1DD 2QADC 1G7LA 3T8XA 1QFWH 3DHJA 3GSOA 4O9HH 2YK1H 1EXUA 5FGSA 3O0RH 3AROA 4LQFH 5GHWL 5C0JA 1FHGA 4X6DE 5DVMA 3ARUA 3MODH 3QWQB 2K7PA 4QF1A 4F7EA 3P11H 3C5SB 1UM5L 1O5DT 5FO8A 1OD7A 2FX7L 5DMIL 1IL1A 4PJAF 1I1FB 5IVOA 2BCKA 4LSRH 4F7PB 4OZHA 1HHKA 6CGTA 3GSNB 3MBEB 2YBRB 1IGYA 3QJFB 4WJ5B 4KK5C 4G8GE 3WNNA 1S5IH 1AXSB 4OD1H 4FFYH 5HGGS 4I48A 3S5LG 4K8RD 1FV1A 1UKQA 3BDYL 2F53B 4U1HB 4JFED 4JFDB 5I8KH 1K6QH 1U9KA 5KOMC 3JTTA 3P77B 1DUZA 1RZJL 3PABB 2Q86A 3PDOB 1A6ZA 2AV1A 5J89A 2P5WB 4KHTH 4R7NA 4NZUL 4HIIB 2J7LA 1J0JA 3SPVB 2JJTC 1AHWC 4OJFL 2FWOB 1MIEL 2CDEA 4EI6B 3QZWG 4G8EB 1AGFB 1MCDA 5IVXB 2JE8A 5IJVB 3HUJE 3HCVB 5HGDB 5K9JH 3MLUH 3IGAB 4F15B 1C5BL 4P4RB 5CILH 5LWYL 2C5DC 2YPLA 2W9EH 3ARZA 1JZ4A 3C5SA 2HJKB 1FCCA 4UZGA 1NUNB 3EGSB 5F7NC 2QR0B 4IHOB 1I1FA 5D1QC 3RGHA 3BP4A 4F7PA 3R4DA 2YD6A 5H2BB 3GSNA 3MBEA 2YBRA 5B38G 3S3SA 3VDAA 3ZT7A 2BOBA 2VZTA 1AXSA 1UQSB 2XWTA 5HYIA 4M4RA 1FC1A 2CPCA 1A7BA 2ZUQC 4OZFA 1BBDH 2F53A 4U1HA 5D1XC 2OSLB 4U3XA 4JFDA 3B9EA 3HTLX 3P77A 3T77A 3PABA 2KDGA 5A2FA 4GQPH 1WISA 2QADB 3BH9B 2GKIA 3ULUH 5KVMC 4JRXD 1AC0A 1UM6L 5IW3A 3SPVA 5D2LE 5C08E 2FWOA 1IAOB 2EE6A 2BSSA 1HEZB 4QEGA 4G8EA 1AGFA 4TNWF 4HIHB 4PJ8A 4JPWH 5IJVA 4XPFL 2VWEE 1QR4A 3IGAA 4OI8A 1YYMH 4P4RA 4M1CD 4N1EA 1MFBL 3NFNB 3LEXB 3KXFA 4O4YL 5GGSB 4JZJB 4KJQC 4ZFOA 3MV9B 2HJKA 3OHXB 4NO3B 2R4SL 3EGSA 3L3OB 3BKCL 5DMGD 5L7XL 3QIWD 4IHOA 4PY7B 4D8PB 4WI3A 4P57B 5B3NA