3JVAA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 121
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jvaA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jvaA01
2PA6A 2PU1A 3TJ4A 3NFUA 5FJTA 4MMWA 3H8AA 3HPFA 2PU0A 2XH7A 2PS2A 1EBHA 2QJNA 2RDXA 3EEZA 3MSYA 4IZGA 4DXKA 2XGZA 4MGGA 3OTRA 4M6UA 4GIRA 3UXLA 1IYXA 2OQHA 4ENLA 4A35A 3UJEA 2HZGA 3QTPA 3RITA 2QVHA 3VC5A 1MDRA 5BOEA 2XH4A 4HCLA 4A3RA 1NELA 3VCNA 1ELSA 3KUMA 3TW9A 3TWBA 1NU5A 3IJIA 4KT2A 5FJPA 3ZLHA 4GGBA 4E6MA 3ZLGA 1P43A 1OEPA 3FYYA 3GO2A 2P0IA 2PP3A 3N6JA 3TOYA 3UJFA 3UJSA 3RR1A 3PWIA 3STPA 3JW7A 2MNRA 4G7FA 3GD6A 3S47A 4DHGA 3OZYA 2FYMA 4KPLA 3TQPA 2OVLA 2QJJA 3R10A 3TJIA 3MY9A 4HNLA 1JPDX 1WUFA 2ONEA 3GC2A 1MUCA 2DW7A 2AL2A 4X2PA 3R0UA 4K1WA 4HNCA 5FJRA 1L8PA 2XH2A 3ENLA 3VDGA 5FJOA 1XS2A 2AKMA 3UXKA 3RO6A 1EC8A 2OPJA 2GGEA 2DW6A 4KWSA 2PSNA 3IJLA 3UCCA 1JDFA 2O56A 2MUCA 1MRAA 4Z17A 4GISA 1JCTA 4GYPC 3THUA 2GSHA 2OFJA 3OPSA 3OZMA 3T4WA 1KCZA 4HN8A 4A6GA 3NXLA 2AL1A 3DG7A 1FHUA 3FV9A 3OW1A 1KKOA 3PWGA 2OZ8A 3U9IA 3FJ4A 3T6CA 4F4RA 2POZA 1TE6A 3N4FA 1KD0A 1YEYA 2GDQA 3QN3A 3SBFA 3D47A 1SJAA 1FHVA 3OP2A 2GGJA 3VFCA 4JN7A 3CB3A 4H1ZA 3QLDA 1R6WA 2NQLA 1JPMA 2P8BA 3I4KA 2P3ZA 3MQTA 2PTYA 3D46A 4KEMA 3TWAA 3V5FA 3PK7A 3CXOA 2QDEA 4HCHA 3I6EA 3DERA 3RRAA 4H2HA 3DFYA 5IDZA 3UJRA 3U4FA 3K1GA 1MDLA 1KKRA 3N4EA 3SN4A 4ZA0A 1E9IA 3UCDA 5ENLA 4JHMA 3JVAA 2OQYA 4IT1A 3Q45A 1P48A 3T8QA 2FKPA 5FJUA 2QGYA 2HXUA 4HYRA 3RGTA 3SJNA 3CK5A 1R0MA 4YWSA 4Z1YA 3FVDA 6ENLA 3MWCA 3DFHA 4ZCWA 3H70A 4IP5A 4E4FA 2OX4A 3QKEA 3R0KA 3EKGA 1SJDA 3PFRA 3VC6A 2PGEA 1BKHA 2OZ3A 3IJQA 3FCPA 4K2SA 3ZLFA 1PDZA 3DIPA 2ZC8A 3DDMA 3SQSA 5EU9A 2QJMA 2PP1A 2HNEA 3SN0A 2XH0A 3P0WA 4IP4A 4M0XA 3P3BA 4DN1A 4FI4A 3BOXA 4DYEA 3JZUA 3P93A 2P8CA 2I5QA 3MZNA 3CT2A 4GMEA 3DESA 4E4UA 1ONEA 1TKKA 3SN1A 4H19A 3CAWA 3N6HA 2PMQA 2PTZA 2AKZA 3QPEA 4MKSA 4IHCA 2CHRA 3T9PA 2OKTA 3NO1A 3DG3A 3S5SA 1W6TA 3UJ2A 2GGIA 4E5TA 4ROPA 5J04A 1PDYA 2HXTA 2OG9A 4GYPA 2P88A 2PTXA 4DX3A 1DTNA 3V3WA 3MKCA 3CYJA 2GGGA 4IL0A 4DWDA 2OZTA 1F9CA 2PCEA 4FP1A 3Q4DA 3V4BA 7ENLA 3H12A 4E8GA 4G8TA 2OLAA 2GGHA 3BJSA 3ZVIA 5BOFA 3TTEA 3H7VA 1WUEA 3MUCA 1EC9A 3R11A 2PP0A 3ES7A 2PTWA 2PGWA 3ZVHA 3VA8A 4HCDA 3DG6A 4K8GA 1TZZA 2PODA 2PPGA 4GGHA 3UGVA 3BSMA 4J3ZA 1BQGA 2ZADA 1EC7A 2OO6A 4IL2A 2GL5A 3IK4A 3TCSA 3NZGA 4JN8A 3DEQA 1MNSA 2XSXA 3I6TA 3FXGA 3GY1A 3R1ZA 1EBGA 3ZVHB 2QQ6A 3B97A 4J1OA 1RVKA 3DGBA 3RCYA 2AL2B 3V5CA 4H83A 4EWJA 1SJCA 2QDDA 1XPYA 1ECQA 3SSZA 3ES8A 4GFIA 1SJBA 3VCCA 3R25A 4HPNA
chains in the Genus database with same CATH superfamily
3CHVA 3NQMA 3I7SA 3U4AA 1QBBA 3F5KA 4A05A 1FTXA 4GNVA 3HPFA 1TV2A 1XIEA 2DDXA 4LYKA 1RK5A 2PS2A 1QDSA 5EKYA 3EEZA 3MANA 3PZVA 2BGNE 2E3ZA 2QEZA 2E28A 4M6UA 1H7OA 3UXLA 1CDGA 4NJGA 5E0KA 3DKLA 4JTFA 2HVOA 2ZZ7A 3MKKA 3EKZA 3M7WA 1J5TA 1JQVA 1UH4A 4QHRA 2X99A 1XCWA 1ELSA 1NHPA 3MCNA 2XN1A 3WBXA 3CHDA 3TW9A 3G1SA 2X16A 5A5WA 1E4IA 5T91A 4UUIA 1GJUA 4PMVA 2REQB 1ZAHA 2PDIA 4AZHA 3W07A 3OZPA 4JTIA 1RZMA 3TZNA 3HQPA 1NDVA 1TPH1 3PBGA 4B3LA 3CGBA 4AX7A 3GXPA 1TPEA 2NXHA 1CXFA 4KIRA 4L56A 1J2BA 1W3KA 1JJKA 1Q8JA 2A4AA 1W3LA 1DIOA 5ABFA 5CGTA 1SSGA 1FFRA 4RNHA 1WUFA 3FA5A 4LPCA 1ODZA 3AYVA 3KE0A 3VIMA 4JFVA 2R1LA 2UWFA 2OEKA 3R0UA 2J75A 5ABGA 5D02A 3RO6A 1YHTA 3AIRA 1P1XA 2QCDB 3O1NA 3CQJA 4HTBA 4O4VA 3VINA 1KWGA 2JFEX 3M0KA 1S2AA 3C4UA 4NJHA 1REQB 2WMHA 4DBUA 3B9AA 3A3XA 3H2EA 1Q3NA 1MW3A 2YDSA 3DECA 1BRLB 1LG1A 2A85A 4EMIA 1A80A 3R8GA 1C91A 2VUYA 2Y2WA 3LX9A 1ZQ5A 4K8DA 5IM51 2HBXA 3P60A 1DXEA 4A2RA 3F2DA 3EWZA 5EPDA 3LPGA 4I7UA 1IIGA 3LTSA 5CJMA 3LZ3A 5DXYA 1PIGA 2VRQA 3QOMA 3L2LA 5AZ1A 2GR0A 1EX1A 3PFMA 1UZ1A 1ZSXA 3CZEA 4U31A 5IOBA 5FEZA 3N1AA 3QR0A 1VDVA 4ATLA 1U1UA 1YTDA 1ONRA 4EQXA 3V75A 4LF1A 2P3ZA 1MXGA 1NH6A 3LN3A 4TV6A 4Y2WA 5CSYA 1JXKA 2PLMA 1ZALA 1ITQA 2GR3A 6REQA 4O13A 1F07A 3MO4A 2QCNA 1LRTA 2GWGA 1H61A 1R3YA 2CXGA 3AMZA 2HK1A 2NQZA 2EEXA 1Q45A 2HTMA 2CPUA 2PAJA 2TPSA 3W1TA 2WKLA 4LBUA 1QW7A 5ECUA 4FX8A 4S39A 1CEOA 1SW7A 2Y7GA 1K02A 1KCLA 3GE7A 3LDVA 2NX3A 2C1GA 2H3BA 1KKRA 3N25A 3CH0A 1OB0A 2YDAA 6XIAA 1VS1A 5FACA 1R85A 1E9IA 1E6XM 3RX4A 3ZJ8A 5DQPA 4UTKA 3L4TA 2XWDA 1U5VA 3NZPA 3ZT6A 3EDKA 3VNZA 4JTCA 3CK5A 4Z1YA 3AZTA 5BWFA 1W3HA 7XIMA 1RP8A 3EOEA 2FJKA 4LRSA 2C0HA 4S23A 3LG3A 4LAOA 2XFWA 4YNGA 3LPOA 3WBYA 1QUMA 2BHYA 1MRQA 2HPIA 3CL8A 3SCRA 4I6VA 3OO2A 1EYEA 1ZBWA 3BO9A 4EQWA 1W91A 5EY5A 2XVLA 5GNYA 4K37A 6TAAA 3CGCA 3S0CA 1J79A 4RL3A 4BQ3A 3SQSA 2VMFA 4IUGA 1W5NA 3DFPA 5LIWX 1UBPC 4I8DA 2XVPA 1XX1A 3ITXA 3MMUA 4H01A 2BTMA 1FFVC 3L4ZA 3TVAA 4NKCA 3MZNA 2NSOA 1CYGA 4A22A 1RM6B 1WV2A 3AMKA 4C91A 4AC1X 2YL8A 2P3EA 3EOUA 4S3KA 1LG2A 4HU0A 1UUMA 4MWAA 3SAZA 4NILA 3HA1A 4E3VA 4URIA 3EANA 1G7UA 3ANVA 4TVCA 3DG3A 2WMIB 1YE6A 3KBSA 2PEVA 2YFNA 2R8WA 5A69A 2QCGA 4P7OA 3VIGA 2YBTA 4H2CA 7ODCA 3LOTA 3LYEA 1PIIA 3EEGA 3LRMA 4E5TA 1Z7AA 3BSGA 2J7CA 3FX4A 3H54A 3IIXA 3TA9A 1G69A 4PUMA 1OIFA 2BMBA 3NQBA 1KR1A 4JYDA 4EKJA 2AQWA 4N02A 3C2OA 2A0NA 1VJZA 3A47A 3DFTA 2WQPA 1S46A 1CTNA 4R7OA 5A3HA 3TTEA 3S2JA 4EPBC 1KGWA 3LBOA 2B7PA 1OC5A 1GOIA 2QUNA 2ZRZA 1TTIA 1RQEA 2J6XA 3QGKC 1HN1A 4N4QA 3ZSTA 1Z69A 2ZICA 3BICA 1UC5A 5H8UA 3GZ3A 2J66A 1XLBA 5A6BA 3R2GA 1EGZA 3N19B 4AHOA 1UP2A 4F8XA 1W5MA 1QT1A 4JQ3A 3O63A 1OX4A 3L2MA 4LWWA 3CHCA 3HV8A 1VR6A 1AH0A 4O0KA 1HO4A 1Y65A 4ADWA 4YVXA 1DP0A 1YXYA 2YGYA 1UZDA 2VDGA 1RVKA 3B8SA 1J6OA 1HGYA 2QR6A 1G94A 3WH9A 4MSSA 5A2AA 1JD9A 3ARUA 3NOYA 1K9EA 1S1RA 4FNQA 2XGBA 4Q4PA 1QCWA 2PI6A 2WJEA 3H21A 4DJFA 3V36A 5FJTA 2DJLA 3GTIA 1OK6A 2GQAA 3HPSA 4DLFA 4IH3A 1EBHA 4NJJA 3CAQA 4EQSA 3VMOA 5AKQA 1W9VA 3E12A 4W4QA 3RX2A 1DE5A 2WV8A 1FHLA 4AY7A 1XICA 4GABA 3QQ1A 2CXEA 1AQ0A 1Q85A 2XWEA 4RE4A 1RUSA 2W5FA 1ADDA 1SU5A 3AUJA 3GVQA 1GYNA 1R9XA 2ZUWA 2GVYA 2WC7A 3GNDA 3PPFA 3LTPA 1TIWA 1DBTA 4LAZA 4JTKA 2VWTA 3W85A 2WANA 1IEWA 5FF2A 4Z2GA 4D2JA 1LT8A 1KW1A 4TQTA 1DJZA 1E9YB 3KEHA 4G7EB 4GGBA 1XIFA 1UWSA 4DJEC 1UWAA 1PUDA 1CGYA 1M5WA 4Q3MA 3CTTA 1V08A 3RR1A 1RQBA 2A2IA 2VJXA 2WPGA 5CZ0A 1DKWA 3M47A 1GESA 1UA3A 3QHNA 2OTDA 2V5CA 4J2MA 2UZ9A 4GC4A 3FSTA 4PULA 3M5YA 3EKLA 5CSUA 4C6EA 3ZXWA 1XLDA 8XIAA 3LLFA 1X96A 3AOFA 2JEPA 3S1VA 3SZ8A 1JUEA 2ALRA 2G97A 4MF4A 4NP7A 2BSLA 4R85A 4NZCA 2UY5A 3TONA 4P8VA 1A47A 4Q8VA 4Y8EA 3VD7A 3SCSA 4H41A 3AIUA 1HKMA 4O16A 2QXWA 2Y7EA 4KWOA 1W54A 3I7QA 3AISA 1A5KC 3LK6A 4PGLA 2J25A 3BAWA 3O06A 3M0XA 3G0XA 4P8XA 2WSPA 1KCZA 1PX8A 5EB8A 4FHAA 4HN8A 4WK9A 1V0KA 1TX2A 2V3FA 3IANA 1I9CB 4H7VA 2VTFA 2YW4A 4LYPA 1K7EA 3W88A 4FA3A 1LYXA 3RAOA 3MUXA 1ZU8A 4JOMA 1YEYA 2ZX8A 5REQB 3LM7A 3H2AA 4ERIA 5CG7A 5IXEA 3CZGA 1W1PA 1EUNA 2VEIA 3KZPA 5FS7A 1C9DA 4B2DD 3NEHA 5JCKA 1NOFA 4YHGA 1UIPA 3A3WA 4HNNA 2FMOA 4LVAA 5FEPA 2XZ7A 1OGGA 1LOSA 3KW3A 3PZOA 1H5YA 2J78A 1GOOA 1JULA 1RK6A 3ZJ7A 1EBDA 4I9AA 1XRSA 1XBZA 2TYSA 2Y4SA 2FTYA 3MMDA 4JZ5A 4ZE5A 2WQDA 3WCZA 3NO5A 3VKJA 3BAJA 4S1FA 3WMCA 2YCIX 2WJFA 3R8RA 4ZVJA 4UNKA 4QX4A 3E2SA 2CERA 3EX4A 3A7RA 1L6YA 3D3FA 1YKWA 4JEJA 3GNXA 1FCBA 4QAWA 3M5ZA 1DYSA 2EO7A 1O5QA 3RJXA 5F7UA 5CJ5A 4GI6A 5D8WA 1JL8A 1L2UA 1B3VA 2PDPA 3VUPA 1UWIA 1R0MA 1I2PA 3GKFA 2CETA 4PSRA 4KFPA 1OJXA 4PEKA 4XAPA 1RY8A 1GRFA 3BANA 4O54A 1FFQA 2P1FA 4WXYA 4IG2A 3GRSA 4W86A 4L1XA 3T09A 4JAWA 3AHYA 4HSNA 2EPLX 1SFLA 4PTVA 2ZRVA 4TU1A 1LQ2A 4DUXA 4LGXA 2E09A 1KRMA 4Q4RA 4HHMA 3AC0A 2BGSA 3AXMA 3UPMA 1EZWA 1BWVA 3M5XA 1P7TB 1AL7A 2O7QA 4M80A 2OXNA 1DWIM 2O4QA 3S5ZA 1TV4A 2Q8ZA 4UTMA 1J0HA 4Z1CA 4JFUA 1O66A 1NVMA 4MUZA 4LUSB 3BOXA 3VK5A 5HNRA 5DBUA 3QHOA 3VIOA 4E4UA 2ZUTA 1TWSA 1XCFA 3CAWA 1JRCA 1KFJA 1NDWA 2VYOA 2PTZA 4AHPA 4FAMA 4MKSA 1E6ZA 1HXJA 2C19A 2VC7A 4CQAA 4JXCA 4HK6A 1XV8A 2F5ZA 1LJYA 4XBKA 2W55A 4UC5A 4AD2A 1FDJA 3W25A 4ROPA 1UG6A 4GNKB 2ZBTA 4NAEA 3CTLA 3E38A 5IBXC 3LBMA 3CHFA 2DVXA 1TE1A 2VZVA 2JEQA 1O1ZA 3KHDA 3EOLA 1GVFA 1YQ2A 3ABXA 3A24A 1K9TA 2VZOA 1QNVA 1TJ0A 2QDGA 2Z25A 3P8IA 2FZ9A 4O1CA 5IRPA 1PTDA 2XPKA 4C6PA 1PB0A 1X6UA 4ZOCA 1W9DM 2VP8A 3SUTA 2ZTKA 1EWDA 3WENA 3VGEA 3WH7A 3PSVA 3U2CA 5CJNA 3TTOA 1TZ9A 4HTYA 1DV7A 4YWIA 4B16A 1Q6RA 1A0CA 2FHCA 1Q6FA 3SECA 2PPGA 1M6JA 1A4MA 3FSUA 3MJMA 1OC7A 4MWAC 1MW2A 3BSMA 1B9BA 3UPBA 1BQGA 4P61A 1OYCA 4BY3A 2OO6A 4U2YA 3B8IA 3TMQA 3FY1A 3TCSA 5J5DA 4NASA 5BW6A 1J0IA 1E73M 1JDDA 3HPXA 2WOQA 1F2JA 2DVUA 1E70M 3T4CA 5ABFB 2J88A 3QV6A 4AD1A 2RKXA 1MI3A 3WEOA 4MAVA 2PDNA 3MT1A 3WNPA 3NL5A 4PODA 2CWXA 1JZ5A 2J7EA 4AZCA 3AHZA 2VGIA 1EDQA 1W1VA 2CLPA 4HPNA 1S2TA 1I2QA 1XRTA 2PU1A 2Q8LA 1LL6A 2GUBA 4HMDA 1V51A 4BF7A 4JFWA 1R2SA 3CPGA 3UWQA 4GYFA 4WGHA 3IIVA 1DXIA 4UQAA 1XDJA 4X61A 4HD5A 3DUGA 5I06A 3DXIA 3S3GA 1VD6A 2G3IA 5XIMA 4ASTA 3URBA 4PTNA 4DZ5A 1PWMA 3RITA 1TWDA 1G4TA 3F4CA 3GDBA 4LH8A 1K6WA 3TYZA 3NVVB 2WCSA 2XN2A 4NZFA 3AU6A 3BOFA 4AH7A 1GRGA 1Z8AA 1QATA 4XAZA 5DT5A 3WSUA 4GHRA 2XIOA 3H2FA 3W7LA 1P43A 3GLCA 1NF7A 1TTPA 4NSBA 1EX5A 1NWUA 3GNRA 2WWDA 4F3HA 1J18A 1GEUA 2MNRA 3I7RA 5A6JA 3S47A 1PCKA 8A3HA 3HURA 3CGEA 1E51A 3ARQA 2VC6A 6REQB 2E5DA 1XUUA 1H60A 1A5NC 4H9YA 3TC7A 1JEZA 1IXNA 4LVDA 1E9ZB 2ZA1A 1DJNA 4L80A 1YXDA 1PBGA 2YL9A 1JCNA 3T07A 4K1GA 1V59A 3B05A 4E4PA 3MWAA 1QNPA 3A9BA 2PDLA 3KL3A 1XLIA 1OABA 3IJLA 1H49A 4W8BA 4NEWA 4GRSA 1EFZA 1FWRA 2VOMA 3VDHA 4GY0A 2VI0A 2O56A 2ZXQA 1JDCA 3TYUA 4I7WA 1A5SA 3P7YA 3BG9A 3V18A 1R3VA 3W4RA 1YIXA 4KMQA 4JKLA 3OG2A 2IQTA 3I3DA 4PB3A 2R6OA 4U2ZA 1NDYA 1G0CA 1RY0A 1OSEA 2O9RA 4JTHA 1ISWA 1FCVA 2Q3RA 3OC4A 3FJ4A 3PZTA 2WK2A 1OF8A 5G1MA 4IMGA 1QNSA 2SFPA 3G1DA 4O11A 2RH9A 3BLDA 3CMGA 4JIRA 1NFPA 3T1GA 4C5YA 3P80A 3VD3A 4M29A 1R30A 1TCDA 3W2UA 3W2MA 1RPKA 4CCZA 4QNEA 4HU8A 1GG0A 3AHVA 3M64A 3QMSA 3C52A 2OYMA 3OVRA 4LNCA 1RBAA 4GPNA 1KFWA 5BU6A 1Y5VA 4ICMA 2J8GA 3LCHA 3ID7A 3L4VA 2GQ9A 1Q7QA 4ZO9A 2OO0A 4MNKA 3V0UA 2PRLA 4CU8A 1POJA 4C6LA 1DXFA 1GOQA 3NVYB 4J35A 1VKFA 4IPNB 1PO9A 1VJSA 1CBGA 1U5HA 2G3NA 1BF6A 3AZSA 4AEFA 3M41A 4A8IA 1XQLA 3CEUA 9CGTA 1GVYA 3LLXA 3B9DA 3VD9A 1VIWA 5I77A 1S5WA 5E5CA 1SGJA 3M44A 3NVDA 2ZRWA 4MWAB 4C6IA 4ZZ9A 3SN4A 3GTHA 5GVJA 3LU2A 1P0NA 3HZ3A 3UFYA 5ENLA 2BZNA 4IFKA 3AJ7A 4GY7A 2EQ6A 1U2YA 3GNOA 3OA3A 1T96A 3OU8A 3UQNA 4LANA 5I6SA 4F0HA 4WKAA 4FOKA 1FH7A 4Q8UA 4CEUC 3TMLA 3RGTA 2CZDA 2NV9A 3BVJA 4V2XA 1GZGA 4RXGA 2ZZBA 4N4PA 3L4YA 4HMNA 4H4QA 3DFHA 3CV6A 1JIBA 4QS6A 1JAKA 3N3TA 3TYEA 1A3WA 1EDGA 4DI9A 3QKEA 5U7SA 2F6UA 4O15A 3VC6A 4EXQA 4Z42C 1ZLPA 2X8HA 1RA0A 1Y8BA 3W7EA 3RRXA 5EYWA 2B0MA 2F6XA 4W8LA 3R79A 1SFSA 4KEUA 3ABRA 3CC1A 4WQ6A 2QUVA 4G56A 1JUBA 1W3JA 1E0UA 3PY2A 3QY8A 3IAPA 4M8UA 2XSAA 3C3NA 1Z48A 4IP4A 6CGTA 4JIIX 1OX4B 1Y5XA 4LT9A 4O17A 1ZHAA 3PJXA 5EA9A 3VILA 1UD4A 3MBDA 2YLLA 2WOVA 3VKAA 5TD4A 4JTUA 4GG9A 1X1OA 4BWLA 2GVLA 2WLYA 1XI3A 2H9AA 2J13A 4UR8A 3TH6A 4QLLA 5HWNA 2TSYA 5F2IA 4ZB0A 3GXMA 1V0MA 3C0QA 5CCZA 1YXCA 4NNBA 4WOZA 4PC8A 4GVHA 3CL6A 5CPSA 1D9EA 1V3MA 3LB0A 4CQDA 3H7UA 5BWAA 3Q4DA 3CQ0A 3N18A 3F1QA 1NP2A 1EQCA 2NV2A 3SY8A 4B92A 4Q33A 3H7VA 2DIKA 4BV6A 2Q6ZA 4JIEA 3FDKA 1KM3A 5CC6A 1D3CA 3GXDA 1ZJHA 4ZO8A 4E2OA 1GJPA 1UJPA 4PL2A 1R2RA 4RLIA 4U3AA 4D6HA 1XLAA 2ZADA 1WB0A 4CQBA 3II4A 2Z00A 3A21A 3QFWA 4IQJA 1FBAA 2EG8A 1E5JA 1WDWA 1KQZA 1PTAA 3GDMA 3S9YA 2JK2A 4Z08A 4ZSUA 2YXGA 4V27A 1IV8A 3WDIA 3B03A 3B3DA 3KHJA 3TLLA 3ARZA 4MDOA 1VFFA 1LP6A 4H83A 1AW5A 1HKKA 1Q6GA 3N3MA 2YDQA 5FL1A 1S1PA 1XYFA 2VCCA 4FOUA 1SJBA 2PWDA 3GFZA 1FA2A 4IX2A 2XIQA 2GDUA 3FHAA 3EDFA 1TJ2A 4KRTA 2WZMA 1PL9A 4RUBA 1E9LA 1B57A 1GW1A 2BP1A 1UP0A 1UCWA 1F74A 3QC3A 5IHRA 2WHJA 4KGJA 2O0TA 2XFYA 5FJIA 2XSBA 4L6DA 2F2KA 1F3TA 2OLSA 4HA4A 1TA3A 4KWVA 2P50A 2OQHA 3S9IA 1KGXA 4TV5A 1A5BA 3E96A 4Q8PA 2E5AA 3W7PA 4V15A 4DZHA 1GSNA 2DT2A 3IWPA 2HCVA 3EB3A 1GEHA 5BMWA 5HQMA 2XU2A 5E0CA 2NZLA 1O94A 1WBHA 1B2YA 1OFQA 5FAGA 2J7DA 2YB4A 3O0KA 3BK0A 3A4AA 4A4AA 2EGZA 4GA8A 4LV9A 4LFYA 3G1VA 4JQ1A 3IIZA 5HPOA 4I9TA 3MDUA 3IPWA 4WVXA 2DIEA 2G4FA 2AQOA 4GX9A 4CQ8A 1XIBA 5GQBA 1JPDX 3W02A 1MUCA 2ZUSA 1JF5A 4F2TA 4NXKA 2PF0A 3VDGA 4U4MA 5L6UA 4WY0F 1WAUA 1Y5WA 2OPJA 4N9BA 1Z32X 1JGIA 3WLOA 1V6VA 1V6TA 3BAIA 4GISA 2CCRA 4ZQMA 3FYOA 3CV2A 4P8UA 4C1NA 2D23A 3AIBA 3THUA 4DWSA 3SY1A 2GWNA 3QV9A 3B9EA 3GNNA 2CC0A 2X30A 3K46A 1VLIA 2ZRXA 1FUYA 4D72A 1Z89A 3VIHA 1XH2A 3WQ4A 2QZRA 3MV11 4UR7A 3NZRA 1XIJA 3GHUA 4POCA 3GFXA 3IUIA 1NOUA 2DZPA 4FR6A 4IG2B 3HRDC 3WK1A 4GVIA 3SO7A 1H63A 4QAIA 4UTWC 2CIPA 4XD5A 3QLDA 1XRVA 3QSTA 5BXSA 1SZEA 1DOSA 2ZFAA 3VVGA 1RSCA 4NY2A 2C91A 1EDTA 1KN0A 3H4KA 3H23A 3RO8A 4NAFA 3S2CA 1I45A 4YYCA 1YNQA 2YLAA 3W27A 3E1F1 1ZBVA 4S3DA 3BAYA 3FA4A 4H04A 2VDHA 3GVVA 3EXSA 4WSJA 1HGWA 4PB5A 4RZ5A 3RMEA 1M9HA 4LQ1A 3K1GA 1SR9A 1W3TA 1ZBKA 2Q71A 3B8VA 5CG0A 4J9JA 2YA2A 1ZS2A 5JCMA 4DBWA 4AG0A 1I8JA 5FA5A 3G1HA 4MADA 4O28A 5CPTA 3Q2DA 1JYNA 4AX6A 3MZ2A 4DM2A 3MHFA 4XUYA 1DJGA 1P48A 3MDWA 4YTRA 4GNJA 3BE7A 3TDFA 5HXMA 1XLGA 3H7RA 4ZR8A 4F0SA 2X50A 1WZMA 4LIIA 1XC6A 4HYRA 4NAEB 3RMJA 3ZIZA 3BV4A 2V3AA 3S6OA 1XH0A 5LNRA 1V6YA 1W1TA 3KRZA 1JEHA 3N2MA 2VX6A 4D6EA 5G5GB 3UNTA 3IIOA 4K36A 4A3YA 4W9TA 3DKJA 4C6FA 5LYRA 1KNWA 3H2OA 4LVFA 1GYLA 3BCFA 4EXBA 4ZQPA 3U2OA 4CD4A 1TVLA 1KM1A 4EXAA 1QOQA 1UP3A 5XIAA 3DBPA 3W26A 2YVJA 3DU0A 4MNJA 4JDRA 1CI1A 3UBPC 5EU9A 1F3PA 1A3HA 4B91A 3LCLA 4JNMA 1B3ZA 3P0WA 1CT5A 2QF7A 4AWSA 1Q5MA 1GOWA 4FI4A 3KWSA 3RF9A 2FPTA 3DESA 3BLFA 3TYDA 1TKKA 3VKBA 4HZ8A 3E0IA 1X7IA 3N11A 5EBKA 3TAKA 3TN5A 4PUEA 4K7VA 4MTVA 2BY1A 5HJYA 4FLQA 3DHUA 1PKYA 2AGTA 3UJ2A 3GXTA 4PFMA 4NG3A 2NPXA 5FEXA 2YL6A 3NQ2A 3QMRA 1XP3A 1WQ5A 1K8CA 1JXJA 2WC3A 4PB4A 3QJAA 2EKGA 3R8HA 2VFHA 2XFRA 1A4LA 2OODA 2FGZA 1XYCA 2NUYA 1JNDA 4DWDA 4GWEA 1LZOA 5LHFA 4FP1A 4XZWA 1WX0A 3V4BA 2GJXB 2V69A 4US5A 3AYTA 1AUSL 3TTQA 3ZVIA 4ZFCA 1XR2A 3R12A 3KBWA 1MFUA 4GXMA 4W85A 4OIFA 1NFBA 1JF6A 3PPGA 1F3XA 3INPA 1Z41A 4DNHA 2W3ZA 4FS9A 3IAQA 4LS1A 1NTHA 4CCCA 1XHGA 3KDOA 4HMCA 3C2VA 2L5HA 1IEIA 2XFFA 4RKAA 5K7JA 2GL5A 3HG4A 4MZ1A 4IMFA 3WDPP 1B3WA 2HDJA 1P4CA 4UFHA 5J5RA 4HJWA 4AWEA 1Q65A 4F0LA 2WOIA 2QGHA 5CSRA 4WJEA 1V3JA 3KBVA 2TPRA 1JAEA 4B5SA 1YNPA 3GZAA 2HPMA 1L6FA 4GFIA 3IJ7A 3R25A 4V1YA 4AD5A 3ITVA 2BV9A 3BTNA 3TJ4A 4C6NA 4AYGA 1VJIA 4W7WA 3BAXA 1UR2A 2EF9A 2RDXA 4I5RA 2QVNA 2PD9A 4Q32A 2VHLA 2W61A 5FS9A 2D0GA 4Z2IA 3RJYA 4A35A 5ER0A 5BOEA 3SRFA 1GVIA 3TOPA 1P6WA 3UXIA 3HGOA 5HQEA 1O60A 1DEDA 1KLZA 4XKMA 4PCPA 4GO9A 5LXEA 1PJ9A 4PE8A 5EGRA 2XVGA 5FJPA 4JBRA 1EEXA 5G2WA 3GO2A 1GEQA 2PC8A 4IPLA 3CB8A 3G3MA 2NX9A 4DHGA 4GZ7A 4HJFA 1IXQA 1OCBA 3NZ1A 2HSAA 3H4GA 1E6NA 3W29A 1O7AA 4QS5A 3NCOA 1OGBA 1WZAA 2WMJA 2ESCA 3W71A 3UYCA 1PCWA 1XS2A 1ISVA 4PRRA 1N60C 3VIJA 2XIIA 5AECA 3LCIA 3GXNA 1JCLA 4MG4A 4QJ4B 3FNDA 3W74A 3M0LA 2IXUA 4H6KA 1S2VA 5C2XA 4IFKB 1XLLA 4BS0A 4XISA 3CO8A 5BXRA 1DXLA 1V77A 3NXLA 3WQPA 2QKFA 2AL1A 4EX4A 3WQVA 5HINA 5D37A 1FHUA 3EMZA 4O12A 3OW1A 1XXXA 3NQ7A 3HJEA 3RX3A 4B2DA 1GQIA 2BFGA 4PFHA 3QN3A 4UQEA 1Q6CA 2J9ZA 5AC4A 1I2NA 3NIYA 3VFCA 2W3SA 4JN7A 1UD8A 1ZGDA 3W1LA 1PHWA 2GJPA 4R88A 2J77A 1V6UA 2YPIA 5AN7A 2Z29A 1B3XA 1QNOA 1SM9A 1XBVA 3JU2A 3I4KA 4DJDC 1S2CA 1AW1A 3TKFA 2V63A 3MV01 2RDUA 1I1WA 1D7KA 3AWNA 5D9MA 2ACRA 2QDEA 2DT3A 3BARA 3WLPA 1V7YA 5HJXA 1XGEA 1PX3A 4WSHA 3PAOA 2A7NA 4JR5A 1PVNA 3RNMA 3LRLA 4H2HA 4QE1A 4H4YA 3VM5A 4MWAD 1K4HA 4U10A 1VYPX 1H1YA 3WD0A 1EPXA 2JIEA 2A6NA 1IEQA 3GG1A 3KOXA 3RLUA 1GNXA 4QEHA 4M1RA 2XINA 5LNWA 3C8NA 4ZA0A 3IIPA 3G77A 3AO0A 3ARXA 4AIOA 2YR1A 4IJRA 2E7FA 3VKKA 5EMKA 2DSVA 5FJUA 2YSWA 2E5BA 4BI6A 4JQ2A 2HJPA 4ERAA 3A7AA 1JUKA 5JH1A 4FR1A 5TQLA 3GIPA 1JG9A 1GCYA 1OZQA 1JZ8A 3L8KA 3HGJA 4GQ0A 2DUXA 4O1BA 4CEXC 1KFKA 3CUZA 3TX9A 3RNDA 4Q6XA 1QFEA 1F4HA 3TYCA 2CDUA 3XISA 1DVJA 3CZ8A 4HZMA 5A6BD 4EF8A 2WVSA 1V3HA 4GIAA 2V3GA 4QM1A 4DIAA 3VIIA 3AHTA 5I3GA 1KBJA 4L9YA 1F3EA 4FZIA 4WOQA 5DN1A 4N7QA 5CH9A 3NNTA 2OSYA 4H00A 1ISYA 2YX0A 5E93A 3VGBA 1MXSA 3NA8A 1YX1A 4DN1A 3P93A 4JIPA 3D0CA 4PR4A 1E15A 1TX0A 1T8QA 2ALDA 4O18A 3WQCA 1X1ZA 3KOWA 1CXEA 5C54A 2J74A 5A8PA 1V4YA 4QFUA 4E0CA 4DJFD 1R3SA 3UWWA 5KMYA 1LOLA 3TROA 3NO1A 1KBIA 1E6SM 4EQRA 3T0TA 4N6EA 2PDKA 1H09A 1M01A 2V3EA 3A4WA 4EVZA 5FOOA 3VGFA 3SQMA 1IQ8A 3QZAA 5FF4A 1BG4A 4OFCA 3UG3A 3E0FA 2OWWA 1IF2A 1UIOA 1CB7B 2EAWA 3S5NA 1AD1A 2BWGA 3WYZA 3GH5A 2YXXA 1FWTA 3IEBA 2W79A 3UR2A 5JRBA 4KESA 2OZTA 5DF0A 1F9CA 1YMYA 1TA3B 2XN0A 3IGSA 3HG3A 2PWFA 3A9IA 3U48A 4W5ZA 3CL7A 3SGUA 4H3DA 4C65A 4OBTA 2X40A 2FIQA 3W6LA 2XUCA 4MB3A 3B0XA 3IC9A 4RDZA 3M0YA 1OD8A 2X42A 5D8ZA 1TV7A 3ZVHA 3VA8A 3CGDA 4YTTA 1I0DA 3WUGA 3QW4B 3GVWA 1UZHA 4D6IA 4M56A 3RN6A 2B4GA 3O6DA 3K30A 2Y0FA 2A6LA 3WQGA 1XCXA 1F8MA 3WH6A 4OOZA 2D22A 2RUSA 3OLDA 1EJXC 3NZGA 5CPQA 1FQ0A 1BTCA 4WDUA 2PDBA 2CU0A 4CKQA 4KGLA 1EBGA 1P6CA 3ATZA 1RLCL 3LHVA 2WSKA 1LOQA 4PCFA 4PUNA 3UWZA 3V5CA 4CN1A 1TR1A 3G1FA 3NL6A 1AL8A 4C6QA 3KAOA 1NQ6A 3RG6A 2XIJA 1IT7A 4CD5A 1EHAA 3IJ9A 4CVUA 4JIHA 4GQQA 3PAJA 4PMZA 5FS6A 3MVIA 3RR4A 2PWUA 3UA4A 3DGZA 5T9BG 4LC6A 4C1NB 2XGZA 4YTQA 4DWSB 1LCOA 3FN9A 1ZFJA 2G3JA 1KV8A 5D4YA 1R9ZA 1TIMA 1TZ7A 2A79A 1W8GA 1JFXA 3C2YA 1J11A 5M2FX 3AXIA 3QTPA 1X98A 4P7NA 1GPWA 4KWWA 3PZGA 5FAJA 5SWUA 3S8HA 4G5DA 1GKRA 2UY4A 2AAQA 2TODA 3VCNA 4W8AA 4MVAA 1VFMA 3PR2A 4OV4A 1B9ZA 1ZY9A 2DZUA 2ZX7A 4A8LA 3A22A 4OTKA 4QG8A 3ZO9A 1IZKA 2DGAA 3O6YX 3MUY1 3ETRB 4XB3A 5EFDA 4C7GA 2E6FA 3T2OA 4TTGA 5JQ9A 1QK0A 3H22A 2PF8A 3DJGX 1UD6A 3STPA 3V35A 4Q4MA 3GUWA 4NAFB 4XK2A 5ECVA 3DYPA 2NXIA 3POCA 4ZQCA 2DUAA 4ZL1A 2D73A 4KQNA 1A5UA 4MPKA 5E0FA 1JPKA 1W8SA 2C1HA 2W67A 2D2OA 1EJTC 5CAKA 2XH2A 2VCAA 3AIQA 5C2GA 4H4TA 1E0TA 3NQCA 4PUWA 1LPFA 1TMLA 4KWSA 3AAMA 1QO2A 4RNIA 4IWWA 3GBDA 1C8VA 2ASHA 4NYUA 1I2RA 2C15A 4Z17A 1KR0A 5I78A 3WUBA 4ZODA 2ZIDA 3OPSA 2C71A 2X7WA 4OUEA 4ZEPA 2BVWA 3WELA 1BVNP 4I5UA 1DL3A 1JQXA 2ZA2A 3N34A 1PSCA 2HV5A 3S9ZA 4KKXA 1KKOA 4J27A 3U9IA 3SCWA 6XIMA 1BVWA 1IZCA 3H6OA 1FWBC 1ZCCA 1DWGM 3T78A 3LV6A 1EGVA 5DCEA 3SBFA 1HVXA 3S5OA 3N4AA 1JZ2A 3E0WA 5F2GA 1FWJC 1OK4A 4HIBA 2P0OA 1WXZA 3KVLA 1ITCA 2UBPC 4CN4A 1F6YA 1O4UA 3BL3A 1SW3A 4HA0A 4L1GA 3FA3A 3VOIA 5DMYA 5JVLA 3W7DA 3S6DA 4MY8A 4PTDA 2CLEA 4WDTA 5I02A 4C6BA 3PSWA 1K4QA 3G8RA 4US6A 4DF2A 1H0IA 3WLTA 2WMFA 4LALA 3GTNA 3SCNA 4Z1AA 2A3LA 5DCBA 1STZA 2WZIA 5I2UA 3NSNA 3GDTA 2UV8G 2IUZA 3LGGA 4TTUA 1FEAA 1YQZA 1XM3A 3ZFHA 2EJ1A 1W3NA 2J8FA 4FNRA 3T0AA 3Q67A 3U2EA 1X2GA 4W5UA 2DSWA 3PG6A 1J9YA 2WC4A 2C3CA 1E3XA 2OQYA 2V5BA 1WXJA 3C61A 4WGXA 2PZ0A 1JZ6A 5T26A 3NZQA 5FSEC 4L6OA 1ONWA 1H41A 2J47A 1AZ1A 3OLGA 4I5XA 3TJXA 2V5LA 3UR5A 1IIHA 4B5XA 3A13A 3EA2A 3H70A 3CWOX 4IFOA 3ECQA 2D0HA 3UEQA 1EB3A 3WLSA 5C7HA 4UQCA 4ZFMA 1NWSA 2VZTA 1OIMA 4PTMA 1XLJA 3WBEA 2WCGA 3FCPA 3URHA 2CLLA 1EJWC 3SIMA 2X41A 2NT0A 1TPUA 1D3HA 5D2XA 4XAGA 5FD0A 3L9CA 3K8MA 2YDRA 2HMCA 1VFUA 4JTAA 3KTXA 1KM4A 3DC0A 4ATDA 3FVMA 1W5OA 3M0IA 3CWNA 5BU9A 3EA3A 1N8WA 5H6HA 3GQYA 4L9ZA 5ABTA 3P67A 4G1NA 4HHHA 1JFHA 4D1JA 1M41A 3SN1A 2VX7A 3KP0A 5CPOA 3UA3A 3EX1A 3NYDA 3QPEA 3USBA 3RU6A 4DYJA 2GQWA 3VNIA 3S5SA 1KBKA 3C8FA 1TELA 2DFAA 3W7RA 2EQ9A 2CEQA 3EMCA 4DPPA 4HPHA 1FWIC 1GVQA 5I00A 1L6SA 1ZBCA 2HXTA 1GHSA 1RPXA 2OQLA 4RK8A 1DQWA 1GUVA 3LS9A 2J62A 4CD8A 3DFOA 4N42A 3W75A 4YCPA 2J7HA 1OFRA 3AMDA 4MFDA 4HOWA 2DY3A 3S2LA 3WJWA 4PCTA 1WO2A 4F9DA 4K6AA 3LLDA 1TUFA 4LJ3A 3F4NA 2A3EA 5CZSA 1A3XA 2GVEA 3ZWTA 4LSBA 2PP0A 4HNUA 3DG6A 2Z7KA 2YXOA 1DE6A 1LWJA 3VIPA 3TXVA 1QHPA 3NPUA 4QSHA 3AROA 4U33A 3CWHA 2AGKA 1E4MM 3IARA 1PZ3A 4MPQA 5KINA 2Y24A 5GJMA 1EOMA 3KRUA 3L0KA 5JIWA 3IGHX 1S3HA 4GINA 1C7TA 3GR7A 1VLWA 2YBUA 1J93A 1PWLA 1J0ZA 1KQYA 2D3NA 1MEHA 2XSXA 1VBHA 3FXGA 3GY1A 3K4AA 2ZQ0A 3EF6A 1P6BA 2GK1A 1TWZA 3VMPA 5C8BB 1LUCB 4LY8A 4UOZA 3WQ5A 4NI8A 4JNYA 5D2TA 3SW6A 3OQEA 4EWJA 4QDMA 1TYTA 4I3GA 4BCEA 1EJUC 1DHKA 2PWEA 1SYTA 5CBBA 1UQZA 3RUBL 3K5XA 4D71A 2X0HA 4O0ZA 1QI2A 4ADTA 4B3KA 2W9MA 3H8AA 1QRQA 2QJNA 4DXKA 3T0CA 3UERA 4HN4A 3KOZA 5DELA 2YCEA 3B9JB 1WZKA 2H8XA 3QRHA 3CIVA 1CGXA 4D1IA 1NQKA 1QXLA 2V6AA 4WF7A 1BXBA 3I3EA 4EPDC 1X8CA 3EA1A 2WSQA 4GX8A 2ON3A 2OYKA 3FXYA 3BSHA 3A64A 5GNXA 2PBGA 3C0JA 1JYWA 3PUDA 1Q4WA 2P0IA 1VYRA 4C1KA 2EPMX 1X6LA 1LORA 1A5LC 5GJNA 3VKCA 2G3FA 3B8TA 3B0PA 3GTXA 1VRXA 3TAOA 2PE4A 1GTHA 5I03A 5MKGA 5AC5A 4FNSA 5HWMA 2CKSA 3N2OA 3CLMA 3W53A 3TQPA 2W3RA 3SIZA 3R10A 2QPUA 1GV4A 1QHZA 2NWRA 2DW7A 3TJLA 5BCAA 1Q6EA 2A7PA 4K1WA 2A3BA 5FJOA 4QR6A 2Z1BA 1E72M 3S6TA 3TSDA 4L4PA 4JTLA 4YTSA 1Z3NA 3WK2A 4XBSA 4O19A 1XYBA 1J4EA 1MRAA 4C6KA 3G2GA 3P14A 5TF0A 1HO1A 5REQA 1Q7ZA 4IIEA 3URAA 4H8NA 4ORIA 3M0VA 2WZTA 3W82A 1YW1A 8RUCA 1VHNA 5HATA 1IT0A 3IGUA 1D8CA 1N8FA 4TVYA 3T0DA 1GVEA 3SM0A 1TV3A 2FHFA 4NRSA 2R24A 3VZXA 2Y8VA 2Q3OA 3WK0A 4NL1A 3IV8A 4QE5A 1OQFA 2G4JA 1WDSA 1A5CA 3G1AA 4LS2A 1G01A 3LCGA 4IPJA 4NUWA 3CUGA 1XC4A 3WMSA 1XKYA 3E3HA 4HYVA 3NVZB 2YCLA 2FZMA 3ME3A 2W4XA 4HVXA 4IPIA 2VFIA 2Z2BA 1LF1A 2WWCA 3HU7A 4OUIA 2PTYA 5JCNA 1W5PA 1FKWA 2P10A 4IMDA 1I1XA 3PK7A 3EXRA 3LCFA 3WJYA 3I6EA 5CPLA 2DQWA 2WXDM 4TVDA 1T6MA 3KL5A 3MUIA 5A6MA 3LQLA 2KZHA 1YPFA 2Z1SA 5KZ6A 1TRIA 3MMWA 1XH1A 3W24A 5FF7A 1ZK7A 4UMCA 3NEVA 2YB1A 1QI0A 1RQHA 1GRBA 1W3IA 3PUGA 1L8NA 2PDMA 3AQUA 4XZNX 4DBEA 5DO8A 1G67A 1XD1A 4IQEA 1I2OA 2P53A 5I24A 4JTRA 3O6CA 1HX0A 1FWWA 1E0XA 1MUMA 2E9LA 1HP4A 4WDXA 2FKPA 4HA3A 4D6CA 1J8VA 3KLJA 4UMBA 1RCOB 2C79A 3UXAA 1UMYA 4XSLA 1XSJA 1HKJA 1ISXA 4H4VA 2E5CA 3B04A 2W0UA 1PX4A 1SSDA 2RABA 3R07C 3UWYA 3B8DA 2WP6A 3M46A 5EMJA 4K8EA 1GKPA 5D9NA 4R7WA 2NT1A 3OGVA 1UMLA 3Q37A 1SJDA 1HL2A 3PFRA 4JKMA 1T8XA 3P62A 3NQAA 4GKTA 4DAFA 3QZEA 4ZENA 2CZEA 4PMNA 4UZUA 4R9XA 1AJ0A 2AOSA 1E71M 1QMLA 4X0VA 4UTJA 2QV4A 3VYLA 2VX5A 4DJEA 1XPGA 1K7XA 5DT7A 1TPFA 1A53A 5HDRA 3SN0A 4PUUA 4PMRA 1NDZA 3NJ3A 5AHFA 1XG3A 5EBUA 4H8HA 1HW6A 3CT2A 4GMEA 4QROA 1AJZA 3HTWA 1SZNA 1V5XA 4MDPA 1ONXA 3EBVA 3TW7A 1UKPA 5CLTA 1KFLA 5EFFA 3W1NA 3QYSA 3W84A 1FECA 4RV8A 2HVNA 3W7QA 3STEA 2CHRA 1MQRA 2G37A 1KWKA 4HQVA 4V28A 4QLKA 1EUAA 3U7VA 2HEJA 1SO5A 3UZWA 2GYIA 4LVBA 2GGIA 1V7AA 3OJGA 2GJLA 2IMRA 3KTSA 3MUZ1 3KXQA 3BMXA 2A5HA 5G4EA 2INZA 4XG1A 1RH9A 3PTQA 1V02A 3IVTA 1VRDA 3W1PA 4DX3A 3D6NA 4GI8A 4O57A 4IQDA 4S3BA 5K9XA 1LLWA 3CYJA 1S7MA 4CNSA 1X6NA 2VR4A 3VGDA 1OD0A 1MW1A 5LNUA 7ENLA 4W89A 2PB1A 3K13A 3R7MA 1G7VA 3R58A 4JQ9A 4HNTA 3CPUA 3DN5A 1Q7MA 5I79A 1VHCA 3MUCA 5I0DA 2OKOA 2PGWA 4O1EA 4ML4A 7REQA 1SQ7A 1UA7A 2OT0A 3WF1A 2X1IA 4X2RA 1X97A 1AG1O 4H6EA 4J3ZA 4FDCB 1UWUA 2WM1A 3LHZA 2VFEA 2BHUA 3GVRA 4QJ1A 2NXGA 4L4MA 2JGYA 1T99A 1MO0A 3W7HA 1W9BM 4FLOA 1J5SA 1HVQA 7PTDA 3DEQA 2PDJA 5CQ1A 3I3BA 3LQGA 1J12A 4DJDD 3W1RA 5B7YA 1L2QA 4J57A 1OVDA 1HKVA 3MJYA 7A3HA 2V9DA 5MF5A 4ZXLA 1ADOA 1QW9A 5I07A 1CCWB 5CC3A 2HE8A 3A12A 5JXQA 3ES8A 4FPSA 5AHLA 3B0YA 4QG9A 4DWSD 1PXGA 2VQTA 3OGSA 4HMEA 1GONA 4OT7A 3OBEA 5DX7A 4R53A 4DUWA 4XD4A 4M1BA 2J3NA 1VENA 3W83A 4GRTA 4MGGA 1KXVA 4GIYA 1RCQA 3T2QA 2Z6IA 5FKYA 1KTCA 1SUXA 2Z2AA 3UJEA 2I5IA 5HUPA 1XBYA 3FFSA 3KCOA 2OX1A 1GYMA 1T0OA 1X39A 1PHQA 4PCNA 1THFD 3KX6A 2PTDA 2HROA 1ME9A 5C5YA 1KCXA 1BYAA 1XGDA 3LBCA 2YCKX 1H2JA 1PV8A 3CZKA 2VEFA 2PCQA 4XIMA 1QNQA 3UJSA 3E74A 1ME8A 2GQ8A 2FMNA 3C56A 1LQ0A 4AVNA 4RE3A 4P7RA 2QW5A 3CV7A 4JCMA 4J4KA 4LAMA 1I60A 4N0RA 3G18A 3BUVA 5TIMA 4J3UA 3VOCA 4L7ZA 1UKSA 3T8LA 4H4IA 5FF0A 5AHNA 3MUAA 4GYKA 1E56A 4MKNA 1L8PA 4GXWA 2QUTA 8TIMA 1E0VA 4Q8NA 2V5KA 4FB7A 3MYPA 3TE9A 1U22A 2Z27A 2CFFA 3P8JA 1JROA 5EMYA 5BMXA 1FHDA 1K9DA 4QE4A 5JMUA 3EWXA 5CZTA 1FRBA 4UQDA 4UTHA 3LZ5A 4O0QA 3AYRA 4O1FA 1O5KA 4Y9MA 4O1DA 2BCPA 5ABEA 1MZRA 1GKQA 2YZ5A 3WIJA 4XVDA 3QR3A 1CECA 1FH8A 1R87A 2ZXBA 4GD0A 4M6QA 5LIKX 5A6SA 3T4WA 2EJAA 2G95A 5FL0A 3OVQA 4M24A 3FJNA 4LU0A 2E6DA 5IBXA 1MQQA 1OCJA 3PWGA 5I3DA 1QW8A 3RFAA 4GJIA 4ADSA 2QPSA 1P1MA 3D47A 4JTSA 3CJPA 3LI0A 4TMBA 1X1NA 1RCXB 1V3LA 3APYA 4HOZA 3DOPA 2GGJA 1JCJA 3CB3A 4H1ZA 3PJUA 1TPVA 1B30A 2R14A 3T08A 5CBJA 2ZTJA 4EWND 4UFIA 3U57A 3R5EA 1K03A 2Q09A 5HR7A 1KRAC 2F8QA 3CXOA 1ZP4A 2C18A 4X22A 1G6CA 3R13A 3PJWA 1GJWA 3UR7A 7TAAA 1SMDA 4EOUA 4AMAA 4PMDA 1OT1A 3SURA 3VNJA 2IPGA 3B9OA 3MI2A 4ATWA 3CHEA 4R34A 3U4FA 2WNQA 1AFSA 3OG3A 2CLIA 5H91A 1GQKA 5GRTA 5D33A 4IX0A 1UKTA 1ICPA 2UY3A 3BLOA 1S2UA 2RDTA 3AXXA 1KC7A 4M6VA 4FIRA 1IE7C 2GVGA 3W7OA 3W7GA 4AVOA 3TQ0A 5HMSA 1G4EA 3JZEA 1M1BA 5KZEA 1FFUC 2IPFA 4IT1A 4LB4A 4AD4A 1NWRA 3J7HA 4RNJA 4Y9NA 4PMXA 2QT3A 1Q6LA 1S39A 4LBRA 2WNNA 2HXUA 2IQ0A 3BMWA 4BJHA 6ENLA 4HPXA 3L4WA 3D3AA 1LROA 3ZM8A 4DI8A 4TVUA 3MI3A 4ZCWA 4US5D 1VFLA 1HIZA 3DYMA 1TPC1 3W73A 1KLYA 1U33A 1W2VA 2PUZA 4F66A 4L9XA 4HPJA 4GFSA 3VKDA 1LM1A 3R4IA 4JL1A 3TN3A 3PBUA 3LPPA 3ZR5A 4MKVA 3GDRA 4V33A 1GK8A 1H4PA 3EWUA 2ABAA 3SUWA 3DAQA 1ISZA 3L65A 1YTKA 5M17A 1NEYA 2RJGA 4DQWA 1EL3A 5AVNA 4OECA 2HE5A 4AWUA 4KBXA 2PP1A 5BRPA 1QJWA 3SJ3A 2DSZA 3OHIA 2ICSA 3E0VA 1CGWA 1ZY8A 3G6LA 2IKGA 1IWBA 4H9MA 3AIVA 1FDYA 2HBVA 3TXZA 1EO7A 3L67A 2GK1B 2AMXA 5G1YA 2QMJA 4QISA 1YPXA 1EJVC 5I3KA 2VFDA 3NVWB 2E77A 4K8HA 1W6TA 1RJPA 5DXXA 3VXGA 3W22A 2P88A 3PZ9A 4ZSTA 1R47A 4MZ8A 2CBJA 2W6RA 4B5NA 2F9RA 4IL0A 3CH9A 4NJIA 3H53A 2PCEA 3U5YA 3RDKA 3WNKA 3LV5A 4U5KA 4YJ5A 2J9YA 3L68A 4J3VA 3QEZA 3GAKA 1HJWA 4IJCA 1OFOA 2FFIA 3W2KA 3UYIA 2WM0A 3OB8A 2NVKX 1OCQA 3W70A 3KCLA 4NT0A 3KWXA 4KCWA 4GGHA 4GOAA 4M6PA 3VIKA 3W7NA 2BY3A 1C9WA 4Q7IA 2V81A 4ICNA 2C8NA 4QCFA 3OQ8A 4IL2A 1LRQA 4Z0JA 1JRPA 3ZR6A 3IK4A 5MKGB 3HJZA 4KPRA 1MZHA 5CC5A 1O5RA 3CUIA 4AYSA 3JRKA 1ZENA 2PDHA 4KW2A 1W1YA 3RCNA 3WD2A 3O2LA 4AMCA 1ZMCA 5T8GA 1W37A 1X8FA 3W6MA 1BXNA 1C8YA 2Y8KA 1MEWA 4Q6JA 3GS6A 1XPYA 3W7IA 2PDYA 3NM3A 3KBNA 1FWAC 1JR1A 3Q6JA 4OWGA 3G3DA 4DO4A 1WOAA 2PA6A 2BODX 1N8IA 3G1YA 1NHQA 4H9ZA 5JCIA 4GH1A 1DTUA 8CGTA 3WQDA 3S1GA 3CLWA 4M82A 1JI1A 4AUBA 1E1CA 4NZ4A 1TREA 1KFCA 1FWFC 3QR1A 2HZGA 4JHZA 4RJEA 2VO5A 3LERA 1MDRA 4HCLA 4I9JA 3CPRA 1EP3A 4JDYA 1WPCA 1FXQA 3WDRA 4XKYB 2R1MA 4FX7A 1E1FA 4MNMA 5D38A 4MJ2A 1H5VA 3FS2A 3W37A 2YCLB 2ZUNA 3UJFA 2F84A 1H11A 5A2BA 1XBXA 1QVBA 3GWQA 5CAHA 3EB2A 3HOJA 3QLLA 3GD6A 5A2CA 3FG2P 5A1AA 1DIKA 4GI9A 4FX6M 1VFOA 1RV8A 1S5VA 4Q4SA 1XYLA 3OVGA 4HU4A 1IHIA 4MJMA 4OBSA 2VGFA 4L6HA 3NQGA 2VRJA 3LMZA 5CC7A 1E6PA 2V2CA 2BVTA 2O92A 1RD6A 3FJLA 3NYZA 3PS7A 3UXKA 3FAXA 4ALDA 2VDIA 2ACSA 2HVMA 4GH3A 1OFDA 1FX6A 4CQ9A 3BDKA 4DUOA 2F61A 4KS0A 6TIMA 1HG3A 1MVYA 1XG4A 1O12A 4OZOA 2OFJA 4B5UA 4EMWA 1A0DA 2FVLA 3B40A 2JIWA 1GPFA 1ODUA 3HPZA 1XYMA 3P81A 1UR3M 1XDLA 3NO3A 1SPQA 4DXXA 3PPCA 1RJRA 4UWMA 2PRMA 1FWDC 2BXYA 2FPVA 1W2PA 3UR8A 2O9PA 3I4EA 3HO8A 3EWBX 3U2ZA 3H4WA 4H4UA 4MLJA 3VTRA 2J79A 3WL1A 3SUUA 3OODA 3TFCA 1ZKQA 5IHSA 1Q6OA 4A29A 4DBSA 2ZX9A 1YRRA 1CGVA 1KTBA 2NQLA 4C6JA 4BURA 4M81A 1WKYA 1PYMA 4INFA 4K3ZA 5A6KA 2A21A 3ANYA 3F4DA 1NIUA 1LBFA 3ITCA 4OQVA 4PZVA 3F5LA 4OBRA 2FZBA 4O50A 4X63A 4MY9A 3CQIA 3BLPX 2O4MA 3VM7A 4H4WA 4V1XA 2V5JA 3EDDA 1MDLA 2WBGA 3IVUA 3IRSA 2FH6A 5FESA 3KDNA 1R9YA 4O10A 1U5JA 3WFLA 4R7JA 2FZ8A 3ITTA 3DFNA 2OYLA 1H50A 2H8ZA 4IP7A 3WBWA 1NARA 3G0SA 1ZTVA 2DH3A 5A8MA 2VUNA 3SJNA 3KRSA 5TR3A 1IXOA 2QMKA 3QC0A 5JU6A 3E6EA 4IFRA 3VZYA 1N62C 3C2EA 2C0AA 1F6KA 3GXFA 5I3HA 1KV5A 3EKGA 2OOGA 4DELA 4JX5A 3WF0A 1S2WA 3UWVA 2YBVA 3NQ6A 1BSLA 3DC8A 4JQAA 1UD3A 2GSEA 3VNMA 2H6RA 2ZC8A 1XW8A 7REQB 1E3ZA 1AQHA 2LLEA 4EM4A 2J7BA 3BWWA 1QPRA 2C14A 3OIHA 3M0HA 4IISA 1AZ2A 4WKHA 3VUSA 1YYAA 3ITOA 3CUXA 3P3BA 4PMUA 4UTTC 3SCQA 2GLKA 3AIWA 4JFTA 3ONCA 1QOXA 4PMQA 3NDYA 3TYBA 3RPTA 1RP9A 3KLLA 3WDHA 2ZUMA 3WN6A 4ZE4A 5FEWA 1UWRA 2ZVIA 1P0DA 1ZZMA 4IGMA 4CNOA 1PTGA 2GJXA 3OLEA 5JBDA 1UWQA 2YZRA 3HIJA 4LV4A 2F2HA 4CGTA 1EZ2A 2P5NA 2KAUC 3GC5A 4HOXA 1DWJM 3GM8A 1BGAA 5D9OA 2H3DA 4JTDA 5EBAA 2VVNA 1YE4A 3LHWA 1OWQA 2OLHA 2VZSA 3MKCA 5HMFA 3BCJA 4CNUA 5HMEA 3U7BA 1A5MC 4LUTB 5F2MA 4G8TA 5D9PA 3FJ6A 1C29A 1MSSA 3WLQA 1CGUA 1GQJA 3P0XA 2ZDSA 2EQ8A 1F8WA 3DHFA 3SFWA 1QHOA 4GUGA 4CD7A 3W1MA 4LAKA 2X8GA 3EMQA 1KM5A 1LQAA 2QIIA 4UTWA 3GHRA 1SZRA 2VURA 1US0A 2W0HA 3S1WA 1EC7A 1V79A 1TRDA 3VDBA 1VQTA 3VNKA 3BLLA 4WDWA 1EP1A 3PBVA 1U1JA 2XDFA 2FDMA 5GJPA 3I6TA 3HQ1A 3LCXA 1UQYA 5HQLA 1W1ZA 4E8DA 2BC1A 4MIMA 1V93A 2OJPA 5AYXA 1CXKA 1WOBA 3VOGA 1YDVA 1FWEC 1PZ1A 4GUHA 4F0RA 3SSZA 3VCCA 1FWHC 3WEZA 3B4YA 3MP3A 1IZJA 1FO4A 5D05A 4W7VA 3B06A 1W31A 3URQA 1UKQA 4GQBA 2VKZG 1E1EA 3CGTA 3EAUA 2WB5A 4ZB2A 2V2DA 4UFMA 1B0IA 2BNJA 3TUUA 1XJBA 4ENLA 4PCSA 1RVGA 1DIDA 2QVHA 1P5BA 4A3RA 1E6RA 3E2QA 4B5WA 2BOEX 1IGWA 4H9XA 1FP8A 4LX4A 1B3YA 4C5ZA 1VAHA 2FQIA 3W01A 1SB3B 1IGSA 3BV7A 3SY5A 1J6PA 5F4XA 3M1ZA 2VFGA 4MHBA 3MBFA 3TP4A 3K4DA 1OADA 1FVPA 3ZLHA 4GZEA 2IW0A 4X60A 1Q4NX 1F4AA 3E9AA 5HNUA 2QCHA 3QZ6A 1VCGA 1M68A 2VC9A 2WKJA 5BOOA 1WXYA 1B1YA 3OZYA 4Q8OA 1FDZA 2VEMA 1GRTA 3WDJA 3BLEA 2J4GA 2GR1A 3GIQA 2X1SA 4BEUA 4B4HA 4QP0A 3QPZA 1K77A 3W7KA 2FVKA 2ZE3A 1PKMA 2Y5JA 5A6TC 4D6FA 1M65A 3NQ8A 3W76A 2ZC1A 4QDPA 2GGEA 2DW6A 2WPEA 2XISA 1TG7A 3I65A 2G96A 4JEQA 4D8LA 5I23A 2NVAA 9XIAA 3H2MA 2ZCGA 3BPWA 4GYPC 4QRNA 1LWHA 2GSHA 4PYSA 2WJDA 3EWDA 3M16A 1XSIA 3N13A 2OSWA 3CM4A 3GK0A 5JH2A 4GE8A 4EM3A 4RXFA 5H8MA 4RR4A 3SR6B 2Y7DA 1F61A 3MSGA 4WY0A 4ACZB 2ZZ3A 2OEMA 1GOMA 1Q66A 4P7LA 3VE7A 3NQEA 4OV9A 2VD9A 1X38A 4WR3A 4DBDA 1OX6A 1WKFA 5BRBA 3HG2A 3SRHA 3M4HA 4QGCA 1US3A 4O4WA 5F1VA 1NPXA 1ZJAA 1W9XA 3AIEA 1UASA 1NOWA 1MEIA 1OCNA 4KEMA 4FK9A 1EJSC 4AZIA 3H26A 3CT7A 3W0KA 4G2DA 4KFNA 4HCHA 3GU9A 2X1RA 3IJ8A 4UFLA 3DERA 3THDA 3O0FA 2C1IA 1W5QA 3AFBA 4IPPA 5A6LA 2R9ZA 1CLVA 1TV8A 3GYEA 2V38A 1BG9A 3N15A 3QKZA 3VABA 4ZTYA 5KITA 3EOOA 3G1XA 4UOJA 2YW3A 3W7CA 3WJZA 1QI4A 1GRHA 3KVJA 3GAYA 3SCPA 2CYGA 5DEZA 3A3HA 2VT0A 4GCXA 5LA2A 1Q13A 3PTMA 3XINA 2GRTA 4G6CA 3FKKA 4JHMA 4PMOA 4RW5A 4W88A 3WNNA 3O8AA 2BS9A 2HQMA 4S3FA 1P0BA 4UTUA 3TA6A 3TN4A 3Q45A 3M7SA 4B5TA 2BVDA 3NL3A 4J28A 3SQPA 2QGYA 1Q63A 2PDGA 2CHNA 3GXIA 3DFSA 3PTDA 1CGTA 3LHYA 1BD0A 4Z0SA 3KBJA 3N2TA 4E4FA 2ZX5A 1WNOA 2PD5A 4FO4A 3MVTA 2E40A 2PWGA 2PGEA 3L12A 4K7ZA 2RJHA 5K2ZA 1XRFA 4Y9AA 3T44A 1FCQA 2VFFA 4G1KA 1PDZA 4PMYA 3VNDA 3S4TA 2YIHA 1N55A 3BC9A 2NLYA 3CZJA 2E25A 1NP0A 1EEPA 1EXBA 3KZSA 1H7RA 1B4KA 2WSRA 3AI0A 3E2RA 4A8RA 3B0VC 2JKPA 1OFBA 3TNBA 1V0NA 1DJIA 2PWVA 2F38A 1SMAA 4BFAA 4E2VA 3C2FA 2RGMA 2E8YA 2WVVA 4JPGA 3EUB3 4JCLA 4M7TA 5EMMA 3QQ0A 4LC8A 1V3KA 1PIFA 4TX9A 1CW2A 4AAJA 4GVFA 1HT6A 4C6CA 3W1XA 3N29A 1KCKA 2R1PA 4PH6A 2Y7FA 4AU0A 3NOEA 4RZ4A 3EB4A 3VFLA 3PWAA 2VRKA 2OGYA 4HPGA 3WD3A 1E1CB 5LIXX 1UUQA 3HM7A 4JKKA 4E8GA 5B7ZA 2OLAA 3NXFA 2TMDA 2W66A 3B8WA 2V6OA 1MMFA 2EG7A 3YPIA 2FLIA 2X05A 2OWCA 1K4GA 1ZMDA 2ZZ2A 4K8GA 1JZ3A 4JX4A 1S5MA 1QK2A 2YL5A 4HYWA 3K1DA 3M43A 3MSDA 4BF5A 1XIMA 3MB9A 1EIBA 4L64A 4DJDA 2QULA 2EPKX 3W1QA 1U1HA 1OY0A 3GUGA 3GRIA 2R94A 1MNSA 7TIMA 3ZYZA 1GZ1A 1H7NA 2QCEA 1XLCA 2WPBA 4OJYA 3L66A 1UR9A 4R33A 2V82A 4KETA 1NHSA 1WCGA 2BOFX 3L5MA 2ZZ4A 1UKOA 1CLXA 2DP3A 2DZAA 2OT1A 2QAPA 4IF2A 1K1DA 2EBNA 3NFUA 3SCUA 1AQFA 2E9MA 1QNRA 2E1WA 3CNYA 2CLHA 2BLEA 2V68A 3B4UA 2R1NA 4H8VA 2WCAA 2WBKA 2VEGA 4A21A 1Q6QA 5KVIA 3UVIA 4DO5A 4WHBA 4CCEA 2O55A 3MMTA 1OC6A 2WZEA 4KRZA 1F76A 3NWRA 2J24A 1NELA 3PZUA 4KFOA 1HUVA 1JZ4A 1BZLA 4N2YA 2PWHA 1D3GA 3KVKA 1M7PA 2QLYA 4PL1A 2W54A 5F1UA 4AF0A 2G8ZA 3IJIA 3KS5A 1EGMA 3ZLGA 3ALGA 1EWEA 1F05A 3RPDA 3MHUA 5C70A 3FOKA 2YOCA 2E1DA 3U0HA 3KOYA 3V5OA 3WNMA 1QTWA 1UH2A 3JW7A 1IWPA 1BPLB 4LW7A 4G7FA 5M5DA 1K70A 4B9ZA 2C7FA 1NJJA 2OVLA 4LXFA 4U28A 4LUJA 1VZWA 4CUCA 3PNUA 3HQOA 2I57A 1XIGA 3MYOA 2X2GA 1RD5A 5FJRA 3ENLA 1UR0A 3OZOA 5HMDA 1EC8A 1W1IE 2VGGA 1L9WA 4O8AA 4N6FA 1NM9A 1PYFA 5C9ZA 5FCZA 4GUIA 4NI3A 3H2NA 1JI2A 3P61A 3VDAA 1ZP3A 5KEZA 1W56A 4AD0A 2XVNA 4XD6A 2XIMA 3BGGA 3N9RA 2R82A 5IFPA 5G2IA 3TZFA 4A6GA 1OGSA 3L2IA 2JE8A 3LXBA 3ZMRA 5FSDC 1SW0A 5JBEA 4ES4A 2R9RA 3SSJA 2POZA 2C6QA 2ISVA 4KF1A 2I9EA 4IJBA 4DNAA 2G3MA 3W2LA 2X2YA 4NZ3A 5BZAA 3I10A 4DJED 5E6ZA 3UVAA 1M7XA 3PZQA 1Q1RA 3GG8A 5AY7A 3URNA 3WMBA 1NF0A 1A50A 3NRZB 4RPQA 3RYSA 3MO7A 4D8AA 5C6MA 2Z2UA 3K2GA 4ILSA 1QWGA 5C55A 3V16A 3QH2A 5AYZA 2VGBA 3RXZA 3R43A 1T5AA 3PBMA 4DRSA 3C0SA 4QBXA 5IDZA 2JF6A 5J8LA 2XG9A 1OT2A 4JL2A 2DZTA 4HHLA 3T2PA 3BW4A 1W0MA 1GERA 3AZRA 4YWOA 4LVGA 2FGLA 1ZX9A 1CENA 3KLKA 1BWKA 3O16A 4F79A 3P82A 3OHMB 1LVLA 1L0PA 2DUZA 1AODA 1ZJBA 4EAYA 5BNKA 3E02A 3BCDA 3D9XA 4LEQA 4UNIA 2CNCA 1UYQA 1TVNA 3CMJA 3JR2A 2BVYA 3AJXA 4QDWA 4BI7A 1EF2A 3BLKA 4UR9A 4YLWA 3W00A 1BGGA 2E68A 5U25A 1R3TA 4HA1A 1M6IA 4EMJA 2WBAA 3HBLA 2PLKA 4MZYA 3O0HA 3WLLA 2V3DA 4F9JA 4X3ZA 2FTPA 3OIXA 4JIQA 1JCYA 3DBNA 5KZDA 2X09A 3TK7A 1BSIA 2OELA 3BGJA 1QOPA 4O1AA 4XWUA 3PBYA 3W2NA 3DIPA 1TO3A 1GQNA 5GNZA 2IQDA 2JGQA 4NQ1A 3UY8A 2ACQA 1TV5A 2NQHA 2WZHA 4C60A 3QMTA 3GH7A 3MPGA 4UTIA 2DZBA 2HNEA 3V1PA 4BEQA 3VX0A 1NSJA 3GX9A 4MYAA 4GIEA 1M04A 3LSCA 4M0XA 3GDLA 1YDNA 3NM1A 4DXVA 2RGLA 4J5NA 2ZE0A 3JZUA 5LNSA 2P8CA 3N2CA 2FFCA 1V3IA 1ONEA 3DI0A 5F4SA 1AMKA 1DJHA 3PANA 2EPNA 3PG9A 3G1RA 5M3WA 4DYKA 1IEVA 2EPOA 3ARVA 1GXFA 1OYAA 3FAWA 3W38A 4Z1BA 4GVGA 1N7KA 4HZ7A 3PHAA 4FF5A 3MA8A 3UZ5A 1PDYA 1HTIA 4KIEA 2PTXA 5AZ0A 1TMHA 3HF3A 3G24A 1D8WA 3KM8A 2YAUA 1J0YA 2VM8A 3WH5A 1MFVA 2J6VA 3DK8A 3L21A 3RIKA 1TPDA 1FWCC 5HJLA 4GZIA 4E8CA 1U83A 3BG3A 2C13A 1ZCOA 3CUFA 4DLMA 4OOUA 4ACYA 1KGUA 2VELA 4LRTA 1LUCA 1TTJA 3WLHA 4TMCA 1V02E 4O8RA 4H4SA 3P5YA 3AWOA 3CASA 4Z2JA 4LB3A 4GK8A 3C3UA 4MB1A 3PG8A 1DJWA 3M07A 2Z1KA 3OYZA 1KTNA 1XSKA 4AC7C 1SZGA 2Z4GA 3FHQA 2NWSA 4NZ5A 2AAMA 3LENA 3VD4A 2GUYA 4H8UA 1Z6KA 3SCOA 4CU6A 1O95A 3PB2A 3H55A 4J1OA 3SDOA 3DGBA 2ABBA 3QYQA 3QY7A 1SJCA 1YADA 5D2WA 1G5AA 2C3DA 1E4LA 1OG0A 2ANUA 1H6VA 2W27A 3AS3A 2I14A 4MMWA 3HQNA 1AOGA 2ISDA 2HS8A 2QV5A 2ZDRA 3CBWA 1EA9C 4JY9A 3LGDA 3OTRA 3IGXA 4HKPA 4QXIA 3B9NA 3E0LA 4WY0B 2OU4A 3NQVA 4L1WA 1XHCA 5BYWA 4A3UA 1UR8A 4JTTA 4LUYA 3C5QA 1IXPA 1ZB5A 1VEPA 2D1ZA 3ZQ9A 4R9OA 2IPWA 3UY7A 2JF7A 3DYOA 3LTYA 2FJUB 4WRHA 4E3TA 1PPIA 1CWYA 2VR5A 2PP3A 4FF7A 2X0YA 4M3PA 4HSOA 2V3BA 1E0WA 3RILA 4GCAA 1XUZA 1M3UA 3PN8A 3T40A 3ANUA 4C90A 4PTXA 5E1QA 3GU1A 1TR9A 2VR2A 4HHPA 2QJJA 4GJ1A 3F4VA 3SADA 4LS0A 4YXGA 2YVFA 4MM1A 1P0KA 1PE1A 1HL8A 4BK9A 4HNCA 3CAVA 4E2DA 1VB9A 3U5UA 1XDMA 3CUHA 1ZDLA 4K68A 2PLJA 2ZA3A 4AXNA 1R7OA 1EP2A 4FIQA 3RK8A 2OMAA 4R3UA 1YPIA 3VAVA 4YU1A 3DH9A 4UCGA 2Y85A 3UCCA 4REQA 1UW9A 3NDOA 3II1A 5D32A 2MUCA 2Y61A 4CN6A 4IGSA 3O05A 1C90A 1XISA 2NQ5A 3M9YA 1H1ZA 4JS3A 1WDQA 3Q94A 4LAUA 2FB2A 4F48A 4JX6A 3DG7A 5LXXA 1UR4A 3SFKA 5C9XA 3GRTA 1UC4A 2GDQA 4NHVA 3AS0A 3QHMA 4ZOAA 1TYGA 4YHEA 1UD5A 5CGQA 2OCZA 1XLMA 2ZXDA 4ZO6A 3IUHA 5I3FA 4B9YA 1R6WA 4LA1A 4BF9A 4KCTA 3S46A 1AD4A 3MQTA 5XINA 1G4PA 4IXHA 2CLOA 2Y88A 1QWKA 2GZXA 4W7UA 4Q4QA 3TWAA 2R91A 3V5FA 1QI5A 4MLRA 4XO6A 4AIEA 3EPMA 1I75A 3VGGA 1UH3A 2D2JA 3RRAA 2E6AA 3UXDA 1IR2A 3DFYA 2ISSA 1YBQA 3W2JA 2D20A 1V6WA 1N2VA 1R7AA 5C71A 1ITXA 1O5XA 4JY8A 5DY3A 1G9HA 3SQLA 1R3QA 3IS4A 4BHYA 4DJFC 1CZ1A 3N4EA 2WVVB 1WYGA 4DF0A 4MWAE 3HB9A 1J0JA 5CLWA 1C92A 2ZUUA 3TQKA 2HNHA 3NS1B 1LBMA 4XZ9A 4ZXOA 4QQ3A 1BYCA 4OVXA 2DJXA 4ZBCA 4GKLA 3POHA 3BZGA 2ZUVA 2WSYA 5LGXA 5TAOA 4M5PA 5H8PA 1KBLA 3JS3A 2QAEA 1J10A 4PUJA 2PDUA 4IP5A 3UG8A 3NUKA 2Q8XA 3COTA 2YJQA 4WD0A 3A4JA 4GO8A 3QW3A 1TCMA 4NNAA 1ZXIC 1CXLA 3THAA 1AMYA 5AYIA 2OGJA 4FNPA 2Z28A 2ZRYA 4K2SA 2ZZCA 1Q2SA 1V6XA 1ZPTA 4Q8QA 4WKFA 3W7JA 3WLJA 5K9DA 2QYGA 1F73A 3RLHA 3N12A 3WUFA 3PUOA 3WX7A 1NDAA 3UD6A 1XLEA 4Q22A 2Z24A 2WMKA 5A8QA 3AM9A 3GD3A 3PZMA 2YFOA 4APNA 1I0BA 1OG6A 4NEVA 3P74A 4C6OA 4WUIA 1MUWA 1GETA 5RUBA 2RDWA 1KRBC 4XUGA 3A5VA 3RM9A 4L5ZA 3GG0A 3V0SA 1BWCA 2AMGA 2A3AA 2YA0A 5DLCA 2EQDA 2CLKA 2RAGA 4H19A 3WEMA 5HOSA 1XINA 3N04A 2OKTA 7CGTA 4RCXA 5AFDA 1MW0A 3TV8A 2WVUA 3R89A 4UOQA 3CS2A 3QFBA 5CGMA 4Q7BA 1EO5A 5J04A 4TX6A 3SRDA 4DUVA 1QU4A 1LL4A 4RPPA 4UFKA 1TB3A 3HG5A 3F2BA 2GGGA 5LKYA 3MCOA 1TSIA 4IMAA 4IOTA 4IM4A 3BG5A 2POTA 3STGA 1V97A 4S3CA 3GW3A 1KBBA 3GR8A 2VZUA 4JQ4A 3U8GA 1VGAA 3R6IA 3N2BA 4EK7A 3NG3A 1FCUA 3ARYA 2DIJA 4MFEA 2PC4A 4NF7A 3CMFA 1MQPA 1EC9A 2FDSA 4ZQOA 4FNTA 2PTWA 1F8IA 4JYEA 4AF0B 3S42A 2FTWA 1YDOA 1H7XA 3DH7A 4H9VA 4AW7A 1XLKA 4RW3A 3NSMA 3WNOA 3ZS4A 1ZL1A 3QY6A 4UCFA 3LHUA 3UESA 1F5ZA 3UU0A 3P6LA 4Z1DA 4DF1A 4QJ3B 1FWSA 1IT8A 1S38A 1Y0EA 3XIMA 4YYFA 2BDQA 3KL0A 1VBJA 3DGRA 1GT8A 2IPJA 1HKIA 1JCMP 3L5AA 4QEEA 1PZ2A 1DPMA 3PUEA 3QM3A 5HANA 1KFBA 3GTFA 2RHGA 1XGZA 4OU1A 4ZTXA 3BAKA 4JHOA 2PFHA 4BQ5A 4KRUA 3MS8A 1FP9A 2ZXAA 3MSYA 1T7LA 1Q8AA 2WNWA 1WDDA 1IEXA 3PF3A 4QCEA 1SO4A 5CEWA 4TO8A 3I68A 1IYXA 5DMLA 4QG6A 4ZB5A 2HQAA 3QV7A 2VVSA 3L5LA 3QXBA 2JKAA 5DMNA 5K9CA 3W23A 8XIMA 2ATSA 4J3SA 3BH4A 4Y6GA 6A3HA 4J3TA 1GOKA 1VPXA 2WP5A 3TWBA 3G22A 4JD4A 1D7YA 4E6MA 5TBOA 1OEPA 2Z1XA 5G5IA 4FMVA 3FYYA 3TOYA 3EYPA 3PWIA 4QLJA 1N63C 1MWOA 1X7FA 3UPWA 1DQXA 4Y90A 4AFYA 4AZBA 4XSMA 9RUBA 3ITGA 1QO5A 5BXPA 1A5OC 2ZYFA 3IUDA 2JKEA 3WLNA 4HNLA 3WQOA 3GNPA 4XAFA 3GC2A 1VEOA 2AL2A 2DSUA 1QPNA 4QIUA 3VOJA 2WKGA 4S3JA 3N9SA 2DQXA 1XYZA 3W1UA 4ECLA 3APGA 2PSNA 3QBUA 2WO5A 2BBFA 1R5YA 1DHPA 2CKRA 4HU3A 4FX9A 1HJXA 4XV0A 5F4WA 1J96A 4FXFA 1OHLA 3UCQA 3PB0A 3SGZA 1DWFM 1TPB1 4Q7NA 2PGFA 5K3VA 1DWHM 1HFBA 2FZDA 1D7FA 1TPWA 3WO8A 1XLHA 3FKRA 5A8OA 4RX0A 1GRAA 4G9PA 4LF2A 4J56A 1FWNA 2E3TA 2YYUA 1TQJA 2OZ8A 4O52A 2ZKMX 3BZJA 2ISWA 2HISA 4JFSA 5FF3A 1WKEA 4L4OA 1KD0A 2DT1A 3KBMA 4MUPA 4R5EA 4H4RA 2O9OA 1FHVA 3HPAA 3LM3A 1PKLA 3LSBA 1WBJA 1H3GA 3THCA 3TSMA 4XIAA 1BWLA 2QCMA 3OVPA 4PA8A 1ICQA 4NX5A 1JPMA 1ZAJA 4NX0A 1W9UA 2GJNA 4J3WA 4IMEA 1O68A 3NPXA 3CXBA 1N82A 3PJTA 1SR0A 5HK4A 3B8UA 4BA0A 4NYYA 2IXVA 1EOKA 3LNPA 4Q8MA 1GG1A 1VQZA 3TN6A 3ZT5A 3KOFA 3U3HA 1UZ4A 1TVPA 4Y9OA 3UJRA 3AUOA 2PURA 3T7VA 2X8CA 2CZ5A 1XFBA 3PZIA 1K7FA 3VI2A 3GFYA 4H9UA 2CWNA 1JDAA 1CLKA 3UZJA 1ECEA 4CU7A 3VNYA 3WY1A 1CXHA 2OSXA 3UCDA 1WAWA 2WNZA 5G2HA 4W93A 3SUSA 5BRQA 3A5FA 3IVSA 1Z42A 1XIDA 3OYXA 4YPJA 2DPEA 3STCA 3C86A 3W6YA 2J27A 2PGRA 4AIUA 5K4ZA 1JPHA 4ONVA 3G5EA 2OZ0A 4UBPC 2QCFA 4IIDA 3L4XA 5D2VA 1HP5A 1YNYA 5DMMA 2VD8A 1KXQA 2E0PA 4D9PA 3MSRA 1BKHA 3VZZA 4GQRA 2XHYA 4YTUA 4HBKA 4P8WA 4TX8A 1PZ0A 3H2CA 3RHGA 1MYRA 2NQJA 5T9CE 2E9BA 3HMCA 4H6QA 5LA1A 2OOFA 1TWWA 3C2RA 3LEPA 2PDQA 4S2BA 3L7RA 4LCQA 1VPQA 1DJQA 4NZ1A 1ENUA 2FZNA 5DCDA 4UNLA 4GYJA 4N9CA 4XD3A 1PS9A 2GSJA 4DYEA 1AJ2A 4HNOA 2GOKA 4I8YA 3FLUA 1W32A 1E40A 1NWTA 4JYFA 1VFSA 3UT0A 2BGQA 3HN3A 4X9SA 4MY1A 4U5IA 5HA7A 4AZ6A 1BYBA 3IK2A 2VEKA 4IHCA 4GBUA 4JTJA 1R3RA 2BXZA 2V8ZA 4K39A 3AS2A 4ZMGA 4FALA 4WEVX 4AWTA 3QTGA 2Z6JA 4KEZA 3NPWA 4DM1A 4UTLA 1NY1A 3WD4A 2GH5A 5BXTA 3SB0A 1ZNNA 2ATMA 3CQKA 2INEA 4EP8C 3O9NA 5BROA 1ZUAX 4EACA 3GYCA 3TYAA 1UR1A 2FB3A 5LSMA 3WQWA 4UMAA 1KM6A 1JYXA 1F6PA 1FOBA 4H4ZA 1CX9A 3EOSA 4W87A 4BQ4A 1QASA 1LLZA 3MI6A 6PTDA 4RZ6A 3TR2A 2I17A 1E55A 1JZ7A 1TTQA 4I7VA 4U3CA 4PRWA 3S1XA 1ITUA 4S3GA 4XZLX 4JICA 3WH8A 4LOCA 4KCUA 4H6RA 3CIWA 5K4XA 4ZO7A 5KZMA 3A7UA 2X7VA 3N6QA 2QCLA 1UHVA 3QOKA 3M0JA 5IDIA 5U4NA 1P0EA 5G5HB 3VDCA 2QJGA 2I1OA 4F40A 4WXZA 2QDDA 2QDHA 3GHTA 4LUIA 3NTYA 5AHMA 3L23A 5D2YA 3REQA 1WP6A 2DZVA 4FLRA 1GZJA 3RLVA 3UGRA 1WDPA 3LXDA 4REQB 2VNCA 3SCVA 3CIXA 5HULA 2QUUA 2IKIA 4D6JA 2WVTA 4P5UA 3LXAA 2B7OA 4XKYA 4EF9A 4LCSA 3QSRA 5E9XA 4AZCB 1PAMA 2R1KA 1B3OA 4ICCX 3PPHA 2MANA 3VC5A 3WLIA 1B54A 1BEUA 4UIOA 3EWWA 3H24A 3GSMA 4TIMA 4AISA 1ADSA 2VQUA 4I6KA 4IIHA 4UXDA 2Y1HA 2PRHA 2NV1A 3IACA 3L5OA 1XFCA 4BKNA 5CPNA 1TWIA 1B4EA 1NU5A 3MC5A 4DZAA 3PTKA 4HSHA 1QAPA 4B90A 2B7QA 2IKJA 3HGRA 2JALA 1U30A 2Z26A 5D04C 1Q2RA 2BB0A 1EXPA 3ABSA 3N2XA 2AAAA 5I3JA 3V0TA 1AW2A 2BASA 3ZSSA 4MYXA 2Y62A 5HNNA 2A3HA 3V7PA 2QS8A 1W1B1 3GG7A 5CXPA 1BHGA 4CNTA 3O6AA 2JK6A 4BR1A 3QF0A 4X2PA 1YBQB 4X0NA 2PDWA 4YMZA 2WYSA 2BY2A 3M5VA 4UQ9A 4MB4A 5E6YA 4HP5A 2CITA 3WF2A 4I90A 3WD1A 4OKDA 1GWJA 3A4XA 4BWLC 4D6GA 4W84A 4NU7A 4RE0A 3MU7A 1JCTA 4PN2A 3BJFA 1SO3A 2WHMA 4RDYA 2GDVA 2Q01A 1US2A 3BMVA 1B5TA 4Q4KA 3R0DA 3UW6A 1EJRC 5AOUA 1VBRA 1BAGA 2OR2A 3ITLA 4FXSA 2YVGA 4AZGA 2BHZA 1OX5A 3QQWA 1LLOA 5HPCA 3P2VA 3V1HA 3FV9A 3GHSA 4YVVA 2QNEA 3T6CA 4M52A 3LY0A 1TE6A 1MNZA 1AA1B 3K8LA 1JOAA 5AB3A 2WHLA 1E6QM 1HJSA 1R86A 2WAGA 2Y63A 3UG4A 3STFA 5A8NA 1C8XA 1KRCC 1SJAA 3GR4A 3TC6A 4E2BA 1S5NA 3OP2A 2A8XA 1VPYA 1JNEA 4H7CA 1V8EA 2E8ZA 1BKSA 5MHBA 2QPXA 3BOLA 1MO9A 4JN6A 3TEVA 1UD2A 4EPEC 2P8BA 1C3FA 2ZZ0A 1QPKA 3QVQA 4NJKA 3D46A 1MXDA 1FKXA 3KCJA 4XZMX 1SFTA 2ISFA 1R8LA 4M51A 4Z2KA 3ERPA 4ZGYA 2X1TA 2D2HA 3AMGA 3BQ6A 1OYBA 3VOHA 3IV3A 1GVRA 1SVDA 1YDYA 5I3IA 1RXOB 3TU9A 5C9RA 3CO4A 4GUJA 5DFAA 3M0ZA 3T0BA 4FNUA 4JTQA 1UWTA 3QFAA 3VX1A 3VIFA 2VX4A 3PZNA 1AH4A