3JV4B

Crystal structure of the dimerization domains p50 and relb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
115
structure length
115
Chain Sequence
ASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor RelB
publication title A structural basis for selective dimerization by NF-kappa B RelB.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 16
structure length 115
sequence length 115
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jv4B00
1LO4L 4U0QB 3MRCB 5HHOE 2ITDB 2I5YH 3RTQC 2G60L 3TZVC 4OZGF 2EIZB 2HH0L 5JW4M 4ZTOH 4LRIC 2QKIA 3QQ4B 1OW0C 5DI8A 3VI4E 3ILPB 2CK0L 3K4DA 1RUQH 4DGIH 3TO2B 3NVQA 4HJJH 4Y7MA 1SJXA 5IW1B 3QUXC 4L29B 1C1EL 3ARTA 2R1YB 3ZYZA 1G7MA 4KHTH 5CINH 5HPMA 5H37G 2FX8L 2FSEA 3UYPA 1EHLL 4LCWD 4NKIH 4G6FB 2X10A 5IEHA 4G7YH 2V9TA 4J3SA 3B9KA 5E8EB 1U3HD 5DTFA 1CWVA 3HFMH 2R1WB 3U0TB 3MCKA 3RNKA 3H3KA 3SDCA 5GSVB 5DO2D 4RWHA 1FE8H 3WN5B 3L3DA 1T0NB 5CEXA 1IEAA 4NRXB 3KPRB 4LKCA 5F1KC 1MRCH 3QIBB 5FV1L 2RB8A 5GGVH 4AEIH 2FO1A 3UTZA 4XCNA 4FQ2H 5J3HD 3O6FA 4UU9B 1CGYA 3DWTA 1I3VA 4PD4J 2KKQA 5BZDA 1YZZA 3SDAA 4H8WH 1KFAH 4JO3L 2P24A 4OZGE 5E8NA 2YSSA 2XRAH 1E28B 1TPXB 1WK0A 2XQYK 1FCCA 2ERJC 3SGEI 1ZOXA 2AVGA 3D69B 2XFXA 1YQ2A 4YHNB 4MX7B 4F7CB 3TESA 5TPWH 4YE4H 1TTUA 4QHKI 1QA9B 4KKCC 2A83A 2BSED 1KN4H 1D5MB 2VDKL 1JYXA 2IAMD 3FB7B 4FS0A 4LFHG 4OQTH 5CIPA 2J8UB 3B83A 4YDLC 4D3CL 1U8OA 3MRLA 4GBXC 4TSBL 4F3FA 2NY1C 4H8WC 3TO4D 1NGWB 4KK8D 4GMSH 3INUH 2YPLE 2FL5A 1N7ML 3HG1E 1TQBB 2X4NA 4KKNA 2DICA 4M62L 1FDLL 5T3ZD 3DBXA 5IG7B 5FHAH 3TF7C 1DBKH 3D9AL 1LDPL 2PTVA 5F7UA 2NY6B 5I1HH 1C7SA 4XMKL 3FOLB 2ITCA 1HCVA 2AJXH 4YX2H 2R8SH 5ANMA 5E94B 5C08E 4MXWH 1F4XL 3C6SA 2HVKA 2GFBA 3G6JB 4PJ9D 4PRHE 3U2SB 3JV6B 5MEPB 3PQYA 1XCTA 2VR4A 2P46B 1GOHA 4UNTA 2RAMA 2A77H 3OWEA 1A5FL 3DHJA 3U46B 2Y07H 2QLVB 3RKDD 2OX5A 3UP1A 4XPTH 3KYOA 5DEFB 1OAYL 1CDIA 3VFPA 5J89A 1LO2L 3BEVB 1JNHA 5D2NE 3IETA 4WWID 1EAPB 1QUNA 5K9QI 4I77L 4YFLI 3JWNC 4NN7B 1EEYB 2DYPA 4NNXA 1YYML 1DL7L 2UZIH 3TH2T 4P46A 1F4HA 1J0ZA 1ZHKB 2IPKA 5CP3H 4HDIA 1FL5B 4XPBH 5BZWB 4LGPB 4IMKC 3HZMA 1LEKB 4HH9A 2R15A 3PV6A 4JRXD 2FGWL 4PJHB 2P5WA 3QFJE 3LKNA 4GKZA 3P9MB 4HXAH 4RDQF 5DC9B 3AGVA 2I07B 4ODVH 4KRPC 5GS3A 5AG8A 2WLZA 4K8RH 4Q0XH 4O2FB 4XCYA 2MPAH 5IMLA 4KY1H 1M7DA 1OM3H 3SEPA 2AEQL 4LHUD 4QRRE 4X6EA 1D9KD 5F96H 1NDMA 2VDLL 2X41A 2L7JA 3DV6B 3MCLH 1JHLH 3GSOB 4ZFGL 3F5WB 4AH2A 5C9JA 4U1SA 1Q0XH 4KDTA 1YJDL 2FLBT 1RFDH 4Y16C 4UB0L 4IRSA 4HIEA 1CBVL 3S36L 1A02N 3LN5A 3CMOL 1I1AD 5I1GL 3VH8A 1RK1B 3OAUH 2EDFA 4P3DA 5LCVH 3V0AC 3VFMB 2I9TA 1WCBB 4J3OC 2EYTA 2EDXA 4RFEB 4YAQB 1NMBH 5KSBA 1J7VR 4MCYA 4ODXB 4AYFA 3M17A 2KZ1B 2BY3A 1YPZA 4PP2A 3C87A 4M5YH 3L1OL 3S35X 3PDGA 2DF3A 1JZ7A 5T5NG 3SJVA 3L3JA 3RWJA 5ISZE 3BOVA 5L2KD 4KJPC 3O41B 2FYYA 1JE6A 4TN9A 5SX5K 4GAYA 1X5ZA 1KCLA 1EJ6A 5KSAB 2DIAA 1HH6B 1WFTA 2Q6WB 5SWSD 3GBMH 4NWUH 3C60B 4U05A 5IFAL 1G7LB 4EJ1C 5JW4R 3H2WA 5GS0C 3PWNB 2R1XA 4K23H 1DBML 2FX9L 3HNVL 5GS2H 1Z0NA 2ZUQC 1QLEH 1I1YA 2EH7H 3MFFA 3NN8A 4XCFH 3KPLA 1FFQA 5CCKL 4LCWE 4QWWD 2LTQC 2FWOB 1AO7E 4NYLB 1QBAA 3MOAH 3QQ9C 4FQHA 4ZXBC 4UZGA 3GSWA 1JPGB 3C5ZA 3MGTA 1T21A 1B2WH 1U8QB 1VADA 2DI7A 3RL2A 3V6FA 4XMLH 5KTEL 4ZNEE 3ARED 1IGCH 3LKOB 2AJZB 4X6FA 2XXMB 4L8SC 1FG2A 1CDUA 2I24N 4PR5A 1GRWA 2FB4H 2PNDA 3ETBF 1NGPL 1GZPB 3CLEL 5E1AA 5I1KH 1TNNA 3CSGA 4Z0XA 1W72B 5J12B 2APBA 3V5DB 1UWEL 3O45A 2VDML 3H7LA 2PXYC 2AGJH 2ZSWB 3QIWC 1Z3GL 2HP4A 4GG8A 3NCEB 4IOIA 2YPVL 2VIRA 1WEJL 2FH8A 2BJML 3V5KA 1EAJA 5FUZL 4GUPA 3GSNA 2XA3A 2C1OB 2EXYC 3HC4L 2PYFA 1FN4B 1SM3H 3VXNA 3AM8A 1WIUA 2NTFB 3P4MB 4OZGB 1NDGB 4YHOH 1RIUL 1BFOB 1MFCH 1JF1A 4MJ5B 3GRWL 3VFUA 2E6PA 3B2VL 4UMGA 3DXAD 1AD9B 4X4YA 2A1WL 3FN0H 2H1PL 1A6TA 1OAUH 4JZNA 1JFQL 2HAZA 5AD0A 1LNUB 2JB6A 3BD4A 2X09A 2NX5E 4EIZC 3GJFA 3TCLB 1V3JA 3WNOA 1OAXH 1X5YA 5ITBL 1R24A 4TNWK 5BO1L 4PJBF 3GSRA 1IL1A 1VGKA 1UWXK 5D70H 1IGFH 3X11B 2XG4A 1YUHB 3R0NA 5FYLH 5FV2A 2H3NB 2UVFA 3S34H 2BY0A 2AV1A 3GSUB 1S7UA 1VFUA 1A6UL 1T66C 3KLAB 2PCPB 2GKIA 2X1PA 5MEQB 2FEEI 2YPLB 2X4SA 5E6ZA 3OJMB 5F6IB 1S7TA 1EDQA 4BK5A 3FB5A 2DLIA 4JKPH 2N1KA 5JPMA 3HCVA 3G5ZA 3OKDA 5DRXB 5MEOB 5FUOH 5DJDA 5EB9A 1CD0A 5E6IC 2CMRL 4NFDA 4NUJA 2GSGA 1CXFA 1HXMB 1LEIA 2CO7B 4XXDB 3JWOL 4G8EB 4RFNB 5K9KA 5DJZA 1A3LL 1F8TL 2IQAB 1R3HA 4LAJH 1QR1A 4ODSH 4ZS6C 3SDDC 5FYKU 1MCEA 5BVJB 3QUZC 2G2RA 3K8LA 1MVUB 1OHQA 4JPKL 1L7TL 4PJ5A 5F1IB 4PJBE 5CJ5A 4O2EA 1IGJA 4LU5H 5HHOA 4IJ3C 3PHSA 2NXYB 2HTKC 4YJZL 4O5LL 3IT8D 4PV9B 3MJ8B 2Q8AH 1VENA 3B43A 1XF2A 4G6ML 3CFCL 5ICXB 3LVEA 4PJAF 1TJHL 1CXLA 2DMBA 2F54D 2EYRB 2BDNL 1UZ8A 3QI9D 4J3XA 2DDQL 4BFIA 4PJGA 5C2UB 1W8OA 1YEFH 2E8YA 1GGBH 2FBOJ 1CDJA 1K5NB 2WQ8A 3L5XH 2H2SD 2D7TH 4WFGE 3GJEB 3H9SA 5DJXB 4I0KA 2HRPL 4I13B 4NT6A 2E7LA 2EYSA 4TULH 3T65A 2KZWA 4X5LA 1ZA6B 4NBXB 3QFJB 3FFCA 3PL6D 1XF5A 4NN6C 3VG0H 3EOTH 2MWCA 1GJIA 5D1ZC 1IC4H 1MCOL 4JKLA 1NAKH 4BQ9A 3KPTA 3O6FC 1QLRB 1DN2A 2PR4H 4MD4B 4QRRB 3AU1B 3I3DA 3OAZH 4GAJH 3NIGF 4XVSL 5EOTB 5BV7L 1MFNA 5FUCE 1VHPA 1ACYL 3LMJL 4OI7A 1D3CA 3NCBB 4XNYL 4ZUSB 4GLRI 3DO7A 1UA6L 3VXOA 4PJCA 3OB8A 3G08B 5I9QB 3U4AA 4PJAE 1ZLVH 5KJRH 2X70A 4TOYL 1R3KB 4PRPB 3AXLB 2WUBL 2YUWA 1MCSA 3LH2L 3R1GL 5D7JB 1KN2L 4F7EB 5FECB 5HHMD 4E0RB 3IFLH 4FFYH 1MHHB 4HX1A 3GBLA 4OCNC 3O0RH 3OV6A 4Z76B 1JHKL 3OTTA 1ODAA 1Q9LA 5F3BA 3CXDH 1P4IH 3OKEA 3MRFA 4U6VH 4KH2A 4GW4B 4AENB 4YHML 3FCTB 5ISZB 5IB1B 3GMPB 4MLIA 4K3JL 1CIDA 4M6NH 5IMKA 4DN4L 4G8IA 5I16B 3QUMA 4I5BA 1XR8A 1KB9K 4EI6B 3HG1A 3NIGE 1BZ9B 1K4CA 5DJYA 1PZ5B 5HYQB 1MCHA 1XGUA 3ARSA 4XBPB 1UJ3A 1A4JA 3VXMA 3QNXB 4M5ZH 1AJ7H 3DSFL 5C08A 3TNMB 1YMHA 1MWAH 3PHOA 3Q5TA 5IWLA 3CXHJ 5J6HB 4MD5B 5I74C 2I9LB 2W1NA 1AO7B 4PRHA 1E6JL 3RWIB 5GSRB 4QRTA 5KVFL 1ZAGA 2AJ3A 4PGZA 3RWEA 3SKOA 2VLME 4E9LA 1JWMA 43CAB 1CICA 4FG6D 4XCCL 4U6XA 5EZJB 5JO5B 3NCFB 4TPRH 4W70A 1FAIH 2V2TA 3MREB 7FABL 1T03H 3PWPD 5I2IB 5CUSH 4WCYH 1MJ8L 2ICWJ 2Y5TA 1F42A 4MVBD 5D2NA 5HD8D 4P48A 2ADFL 3HE6B 4XNMA 3WUWA 4NHUB 1AQDA 4JPWL 3V52L 2P5EB 4P46C 4J23A 3EJZC 1I7ZB 4YGVB 3GMQA 1I3GH 5IJKA 5FA3B 4LASL 2I60H 5ESVB 3P0VL 2A0LD 3HAEG 4XB8A 4P2QE 1B4JH 4HUVB 4WWKA 2CGRH 5ID1A 1NC4B 4FQIH 5DQDH 3VFGL 1PDKA 4DUWA 4Q7DA 1FO0H 5F9OL 1KYOJ 4YHLH 4N1EA 1F97A 1LILA 4YHKH 4ZPTB 1CDYA 4KKLD 3D6GA 3RVVC 3BPNC 2VLJD 4L3EA 3IFNH 4LSPH 5JR1L 4TUOA 3HZVA 2WLYA 4L9LB 2MCPH 2XNAA 4YDLB 2DQIL 4IRSC 3WFCH 3UJTL 2FZ3A 3H3PH 4GBXB 4GXUN 1IAKB 4NZJA 3TJEL 5F8QC 2X4RA 5I1LB 2Z92B 3RA7L 4KDVA 1ZHLA 1RZIB 3MZGB 1A7OL 1W8NA 1BJ8A 5CILH 1EO8L 5DRNA 4CGTA 4HUNB 3WFBH 4DFHA 4F9PA 1J11A 3PIQA 2NX5B 1QSED 2W07A 4WVRA 3S37H 3UJJL 4L8BB 2DI9A 4MA3B 3RAJL 4XTRC 1BQUA 3CDYA 1IM9A 1EV2E 1MHHA 1NKRA 3IB4A 1UH4A 4RA3A 2WIIB 4UT7L 4F8TA 1A1MA 3RZCD 4JHWL 1HEZB 4RAVB 5DD0L 5HGBB 3GGWB 4RNRB 4JFZL 4F2MA 4YO0A 5CBAB 1F5WA 2DQEH 1IGYB 4NOFA 5A3IC 1DE4A 1QVOB 5DQJB 3X13A 1ND0B 1I8MB 2DD8H 3B5TA 5CBEA 3MR9B 1BZ9A 2C3VB 4Y2DD 1R5WA 3RU8H 3GM0A 1FL6A 2FHBA 1MFAH 4J8RB 1Z2KA 3PABA 4X0KB 1UVQA 2ICEB 2ZPKH 4LLWA 1C16B 2M8XA 4LCWA 5KG9A 3NFNB 1CIUA 3BP4A 3IDXH 4PJBB 3DUUA 3WNMA 2FJGA 2V9RA 3BMVA 5FYJD 5A43C 1JNNL 1U3HA 4WUKH 3G6DH 4ZAKD 3N1QC 2M1KA 4RMRA 5EUKB 4RIRA 5I0ZA 5LJYH 4L8CB 1NGQH 1FGNH 4FHBD 2Z91B 4P2RD 4XC3H 3HPJA 5TGBA 1OPGL 1QBMH 3MRBA 3HE7D 3OKKA 2WWKT 1KPRB 1H3GA 3L3HA 3QQ3B 4JRWA 4NRZA 1MI5B 3P3YA 3WHXA 1KIPA 2HWZH 1HINH 5ESAB 5GRZA 4BFGA 2R9HD 1HKLL 1I7ZA 2N7AA 4FOMA 4Y16B 5A2JH 4UNVA 3MBEB 3UBXI 1JTOA 2BVUA 1D5BB 3DMMC 4A2MA 4R4NC 3Q3GA 2LVEA 3LD8C 4Z0BH 1QFWH 1QRNE 5GRJH 1ZLUK 3OSKA 1JPTH 2W0FA 4U7MA 4JFPB 5C0CE 1T04A 1PYWB 3AM8C 1S5IL 2VLKD 1G9EA 5D8JL 2M26A 2IAMA 1D5XA 1K6QH 3BIAX 5IQ9A 2NZ9C 3WLWD 4EN3B 1RUAH 5D7IF 3MRDA 5I19L 5HI3D 1S78D 5BCAA 3I9GL 5EUOA 3TO4A 1EO7A 4K9EH 5CJBA 4PJAB 3MRGB 3EDEA 2GJZA 3T4YA 3RJQB 1TZIB 2MKLC 4P4RA 2OZ4A 2VJXA 4NZTH 3FO9B 2YD5A 1MH5A 4JG1L 2IGFL 5DD5H 4YXLH 1ZTXL 5GISH 1T4KA 3CVIH 3DO3A 4WHTB 1YEKL 1R5VB 1JTPA 2X4OB 3KWWA 2HJFA 1JPSL 2VXSL 4UT9L 3VFNB 2ZUQB 4QHUA 1EBAA 1ZGLP 5GHWH 5DD3H 3RWFA 1NBQA 4PJ9A 4FXLA 1U8JA 2YD8A 2IG2L 4ZSOE 1NAMA 3WCYA 3FB6A 1T1WB 1DSFL 4ZXBB 5C2BH 1F58L 2QADD 5CJQL 3NGBC 3PWPE 3IF1B 4YHIA 1NUDA 3LQAL 3SPVB 1UACH 2XZAL 5D7IE 3CC5A 1A3RL 1EGJH 2ICWI 3I6LD 2C3VA 4L8DB 2IEPA 2CPCA 3DRTB 4M43H 4YDKH 3UZVB 4BFEA 1OTUC 4QOKE 2Z35B 3VA6A 2X5PA 2HKFL 2QR0A 4GRLC 1ORSA 4P5TC 4ZO9A 4JRXA 5FGCE 1JGLH 2NCMA 1I1FB 2WMPA 3QIWB 3L5JA 1MELA 1E27B 2VE6B 2UUDH 1KIQB 5DJ6B 2H9GB 1RZ8B 5BQ7A 4WTZG 3NZHH 3TFKC 5CHNA 4LHUA 1D9KA 1UM6L 4HUXB 4NC1C 4OJFH 3RZWA 2E27H 4ZFFB 4B0MM 2JCCA 1PKQE 4K3GA 3BO8B 3O2VH 2E7LC 3P2TA 1C5BH 1A1NA 3S4SG 1I3RA 3KPQB 1OARL 2AJVH 3QXUA 3TNNA 5GGSY 1JWSA 4R7NB 3PDOA 3QXDB 1AR2A 4I0PD 4P2QB 2P49B 1BOGB 2F58L 3O11B 5E8PB 1I1AA 3D2UD 1ETZB 4Y4KA 4DVBB 1G9NH 4ZFZA 1FPTL 4HKBA 4OZ4B 3FT2B 4XMPL 4OF7A 4D94A 2VXUH 3A6CH 5EULV 3GMLA 5DUBB 3FQRA 5DMIL 1NFDF 5IFJA 1HI6B 1KXVC 4X5XB 4JANA 3Q6GL 4KMTL 1RZFL 1P5VA 5HYSB 4PP1D 2PO6C 3D85D 1QTYT 4ZUTB 5GJTL 5L2KA 2DQUL 1BVZA 1K8DA 1OCWL 4JZJC 3L6FA 4NNYA 4RGMC 1CL7H 1IAOB 3P4NA 1NCDL 4S1SH 5SWSA 1ITBB 1IFHL 1I8IA 1VKXB 3DGGA 4O4YL 4U33A 5CSZB 3NIDF 1H3PL 3VXRE 3RWDA 1UXWB 1HZHL 3NH7L 5HGGS 2VH5L 1BD2E 3I84A 3EO1B 3SDDB 3EZ8A 5I15L 1MEXL 3QUZB 4M1CD 4R7DA 3VA2C 4LCUB 4NHCL 1NFDE 3VWJD 5FO8B 2NY3C 4HBCL 4X9HA 2F5BL 1VA9A 3RRQA 1UJ3C 4XPAH 5BMFH 4JR9H 5IWLC 3U7WL 1WAAF 1MCLA 4MSWB 4XAWH 4UTAL 3IS0X 4LPTA 4MB4A 5JDJA 4LSUH 4PTUB 5DVMA 2F74A 1G7IB 32C2B 3IJHB 1ZHBB 3E0GA 1CICC 4M6OH 4RRPA 4OZFA 2DTSA 4OD1H 3QCVH 3U30C 3P30H 4JQVA 3NIDE 4X4XA 2EEBA 3WIIH 3IU4H 4NN6B 5B38A 4JEGB 4POZD 2NPLX 4JE4B 5D1ZB 2JELL 3OB0K 2VDOH 2OLDA 1KV3A 3ARRA 1ERNA 2BERA 1FFPA 1HK6A 1FH5L 3OAYK 2CDFB 4JFXB 5IJKC 4DAGL 3KVQA 3MLVL 4JLRB 3IDGA 3CD4A 1JZ8A 5J6GA 4MS8D 3W9DB 4WWKC 4P2OD 2UYLB 3MRIA 4JREB 3DXAA 3G9VA 1MAML 2CLZA 3QNYA 5F7HA 5I71B 1WAAE 3PF2A 1CLZH 5IGXH 3TBSB 3FAWA 5EN2B 1NEZB 1HOCB 4P5MA 1Q38A 1QRNB 4LLVA 2R0ZH 1G6RL 5C0CB 3ZT5A 2V7NB 4UIKH 3KXFB 4MAYC 2XZQH 1NBZB 1YEHL 4RGND 5AWNH 3ULVD 5C0RH 5T1MA 1U3JA 1YN7A 3HI5H 5IB5B 3BP7B 5KVGL 1G6VK 3VDAA 1LQSR 4ELKA 1KTDA 1IAMA 3FRPG 1MIMH 2FHCA 5I6XB 4F57L 3K2UH 3REVA 3ARQA 2NY0C 5FM5O 1NGYB 3RVTC 3X14B 3ECBA 2GSIB 4PLJD 1DANT 2E5EA 5T1KB 1KJMA 1Q1JL 1YECL 2FNBA 4HD9A 3DV4B 3IFOA 4FQLL 2BY1A 4YQXH 4AJ0A 4BQ6A 5D6DC 1CFQB 3WEXA 1YYLL 2AS5M 3UPCA 1BJ1H 3EJYC 5LAXB 3CZFA 4G43A 4NZUH 2YHGA 4OGZA 4WU5A 4XNQB 2W65A 5FKAB 1GOFA 3MLWL 5DWUH 4HGWB 3BSZL 5FYKL 2K3TA 1S8DA 2F19L 4NQEE 4ZO8A 4LLUB 2J12B 2IPTL 2AABL 2R4RH 1KB5A 4KJWD 1S7XA 3HMXH 3SKNA 3QZWG 5E9DE 2XTJD 3QEHA 4LLAA 5D7IB 3KPOA 2PW2A 2XTLA 3BQUD 1RIVL 5IP4A 4C54A 1S9KC 4I9WD 5DT1L 1RULL 3TBWB 2F54A 3QI9A 1LD9B 2EDTA 4F9LA 1HKFA 1QP1A 4QF1B 5E2UH 4Z7UF 2ORBL 1MWAB 5LWYL 4TTDD 1C5DB 2DQDH 4WEUD 5D72H 5SX4H 4QOKB 1U3HC 1RMFH 4DUXA 3GI9L 1ADQL 4R8WL 3D39B 3VD9A 4JRYE 5DO2C 2X7LB 4NFCA 3PL6A 1A6ZA 4F8QA 4ZUVB 1ZT4B 3PWVA 3MCG1 5I1AA 3U82B 4XP5H 2IAND 1A9BB 2E7CA 5J3HC 4FFVC 4OZHB 3SQBA 5EU5B 2BSTA 2DQCL 1ZMYA 4YHPA 3ZLQC 4EDXB 5CEZE 2YK1H 5F7WC 4KQ3H 1PKQB 2Q86B 4FZEH 2Z31C 4ZDHA 3K74B 1CDCA 1ZVSB 4ONFL 1L0QA 4M1DL 2OTUA 1FV1B 3ZT6A 2B5IC 5D96B 5EBMA 4N8CL 1MCPH 1J1XL 3TIEB 3GKWH 5IVXA 1AFVH 5K9OA 3BP5A 4CMHC 3FOMA 4JY6A 3EYQD 4NN5B 2NY5L 3T2NL 2J6EA 1RQ5A 1NPUA 3B9AA 3Q1SL 5DD1L 4XP9L 4Z7UE 2IAMC 1FO0B 2OR9L 4GRMA 4NJAL 3IKKA 1CI5A 2V7NA 2GK0B 1NAMH 3EOAA 3MPCA 3FN9A 5JW3H 1EBPA 1T5WA 4OGYL 4KROB 4KK8C 4ZPVB 1QYGL 3SOBL 2OM5A 5GJSH 1MPAL 5DYOA 3QWRD 3L7FA 3U4EA 4N68A 5I75C 1W0YT 3EYUH 4MJ6B 1KTRL 3MLUL 1EVUA 1OQXA 1A7QH 3RUGB 3WFHA 4F80A 3S5LB 3MA9L 5EOQL 5F93C 5C0BE 4CADB 3VXRB 2XQBH 1T20A 4GKOA 5I18L 3QPXL 4ZD3L 1BD2B 1NCUA 5IF0B 3MC0A 4HW6A 5D7LE 1MF2L 5I30H 3PE9A 1CFTB 1QRKA 2WWMD 4L4VB 3WDHA 5L7XL 3RKDC 4ZSOA 1NFDB 1MHEA 3W0WA 3P9LA 3K81A 3VU2A 4FA8A 3F12B 3BRGC 1FNSH 4PGDB 3DI3B 5D6CA 3BT2H 3PWPA 1KG0A 1RUMH 4D8PA 1BQLH 1JL8A 5I73B 2X4TB 4NQVB 5KOMC 4OGXH 4XGZB 1QLFB 4MMZC 3SKJH 1H3TA 4HK3J 1I8KB 3SGDH 4NDMA 3BI9X 5E5MB 1KTKE 4LRNL 5IB2B 4HFUL 3VMPA 4LBEB 5ALBH 1KJ3L 4JFDD 1QPPA 4JQIL 2ATPB 1C5DA 4LOUD 4DVRL 2IALB 5LGHH 3DMMB 5BXFA 3H8NA 2A6IB 3WXWH 2E9WA 4DOHB 1YEJH 3F7YB 2CUMA 3OF6D 2NNAA 2VLJA 1A4KA 1PG7X 2OL3A 3QUKB 1GGYA 3LDBC 5CKAA 5CZKA 3SE4A 3FO0L 4R2GC 3G5XA 1TDQA 3O2WL 5IHLB 3UZEA 4Z78B 5E2VL 3OKYA 3P11L 4FFWD 5C0FB 1I1AC 3MV11 1MHPH 3QJHB 4JJ5A 4GAGL 1NGZA 5LXGL 4XNUL 2BNQD 4IDJH 4KKAD 3BH8A 3T0EE 4XBEL 4OQ1A 3QIUC 3CLFL 3MROB 4PRBB 3WKMH 1N8ZB 1QSEA 3QCTH 5MHSE 3N0PB 4OB5H 1PG7L 1TJGL 2BOCA 5MP6H 1F90L 1E0OB 1PSKH 2BNRE 1TVHA 2FBJH 4ETQA 5F89A 3HPLB 2AJYL 3SY0B 1TZGL 4I1NB 1N4XL 3MJ9H 1TENA 2YBRA 4YDIL 4BUGA 5JHLL 2DOCA 1EXUB 5C3TA 1DLHA 2FECI 1K8IA 5F7YC 4M7KL 2CDGB 3WIHH 3RZCA 1MCCA 1V7MH 1P6FA 5CJOL 5DC4B 5TJWK 1HHGB 1EHXA 1DBJL 1UB6A 1AGEA 4HIIA 3L3KA 5GPRA 2FR4A 3BPOB 2A6DB 5IR1A 1GOGA 3MV9D 5C86A 2FJHB 4J6RL 4CNIB 4XXCA 5D71H 3V6ZA 5BVPH 4NO2A 1X3DA 2BY2A 5E4IA 4H1LG 1XEDA 4I9WE 3BKMH 1P1ZB 3IDNA 4Y5XB 4Y2DA 1KT2A 1CGSH 4C59B 2WSKA 5C7XL 1G9ML 2L0DA 3OXSA 4OZFH 4QWWC 2DM2A 2EDNA 3ULUF 3MOBL 5FM8A 5J0BA 3I75B 3FHQA 4I3GA 4Z77B 5GIRA 1DR9A 3NTCL 4NSKA 1L7IL 3SDYH 1U0QA 4NQEB 1KCUH 1LO0L 4XZUB 5F70A 1IEHA 3EFDL 2OK0H 1WBYA 4GRLB 4MQ7A 4KU1A 3D18B 4P5TB 1C08B 5B8CC 4ZAKA 3MJ7A 2WBWB 3AREC 3OKMB 3LN4B 1XF3B 3OXRB 4P2RA 3DUHA 4AL8L 4BQ8A 4XWOD 3HZKA 3PWJB 2HT2D 2R29H 4TYUA 3OJDB 5T5FL 3O6KL 3FKUS 3TA3B 1M71B 3S96B 3NACH 4K71B 4RISL 1U8PA 2W9EH 1ZV5A 5DJ0B 3CCHA 1I9IL 3QHZL 5IROA 5AAWA 4E41B 2QQLL 4PREB 1ZEAL 4XHQA 1S5HA 5D2LF 3AC0A 1QKZH 2DIBA 3CVHB 3ZTNL 4LQ1A 1T89A 3K46A 4JRYB 3MLXL 5D1XB 1FZOA 1F6AA 3UBXG 4BM7A 3V4VH 4NQUA 3KNBB 1IC7H 1JBJA 3ULUE 5KBNC 3QH3B 4OTXH 1CZ8L 2A9MH 5IVNA 3IVKA 1EJOL 1G7PA 3VMNA 3BRDA 2DBJA 2Q7YB 2VLKA 2B4CH 4XWGH 4HK0B 2APWA 2IFGA 1CFVL 1N2RA 1CLYH 2GTZA 2H8PA 1ULVA 4X7SL 1EEQA 4Y1AD 1RI8A 2V17L 3S6CA 3HC0A 2PO6B 4R9HA 3FMGH 2RJMA 2G5BB 1NBVL 3JWDH 4JZJB 2AI0H 1HN1A 1NFIB 2R4SH 5I8EB 5EORH 4X6DA 3FQNB 1WAAA 3D0LA 4WW2F 1CCZA 4LSVL 1W0VB 3TV3L 5IT2L 3EO9L 1ZGLA 1S9WB 1NLDH 3QEUA 4G7VH 1FFOB 1HHJA 1OL0A 4YDVB 5H94A 5D2LE 3BZDA 4HLZH 1QG3A 3MNWA 4KHXH 1KBGH 1TVBA 5C0AD 1KB5H 2GHWB 4QY8B 5DJAA 3P77A 4Y4FB 5IHUH 3BHBA 1P7QB 4B50A 2VWEE 4QXTA 1T3FA 1UJTA 4POUB 5SWQA 4HBQA 4JAMB 5HVFB 4LKXB 3JWDC 3GMMB 4JFYB 1BQSA 1V3MA 3UTTE 3DVGB 4JY5H 4WRLA 5HGHB 1T1YB 5BJTB 2YRZA 2ZCKL 4CW1A 5C0BB 1SYVB 1IC5H 4ZOCA 5LGJA 2D9QB 4ZFOB 4LNVA 4YXHL 5INDB 3F7VB 1SY6H 1AY1H 1Z9MA 4V2CB 5D7LB 2ZKHH 3FQWA 1MREH 4YIQA 3V0VB 2B0SH 4LLMB 5AZ2H 4P9HL 1Z9LA 2V2WA 1U8HA 5CSGA 1RUKL 4KVNL 5GZND 2MNUA 3UTSD 5EZOL 1PY4A 3TYFA 1EFXD 4S0TD 4X7EC 5DLMH 1IAII 3BVNA 1RJCA 2CIIB 2OJEB 3TT3L 4ZTPL 2ED7A 1TCRA 4C56E 1LE9A 1IGTA 5E9DA 3BW9A 3AS2A 3R0MA 4QXGL 3MRHA 4S0SD 1FIEA 4F9LC 3KJ6H 1MUJB 2H2SC 2F53E 4JO2L 4XHJC 4R97C 3MLRL 1YNKH 4B53A 3PL6C 2QL1A 4I0PA 1NH6A 2F9BT 4X98B 1HSAA 1NC2D 1KJVB 4AIZA 3CVHA 1G1YA 2NLJA 4JZOB 4OFYD 4R0LB 1GGIL 4U1LB 4MAYB 5D4QA 1U8KA 4ORZC 2RCSH 1MJUL 5IBTL 3I02B 2OXHA 4HK0A 1DCLA 3PUCA 3VXTB 2DLFL 4LVNB 1WZMA 2HJLB 4QRSA 4BSWA 3LIZL 1K4DA 5JXAH 5FDYA 3D85A 4JHZA 1MFDH 5I8CB 4LVHC 3MV9E 4NCC2 2GCYB 1MFEL 3T0EB 2R2BA 4Q9CA 4DGVL 5JOEA 5IB4A 4LNRA 1JNLH 2BNRB 3DVNA 1T2QL 1CGUA 4Z7UA 3I50H 4NQSA 5DRZB 2AK1H 5FCUL 4JM4L 4EOWL 4QT5A 1N6VA 1FYTD 1Q9WA 1UZ6F 1A6VH 1QO3A 4HUKB 2BOBA 2HN7A 5EWIH 1WBZA 1ROWA 4FXKB 2H32A 3FTGB 4JPVH 3RVUD 2E7BA 1OLLA 2R23A 4FQXC 1D5IL 5KN5A 2BHYA 2IF7A 3JV4A 2XACC 5GGUB 5JIKA 3VGEA 5LVEA 1JZ2A 4OLVH 3VWJA 3BP6B 4EVNB 4MJIE 4YFLF 4L4TD 2YKLH 2CJUL 2VC2H 1MNUH 5KANG 4O02H 2ZCHL 3OKNA 3W82A 4DTGL 5BRZD 2EIDA 1D7FA 4HZLA 4HGMA 3OAZK 5DEGA 4UV4H 1V7NL 2FECL 3LKRB 4JCLA 1N0XL 4I2XE 4PG9B 5FEBA 15C8L 1P84K 1XGRB 2EDOA 3IDUA 1KCVH 4IRJB 1KIRB 4JM2F 4FG6C 2FATL 4FP8H 2UWEF 1UWGL 4XRCB 2DTML 1INDL 4DKDC 3MSPA 1K3IA 3CUPB 1ZLVK 1UZ6E 4ZMAT 3T8XA 5ADOL 2CIIA 5DK0B 5HD8C 3DIFB 2YMXL 3P73B 3BEWA 3DJ9A 3RFZC 1T6VN 3ZSSA 4NZDA 5D5MF 5F7MC 2E9IA 3ZTJG 5I8OL 2Z31B 2ZNXA 4PJXF 4OFVA 2A0LC 1T7WA 3NMEA 2DWDA 2NR6D 2BVPB 2B5IB 1CGXA 4DKFL 5B22A 3DPBA 2HG5B 4P2OA 3HNTL 4PG2C 4WFEE 3HRPA 2EEAA 5IQ7L 1NQBA 3OHXA 1A6WL 5I1CL 4LSRL 1CXHA 1VGEH 4HUWA 4KKLC 1K2DA 4GW1B 4I18B 5JXEC 1ZA3A 3IDMA 3LS4H 3GUTA 1J1OH 4JKMA 2UWEE 3PGDA 2RFXA 2AEWA 4OCWL 4XP4H 3SDXB 5I1EL 2EC9U 1G0YR 5FO9B 3BMWA 4RX4D 4TUKL 3IFPB 4Z8FH 3MFGB 1MCKA 5I1IL 5ACMA 3EYSH 4H88L 1DTUA 5E56A 5LQBL 3BDBA 5T33L 1JI1A 2J7LA 2ARJB 5D5ME 4R4BA 4MA8H 3IDYB 4P4KD 4U1HA 4WW1A 2VLRD 1S9VB 3T0EA 2C7UB 4UAOC 3RIFF 4KZEH 1P4LB 3LKQA 3IJSB 4PJXE 1H3XA 4AT6A 2GTWB 5D2LB 2LV4A 3MLZH 1CG9A 5HJ3A 5GGQL 2XPGB 4FTVE 5GS1B 4CVZA 1S9XA 2G75A 3WKNA 5IB3B 4HT1L 1OP5H 4BQBA 1J0IA 4OLZH 4Q58C 4ZQKB 4RAHA 4OI8A 2P44B 3C2AH 4XXCC 3UXFA 1N59A 4UT6L 4JDTH 4MA7L 3VI3F 1VACB 2YRPA 3PXHA 3UTTB 5KSUA 1ZHNA 1ZSDB 2VLLA 4K94H 3VCLB 3BH9A 3BQUA 4X7DC 4RWYL 3DTXB 3NFSH 1UB5B 3O6ML 4OD2A 3U6RA 1MJJA 4X8JA 5HYJD 1I7UB 4DGYL 4PYGA 5IKCA 4WW2B 1OAKH 4NKOB 1G7JB 4P9ML 4YC2C 3R06B 3HI1A 2R2EA 5IHBA 3BGMA 1ZXQA 5ADPL 5HI5C 4ZAKC 2BVEA 1A7PH 4R96B 2HJKB 4HG4K 4WUUD 1QPXA 4I3SH 2ZUXA 1KNOA 3LZFH 5DMGD 3GNML 3GMNA 2KPNA 2AXGA 5DQ9B 4C56B 3MNVA 3GB7A 1HE7A 1Q94B 3HE7C 1CR9L 4C4KO 3NFPB 3DX6A 1WIPA 3NPSC 5FCSH 5SV3A 2F53B 2VAAB 8FABB 5IM7A 1W0WB 4PJEF 5KW9L 3FT3A 4R2GB 3CGTA 3Q2CA 3VI3E 1ZLWH 1A6PA 4W4OC 1A0QL 3BZFA 2VITB 4BK4A 4KTEH 1XCQB 1T89C 4M00A 4WI5A 4XVJH 3HNSL 4CU7A 4F7PB 5DFVD 5GGSA 4DZ8A 5T1DL 2Q87A 2B1HH 4JY4A 2YS4A 1PFCA 1MRFH 4YPJA 2WP3O 4LLQA 2AEPL 5DDHA 4HQQH 3RWCA 4QRQA 4RA0C 1AGFA 1OP3H 2VERN 3QIUB 5ALCH 4M48L 5K33A 3THML 2EKSA 5EZLB 4BYHA 2Z93A 1G7HB 5FOBA 2DLGA 1P2CB 5I1JL 3WLWC 4UQ3A 3PJSB 1E4JA 2EH8L 3VFTA 5IOPB 3WO4C 5HI3C 3V4PH 3M8OH 4ZTOL 4N8VB 4BZ1H 1RUQL 5CWSA 5TDNB 4G6JH 4DGIL 1BP3B 5E08H 5DK3A 2Y06H 3VXSD 2B2XH 3QWRA 5A2KH 4NQDE 2CIKA 1HSBA 4MDJA 4KHTL 4WHYG 4PJEE 1LE5B 2QSVA 4WU7B 5I66B 1DQMH 5DVKA 3HAEA 3K7UA 4PRDA 4NKIL 1P69B 4G8GB 5EU6D 1EH9A 1S7VB 4G7YL 4GRWF 4F58H 4XCEB 3WXVH 1MHCB 4OZIF 3HFML 3CDCA 1UM5H 3QDGD 3L3IB 4QRPD 1FE8L 1AHWA 3DETD 1A1OB 1RU9H 2HFEA 2XT1B 2P48B 4AEIL 4LPCA 3V4UH 2EZ0D 4RAUB 2V6HA 4FQ2L 1CGWA 2QADC 3OR6B 1QBLL 2FIKB 5TE4H 5CAYB 5B8CB 5KAQF 1MCNA 5TF1H 1KFAL 4MJIB 5IJVB 4JPIA 3TN0B 3AREB 3IDJB 3BKYL 3QA3A 1CFNA 5B4MD 4K7PH 3T1FB 1CTOA 4HG4J 3EGSB 5TPWL 4YE4L 4I2XB 3EDDA 4ERSL 2VISA 2AV7A 2P8LB 2GJJA 2V5RA 1RHFA 2C1PA 1R3LB 3N50A 5E00B 3WJJC 3WLBA 4JFDA 1SEBA 1KENL 4IBLT 4OQTL 4X8XA 5EU3A 4GRWE 2Q3ZA 2YPKB 2P47B 4OZIE 3IU3B 3MV8D 4LL9A 3V6OC 5F88A 1CF8H 1OGAD 3L9RA 4GMSL 1J1PH 3INUL 3OF6A 3STZB 5DUMH 4HPOH 5C8JA 4M6AA 1RZKC 1H5BC 5FHAL 1R3JA 1DBKL 3KYNA 5MI0B 5E03A 4EUPA 3WL9A 4TVPH 3N1PC 1D6EA 2AW2A 4KPHL 4DKAA 2R8SL 1KGCD 2DM4A 1XGQB 1AXTL 4NCC1 1MLCB 2YWZA 2BNQA 1FORH 1X5LA 3ALWA 3WNLA 1I3UA 3CH1B 1H0DA 2DWEB 5EIIA 3QEGH 4J4PD 5EFIA 2EDLA 1JZ5A 5INCA 2HLFD 3MUY1 3DROA 4JM2B 4NO0B 1M1SA 2UWEB 1FZKA 2BCKB 4KUCD 5DHYB 1NCWH 2EE2A 4M4RA 3MRPB 4PP1C 4Y5YA 3SN6N 4Y4HB 4PRIE 3RDTB 1DUZA 3LSOB 2XKUA 4KVCL 2VXQH 2HYMA 2QSQA 5F9DC 1RURL 2D4DA 2DQGH 5J1AB 2BVTA 1A6AB 1GGCH 5D5MB 2YXFA 5HHNB 1ZK9A 3MV9A 1KJ2H 5F7KC 1LO4H 3KPNB 3D0VB 2GEEA 1G7QA 3C5JB 4PJXB 3C8DA 1TZHB 4XPBL 2G60H 2UUDK 2HH0H 4L5FL 3MYJA 4Z7VB 5HYJE 1E4XI 4FTVB 3W9EB 5HHXH 1S7VA 4ZO6A 5HY9A 1KPUA 1H8OA 5JHDB 3JTSA 4M1CC 3EOBB 4K8RL 4Q0XL 3U83A 1C1EH 2MPAL 2DJSA 3Q48A 2YUVA 3V7AE 3DI2B 3O9WC 4N90E 5F96L 5HVGB 2IWGA 3MCLL 1JHLL 3MA7A 3IAPA 1AR1D 4AIXA 2EDEA 1FG9C 1YC8A 3EJJX 5FF6A 1Q0XL 3MNZA 1RFDL 3CFKA 1JN6A 2R2HB 4N9GA 5FYKD 5EIVA 2X4QB 4JFHD 5F44A 1WFOA 2R69L 5HGAB 3OAUL 4E42A 3B6SB 1NMCB 5I17B 2ICCA 3O4LD 1GXEA 1O7VA 4U1NA 5J13B 1T7XA 2YR3A 4IEFB 4NO3B 4JO3H 3MLSL 4POZC 1HQ4B 4M5YL 4PJDF 4XH2B 5JDSA 4LIQL 2X42A 2XWBA 4NKDA 3PGFH 2G5RA 1QBBA 1CLOL 1MCWM 5HDLA 3L7EB 3UMTA 4I4WB 3EO0A 1RJZB 3T1WA 2QJDA 3O3EA 1DBBH 3SE3A 2VDKH 3GBML 4MS8C 4K3EL 3U79A 5JOFB 3BJ91 4Y1AA 2XG5A 3ARGC 5FA4A 4PJIA 4D3CH 3IXTA 4U2YA 4EI5D 3HA0A 1WQVT 2EH7L 4JHAL 2DL9A 4XCFL 3RWHA 1IC1A 4GS7C 1U58A 2BC4B 3B3IA 3MOAL 1LDPH 1AGDB 1IBGL 3CSYA 3EOYG 1J0JA 2VL5B 4XMKH 1C12B 2WINB 5ICYB 5C0AA 1M05A 1JK8B 4PJDE 1B2WL 3B9KD 2VNCA 3PP4L 5IMOA 1JGDA 4O2CA 4WTZA 5KVEL 3VXUE 3TP4A 2ADIB 1GCFA 4FQXB 1Y6NR 1IGCL 5DMKA 4NQDB 5E7FA 4FFZL 1ZT7A 4EQ3A 4PLJC 5IV2B 1X9QA 2O61A 3S4SA 3QDME 4RDQG 1RPQA 2CLVA 2VMFA 3ARDA 2I27N 3EYFB 1I9RH 1KLGB 1NCTA 3LY6A 4KDWA 4M7LT 1P7HL 3N9GL 5DFWH 4RMWA 1S7QA 4KJWC 4D9RD 3UTSA 1T0PB 2XTJC 1EFXA 1DLFH 3V5HB 3QISA 5E5UB 1L9NA 3C6LB 2A6KB 2JJVA 3N1MC 1OGAE 3E2HC 1MFCL 2XY1A 3Q6FA 4KI5C 3U0WH 1PGRB 3FZUD 5JNYA 3MRKB 3FN0L 4Z5RB 1NCCL 1EEZB 4BSVB 5HHPB 4OBRA 4JGMA 1YMME 2B1AH 4TTDC 2ZUYA 1J5OL 2VDLH 3RX7A 2NY4C 3WS3A 5EO1B 4MYWB 5DJ8B 5K9JL 4CVXA 2JB5H 1RD6A 5D70L 2VDPL 3HLAB 2Z8VC 4OZIB 1NC2A 5IHZA 1YJDH 3OMZA 4UB0H 3S36H 4KK6D 4JFOB 3VD7A 1M7IA 3G04B 5I1GH 3RVXD 2VDQH 2ZWLT 1U93A 3FONA 5MENE 4OFYA 4JKPL 3C8KB 5TDPB 1X5JA 2J3SA 3BE1H 3LKSB 3OG6B 4PV8A 3TYGH 2BVQA 1X5GA 1Q9OB 3H0TA 3KDMB 3P4OB 5FUOL 1YNLH 5J7CC 4HV8B 1DN0B 4PY7B 5JUEH 1RUPH 1LDSA 2YWYA 2VZ3A 1AC0A 1ZVYA 4FMFA 4TVPE 3WJLA 3MTRA 1Z6JT 3HS0B 1BF2A 4OLWL 1WC7B 1U8LB 4ODSL 4X7TA 1YJDC 3TWCH 1OGTA 5HYEA 5HDQL 1H15A 5HI4D 3O8XC 4NQXB 1T7ZA 4ISVB 5FO7A 1PAMA 5CD3B 4X5WA 5IFAH 3NABH 4YH6A 2NW3A 4LU5L 3HUJE 4MCZA 1FBIL 4PRIB 3CNKA 1DBMH 4G6FD 3HNVH 4HHAA 2Q8AL 1JUFA 1X7QB 1QFWI 1I9EA 1KLUA 4YDJB 5F9WC 5CCKH 3U36A 4WDIA 2LAGB 1YEGH 3BD3A 5CZVL 2W91A 3D25A 4P23B 2K1MA 4BFBD 1EHNA 5DJCA 3KPRD 1WBXB 3QIBD 4PJFA 4PJEA 4UBDD 1KPVB 1YN6A 4L4TA 1JPFB 2P7TB 1JRHH 2O5XH 4CJ1A 4NPYA 1R0AL 5BRZA 4Y5VC 5D9SB 4XNZC 2ESVE 5IEKA 2WWMC 3EOTL 1IC4L 5DMYA 1NAKL 2JE8A 1CE6A 3MRMB 1BLNB 4BH7B 4JB9H 4YC2B 5GQBA 4QRUA 4JO4L 4EZMA 1NGPH 3CLEH 3A6BH 4GAJL 4L3CB 4HKJA 3DRQA 4QKXB 1TTGA 4BKLB 4ZUWA 4Z95L 2BNUB 3FRPA 1H3UA 3IJYB 4HS3A 2VDMH 1U91B 3E3QE 1Z3GH 5J8OA 2V5YA 4U1KA 3PGCA 3LN9A 1G0DA 3OKLA 1Q0YL 3D5OF 3MODH 3MRRA 4U4BA 1UCTA 3OZ9H 3IFLL 1LO5A 4FFYL 1LP9A 2IFFH 4K7FB 3O0RL 1JF6A 1RIUH 4XVTH 1C7TA 3Q0HA 2D0HA 3QO1B 2NY6D 3GRWH 1AXSB 4FQQA 2NYYD 2A1WH 3JSSA 3K4ZA 4U6HA 1JTTA 1Y18B 4HS6A 3RHWF 4PGJA 1JFQH 3QO0A 5HYIA 1ZVHA 3O4OC 3QZWA 1T5XB 3QRFM 4W81A 2PTTA 4RMQA 2BMKB 3W5NA 1G0XA 3IRPX 1SJHA 2OTPA 4XP1H 5A2LH 1P6AB 4FFWC 2R0WH 3VJ6B 3FFDA 4LEXH 4RX4A 4QHMB 4KKAC 2J88L 2RHEA 1X5HA 4QEGA 1A6UH 3KPPA 1MWAL 1T22B 4Z6AT 2H45A 2VLRA 3VXQB 4F33A 4OKVA 4P5KA 3BD5A 5D7SH 4YBQD 5JPNB 3KYMB 1BM3L 4KGJA 4ZYKA 2YUXA 4Y5YC 4C57C 4D9QD 1CDHA 3JXAA 5SWZE 3KPMB 1N26A 1U95A 2H26B 2VQ1A 3I2CH 4PJDB 4TPRL 4UOW1 3WSQH 1FAIL 3QXTA 3AMKA 4LPUA 1IM3B 2WW8A 5CZXC 1HHHA 4U1JB 3VXUB 5F3HA 2VZUA 4N1HB 3T4AA 4WNQB 1RV6X 1UXSB 4ORGB 1T7VA 1XGPA 4Q6IC 4Q9RL 3FT4A 1BFTA 2PW1A 1CE1L 1MJ7L 2AJUL 3VXPB 3ZKXB 1P9MC 1D5ZB 5HGDA 4D0DA 1JNJA 1HH9B 1L7TH 3BDXA 4L3AA 1M7XA 3E6FA 4OAWA 4PGEA 1B4JL 3U9UA 3L95B 2CGRL 4KQ4L 1S7WA 5HYJA 5DQDL 4G6MH 2YD9A 1HXYA 1CL7I 1FO0L 1TJHH 3WIFA 1EZVX 1IJ9A 2BDNH 3G5YB 1NMAL 1NGXA 2DDQH 4QHLB 6FABL 4LLYB 4YHKL 3OPZH 2J8HA 3S37X 2CRIA 2PYEE 3IFNL 4LSPL 1AP2B 4O51B 5GRUL 2GJ6E 1HQRB 1VFAA 3CFJB 2VXTH 3CDGA 4WUUA 2MCPL 2DM3A 4LCCB 2KQMA 4GKNA 1A2YB 4R6UA 4XWOC 5HHQA 2HT2C 2VDRH 4WFFD 2IH3B 5E99L 3VFSA 3RPIB 3QAZC 5CILL 1YMMB 2BSSB 2JKXA 3AROA 1G1CA 1H5BB 2JK5B 3WFBL 1XGTA 4URTB 3HB3D 4S2SB 1DUYB 3QSKB 4LSDA 3FQUB 3TJHC 3RI5F 5BV7H 5F1NA 5H2BA 4G80A 4MXQD 4Q6YA 1K9TA 3CFDB 5EO9B 1AIFA 5KSAD 4HWEH 3D2UB 2WAHA 3C60D 3U1SL 3ROOA 3LKPB 3BIBX 2ILLA 2YC1B 3QXAB 3LQZB 3PHQB 1XIWB 2EIEA 2WUBH 3VGDA 5MENB 4RZCA 3O81A 3SE3C 1E4WH 2N56A 3R8QA 2DQEL 3C2SA 5IESH 3PWUB 4EBQL 1BFVH 1HHKA 2DD8L 1KTLA 2J8UF 1XZ0B 3FRUA 1R3IH 4X9GA 3RU8L 3VXSA 5BV7C 2YA1A 4YHMH 1U92A 1F3JB 2VABB 2HVJA 1MFAL 2C3HA 2CKBB 3OX8A 4HJGA 2H6PA 3KPRE 4DN4H 2ZPKL 2ZOKB 3JTTB 2F5AH 3LV3A 3T77A 4LARL 3NAAL 5EU6A 3BXNA 3LPGA 1CFBA 2WANA 3IDXL 5D1QB 4KGLA 1FZMA 2Z4QA 5FFLA 3QDGA 4QRPA 5JLZB 1AD0B 3VRIA 1NGQL 3UPRB 3B2UD 1PQZA 5DJ2B 2IQ9H 3RY4A 3D3VB 4HXBH 3QG6B 1CYGA 2CLRA 3I6GA 4MD0A 4OF8A 1QBML 3O9WB 3CSBA 3MMEB 3GM8A 4FXGA 4QYOA 5MERB 5EC1B 4WV1A 3NCCB 5M94B 5FB8B 1FSKC 4HKZA 1TLKA 2DLEA 1HINL 3SGKA 2DQFB 5IIEB 3QDMA 3H9YA 1KJ2B 3BAEL 4XCCH 4UIMB 5C6TH 4V1DE 2J8UE 3DUSB 3MGOB 1HILA 5J1SC 4CN6A 2BVOA 4XPHL 7FABH 5GGVY 1WITA 4MNQE 2ESVB 5KOVC 4Z0BL 2W59A 3BKCH 2ADFH 2HFFA 4JPWH 5C0EB 4K55A 1P7KB 4QO1A 1JPTL 1OSZB 4ODBD 5IVZA 4NRYB 4HWZB 1BZ7A 3KPSE 1JV5A 4FQPA 4OF3A 4UDUB 3CFBA 1RUAL 1S7SB 1XR9A 4LVOC 3UX9B 3MV8A 1I8LC 2AKRA 4D2NA 1OGAA 4K9EL 3VFGH 1N5AB 3NZ8B 1N6QL 2XWTB 2HTLD 2ATKA 3OR7B 3QEQE 3B5GA 4DQOL 4HIHB 5EO0B 5DD5L 5KS9F 2YPLD 5DURB 2ICWB 3ZHKA 3GMRB 3HG1D 2V2XB 1FNGB 4WI2A 5IK3B 3ARGB 4YFDB 2X4PA 2DKMA 1GYAA 2DQIH 2ZCLH 43C9A 3MYZA 2EKJA 3RA7H 4S1RH 5DD3L 1WWBX 1JGEB 3BUYA 4HIJA 5C08D 1A7OH 1OB1B 2WP3T 3UC0L 5D93C 3MRJB 2Q76A 1QFUL 5SX4I 3C5SB 1TCMA 1XIWA 4PRHD 4X6CA 1V3KA 3LEXA 4JDVB 3BISA 5C2BL 5I76A 3UJJH 1DVFB 3FN3A 1F11A 4L4JA 4MHHI 1NEZG 1UACL 2YA0A 3GSXA 5ITFA 4BZ2L 4IIQB 5JOPE 5C0DB 1XAUA 4ONOA 1EGJL 3DX7B 3LHPL 3VFWA 1FVEA 2NY2C 3WHE1 5ACZB 2NXYD 5JORB 2NZIA 1FVDA 3RNQB 3V8OA 5KSVB 4YDKL 4IS6A 4N0CD 4JFZH 3CVHL 5KS9E 2APVA 1AKJB 2FH6A 4JGUA 3UBXA 1H3VA 4U3XA 5SWZB 5IW6A 3FHAA 1S9YA 4DWHA 3QUYC 1IT9H 1J05B 1JGLL 4W4NA 5K59F 1J8HE 1RK0B 5EC2A 1NLBH 3HUJA 2QHRH 4NKMA 4UDTB 4RQQA 2P8MA 5CEZL 5ELIA 2I25N 2SEBB 4PS4H 3QFJD 3NZHL 2E6JA 2DLTA 4WO4C 4ELMB 5FKPB 1NSNL 4OJFL 1FL3B 1YDPA 4Y8DC 3PNWA 1XH3B 4ZUUA 3O2VL 4G9FE 3GHBL 4QRRD 3H42H 1JNNH 5J11C 1KCRL 4KAQH 2MOVA 2D31B 5DF0A 4OI9A 3REWB 4C58B 1KULA 1XMWA 1SEQH 4OV5A 2ZUUA 3ZE1F 1NL0H 1G9NL 1OPGH 4HWBA 3V0WH 4H25B 1YEIL 2NY4B 4CMMB 1WZ1H 5DA4A 2PYEB 3A6CL 1S7RB 3KR3H 2GJ6B 5C0JB 2G9HA 1RJYB 2EECA 2XWJA 2J5LC 4KK9D 4OFPA 1UH3A 1HKLH 5D7JD 1FNEB 5K59E 2IANB 4OCRL 3H7BA 4M6MH 1SVCP 2QQKH 4LPXA 3QBTB 5GGRY 1R5IA 1AGBB 4U6YB 1CL7L 1K85A 3TPUB 1ADQA 1I7RB 5ISZD 1B0GB 4Y88A 2BFVH 4S1SL 2QEJA 5D8JH 3FJTA 3KHQA 2OYPA 3VD5A 2UV3A 3UAJD 4TSCH 3T0AA 2AXFB 1RJLA 2N7BA 2LVCA 4Z7QF 2A73B 4PGCB 3U9PL 5I19H 3O3UN 4MQXD 1RIHL 4KUZL 3I9GH 4EI5A 3U0PA 1RSFA 4XBGA 4GG6F 3CU7A 3SGDI 3F62A 3ZE1E 3MXWL 4QTHB 2WIMA 4OCYH 3TIDB 5C07E 1Z5LA 1Z9SA 3O8XB 4JG1H 3ZE2F 2IGFH 4M93B 3BZEA 1T1XB 3QP3A 1BAFL 2OI9C 2Q8BL 1YEKH 4B5EA 1DEEB 2ZUWA 1AO7D 4X6BA 3U7YL 4HS8L 1U36A 1JPSH 2VXSH 5A16A 4WI7A 2D9CA 4UNUA 2HT3C 4JR9L 2E7MA 1DQJB 4PTTA 5EOCJ 4P4KC 4M9OA 2F8XC 2IG2H 2HFGL 4X80H 2ADGA 3SQOL 4Z7OF 1N6UA 1QHPA 2O5YL 1U8MB 3EFFA 5JW5B 3HE6D 2DM7A 2NW2B 2P5ED 2ADJB 3CFEA 5CP7A 4YHZH 1T0MB 3CPLB 5CJQH 3SCMB 3TVMB 4Z7QE 3RBGA 4TVSa 4Y5VB 3WIIL 2JJUA 3IU4L 5DVOA 5ETUA 5CGYD 3ULVL 4GG6E 2V5MA 1AGCA 4AEFA 1BMGA 2VDOL 3DX8A 3H9HB 1NC4D 3S5LG 3ZE2E 4Z7WF 5LGKA 5EU4B 1RHHB 1OF2B 3R4DA 3L3OA 4V1DB 5F7EL 1F3RB 1I9JL 1IQWH 4GKSA 2X9YA 5IMMB 1F3DH 2CDEA 4OCSH 3V6BR 4MNQB 3VRJB 1CLZL 3STLA 3MGAA 4KJYA 4PYHA 5EU7C 5IGXL 4L1HA 4GBXD 3LQAC 4M61A 1TETL 4H26B 2BSRA 4Z7OE 4QCIB 2P8PB 4Q2ZA 1UM6H 4AM0A 1EA9C 3X12B 2R0ZL 1INQA 1SYSB 4UIKL 3KPSB 3LRHA 5DMGC 5AWNL 2NX5D 3IGAA 5EBWB 1ZKAA 1OARH 5KZCB 3HI5L 4F7TB 3HZYA 1RZ7H 1PLGL 2CXKA 2OTWA 4WEMB 5DHVA 1M6OB 1MIML 1XGYH 2Y7QB 3K2UL 3QEQB 4J1UB 4ODHH 1MY5A 3RL1B 1I1RA 2E7HA 2WBJB 2BVYA 4Z7WE 1UQSA 4P57A 4LCYA 1FJ1A 5DMIH 1CFSA 1DQQB 5DFVC 3QXWA 4CJ0A 1OP5K 3MRCA 2ITDA 4YQXL 3Q6GH 3QCUL 1RZFH 4NNPL 3TBVB 5CMAB 1MFBL 2EIZA 4NZUL 1U2CA 5GJTH 2JJTC 3QQ4A 5FHBH 3ILPA 1OWRM 4ODWB 1YEDB 3TO2A 1ZGLM 1N3NB 5IW1A 3ULSB 4L29A 5DZOA 5JW4N 2DQHL 1XF4B 3T0WA 2R1YA 1RAMA 4O4YH 3SGJC 4OLUL 3T0XA 1H3PH 5DD6B 1FNAA 1HZHH 4Q6IB 5GGTH 5E8EA 2VH5H 1A9EB 5I8KL 2R1WA 3C09B 3U0TA 1JP5A 1C8PA 1LWRA 5GSVA 5I15H 4M7ZC 1MEXH 4S1QL 3WN5A 1T0NA 4JCMA 4NRXA 1OAQH 3KPRA 5KS9B 2DQDL 3QIBA 3VFVB 3W5MA 4HBCH 2F5BH 4XI5D 2FCBA 2A74B 4UU9A 3ROLB 1AH1A 3ULUL 1EMTL 5DVLA 1J8HB 4HCRA 1WWWX 4WFGD 2EDBA 3DETC 1E28A 4IM8A 5TDOB 4XP5L 5H35B 3GI8H 1ZLWK 3MBED 2EZ0C 4UTAH 3VWKC 4PRPE 3D69A 4Y4KD 4YHNA 4MX7A 4F7CA 5GS0H 3WFDH 4OIAA 4NJ9H 2YK1L 3DYMA 3SGKC 4KQ3L 4FZEL 4X4MA 4XPGH 1QA9A 25C8L 4G9FB 2XKNB 3G5VB 1ZANH 4H1LH 4Q74A 4K8RD 3MLYH 1D5MA 1OP3K 3QULB 3FB7A 4PJ7F 3KG5A 5HXMA 2J8UA 3QAZB 4HC1A 4EN3D 2JELH 1KEMH 4WI3A 3QWOB 1X4ZA 1NGWA 5ILTH 1FH5H 1OT2A 4DAGH 2D03H 1BX2B 35C8H 3MLVH 3DURB 5IG7A 4LEOB 4YPGB 5JW3L 1WTGT 1BQHB 1ZT1B 3RGVC 3VD4A 2GT9B 3FOLA 3S35L 1MAMH 3TBYB 5E94A 2CSPA 3OBAA 1HYSD 2GAZB 1IGIH 5GZOC 3G6JA 3TPKA 1ES0B 1G6RH 1T2XA 4LQFH 1CD1B 3WO3B 3U2SA 3EYUL 2JJWA 3JV6A 2VKXA 4H5SB 5MEPA 4UQ2B 2X89D 1YEHH 3TBTB 5J9PB 3ESVF 3RVWD 3TT1H 3IAGC 4ZXBD 3U46A 1I7TB 5BV7B 4PJ7E 4APQC 5DEFA 1DQDH 4LPWA 4J4PC 3BEVA 3W39B 2OSLB 3ZZ1A 2NXZB 5L6YL 2HLFC 1EAPA 3EBAA 5I30L 5L0QC 5C07B 2P5EE 5EBLB 5CLTA 1EEYA 3LRSB 3TM6A 2KDGA 1YECH 5GS2D 4NZRH 1VFOA 1B3JA 1T83A 5L88L 1ZHKA 2RIKA 2KL6A 1FL5A 2VLMD 4LLDB 5BZWA 1YYLH 2ZOLB 1LEKA 2Y36L 1BQLL 1HHIB 2XN9E 5C9KA 4OGXL 4QXWA 4LP4A 2AEIT 3CK0H 4PJHA 5J06A 3SKJL 3MLWH 3P9MA 3QIWD 2I07A 3BSZH 4GJTB 4MWFB 3T09A 1NJ9B 4YWGL 4O2FA 1OAZH 3QHTC 5DK2B 2IPTH 4TQEH 5ALBL 1ZWIB 2VYRE 3BGFC 4NBZB 4CBPA 3I85A 4OUUB 3DV6A 5DSCB 3GSOA 1RIVH 4MDIB 1U8IB 3F5WA 2QTEA 4NQTA 5DT1H 1RULH 1IKNA 2D2OA 4GG6B 1FFNB 4XNXH 2VTFA 2Q7NA 3O2DH 5JMRA 4P2QD 2ZG3A 3ORJA 3LEVH 3FQXB 5J4MA 4HKXB 3NCYP 1AR1C 1L0XA 4M3KB 2ORBH 1RK1A 1I85A 5FDWB 3VFMA 3RX5A 1WCBA 1K3ZA 4U1MB 3GI9H 4RFEA 4YAQA 4LVOB 2VDNL 4UOW0 1A8JH 4ODXA 1S3KH 5HVWA 1MHPL 2DJ4A 4KJQD 2MFNA 4IDJL 3MZTA 1ED3B 1IEBB 3MV7E 4PJ8C 1VFBB 4Y19E 2DQCH 3NA9L 3WKML 4X7FC 3O41A 4OB5L 3TCXA 5MP6L 4ODUB 2WBKA 2FBJL 2F15A 5KSAA 2JIXB 4YK4C 4ZG1A 1HH6A 3I6KB 3MJ9L 2Q6WA 2D7QA 3QJFB 1DEDA 3C60A 4DCQB 4N8CH 2O5ZL 4KXZH 1EZVY 1G7LA 3PWNA 1V7ML 2EXWD 2NY5H 3T2NH 3VFOB 4MLSA 1SJEB 3KGRA 3Q1SH 4N5ED 3BYYA 5D7KE 1BVKB 1U3YA 2MHAB 4G5ZL 4Z7WB 5FYLD 5ICZB 1C5CH 3SDDD 4ALAL 3N06B 2FWOA 1LMKA 3QUZD 1QR4A 4NYLA 1JVKA 3BKML 4A6YB 4Y2OA 1PD6A 1X5FA 4OGYH 4EI5C 3CXHK 1JPGA 2GY7B 2NY2B 3FO1B 4NOBA 3MX0A 2E6QA 1U8QA 2HTKD 4AZ8A 3A0OA 1MPAH 4JG0L 5B39B 4XX1E 5AUMB 1SJVA 3LKOA 2AJZA 1KCUL 1FYTB 1MI5E 5ENWB 3MLUH 4N0UE 2LAAA 2OK0L 4ZODA 4PRAB 2NY5C 4JO1H 3B9KC 1TQCB 4G8FB 2GK2A 1CLCA 3ARFB 3QUYB 1GZPA 3MA9H 1CGTA 2HKHL 3SDCC 1PEZA 2V7HB 3UYRL 4HULB 4OCMC 1W72A 5I18H 4HEME 4ZD3H 1EX0A 3CU1A 5CIPH 4PLKD 3V5DA 3OGCB 4WO4B 5F7DB 1UYWH 2Z9TA 1MF2H 1WFUA 3HC3H 2WUCL 2ZSWA 3ARBB 3NACL 5BS0B 1FZJB 2W9EL 5D1ZD 1GPOH 3SDAC 5L7XH 3NPZB 1JYNA 1YNTB 3DGCR 2GUOB 2C1OA 1QKZL 1FN4A 1KYOK 2NTFA 2GITB 1A14H 3P4MA 4OZGA 3ZO0A 4JFFB 1NDGA 1E4XH 2ICES 1BFOA 4BQCA 3UROR 4MJ5A 4OSUH 5DS8B 2A9ML 3AB0B 4HWUA 1AD9A 4MJ4A 3GSQB 3MRNB 3S88L 4P99A 4LRNH 2B4CL 3GZKA 4HFUH 5DHVH 1LNUA 1KJ3H 1QRND 2J5LB 5BW7A 1CLYL 3BZ4B 3SE9L 5C0CD 4GFTB 3TCLA 4DVRH 2R0KH 3RY6A 4KI1A 3FZUC 4P2CG 4N0FB 4X9BA 2AK4E 3K1DA 4UTBH 4RMSA 3QDJE 4I3RH 3X11A 1YUHA 4QXUL 2D0GA 3X3FL 4OFDA 2H3NA 2AI0L 3L5WB 2R4SL 3GSUA 5EORL 5T1LB 3KLAA 4NFBA 2PCPA 4N1CA 4OIIL 3RHWK 3EYOB 5MEQA 2YPLA 1B6DA 1B88A 3RTQB 4G7VL 3TZVB 1NCNA 1T2JA 3O2WH 4MQSB 2YXMA 4HAFA 4M7LL 3BPCB 1BWWA 5E2VH 4KHXL 3RY5A 4JFQB 1KBGL 4U1IB 3VG9C 1PX4A 4KK6C 5T1KD 2AAVA 4F37K 1LEGB 5DRXA 4C55A 5MEOA 4GAGH 5LXGH 3QUXB 4XNUH 5DXWA 5C0IB 5IHUL 4BUHA 2ZJSL 1QSFE 1MLBB 1HXMA 3T0VA 1IQDB 4XXDA 4G8EA 4ONHB 2D4FA 1J0YA 1TJGH 3OQ3B 1YQVH 2IQAA 2OI9B 2W60B 1FLRH 4GXVH 5BVJA 4NO5B 2AJYH 3KLSA 1N4XH 4JFEE 1MVUA 2VZOA 5F1IA 5JHLH 1IC5L 5CEYB 5AZEH 4PJ7B 4LSTH 4P4KB 5EBGA 1B0RB 4M7KH 1BREA 5CJOH 3HRZB 1SY6L 4KK5D 4U2ZA 1AY1L 4PV9A 4W6WB 5HI4C 3MJ8A 2ZKHL 1MREL 5ICXA 3WE6B 2B0SL 3IKCB 3MLTB 5L2JB 2EYRA 1Q9KB 3EJZD 5C6PB 2A6JB 1G84A 1K5NA 4PRNB 5F6HJ 3ZSTA 3O3DB 2ERJB 3UZQA 3GJEA 4QOKD 5DJXA 3MACH 4M7JH 3VE0B 2YZ8A 2OQJB 1G9MH 1BWMA 2XN9B 3D39D 2A38A 2HLAB 1ZA6A 3WN5C 3QFJA 3MOBH 4WY7H 3KJ6L 4MQTB 5EH1A 3GIVB 3VW3H 1L7IH 4UBDC 3I3EA 3LEYH 2ZG2A 3EFDH 1QLRA 2OJZH 4MD4A 4JN2B 4DZBB 3ZHDA 3AU1A 4QRRA 1LO3H 3P0GB 4BH8B 4KDTC 3VFRB 1WLHA 1I4FB 2YD3A 5EOTA 3C08H 4M8QB 2NY1B 4AL8H 3PV7A 4WIQA 4G9DB 3WHE0 3E8UL 5C09E 1ONQB 3O6KH 5T5FH 3KHOA 4ZUSA 1X5XA 5A40E 1MIEH 4Q9QL 3G08A 4RISH 2YUZA 4P59L 1G9MC 4WTXA 4NC2B 1R3KA 4PRPA 3AXLA 3K4AA 5E95B 2QQLH 3G6AB 3PWLB 3QFDB 1ZEAH 4AIOA 5D7JA 1GVIA 5FECA 1JWUB 4F7EA 4E0RA 3RI5K 4HUUB 3IXAB 5CD5D 4XTRD 4Z76A 3NCJH 1MFDL 2EDHA 3W0WE 5L8KB 4OT1L 2FJFB 4WEBL 4KROD 5FYLE 5ID0B 1CZ8H 3CX2A 3MV7B 4AENA 4GW4A 3QNZB 3FCTA 4Y19B 3K8KA 5ISZA 5IB1A 3GMPA 1TQBC 4GMTH 1FGVL 3IDIB 1JNLL 5I16A 3OKOB 4WI4A 1CFVH 3L3GB 2H41A 3EZJB 3I50L 5A3ID 4EI6A 3RTQA 2V17H 1A6VL 4JDZB 1GZQB 4DJMA 3WNKA 4EUPG 2YEZB 3FB8B 3ZKND 1BECA 5EWIL 2QHLA 1LK2B 1F02I 1PZ5A 5HYQA 1NBVH 3T3MF 3FO2B 3CMGA 4XBPA 3GK8H 4HSQA 3QNXA 3VXRD 3TNMA 4N5UA 2FEEL 3UJIL 1II4E 1BD2D 1MQKL 3TV3H 4MD5A 5J6HA 3EO9H 1NCBL 3C5ZC 4J2XA 2I9LA 5T3XH 1AO7A 4L4VD 3RWIA 2LU3A 5GSRA 2HMID 2YKLL 4TUJB 1U6AH 2VC2L 1MNUL 3GSNH 4IOSD 3ZDYF 43CAA 4O02L 3QRGH 1RVFH 4PGBB 4KRPB 3QQNA 5EZJA 5JO5A 1OWWA 2H2PD 3MREA 4UV4L 4M7ZB 3U4BH 1DZBA 4ZNEA 4IHOB 4J3WA 4OGAD 5I2IA 1OTSC 5ERWB 4E5XB 3HE6A 3BFOA 2C3XA 4N0UB 4FP8L 4NHUA 2P5EA 4U1GC 1CT8B 5JIPA 5EDXA 4YGVA 3GJFH 5FA3A 5DGRA 3EYVB 5ESVA 5EZIH 3T3ME 3VWKB 2DI8A 1L6ZA 1YC7A 3DMMD 4HUVA 3DX9B 1BVLB 1NC4A 4R3SB 4HFWB 1HDMB 2X44D 4P9HH 5IBUB 4C83B 4YZFF 3IAQA 1RUKH 3KXFE 4KVNH 4ZPTA 5EZOH 4YEEA 5E8OB 4Z7NF 1BF8A 3C9NB 3TT3H 3AAZB 3ZDYE 3K0WA 4UUJB 4L9LA 4QHNB 3MUGB 4NM8L 4M4PA 4LCIL 5TH2B 1VGEL 3S97C 4QXGH 4GBXA 1IAKA 4FQJH 5I1LA 3F65A 2Z92A 2X4UB 1RZIA 1I85C 4JO2H 4ZS7H 3LS4L 1J1OL 1NBYB 2DKUA 3QHFH 2Q20A 5ANME 1ZS8B 2NX5A 4XP4L 3MLRH 3JBG7 3RGVB 1AI1H 1YY8B 3QXVA 4P9HC 4L8BA 2AK4B 5GGRB 4MA3A 3QDJB 3F7PC 4H1LB 3FAXA 2PKDA 3PQYE 5C0GB 2LTQB 4NQCB 1RZJL 4D0CB 3MRQB 2QSCL 4OQTA 3HB3C 4IMLB 3WBDA 2WIIA 2OP4L 4OZHF 4MA8L 1F4AA 1UG9A 4G42B 5EPMB 1VEOA 4MXQC 2DLHA 4YZFE 2EE3A 2PF6A 1HEZA 4RAVA 5KSAC 1MJUH 1X6NA 3WFEL 5IBTH 5DRWB 5HGBA 3GGWA 4RNRA 5F9JB 5CBAA 3C60C 3GMOB 4Z7NE 1RZGB 1IGYA 4MNHB 4HUMB 3OKOA 1QVOA 5DQJA 4I48B 4APQB 1ND0A 1I8MA 1OTTC 2K7PA 4WJ5B 3MR9A 2FO4B 5K9QG 1JGUL 1QSFB 4L8SB 5KSBF 2DRUA 4RMUA 3C2AL 3E6HB 5TFSH 4J8RA 4X0KA 1YPZF 4JDTL 4W68A 2ICEA 4IDLA 1C16A 2I26N 4TNVF 5FCUH 3ME0A 2P5WE 4JM4H 2MSPA 1G6RB 4NQED 3D39E 4JFEB 1JHTB 4IMKA 4K94L 4WFHE 3NFNA 4KZDL 4GRLD 4PJBA 2PXYB 3ALPA 3NFSL 5E9DD 5EUKA 3O3BB 4L8CA 4J3UA 4OZHE 3O6LH 2Z91A 2OXGA 3TA3D 1QQDB 2XICA 1KPRA 3BGFB 3MUJA 1HIMH 3QQ3A 3RUGF 1MI5A 1O0VA 3STBA 4I3SL 5ESAA 4IRZH 2B7DT 3B2UC 1SVZA 4E41D 2ZCHH 4DTGH 1T1ZB 4Y16A 1DDHB 1TFHA 3MBEA 4JRYD 3AS1A 2W9DL 5D1XD 1D5BA 5CP3A 1U8NB 1N0XH 1VSCA 3ES6B 1CK0H 1L4IA 2MMXA 5CJXA 5KSBE 3VRLF 3K1KC 4GSDL 1YPZE 4PBVC 1F45A 3BIKB 2HT4D 1UWGH 4YLQT 2DTMH 4JFPA 4LF3B 1INDH 3PG2A 1PYWA 4NKQB 5CEZD 3QUMH 3SJVE 3AVEA 2IH1B 4ZOBA 1PBYA 1NKOA 2CR6A 3B5HA 5ADOH 4HF5H 4EN3A 4HQQL 4UUJA 5C09B 4PJ8B 3RWGB 3UTQB 2PO6D 2O26U 1HNGA 3MO1B 4PJAA 3MRGA 5I1DB 4F7MB 5I8OH 2VB5A 1TZIA 3M1BB 4PUBL 4YR6B 1Y0LB 4YK4B 3FO9A 3RY6C 3RUGE 4DFIA 4DKFH 1DQLL 3M8OL 5E6IB 3SO3C 4WHTA 1R5VA 2A2QT 3D48R 2X4OA 4G6JL 2Q1EA 3RJDA 5I1CH 4LSRH 2Y06L 3VFNA 3W0WB 2AJSH 2IBZX 2VN4A 4L4VE 3VRLE 4Y4FD 4CL7A 1PKOA 4KC3B 1P7QD 3CH8A 4K2UL 2X89A 2QKIB 5DI8B 1T1WA 1WTLA 4IJ3B 4OCWH 4LSQL 4ZXBA 1UCBH 2VQTA 2VUOA 1EUTA 1MRDL 4TUKH 1UM5L 4K7PX 3IF1A 3SPVA 4OIBA 4DEPC 1G7MB 4H88H 5HPMB 5C0BD 4HWNA 1CQYA 1SMOA 3IYLW 2FSEB 4FABH 4UOJA 3V4UL 5IEHB 3KJ4C 4L8DA 3DRTA 4ODTH 5TE7H 3B9KB 5TE4L 5D7LD 1T7YA 5DTFB 1CGVA 3MCKB 3RNKB 2QQQA 3VGGA 3PP3H 3SDCB 3ARUA 2Z35A 3L3DB 5CEXB 1IEAB 2NXYC 5T3XE 4LKCB 2ARJQ 4K7PL 2KUTA 5D2NC 4H20L 3UTZB 1I1FA 4XCNB 2WWKO 3QIWA 5F7LB 3O6FB 4DOHE 1E27A 3KS0H 1OSPL 2VE6A 4M02A 1KIQA 3SDAB 3EIFA 4GQ9L 4K3DH 3DYOA 5DJ6A 1QFHA 2P24B 1MAKA 2H9GA 2YSSB 1RZ8A 5E8NB 5E2WL 4MAUL 1Y6KR 4HUXA 1KF9B 4XVUD 1MCRA 4ZFFA 3BO8A 2XFXB 4XPFL 4QNPF 2C3WA 4MGXA 4RWYH 4OM0L 3KPQA 3O6MH 3OGOE 3MXVH 4P3WA 4R7NA 1BHGA 3QXDA 1E6OH 4P2QA 1BOGA 2EDQA 5DUML 2A83B 4DGYH 2HRLA 3O11A 5E8PA 1ETZA 5CIPB 4DVBA 4BSJA 4OZ4A 2DIJA 5L9DL 3FT2A 5C0ND 4EDWL 1U8OB 4MAYD 3MRLB 4TVPL 4F3FB 2XIDA 5DUBA 2CKBL 1HI6A 4X5XA 4EXKA 3G9AB 2FL5B 2X4NB 4FQ1H 4PJGF 1CR9H 3DBXB 5HYSA 5I9QC 4F9PC 1YEEH 4K3HA 5B3NA 4ZUTA 5KW9H 3T0ED 2ITCB 4G6KH 5TQ2H 3RVTD 1JRHI 5D7JC 5ANMB 1VPOH 1IAOA 3C6SB 3UEZA 4JVUA 3VG9B 5MHSD 2HVKB 3L5HA 2GFBB 5T1DH 2BNRD 1VKXA 4QNPE 4D9LL 2VXQL 5CSZA 2AP2A 3PQYB 1XCTB 2AXJA 2DQGL 3EJYD 5I74B 1UXWA 1GGCL 4M48H 3D87B 3THMH 3ABZA 1CD9B 1KJ2L 4PJ5E 3UAJC 2NQCA 3EO1A 3SDDA 3KYOB 3QUZA 5DMJB 5I1JH 4YHYC 3VFPB 2EH8H 4HWBL 4LCUA 1JNHB 4MQXC 3IETB 4BZYA 4PJCF 5HHXL 5FO8A 1FYHB 2ZUTA 4HMCA 2DYPB 5B3JF 4NNXB 4PJGE 1IGML 2XQYG 5KAQG 4P46B 4TSAH 4NC1E 2IPKB 4MSWA 3H9SE 4HDIB 3HZMB 2WZPD 5JIIA 4HH9B 3PV6B 2K9UA 2COQA 4PTUA 5DZNA 4E41E 1TNMA 1G7IA 2P5WB 32C2A 3IJHA 3LKNB 1ZHBA 3FFCE 4GKZB 4IRJD 5AAMA 1FHGA 4XCYB 5IMLB 1M7DB 4O9HL 4X6EB 1DFBH 1NDMB 1IZKA 5D1ZA 2EIBA 3BPNB 4UINL 3HE6C 2X1OA 12E8L 4FFVD 4AH2B 1QBLH 5C9JB 1ZLSL 4U1SB 3BRFA 5EG6C 2MJWA 2CDFA 3BWUC 1J12A 4HIEB 4IRSB 4JFXA 2OZ4H 5T3ZH 2Z31D 1FRGL 4PJCE 5CGYC 3LN5B 3BKYH 4JLRA 3VH8B 2ZSVB 3OL2A 2C9AA 4P3DB 5B3JE 3W9DA 4NCDA 4TRPL 2I9TB 2UYLA 1I75A 2EYTB 3PGFL 1CS6A 4ERSH 5KSBB 2ENSA 5M95B 4MCYB 3M17B 3TBSA 5EN2A 1YPZB 1NEZA 1HOCA 3ULUD 1HWGB 1QRNA 4PP2B 1DBBL 1L6XA 1KENH 1FVCB 5C0CA 4L9LC 1VEPA 5HHVL 3KXFA 3SJVB 3L3JB 3RWJB 1NBZA 3TO4C 3V7AG 3JVGA 3MOQA 2FYYB 4NWTH 4GAYB 5IB5A 5CFHA 3HI6H 3BP7A 4HIXH 1X5AA 3K8MA 3MV01 1M4KA 5CJ8A 1NANH 2WV3A 1DBAH 1NGYA 2R1XB 3X14A 2GSIA 3VXME 4HPYH 4M03A 2DQJL 4KPHH 5T1KA 1I1YB 3MJ6A 3DV4A 1AXTH 1FNLA 3MFFB 3NN8B 3KPLB 4PJ9C 1CFQA 4DN3L 1P53A 5LAXA 4HK3N 2BX5A 1HCFX 5BOZG 3WFZA 4FQHB 4XNQA 4K07A 3GSWB 5FKAA 3C5ZB 4NP4H 3MGTB 4HGWA 1T21B 1VADB 3RL2B 3V6FB 4LLUA 3P9WB 2DQTH 5L8LB 3UTTD 3HN3A 2Z8WC 4KVCH 4X6FB 1I9RL 5D7IA 1FG2B 1RURH 4PR5B 2EC9T 5E1AB 3TBWA 3S9DB 4Z0XB 4PFEA 1LD9A 2HFTA 4U1GB 3MUZ1 1B9ZA 3PXJA 1F4YH 4QF1A 3X3GL 1DLFL 1MWAA 1CVRA 3O45B 4L5FH 3V9FA 4QOKA 2QQNH 4GG8B 4IOIB 1SBBA 2VIRB 3S36X 3U0WL 1J0HA 3D39A 3V5KB 1DP0A 3LD8B 2X7LA 4GUPB 3GSNB 4L3EE 5GRXG 1D9KC 2B1AL 4RCAA 2PYFB 4ZUVA 4C56D 1ZT4A 3BKJL 1U41A 3VXNB 4KV5F 2YD1A 1A9BA 4XI5C 4XC1L 3SKMB 3QG7H 4OZHA 1QFOA 5EU5A 3OJVC 1JF1B 2F53D 1BGXH 4EDXA 3D1MC 3VFUB 1T80A 2JB5L 1PKQA 2Q86A 3GIZL 3S3PA 4R2GD 5E1HB 4X4YB 1ZVSA 1A6TB 3MBEC 4JZNB 1FV1A 5AD0B 4Y4KC 2R69H 2JB6B 5CJXC 3TIEA 2ZSVA 2VDQL 3GJFB 4P0DA 2IADB 1R24B 4PBXA 4R90L 3GSRB 2LQRA 1IL1B 1VGKB 3QIUD 2XZCL 1FIGH 3BE1L 4K8RC 3TYGL 2VSDA 2AV1B 3MLSH 5FUCC 3BUTA 1P5UA 1S7UB 1FO0A 1YNLL 5JUEL 1FVCA 1RUPL 4EN3C 2GK0A 4LIQH 2X4SB 3WUZA 4YUEH 1MCDA 1S7TB 4GOSA 4ZPVA 3FB5B 1CLOH 2BRRL 4HCRL 5JPMB 3TWCL 4KV5E 3HCVB 3G5ZB 2K7QA 2X9XA 3OKDB 5DJDB 1BBDL 3NGBB 4K3EH 3BDYH 3NABL 4CU6A 2E8ZA 4AEHH 4MJ6A 5C92A 4NUJB 2GSGB 2RQ8A 1LEIB 4IOFD 4G8GD 5K9KB 3ZYIA 3RUGA 5DJZB 4XP6H 4G3YL 3S5LA 1R3HB 5CLWA 2FEDD 1HYSC 1QR1B 1MY7A 1A22B 4JHAH 4CADA 3VXRA 2G2RB 1YEGL 3ARWA 4LAQH 3K3QA 1BD2A 4MZ2A 4PJ5B 5IF0A 3KYKH 4O2EB 5E8DL 1P4BL 1D6VH 1IGJB 3RX8A 5K93A 4HC1L 5HHOB 1VCAA 3RVWC 1CFTA 4L4VA 1IBGH 1KELH 3SDXF 1JRHL 1QNZH 2O5XL 3WS6A 5EUOF 2JJSA 1NFDA 3PP4H 3QPQD 1XF2B 2YRLA 5KVEH 3F12A 1F3DJ 4MJID 1UZ8B 4PGDA 1JIBA 3TN0D 4BFIB 4PJGB 5HTSA 1TXKA 4FFZH 2X4TA 4NQVA 4JB9L 4XGZA 1QLFA 1BZQK 3H9SB 1TMCB 1I8KA 4NT6B 3A6BL 2EYSB 4JQVC 1KSRA 3T65B 4X83A 5E5MA 3FFCB 2C4FT 5IB2A 1XF5B 4LBEA 4GH7B 2ATPA 4AMKH 5LBSH 2IALA 3T04D 5CS7A 3DVIA 3DMMA 1A7RH 2A6IA 3N9GH 2NY7H 2VUYA 5AG9A 3MODL 1A64A 2ID5A 3F7YA 3LAFA 3OZ9L 3GFUA 3GO1H 2A9NL 2IFFL 4AQOA 3QUKA 3SDXE 3DO7B 3SKMA 5EUOE 2E3VA 4XVTL 3VXOB 4PJCB 5F7FA 2X70B 3M45A 4PIRF 3AMLA 4OLYH 4Z78A 5T3ZE 1NCCH 1OP9A 1L0YA 4RGMB 5C0FA 1BIIB 1F6LL 4MZ3A 4WFED 4ZOAA 4QGTA 3QJHA 2JF1A 4NUGH 1J5OH 4HX1B 1OOAA 3GHEL 2IADA 1Q9LB 5F3BB 3MROA 4PRBA 1N8ZA 4XP1L 5K9JH 3OKEB 3SO3B 4LPYA 3MRFB 2VDPH 2R0WL 4JM2D 2ARWA 4NO0D 4LEXL 4KJQC 3HPLA 3SY0A 5IMKB 3AUVA 4G8IB 3QUMB 4Y4HD 3RDTD 1EXUA 2ZP0T 4I5BB 1XR8B 2JCCF 3HG1B 4DKEL 2CDGA 4LMQI 1K4CB 5D7SL 1HHGA 5DJYB 1NCAH 2NY3B 2A6DA 1BEYH 5C3LD 1XGUB 2FJHA 1UJ3B 1A4JB 4M9PA 3VXMB 4CNIA 3KYAA 5IBLD 3DSNA 3I2CL 4OCLC 3ARDD 3UO1H 3WSQL 5C08B 4J3VA 1YMHB 3PHOB 2YD7A 4DEPB 2EXWC 4X9FA 2FRGP 1P1ZA 3EHBD 4N5EC 4Y5XA 4FTVD 4OBSA 4PRHB 4OLWH 4QRTB 4O58L 2AJ3B 3KJ4B 3RWEB 3SKOB 1JWMB 5JHDD 5HDQH 1CICB 5TQ0L 3U48A 3I75A 4U6XB 4Z77A 4JRXE 5JW4Q 3U30B 2V2TB 4NQEA 3WNPA 4XZUA 2QV2A 1AQKL 1FBIH 4GRLA 3D18A 2Y5TB 4P5TA 1C08A 5D2NB 1KXTB 4XNMB 3WUWB 3QI9C 1AQDB 5EOCH 3OKMA 2VQUA 3LN4A 1XF3A 4N0YH 2JCCE 3OXRA 5CZVH 2IPUK 3GMQB 3PWJA 3OPZL 1VDGA 3KAAA 3OJDA 3TA3A 3HR5B 1PVHA 3QDHA 1M71A 2IBBA 3S96A 3WMSA 1URLA 1EGJA 2J6EH 4P49A 4RFOL 5DJ0A 2VXTL 4XHJD 4WWKB 5ID1B 2BXYA 4E41A 4PREA 1R0AH 1Z9OA 2VDRL 4PLKC 2EDWA 2XA8L 4JRYA 3IS1X 5D1XA 1VESA 4CAGA 5A2FA 4L3EB 4GXUM 4TUOB 3HZVB 4FNLH 3KNBA 3QH3A 4JO4H 2XNAB 5EA0H