3JVAA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
353
structure length
353
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 121
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jvaA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jvaA01
3ZVHB 4IP4A 3N6HA 3OPSA 4GGHA 3I6EA 4HN8A 3UJEA 3OW1A 4YWSA 2ZADA 2O56A 3SQSA 3QPEA 2P88A 2PU0A 4JHMA 3RGTA 3P0WA 3UGVA 3EKGA 3MUCA 3TOYA 3S5SA 1P48A 1XPYA 2ZC8A 5EU9A 2XH4A 1EBGA 3I6TA 2AL1A 4FP1A 4GYPC 3EEZA 3UJSA 3DIPA 4E6MA 1PDYA 1SJBA 1MUCA 3RR1A 4Z17A 3PWIA 2PU1A 3FYYA 3DDMA 2AKMA 1W6TA 3UJFA 4DHGA 3BJSA 2MUCA 3U9IA 5FJRA 3MY9A 4HCDA 1IYXA 1TKKA 3VA8A 3GO2A 3ES7A 5FJOA 3H12A 4ZCWA 1TE6A 2GSHA 1KKOA 4KPLA 3TWAA 4J1OA 3U4FA 3FXGA 1P43A 3ENLA 4GGBA 4G7FA 2QGYA 2P8BA 7ENLA 3SN0A 2FKPA 3R11A 1E9IA 2OQHA 3Q45A 3P93A 3UJ2A 3V5CA 4JN8A 2OFJA 3PK7A 3GC2A 2AL2A 1EBHA 1R6WA 3MWCA 4J3ZA 2PPGA 4IL2A 3DG6A 1SJCA 2PP3A 3STPA 3DG7A 3I4KA 4A3RA 3ZVHA 2PTWA 4MGGA 1WUFA 1WUEA 3N4EA 2GGIA 4GMEA 4X2PA 3FV9A 3D47A 3NO1A 4F4RA 4M6UA 3JW7A 1SJAA 3DESA 2XH0A 3VC5A 2P0IA 3DGBA 5FJPA 4IP5A 2DW6A 3R1ZA 1BQGA 3R25A 2PTZA 3SN4A 2HXUA 2MNRA 3K1GA 2I5QA 1YEYA 4GYPA 3SSZA 1F9CA 3H70A 3TCSA 3UXKA 2OO6A 4A35A 3OZMA 1DTNA 3H8AA 3SJNA 3MZNA 5BOFA 4EWJA 4M0XA 4IL0A 1ONEA 2OX4A 4H19A 3QLDA 3T4WA 3R10A 4KWSA 2RDXA 3TTEA 1MDRA 3R0KA 4DWDA 1PDZA 2DW7A 3VDGA 4JN7A 3DG3A 3FJ4A 3T9PA 6ENLA 1XS2A 2PTYA 3KUMA 2PSNA 2PP1A 3IJIA 3V4BA 3P3BA 2FYMA 3DERA 3JVAA 2CHRA 3V5FA 3RCYA 3MKCA 2GGEA 3GY1A 2OZTA 2QDEA 3GD6A 4Z1YA 1FHUA 3PWGA 2XH2A 4GFIA 3UJRA 2NQLA 3IJLA 1MRAA 5FJTA 3DEQA 2XH7A 3OZYA 3B97A 1FHVA 1KD0A 4HYRA 1EC7A 2POZA 5ENLA 1NU5A 4E5TA 3ZVIA 2HXTA 4ZA0A 4GIRA 4K1WA 2AKZA 2GGGA 2HZGA 3THUA 3Q4DA 3CK5A 2PP0A 4KT2A 4HPNA 1MDLA 1RVKA 3HPFA 4DX3A 4K8GA 3CB3A 2GDQA 1EC9A 3DFYA 2PA6A 3CAWA 2OZ8A 1SJDA 1JCTA 4G8TA 3FCPA 4ROPA 3QN3A 5FJUA 2PMQA 4ENLA 2P3ZA 2QDDA 2PGWA 4KEMA 3H7VA 1L8PA 3NXLA 3NZGA 2QJNA 3TW9A 3VC6A 3MQTA 3N4FA 3UCCA 4HCHA 3JZUA 1KKRA 2OQYA 3OTRA 1JPDX 4FI4A 3TJIA 3ZLGA 1JDFA 4MKSA 4HNCA 3BOXA 4K2SA 3R0UA 4H1ZA 2GGJA 2QJMA 3IK4A 3VCNA 3RITA 4E8GA 3QKEA 1TZZA 3TQPA 3ES8A 4IZGA 3RRAA 3TJ4A 1ELSA 4HNLA 3S47A 4MMWA 3SN1A 1MNSA 5IDZA 2XSXA 1BKHA 3FVDA 3CYJA 4IHCA 3RO6A 2P8CA 1JPMA 1R0MA 2PODA 4GISA 2PTXA 2GL5A 3OP2A 3TWBA 2OKTA 4H2HA 3UCDA 3BSMA 5J04A 1KCZA 1NELA 4IT1A 2QVHA 4HCLA 1EC8A 2OG9A 4H83A 4DYEA 3QTPA 4E4UA 4DN1A 3VFCA 2OVLA 2QJJA 3NFUA 3PFRA 2OPJA 3T6CA 2QQ6A 3ZLHA 3UXLA 3N6JA 2PS2A 3MSYA 1OEPA 3VCCA 3ZLFA 3CXOA 4A6GA 3CT2A 2PCEA 2AL2B 2PGEA 3V3WA 3SBFA 4E4FA 5BOEA 3D46A 2HNEA 2XGZA 2OLAA 2GGHA 4DXKA 3T8QA 2OZ3A 3IJQA 1ECQA 3DFHA 2ONEA
chains in the Genus database with same CATH superfamily
3GWQA 2Z6JA 3V0TA 1YADA 2WP5A 1JCXA 3I6EA 1TV2A 5CGMA 1MO0A 3ZR5A 3UJEA 4YN5A 1DWGM 1GV4A 2A3LA 3C86A 1E4MM 4C6JA 4G1NA 4LFYA 2Z28A 1O6IA 1E55A 1EYWA 1SSDA 2VFDA 3MUY1 3N2CA 1I2RA 3H2NA 3O7UA 2FTYA 1S5MA 3CIXA 5CJ5A 2HROA 4OGZA 2V3EA 2AL1A 2QDHA 4G6CA 3IIXA 4XO6A 1SJBA 3W9ZA 2QT3A 3E2VA 1XISA 5AVNA 1YXCA 1XLCA 2QUNA 2D3NA 3OG2A 3OJGA 4AZHA 1RA5A 4B4HA 3ARSA 4AEOA 4XZNX 2E5CA 3VX0A 4S3AA 1JUEA 1G94A 1CIUA 4M29A 4D6FA 3TMLA 1E4IA 3KW3A 4FX8A 4LEFA 4AHQA 4XKYA 3S1UA 2DZSA 4FZIA 1DWJM 2HE8A 1IGSA 2BHZA 2YDRA 4PMNA 1RZMA 5FS8A 4AH7A 4K7ZA 5A95A 4Q8OA 1VF8A 3GVRA 2ZRZA 3OYZA 1E4NA 3H21A 5AZ1A 1VPYA 3W76A 3HM7A 4H7VA 1RR2A 1KRMA 3BLKA 5K7JA 1XIDA 4XBJA 1JJKA 4FDCB 4KGJA 2WM0A 4EMJA 4FX6M 1JUBA 4B5UA 2C16A 1XP3A 2IXVA 1QPQA 4TX8A 3ZMRA 3PUEA 1WUFA 1K4QA 5HWJA 2CITA 6REQB 3WQEA 5K2ZA 3JW7A 4JX4A 1TPUA 4CN6A 3LRMA 3PUGA 1DKWA 3R1ZA 4JTLA 1XF0A 4ZB0A 4EMWA 5HANA 1XQKA 3FLUA 4CD8A 1DTUA 1KW1A 1AG1O 2VR2A 1NP0A 4DWSA 5G4WA 2Y8KA 1ZXIC 1AJ0A 2QUVA 1D8WA 2HVNA 4KWVA 2XHYA 3M7WA 4O50A 1GOQA 2E8YA 1V3HA 2PLCA 5HJYA 1V02A 1TV4A 4UNLA 5HINA 5AC6A 2RDXA 3QQWA 5A8QA 2QCMA 2WLYA 2A7NA 3RDKA 4DWDA 2ISWA 4XD6A 1SVDA 1PTGA 1UR2A 2DP3A 3GVVA 4LUTB 3HQPA 4BWLC 3AU6A 3IV8A 2JIWA 2PDIA 4U33A 1KCLA 5MKGA 1LWHA 1YMYA 3GY1A 5JMUA 2P76A 3O6YX 1TIMA 1UR4A 1FHUA 2WCSA 3IJ7A 4O11A 3B0YA 3I6RA 1CLXA 4UQEA 4TIMA 3DEQA 5AHIA 3MUIA 1HTIA 2CZ5A 3DECA 3G0SA 3GZAA 4B16A 2YYUA 4H7CA 3URBA 4DJED 3LCGA 4QG9A 1EC7A 4IMCA 3RK8A 3HPSA 4X60A 1J0KA 1LWIA 1FWFC 2GGGA 3W72A 5C70A 1OJXA 1BSLA 1HP5A 2E25A 4HQVA 1PZ1A 2RGLA 3E5BA 1R85A 2RJGA 4UZUA 1ZP4A 5I78A 2PRMA 3PY2A 2E6DA 1S39A 4TV6A 4MDOA 5CKSA 5I79A 3VMNA 1N8WA 1E0TA 4DX3A 5A8MA 3UZYA 1H09A 4ZO6A 4UMCA 4GJJA 2ZYFA 1FDYA 4PMJA 4HKPA 3CQHA 3M1ZA 3QR0A 5I00A 2Y7GA 4TVWA 4C6KA 4XK2A 1FX6A 1Z42A 4NNBA 2VX7A 2YQUA 1DQXA 2JALA 3PG9A 3NR0A 3SGUA 2WBKA 4IPNB 4CQ9A 5FJUA 5H8PA 1AH4A 2VDHA 1TV8A 4IFRA 2OGYA 2X7WA 2AQOA 3D3AA 1JD9A 1OFAA 2VZUA 4YVPA 4L9ZA 2EEXA 1XRTA 4NHVA 4PCSA 3MQTA 2R24A 2WQDA 2VL4A 3CEPA 5GJNA 1D9EA 1ZP3A 1OCJA 1GJPA 1CWYA 2E5AA 3OTRA 3EGJA 4ZOHB 1B0IA 4TMBA 2ZFAA 3AJXA 3BJTA 1GJWA 3CV7A 5J8LA 1GQIA 5REQA 5FACA 3L2IA 4KIRA 1EXBA 2I17A 1S1PA 1KWKA 3SUTA 1P0BA 3DHPA 2PWGA 1NQKA 4LS0A 1Z9AA 1EEPA 2GK1B 3T1GA 2BY1A 4S3BA 4AF0B 2JKPA 1Q6RA 3SN1A 4Q8VA 4ADTA 2XSXA 5DF0A 5G2WA 1JNEA 1GEHA 1FFVC 1H50A 1HL8A 1JPMA 4MADA 3QY7A 3OP2A 4R3UA 4C6FA 4GYKA 1G01A 2PWVA 3TWBA 1S3HA 3SURA 5J04A 1KCZA 3L4WA 4HCLA 1EC8A 2C0HA 3WD0A 1NDAA 2W0UA 1IEIA 5E0KA 5E1QA 4JTHA 2QIIA 5FF0A 1TRDA 2WV8A 3G1SA 3UYIA 3PZTA 1NWSA 4CN1A 2DSWA 2OPJA 3IANA 3KOFA 4S3DA 2V68A 4DBDA 3VINA 2CZFA 4R33A 3UXAA 1UC4A 4JDRA 1J10A 3QW4B 2PDCA 2WSQA 4IFKB 1M41A 1NQ6A 3AMGA 2HJPA 1OX4B 1MWOA 3ITOA 4HN8A 5HWMA 3ETRB 4JTGA 5BZAA 1L8NA 5EBAA 3QHMA 1H63A 4MFDA 1QPRA 1CBGA 2X50A 3LV5A 4P7LA 3IUIA 3CH9A 2V3DA 2PU0A 4W88A 3ISIX 3KDNA 1QI0A 3NCOA 3TOYA 5BCAA 5DMYA 5EMLA 3ALFA 2DZTA 4H8HA 5C0QA 4H4ZA 2XVKA 3I6TA 2YLAA 3BQ6A 1UH4A 3MBDA 1W56A 4E6MA 4X22A 1KTBA 3AYRA 3CBWA 1XYCA 3U5YA 3P14A 3VD7A 3TC6A 4ADUA 3TYAA 4UMBA 1YQ2A 4GG9A 1W6TA 3DFTA 2ZE0A 4Y9PA 3HU7A 3HW2A 4B2DA 5LGXA 1GVQA 1PYMA 1KGXA 1KQYA 3TWAA 4WK9A 3AZRA 1X8CA 2AAQA 4AD1A 2VVNA 5FSEC 3H23A 1UYQA 3N18A 4DI8A 3KVLA 1TJ2A 5JBDA 2GUBA 2Z25A 4MPKA 2FKPA 1TR1A 2Q09A 2AGKA 1BYDA 2AAAA 3DYOA 2A8XA 1HW6A 1D7KA 2OEKA 1E6PA 2BXYA 4KRUA 4QDMA 3C5QA 4I9AA 3TXZA 3CV6A 1WB0A 4LBRA 2VNCA 1Q8AA 4JNZA 4HMEA 2OWXA 4MNKA 5KEZA 3K4AA 4OUEA 3RU8X 2IW0A 4QP0A 3RNDA 2X2YA 3E0VA 1TV3A 4JDBA 5A8PA 4J27A 1ECEA 4H6QA 4ICMA 4M82A 3WD1A 3VC5A 1RY8A 4PC8A 3NSNA 4UC5A 1BQGA 2CFYA 3I68A 3QTGA 1DIKA 3Q65A 5KZDA 1YEYA 3W1LA 1F9CA 1W1B1 2V6AA 4CNPA 4UTJA 5ABFA 1R3SA 3S1XA 3SECA 3WBEA 1NFBA 4IICA 2D2HA 1W0MA 2NVDA 4LVDA 1Y8BA 2OWWA 2ZX8A 1DIDA 3TC7A 3LB0A 3UZXA 4KWSA 4MY1A 4WGHA 7XIMA 2VHLA 3LX9A 3IRSA 2HRWA 1C7SA 1K3UA 3VDGA 5BYWA 3UR2A 3C0LA 3FYPA 4UBPC 3GC5A 3ANYA 2HPMA 2DUZA 4N9DA 1ISVA 2YDSA 3WF2A 4C60A 3EA3A 3TDFA 3L2MA 2YBUA 1F6KA 2OSWA 2PB1A 2I57A 1XDIA 1TA3B 3VIMA 1L0PA 4MB4A 1Q6LA 5A6JA 1VFLA 4WDWA 1BF6A 3MYPA 3BL3A 3TXVA 4CU7A 4A22A 1H7RA 4GZJA 1V02E 1KD0A 1WZLA 3GXNA 1SR0A 2C3CA 5ENLA 5G5HB 1N8IA 4FB7A 4XZLX 4CVUA 3CIWA 3I7QA 5CGQA 4L4PA 1BXCA 1FWEC 4I8YA 1CECA 3LCLA 1NWRA 4O4VA 3IVTA 2C13A 2GOKA 4LVAA 4AEEA 4I7VA 4IG2A 4FOUA 1V0MA 3C0JA 3NPXA 2HBXA 3G1RA 1BEUA 3GG1A 1KRBC 4J3WA 3VGDA 2GJXA 3ITGA 5CCZA 5CBJA 3WK3A 2Y61A 3G1HA 2XJ7A 1ADSA 3MS8A 3O6AA 5U25A 2PFHA 1BLIA 4Q4OA 1OK4A 3WQGA 2VX5A 3KRZA 3MU7A 3NOEA 1FO4A 2I14A 3NQ6A 5EMMA 4JN6A 1DE6A 4JZ5A 4QE5A 5LNUA 2D1ZA 4ZOEA 2E68A 1XC6A 4YU1A 2V5CA 2XWDA 3EAUA 1OZMA 2VMFA 3CTTA 3PANA 5IFPA 4M1BA 1HJXA 3B05A 4HBKA 2R1NA 4GNKB 1HXJA 2NV2A 5E6YA 1JYWA 3TW9A 3VC6A 2VWTA 2O9PA 3NPUA 5I2UA 1E9YB 1G9HA 4HCHA 2CW6A 2JEPA 2XVNA 3H7RA 1FKWA 5ABGA 3RMEA 4MVAA 5AYBA 2BCPA 4MSSA 4LXFA 4ZVJA 3HPZA 1SO3A 4GIYA 4O4WA 4ATDA 1QNSA 2R1PA 1LM1A 2VT0A 1QOQA 3EBVA 1E6ZA 1GWJA 3AOFA 2GYIA 2WVVB 4OUIA 4K37A 8XIAA 1XYLA 3AHYA 3GQYA 4RZ6A 2SFPA 1HZYA 3Q2DA 3KX6A 4NQ1A 4HNLA 4IJCA 1DJIA 3DHFA 3QV8A 4C7GA 3FVDA 4JQ9A 1W9PA 3KAOA 2XPKA 3PZMA 1AODA 3HPXA 1GOMA 4J3SA 3BDKA 1FA2A 1UP2A 2OT0A 3G3DA 2WZEA 2B0MA 4AVNA 1R9XA 1W3TA 1SO4A 3CGDA 2A3EA 2OLSA 1XXXA 3RLHA 5I5RA 1HKVA 1V5XA 5B80A 3UWZA 1NHSA 3CUJA 2WM1A 2GVGA 2EKCA 3R94A 2O7SA 3DGZA 3GHRA 4DUVA 5EYWA 3LMZA 3CT2A 4H4UA 4QCEA 1NDYA 1RV8A 5KZEA 1BTCA 1LBLA 2REQA 4L6OA 1N2VA 3WNMA 7TIMA 1FH9A 1SZNA 4FOKA 2ZX6A 4PB5A 4O15A 4Z08A 4CQBA 3GR7A 4IP4A 5DCBA 3UT0A 4DAFA 1IWBA 4GGHA 1UD5A 5C9RA 3HG2A 3W22A 2R14A 3AIBA 1S2TA 2ZZ0A 4LYKA 1QATA 3ZJ8A 1B3OA 2A0NA 3IGUA 3O2LA 3RX2A 2VDIA 3EX3A 1HP4A 2YB1A 4BQ2A 4W7VA 1KR0A 1Y5XA 3OZOA 1XPYA 5CZJA 4BF9A 4ACZB 1NAL1 2NX9A 2DV0A 4PL1A 3AMLA 4IFOA 3QQ0A 1H7OA 3CAKA 1FECA 2WPFA 1PTDA 5DBUA 4B3ZA 1DHPA 1TQJA 1VS1A 5KZMA 2XIIA 3DH9A 3B8WA 3UP8A 3LHVA 3LN3A 3HB9A 4MJ4A 2XIQA 3LLXA 1F8IA 3O07A 1DJGA 1KM3A 4MWAD 1VB9A 1Y7VA 1HKWA 1O68A 2B7QA 1Y5VA 2WJFA 3A24A 3KLJA 2WOVA 2R1MA 3VNDA 2Q6ZA 4AZ7A 1YHTA 1ZJIA 2INEA 3SCQA 3II1A 4K39A 3NQCA 1F3EA 1GSNA 2PGFA 4GRTA 4XZMX 1EOMA 3UJ2A 2Z2BA 3S46A 1OWQA 5ABEA 2EO7A 5DXYA 5LZLA 1A50A 2R1KA 3NQ2A 1K7EA 5CZ0A 1V6UA 4AYGA 1ZBWA 1JD7A 1W1ZA 2ZXAA 2V82A 3UGRA 4QROA 3RPTA 4LCQA 1GEQA 5AC8A 4MUZA 1FXPA 4GXWA 2TYSA 4HA0A 3MP4A 2J9YA 3L8KA 3QKZA 1US0A 1P0DA 4GQGA 5JIWA 2CCRA 2BX7A 1BYBA 4DLMA 1N63C 4LCRA 5CBIA 5HMFA 3STGA 4WDUA 4M51A 3A6OA 4Y90A 1LRNA 5XINA 1ZKQA 4GYPA 1G0CA 1KN0A 4EF8A 3PTMA 4J56A 4AZCA 2Y5EA 3MSDA 2A21A 3L0KA 4U4MA 1XIIA 2OLHA 3AIWA 3QY8A 2OYMA 2RJHA 1GERA 5CSSA 3FDGA 2OX4A 3QLDA 2FTWA 4IUOA 3W1AA 2QEZA 4BJHA 1W3LA 4LJ3A 4DBEA 1MDRA 5I24A 1XV8A 2ESCA 3TLQA 3ZSSA 3MANA 4CUCA 1YNPA 4EPDC 1V0LA 4RLIA 3K8MA 3ZJKA 2E28A 3P3BA 5FS9A 3N2XA 1TTPA 4FXJA 4EX4A 2ZC1A 5T9BG 2QDEA 1IQ8A 1UD6A 4E2OA 2Z1VA 2CLKA 3WD4A 2OSXA 1W37A 3TYDA 3GTFA 3AM9A 3SR7A 2NQLA 3CO8A 2X0YA 5BWAA 3W2LA 3A7UA 3AUJA 2NV9A 1IEXA 3KHDA 4JTDA 4I7UA 2GR0A 1AL7A 1GQLA 3NVDA 1NU5A 3TX9A 4C1NA 4J2MA 1DNCA 1FP8A 4UOJA 3ID7A 4L9XA 1Z41A 2Y89A 5D9OA 1KGUA 5BRPA 5G2IA 3FYOA 1C8XA 5A6AA 3MYOA 3TROA 3N17A 4AZ5A 3VOFA 3L68A 4PTVA 2QCEA 3YPIA 1CZ1A 1R7OA 3G18A 1EC9A 3C61A 4Q8WA 2ZZCA 2VEFA 4H9UA 1KFJA 1W32A 3CIVA 1OM0A 1SGJA 4GUHA 2DVTA 3WBYA 2J6VA 1OD8A 1E6QM 1O66A 4ORMA 1DP0A 4PH6A 3D5HA 4R5EA 1N60C 3TLLA 1XLFA 3VDCA 4IISA 3DENA 3WQFA 4RX0A 1REQB 2D0HA 3AWNA 1TPC1 4M7TA 2ZICA 3C0SA 2YCLA 1H61A 4QRNA 1OF8A 2EG8A 4D6IA 3W75A 5CBBA 7ODCA 1J0YA 1TX0A 4A3HA 3JZUA 5I06A 4XZIA 2XGIA 3TQKA 5AC4A 1CGUA 4GYJA 4JY9A 5M03A 2H8ZA 4ZB2A 4PMOA 2CBIA 5TR3A 3S6DA 3PF3A 4J4KA 1MFUA 3NRZB 4X61A 1R46A 3P67A 3HO8A 4M7SA 2YL5A 3FOKA 1W1VA 3PPFA 4OECA 1QW9A 5L6UA 2PLJA 2Y5SA 3RITA 4L80A 3MUZ1 4AWEA 4APNA 1K9TA 2PDFA 3U7VA 3WJYA 1XLHA 1XICA 1KXVA 3HA1A 4RZ5A 1GOKA 4P7RA 3HMJG 1E6XM 1JFXA 3CL6A 4C1LA 2VX6A 2VC6A 2Q8XA 2IQDA 1K4GA 3AU2A 5F4WA 4TX6A 1FWSA 4EQXA 4RE4A 3A4AA 1R38A 4A8RA 2R91A 4GZEA 3GIYA 1A5BA 1U5HA 5I7GA 4H2HA 1BTMA 4JTQA 4TVDA 1JRPA 3LERA 2WKGA 4WY0B 5C8BB 3AXIA 4UFLA 3W53A 1AZ2A 2DZBA 4QITA 3CHDA 3UG3A 3KRUA 2QJJA 4G9PA 1VYRA 2Y1HA 3WY1A 3T6CA 3TR9A 2J66A 4H3DA 2G3MA 1E6SM 1R8LA 3R58A 4MZ8A 2WPEA 3PTQA 3GYCA 1OFBA 4MB5A 4GIAA 4ZB5A 3BAJA 2W5FA 1R3YA 4NZ4A 4Q32A 5DO8A 2VC7A 2HBVA 1XRFA 4WLCA 4M52A 1QK2A 4PUWA 4IGHA 3CUIA 5GRTA 1I75A 3A3WA 3HOJA 2GJLA 1R7AA 2WSKA 5JH1A 3RN6A 1LRQA 1XGZA 3KRSA 4KKXA 4LX4A 3ICJA 1TWIA 3RGTA 3WFLA 1XYZA 2GDVA 4KCTA 3LB8A 3EKGA 3PWAA 2B7NA 1W8SA 4GXMA 3PVFA 2X05A 4DO4A 3K4DA 3CMFA 4XUYA 4WSHA 1HKJA 1V0NA 3W74A 3APYA 4H4PA 3GAYA 2J7FA 2CXEA 1XPGA 2VUYA 1PDYA 1YTDA 4OWGA 4DRSA 2X8CA 2CWNA 1PZ0A 2YLLA 1W9XA 5C71A 1FWWA 4DF0A 4FLOA 2VQTA 2FJUB 3ITVA 4JFUA 2MUCA 1HVQA 1OINA 1F8WA 4H8VA 4AD5A 1NDVA 4JQAA 4ALDA 3M46A 4JKKA 2V2DA 1U83A 4HP5A 3TH6A 1JZ5A 1KKOA 5AYZA 4G5DA 3EUB3 2PDUA 1RQHA 4TOQA 5BXSA 5CPQA 4E0CA 3B0VC 4HOZA 1B90A 1XBZA 3PBUA 2C1HA 2P8BA 1RJQA 1E0WA 2ALDA 5CJMA 3AMKA 2I5GA 4K7VA 3SB0A 3W29A 3BMVA 4AC1X 4HT3A 2FZ8A 2CPUA 3KL3A 1P6WA 4H4YA 3G1VA 1M7JA 2PP3A 1K7FA 4H41A 3SEPA 3WBWA 4YWIA 3PB2A 1T99A 4GI6A 2J62A 2FJKA 2QV5A 3ABXA 2VZOA 3LK6A 1EA9C 4S2BA 3U6WA 3NWRA 1FRBA 3PP7A 4O0ZA 3VABA 1RCOB 1WDSA 1LQ0A 4C5ZA 4F2UA 3SUVA 1DJZA 2D3LA 2DW6A 3GXDA 3P6LA 4GZIA 4LIIA 3S3GA 4ICNA 5TQLA 1UW9A 1UA3A 2NUWA 1K8CA 4O19A 3FEMA 3OEXA 3LHUA 1RSCA 1VIZA 1GTHA 1ZJHA 4JR5A 1DTNA 1DBTA 1D7YA 3QW3A 3VD9A 1P7TA 4MNMA 4H19A 2CLMA 3UWUA 3LCWA 3GTNA 5K4ZA 5JU6A 3RO8A 4PTMA 1YE6A 2VFEA 3CB8A 3U4AA 3UD6A 4UTTC 1TYTA 2YVJA 1DXIA 3SIZA 4R88A 5GNYA 5DLCA 1UR3M 1RBLA 2DW7A 1BHGA 4JN7A 3WL1A 1LG2A 1ZB5A 2PTYA 4NYUA 1Q6CA 3A3XA 3KUMA 1AH3A 4IIGA 4FF7A 1NSJA 2W67A 3JVAA 1XLDA 2VOTA 3DXIA 3WLOA 3WNKA 2YAUA 4GC3A 1H2JA 2PD9A 1W31A 5AYIA 1GRBA 5CJNA 1G7VA 4POCA 2VGIA 3UJRA 3LXAA 1KB3A 1OYBA 1V8EA 3SUUA 4L65A 1B2YA 3B97A 2CLFA 1FHVA 2V63A 3GR8A 5CLTA 1Z69A 1IT7A 1KBIA 3PJXA 2YA2A 1EO5A 5SWUA 3IK2A 3S9YA 2VCAA 1VKFA 2W61A 1UZHA 3ARZA 4TQTA 2Z00A 5H8MA 1YTKA 1XFCA 2BP1A 1OC5A 3MO7A 2PP0A 4GYFA 2VFIA 4LVGA 1M7OA 2O7QA 5DRIA 5CG0A 3FDKA 2BWGA 1GK8A 5LIUX 1W2PA 3DH7A 4UTIA 3LI0A 2NQ9A 1J0ZA 1NEYA 4DY1A 3VIPA 1FBAA 3K8LA 3T08A 3GG8A 3NEVA 4ZQMA 2PA6A 1SB3B 4A05A 5E9AA 1VZWA 5HQEA 4A8IA 1JCTA 4S3KA 1I1XA 5FEZA 3AQUA 3ANUA 4FNTA 1S1RA 1ML1A 3FAXA 3TYBA 2PCQA 3OU8A 1MEHA 4FXFA 1H4PA 4LAZA 4RK8A 3WZ0E 1E9LA 2CNCA 2WOIA 1L8PA 3CC1A 1BD0A 5L9FA 1EEXA 3EOEA 4RW5A 4F8XA 1MVYA 3CZEA 1XW8A 1M03A 4X9SA 4OBRA 3B4YA 4H4VA 1GGOA 3L66A 3VUSA 1IZCA 4QSFA 4OU1A 1O12A 1RD5A 1U1UA 3F2CA 4JFSA 4L5ZA 1IXQA 1TR9A 3VGFA 1ME8A 3QFBA 4Y2WA 4J40A 5ECUA 3BGJA 4B3LA 1KFCA 1M04A 2Z1SA 4GPNA 2WNNA 1Z8AA 2VZVA 3SQLA 3DN5A 4E8GA 3H6OA 4NZFA 4E8DA 3LZ5A 5LA1A 1RK6A 4QQUA 3M6DA 4B3KA 3W7RA 1Y0EA 5C9WA 2OCZA 3IJ9A 3ZWTA 4NAFB 3ZS4A 3RRAA 5BOOA 4HMCA 3C56A 4ONVA 4Z1CA 3CNYA 1UKSA 5F1VA 1MI3A 4JYEA 4UNKA 1M6JA 5HUPA 1DL3A 2ZBTA 5T26A 4N02A 4HNTA 1M65A 5FF3A 3BQ5A 2DT1A 3UY8A 3WUEA 3TSMA 3VIGA 2A4AA 1GONA 3O0KA 3QV7A 4IT1A 2QVHA 4R85A 1JULA 2WLZA 3UR7A 3IC9A 1Q85A 4DN1A 4NXSA 4AFYA 5U7SA 1B30A 1CNVA 2W79A 1FFUC 6TIMA 3AHZA 2I9UA 3IEBA 4WEVX 1VRXA 1DPMA 3LTSA 3S0CA 2NVCA 4ZBCA 1I60A 4RR4A 4LUYA 2NXIA 4LUIA 1QNPA 3H24A 2YBTA 4WKFA 1QRQA 2QKFA 3MWAA 4IOTA 4GD0A 2J24A 1C8VA 2G41A 1PTAA 4RE2A 3AMCA 5C5YA 5KSWA 2OX1A 3M5VA 1O5XA 3OW1A 2W91A 3MHGA 4IMDA 1HL2A 1KM5A 2QCNA 3OB8A 3TYZA 2PLMA 4HHMA 3SQSA 1TPH1 1EWEA 3VOGA 4KWWA 4RKAA 3APTA 2P88A 4C6BA 3NAVA 3DBPA 3PZGA 2D23A 5AVHA 5HA7A 2PURA 1P48A 3KL0A 1CGXA 3RILA 1EBGA 5HK4A 3DIPA 4TR9A 5LIYX 3B0UX 1Q6EA 4Z17A 4QSHA 1B57A 1QJWA 2ZUTA 5CSYA 1STZA 1DIEA 3MDWA 4FA3A 3NO3A 2ADAA 4C6EA 1NJJA 2GQ3A 1X97A 2DZPA 1LUCA 4O8AA 3EDEA 5GJPA 3NDZA 1BSIA 2GVJA 1NM9A 3KLLA 1FWTA 1XYAA 1QTWA 3B06A 4TV5A 2IPGA 3UA4A 3EPNA 1H2IA 3BW4A 1JI2A 3FXGA 4OOZA 4G7FA 4F9DA 1XHGA 3BGAA 2BVWA 1LLZA 4D1JA 4U31A 1X38A 3AYSA 2WBAA 3P8JA 2OFJA 3EOLA 3CZLA 1AD4A 3OLIA 3W2JA 1TPFA 7PTDA 1WXJA 4WD0A 3TAKA 3BLDA 1U33A 4IL2A 1SJCA 3KCJA 2JF7A 1G1YA 1XSIA 5D37A 1QMLA 4N6EA 2ZZ2A 1ITUA 4O52A 1UP0A 3NTYA 4URIA 5G4EA 1LWJA 1RBOB 4GMEA 1Q6QA 1HNYA 5G1TA 1E1EA 4ZZ9A 2EQ8A 4GIEA 3CGBA 1H62A 3Q67A 2XH0A 2XUCA 1JF6A 3LCFA 4RE3A 3PBYA 1FWJC 1GYNA 1FWIC 1W3IA 3H26A 4R9XA 1VEOA 2V9DA 2XN0A 3DFSA 2E67A 3TCSA 2D73A 5LKYA 4Q8NA 3HG3A 3W1MA 2PC8A 3WDIA 3PUOA 1UOKA 2FGZA 1W3NA 5KVHA 1EOKA 3NM3A 3E96A 4FS9A 4DZAA 4CEXC 2X41A 3T4WA 3VDAA 2YB4A 3S2LA 3R8HA 3C2VA 5FF7A 4L7ZA 3T8LA 2DJLA 3GG0A 3J7HA 5G1YA 4A3YA 4FALA 5A1AA 3S2CA 3VTRA 3PG6A 1C8QA 4J28A 8RUCA 4X0NA 2EQ7A 1JR1A 1WBJA 4L61A 3VGEA 4JX5A 4H4XA 3GXPA 2D2GA 2JQXA 2PDLA 2OZTA 5F4SA 1F8MA 4D6JA 2VI0A 2ZA1A 4RZBA 4FIRA 3MSGA 1P1XA 2C1GA 2GR2A 1HO4A 4C65A 2XH7A 1KFBA 3LLFA 1H7NA 1GRTA 1J9YA 2GUUA 3VIHA 1JAEA 1OADA 1KFLA 4MY9A 1JCJA 2O9RA 1QFEA 1N5WC 2POZA 3LPGA 4XAYA 5T91A 4OE7A 2QCFA 3W7HA 4ZQOA 1LDCA 2HVOA 3L9CA 1FIQB 1EX1A 4AD3A 5JXQA 1R86A 4PFMA 3WH7A 2Z1WA 1OFPA 4EF9A 3B9JB 3GC4A 3WLIA 4N9EA 5FL1A 4S3CA 4INFA 3EB4A 3VGGA 1UHVA 3QY6A 1XDLA 3TAOA 3QH2A 1TVLA 3UF9A 4GK8A 4ZQRA 1NHRA 1UWAA 5EMUA 4DEFA 5FEPA 3V7PA 4ZSTA 2JEQA 4IIHA 4NY2A 1XLMA 1LL4A 1UPPA 3TNBA 1KR1A 5CG7A 1I2QA 3UVAA 4MY8A 2V2CA 2WCAA 3F4WA 5A2AA 3NZGA 1TPVA 3LHWA 5FOOA 3CUGA 3M6YA 1WDRA 4JY8A 3GFYA 2G5WA 4Q4PA 2HQMA 2QCDA 2W0HA 1BVWA 3PSVA 4Y6GA 1R3TA 3VZXA 1GHRA 2GWNA 3L5AA 4H2CA 3GUWA 2F7FA 2FB2A 1Q6DA 3CHCA 3NJ3A 4KW2A 4FI4A 3W1PA 3A3HA 3VILA 2YA0A 2XWEA 4YVXA 1X98A 1Q5MA 2NSXA 5CZSA 4PB3A 2AQVA 3IK4A 5T8GA 2V69A 3JRKA 1HJQA 1JZ6A 1G5AA 3P0XA 2XIJA 2XSAA 5I77A 1UZ4A 5K4XA 3KVMA 4ZQNA 1ZUAX 4A3QA 1EHNA 1UR9A 2Y8VA 4MUPA 5BWFA 5H91A 1KLZA 3O0HA 3BCJA 2UY4A 1JPKA 5ABHA 2QYGA 1OCNA 1LQAA 1WDDA 3R6IA 3CYJA 2P8CA 2BBFA 1SM9A 1UIPA 3ARWA 3LGDA 1E5JA 2ZA3A 4H9TA 4FNPA 3GH4A 1XGEA 4TUFA 2WVTA 3BAYA 1NELA 2H3BA 4XD5A 5CLWA 1OB0A 2J47A 4DJFC 5HNNA 2PDXA 3L4ZA 1KGWA 4ZEPA 3FX4A 1ISYA 3HURA 2OVLA 1EF3A 1E15A 1GYMA 4L1GA 1QUMA 1XQLA 3ZLHA 3SQMA 3KOWA 3GRIA 3TOPA 1I45A 4C6CA 2J4GA 3FIGA 3TYEA 1CEOA 2XGZA 4AXNA 3OGRA 1JF5A 3VDBA 4DXKA 1YPIA 2FVLA 3QVQA 1GOWA 2ON3A 3AIVA 3N3MA 3W84A 3G8RA 4QQ3A 4RXGA 4RV8A 4HPGA 4LB4A 3SCVA 4ZL1A 4AG0A 1XIGA 2W54A 4JEQA 1NDWA 4E2DA 2EXOA 3S5NA 3H4XA 4IIEA 3N3TA 4QBXA 4W87A 3GDLA 5A6KA 3AHXA 4FXSA 3S5SA 4HMNA 4D1IA 4WHBA 3AS2A 4IIFA 3GXFA 5E6ZA 2GH5A 2ZX5A 2QW5A 1G4PA 1L6YA 1GRGA 2XFFA 5I6SA 3A9BA 5U4NA 1JQXA 2YVGA 4Q8UA 3DDMA 3N14A 3VKJA 4Y96A 4LBUA 3EKLA 3GD4A 5IXEA 3NIYA 4FX7A 5AYYA 1GOOA 2O4QA 3GDTA 5FJOA 4HNUA 4EK7A 2O9OA 1H3GA 3VNJA 3WDRA 3WJZA 2BDQA 1M01A 1TB3A 1ZHAA 2F8QA 3U5UA 3UZJA 3FY1A 3W82A 3WF3A 1E5NA 1ZCOA 4QTGA 4L9YA 2E9LA 1J5TA 4E2VA 3SM0A 1RP8A 2WVSA 2NWRA 1SPQA 3LI1A 4NJJA 3ZO9A 4LU0A 1WNOA 3G1XA 3W38A 1YDVA 4UQ9A 2PPGA 1MYRA 1JFHA 2CWXA 3CL7A 3SCNA 4QIUA 3UQNA 1DXFA 2ZRVA 1SR9A 3F5LA 3D0CA 3DFPA 5CPSA 5DN1A 1TO3A 4PMYA 3TU9A 4U2ZA 3S5YA 1MSSA 4MGGA 4E3TA 3QGKC 4PMRA 2NXGA 4X2PA 3BE7A 1N55A 3QSRA 5AN7A 1XCFA 2WHKA 3SAZA 1EKOA 2ZZ6A 4MTVA 2QUTA 2J3NA 3VE9A 2PTZA 1MEWA 3FSTA 4DJEA 1UZ1A 4DPPA 3PZOA 1S2CA 3SSZA 1EH9A 4UNIA 3B9EA 1X1OA 4B91A 4Z1DA 2Y2WA 3CO4A 1KV5A 4GXPA 5JBFA 2QV4A 4PUJA 3PR2A 2QGHA 3F4DA 3TKFA 3UW6A 1ZPTA 4B5VA 4M0XA 3ITTA 1RP9A 3VD4A 3FAWA 1OQFA 1BRLB 2LLEA 5M5DA 3W3OA 1JOAA 3AN1A 3GRSA 2P3EA 1W1TA 3VE7A 5KVIA 3B40A 3PJUA 3IJDA 3LA4A 3SCOA 4MZ1A 1LYXA 1ZNNA 4H04A 4O14A 4EOUA 2F84A 3CWOX 4KFNA 2OQLA 2FYMA 5F2LA 1O60A 1BVZA 1M5WA 1CXEA 3N13A 2GGEA 1QU4A 3PWGA 4AC7C 5H1WA 4GFIA 5C2XA 1XYFA 2BS9A 2WOWA 3BLEA 2PDWA 4DF2A 4QNWA 3TP4A 4BI5A 4YLWA 6ALDA 4K8EA 4V33A 1EJRC 1DWHM 3H7UA 2ISSA 1CXIA 4JICA 3MT1A 4Y9MA 3FKRA 1Q4NX 2HXTA 1WOAA 3G3MA 2X42A 5G4HC 3DK4A 1HKKA 4XZWA 1BQCA 1V51A 4LYPA 1SZRA 4K7YA 3M47A 4XVEA 2YYTA 4PTDA 3FFSA 2X09A 1G4EA 4DQWA 4NIRA 2RAGA 1FWCC 2TMDA 1XD0A 3LSCA 1D3CA 3BLLA 3U2CA 1QDSA 4AHOA 4HSNA 4LOCA 3GFZA 4ERIA 3CB3A 2BNJA 3KHJA 1X6UA 2C19A 4PGLA 3WEMA 3W83A 3CUZA 5GPRA 4TMCA 4WX2A 3CMGA 1XRVA 5IHRA 1NY1A 4J3TA 4AY1A 3G6MA 4F2TA 3QYQA 3K46A 2OYKA 3LUTA 1EJUC 5LNRA 1DIOA 4MOZA 1JCNA 3S83A 3BURA 4HJWA 4ROQA 1I2PA 3LCXA 4LUTA 2W3SA 3L4XA 7REQB 4GQBA 4BQ5A 2QJNA 3E3HA 3KL5A 2DZUA 4Q6XA 1AMKA 4PULA 2Y6ZA 2GVYA 4WXZA 2XN1A 4UOZA 4PZVA 4PMDA 3BWWA 4AWTA 3WF1A 3TJIA 1LOSA 2ZRYA 1QBAA 3T78A 1CENA 2CKSA 1DE5A 1IR1A 1NOUA 3NYZA 4NVTA 1PKMA 4FK9A 5DMNA 3VOIA 4XV0A 1A5KC 1WCGA 3LOTA 4WGXA 5IRPA 3T0CA 1EIBA 4EXAA 5HOSA 4XWUA 1UIOA 2XIOA 4HIBA 4ML9A 1MFVA 1W9UA 4NJGA 3C3NA 3LV6A 4U3CA 1ELSA 1OVDA 3M16A 4HB7A 3GBEA 2J8TA 1PCKA 3XIMA 4UFMA 1WBHA 2ZUUA 3AS1A 3B9AA 2WC4A 4YTRA 4FNQA 4DYJA 5FSDC 3WYZA 2OKTA 1P6BA 5K9XA 4Y7EA 1QASA 1N5XA 4GKTA 2ZDRA 3QGAC 1TWZA 3I3EA 4ZOBA 6A3HA 1CLKA 1VEPA 3A23A 1IEVA 2HS6A 2C71A 4H4RA 5A6LA 2D2JA 3NFUA 1XG3A 3PFRA 1WO2A 1H5VA 5FD0A 1HO1A 2YVFA 3HQ1A 4RJEA 2AL2B 4R7WA 3DFNA 4AU0A 3PBGA 2E40A 1UWSA 1GOIA 3BOLA 1QO5A 1UB3A 1NH6A 2ZOXA 3DGRA 4AVFA 3LLDA 2F5ZA 2VD9A 1QXLA 5CZTA 1VGAA 4E38A 2YA1A 3QMSA 2J75A 4D2JA 1V7YA 2ICSA 3VIJA 1NHQA 2WB5A 2BFGA 4AIUA 2V3AA 5A69A 3A4XA 3QPEA 3WBAA 5CQ1A 2GJRA 3EXTA 1KLYA 1XIEA 3PZIA 2ZUVA 2W4XA 1TPDA 4XIMA 2X0HA 5D9PA 4HNNA 2GK1A 1ME9A 3WH6A 2FHCA 3URAA 1Q45A 4Q8MA 3BV7A 4IQEA 4GABA 3W26A 3RLGA 3RMJA 4N7QA 1C7TA 4W8BA 3VM7A 1ZBCA 1VEMA 4HHPA 4IX2A 2ZRUA 2RDTA 1FWDC 3MO4A 1ZGDA 2EPHA 3BJSA 1ZY9A 3B8TA 1DXLA 3SO7A 1DOSA 3OC4A 1OD0A 4H8UA 3A21A 2ZXDA 1JZ3A 4P8VA 2GSHA 4M6PA 5A2BA 3PUDA 1ZBVA 2PDMA 3EWBX 3PBVA 4Z2KA 4HA3A 1XIBA 1QW7A 2WAGA 4DZHA 2QGYA 3ELFA 2E6AA 1GVIA 2GOUA 7ENLA 3R2GA 3SN0A 1SUXA 3F2DA 1BPLB 4NSBA 1SZEA 5I3HA 4NNCA 4CCZA 3EAOA 1X2GA 1EB3A 3O63A 4WDTA 1P6CA 4HD5A 3WLMA 4XAPA 3E49A 2ACRA 2XVLA 4XKMA 2WSYA 1TX2A 1JUKA 3W86A 1XINA 1OX4A 3B04A 3KBNA 3ZWSA 1JGIA 2PTWA 1W17A 4W85A 4QFUA 4ZXOA 4Q6JA 2HS8A 2Y4SA 3OO2A 1O5QA 1YXDA 2Q71A 1SJAA 3P5YA 2WQPA 1NWUA 1P0EA 4HK7A 4CQAA 3TE9A 4FPSA 1FFQA 1V6VA 4U5IA 3ARPA 4ZE5A 3SY1A 1WE5A 2ATSA 3ATZA 4JTKA 2ZRXA 4LBSA 4KF1A 4XZHA 2FPVA 3SDOA 4CVWA 4MWAC 3T7VA 3V5OA 3B8UA 1MNZA 3VGHA 5C2GA 4PE8A 1E0VA 4PODA 5DMMA 3P82A 4UTWA 3UFYA 3F5JA 1V4YA 3FXYA 4PFHA 2F61A 1YPXA 2W63A 6XIAA 3INPA 2E8ZA 2DSUA 3NO5A 1IZJA 2Y70A 3T9PA 6ENLA 5FKYA 2PP1A 3GKFA 4JTAA 3DERA 2O0TA 4NF7A 3MV11 2IPJA 3POHA 4F0RA 4P7NA 3WFAA 2QXWA 3U48A 2XH2A 1B4KA 4M1RA 3VIOA 3DI1A 1FP9A 4MDPA 4GHRA 2FZNA 3L0NA 2PC4A 3V0UA 1ODZA 1ZSXA 4RW3A 2PRHA 3UG4A 3LXCA 2G96A 4GBUA 4NP7A 3BJFA 3QRHA 2Z0IA 2GVEA 2YW4A 3ZVIA 1SFJA 2OODA 1XH1A 3HQNA 4J57A 3EZ4A 5A3HA 4U10A 3W7MA 3PG8A 1OZQA 2BMBA 1IEQA 1A4MA 2WK2A 3W1RA 3SR6B 3CK5A 1VFMA 2J7CA 2QCLA 1MDLA 1OHLA 3A13A 2FFIA 3T55A 1JVNA 4EE9A 4A8NA 2E1WA 2J25A 4OV4A 3T0TA 1KQZA 4GVFA 5H2ZA 4NZJA 3UEQA 4TTUA 3N73A 3I65A 5CAHA 1XLJA 3CAWA 3WLHA 1THFD 5EB8A 4QLJA 4ZXLA 3FCPA 1VCFA 2E5DA 2VENA 4DZIA 1GT8A 4UWMA 3B0XA 1FY6A 1BG4A 4F0HA 2W62A 4M5PA 5CH9A 2GJPA 5DCDA 3UESA 3CM4A 3APGA 3H7VA 1HF6A 3NXLA 1W5QA 2YCJA 3S1VA 2OXNA 3AIRA 5EPDA 3B8IA 3CZGA 1A0DA 1JDDA 4XZBA 4Y8FA 3KCLA 3MJYA 3EF6A 4EAMA 3NVZB 4AMAA 5EBKA 3UXDA 4LGXA 1TYGA 1NVMA 1J93A 4O0QA 3UU0A 4PN2A 3M7SA 4UFJA 4L6HA 4EACA 4H7ZA 2OO0A 4TVUA 1XH0A 4YCPA 3BAWA 3VDHA 3QBUA 2VUNA 4KBXA 3B9OA 4KERA 4W5UA 3UBPC 4O1CA 1YBQB 2GSEA 4LF2A 2E5BA 1E3ZA 2P10A 3OVRA 1QO2A 4DXVA 4MKVA 2DSVA 5C54A 4WXYA 1QPKA 2J74A 3NDYA 3RUBL 3W7LA 1UWQA 1K1DA 4Q22A 3N2BA 4PUNA 5CEWA 4FHAA 4JTIA 4WJ8A 3WLKX 2CLEA 2H90A 1R0MA 3NURA 2OWCA 3V0SA 4V1XA 3JR2A 2GL5A 1SW7A 4UIOA 1OK6A 3NGFA 3BSMA 4A2SA 3LRKA 1CCWB 4HZ7A 1A47A 3A7AA 4GCAA 5EFDA 1E1FA 1QNQA 1QWKA 4C6NA 4LUSA 4MWAA 1I2OA 2I7GA 4EIVA 1PXGA 3F7JA 4RNHA 1JROA 3I7RA 2BY3A 1W3JA 4KETA 1TJPA 4LAMA 3MJMA 3THQA 1IZKA 2VFHA 4QJ1A 3BK0A 4HPJA 2YKKA 3ZVHB 4EP8C 2WANA 5FEWA 3HFTA 1Q63A 2JKEA 2GUYA 4H4SA 4GINA 1WOBA 2V8ZA 4GY0A 3T09A 2ZADA 1I0DA 3ZYZA 3VOHA 3WQ6A 2G97A 3W7NA 3O15A 4PRTA 5TD4A 3M0JA 2VX4A 4JHOA 3F4NA 3BGGA 3MCNA 3WEZA 1JCMP 4QJ3B 1PV8A 1XM3A 3MUAA 3TZNA 2ZC8A 2WVVA 2J79A 3C2OA 3PZ9A 2RABA 1PS9A 3PFMA 3G0XA 2Z1BA 3THCA 2PDJA 1HKIA 3NEHA 4S39A 4J2PA 3CPUA 4JAWA 2YIHA 3FYYA 2IQTA 4HOWA 2QF7A 3H2CA 2AKMA 2G3IA 3UJFA 1EUNA 3GFXA 3E6EA 4PCFA 3H2AA 3MY9A 4TU1A 4B5NA 3BANA 2Z4GA 4BEUA 1J18A 3GO2A 1LPFA 1EX5A 2XYLA 4GACA 4H4QA 3MMWA 1J12A 2GQ8A 3L21A 1XD1A 1AA1B 5XIMA 3NL6A 2HE5A 1S7MA 1OFQA 1GW9A 1ZBKA 1FWHC 2DZWA 4MLJA 2PD5A 5CPMA 3OVGA 4IIDA 3V5CA 1JRBA 3GC2A 5KZ6A 5CPNA 2AGTA 3MMTA 3KDOA 5LIKX 2YCKX 5HATA 4J3ZA 2W3ZA 3H2OA 5RUBA 3P81A 1EDTA 3NQDA 4H4TA 2VEKA 1JI1A 4H6KA 1JPHA 1XGDA 5BXPA 4MJZA 4PSPA 2PDPA 2RDWA 4QG6A 2R94A 1W9VA 2XVGA 5LIXX 3BICA 2JIEA 2WMGA 1L6WA 4OVXA 1HKMA 1S5NA 4X9YA 4M6UA 3PZNA 2GR1A 1O95A 3T81A 2D0GA 3NXFA 3OA5A 3WJWA 5HAOA 1EBDA 1Q65A 4JCLA 3UR8A 3E74A 2INZA 3BUVA 5KITA 1G7UA 4L4OA 4CD4A 2J6XA 4GCXA 4ACZA 3UXKA 3ECQA 2PGRA 2EPNA 3DFQA 2FDSA 1MXGA 4QS6A 2B7OA 3PPGA 1E56A 4PMXA 1HL9A 1RM6B 3MKVA 1XLEA 3ITLA 3M5XA 3H4KA 5A8NA 4DJFD 4Z42C 4Q4RA 3GHSA 2EPKX 5LXXA 3VI2A 5HWNA 3LHYA 3EMCA 4HTYA 3RJYA 1R47A 3HPAA 3W1NA 1OFOA 4GQQA 3KOXA 2QMKA 3DG3A 1YRRA 2F38A 3S2NA 3EOSA 2WMFA 4IPIA 1XUUA 3ANVA 2PRLA 3TVAA 4CNNA 2HEJA 4K8HA 2QAEA 1Z3NA 2DH3A 1C29A 4FMVA 1MMFA 3O0FA 4LY8A 4DIAA 2Y7FA 4KCUA 5FJTA 4AD0A 3C4UA 4HGXA 4DPQA 5D2TA 3RU6A 4Q4QA 3VX1A 2PDKA 1EJVC 2PAJA 3USZA 4BURA 3GVWA 1YXYA 3PULA 3M41A 1XYBA 5MHBA 3W02A 5CC7A 4GIRA 2POTA 2YDQA 2CU0A 3W0KA 4LNYA 2ZUNA 4OZOA 4GH1A 1DJWA 1HVXA 4DZ5A 4LYQA 3SY5A 1RVKA 3V36A 2A3HA 1VBJA 3DAQA 3HPFA 3EMQA 5D9NA 3KVKA 4M81A 2Z7GA 3WH5A 2RH9A 4AXKA 5FS6A 4MF4A 3BW3A 1QPOA 5GNXA 4PRWA 1DVJA 3WH8A 1VQTA 4F79A 3CHFA 3UY7A 1UQZA 2OZ8A 4XAGA 2V5KA 4Y9NA 4LS1A 1OBAA 3QLLA 1V7AA 4DUOA 1S38A 2KAUC 2YR1A 4ECLA 1IXPA 2JKAA 3QN3A 1O7AA 1SMDA 4I9MA 4AB4A 3QYSA 2VEPA 4BWLA 4MYAA 3O9NA 2PGWA 3L0GA 1RH9A 3K4WA 4Z0JA 1RY0A 4QAWA 3I3BA 1XBXA 1LP6A 2OT1A 3S8HA 2VFGA 2Q3OA 3UCCA 1E73M 1TWWA 1KKRA 1OG6A 4PBFA 1J0HA 3TC3A 4FLSA 3HV9A 2OQYA 5CSUA 1GQJA 3WJXA 4MJMA 4AY7A 1LZOA 1NDZA 1WZKA 4JKMA 2QIWA 1G4TA 3PPCA 3PJWA 3E5PA 1WQ5A 1TPB1 4H4IA 3N04A 2WZTA 5FI8A 2A7PA 4K2SA 3R0UA 3A9IA 1KM0A 3S9ZA 4FLRA 4XO7A 2QJMA 3RJXA 3AIQA 1LROA 1OIFA 3LSBA 4IJRA 1FVPA 1CGYA 2PDYA 6TAAA 4DBUA 3GIQA 3TQ0A 3G1AA 1YE4A 3WENA 5JCMA 4G2DA 4HK6A 3DK9A 2FTPA 7A3HA 4LF1A 4NL1A 2CERA 3ZR4A 1LL6A 2BLEA 3GLCA 4W89A 1POKA 1BKHA 1RJPA 4UQBA 3W7GA 5JVLA 3M64A 4EPBC 2J13A 1TMHA 1PX3A 3UPMA 2WYSA 1QW8A 3RPDA 2PE4A 5A5WA 3VD5A 3WBXA 4HHLA 4PUUA 3LTYA 1O4UA 3MZ2A 3LDVA 2UY3A 3WEOA 1OABA 3AYTA 3EPMA 1J4EA 4N4PA 4H83A 5M2FX 4ADWA 1TWSA 1XHCA 3R89A 5DFAA 3W37A 2HPIA 3R4IA 3EWUA 1YTEA 5AECA 5KTLA 1OEPA 4E8CA 1REQA 1GVYA 3SBFA 4LEQA 4CCCA 2IMRA 4J35A 2CFFA 4K3ZA 3UNTA 3C6CA 2OLAA 4DAIA 1GQNA 3FJNA 1V3IA 4P5UA 1ECQA 2FLIA 1VBUA 3N6HA 4OFCA 1VCVA 1KFEA 1T8QA 4LY4A 1PAMA 1XG4A 2NQJA 3KP1A 2G37A 1V6WA 2ZTKA 3IARA 3KTXA 3W1UA 1E0XA 3EOOA 1VJSA 3SJ3A 1QOPA 1S2AA 4F0SA 2F6XA 3QQ1A 4MWAE 3UPBA 2V5BA 1KBBA 4C6IA 3MPGA 3GNRA 3TW7A 1BGGA 3PNUA 3P80A 2RGMA 1QNOA 2BOFX 1DQWA 1MUCA 1V08A 1X6NA 4M24A 3Q94A 2O55A 1SW3A 2W27A 2WC3A 1ZJBA 3SCTA 2Z24A 4PB4A 1H0IA 2EGZA 3QHNA 2VVSA 2D0FA 3MI2A 1GKRA 1AFSA 1ICSA 4RDWA 3VK5A 2FB3A 3U7BA 4Q33A 3WF4A 1BWLA 3KOZA 4HYWA 3W07A 4BF7A 3RNMA 4WY0A 3TN5A 2OU4A 5HXMA 2HSAA 1P43A 3KBWA 5IBXC 2YL6A 6XIMA 2QLYA 1WKEA 3Q45A 1WAUA 3G8EA 4F48A 1J79A 4Q7NA 4I7WA 3PBMA 1KRAC 4GVGA 4ACYA 1YX1A 2CESA 1FWNA 2ODOA 4OT7A 1H49A 4XQ6A 1AJZA 1CI1A 4NT0A 3QPYA 4W4QA 3WUBA 2EF9A 1QNVA 1WX0A 3TNOA 3KE0A 8TIMA 3ZSTA 4AQLA 3NUKA 3S5ZA 1EJWC 3WDPP 1NP2A 3P84A 3NO1A 3NVVB 4GA8A 2RDUA 3DESA 3EWDA 4ZENA 4QAIA 5AOUA 2ZDSA 1TJRA 1ZL1A 3VKBA 2OEMA 1YIXA 5K9DA 1ICQA 1A3WA 4Q4SA 1JZ7A 4ZO7A 4LUSB 4MWAB 1FUYA 1XJBA 5HNUA 1TUFA 2DU2A 1O94A 3AS3A 3S9IA 3NQEA 4QXIA 4GUJA 2E09A 4IXXA 3M0KA 4JQ2A 4Z2JA 1F2JA 4EWND 1V0KA 3CMJA 5HR6A 3WMSA 3EB2A 2VDGA 2IQ0A 4RNFA 1J2BA 1VFUA 2EQDA 3SRDA 1A0CA 2H9AA 4J3UA 4R34A 2PBGA 4PCTA 4C1KA 1O1ZA 2IPFA 5C7VA 1XS2A 3WLQA 4DBWA 1VPQA 1TYPA 1XLKA 1GRFA 3QC0A 3ABZA 3S1WA 1EL3A 2C7FA 2JE8A 4QCFA 3N25A 2X1UA 4O18A 2EPMX 3HTWA 3G1FA 1A5MC 2FZMA 5IDIA 4NU7A 4JL1A 1PPIA 2ZX7A 1Q8JA 2XM2A 4O28A 4LANA 4YYFA 2JGYA 2R82A 1GQKA 3OZYA 4P8WA 2AAMA 3IAPA 4AAJA 2BY0A 2ZWZA 4F0MA 2FQIA 8XIMA 1IE7C 5A94A 4UB9A 2ZVRA 4EPEC 1FH8A 4NZ1A 1GJUA 1G6CA 4FNRA 3XISA 4H4WA 2WNZA 3GNDA 5A6MA 1P0KA 3LZ3A 3PAJA 1F5ZA 4BF5A 2WMJA 2VGGA 3AIEA 1FTXA 1CT5A 2YZ5A 3SW6A 3WF0A 2DVUA 4IXHA 4J7RA 1EJTC 4P7OA 1F61A 2CHOA 2QCCA 5HDRA 3PTKA 3G77A 2XGBA 3E2SA 1H1NA 4QISA 5M17A 1KXTA 2CLLA 4C6DA 3ITCA 4GNVA 4NI3A 1SJDA 4QE1A 2JBMA 3AAMA 1HJVA 1I6NA 3T0DA 2XTKA 4R53A 2YFOA 1P5BA 4N2YA 4W93A 3W2KA 5JCKA 3HFYA 5AY7A 4KEMA 1MXDA 1RXOB 3C3UA 1ONWA 5AFDA 3QM3A 4NI8A 4MKNA 2FHBA 1KWGA 2E77A 2BASA 5JH2A 2WNWA 1IT8A 1CW2A 1OFEA 1RK5A 1HQTA 1VFHA 2HCVA 1MW3A 1US2A 3MMUA 2X16A 1WYIA 3KP0A 4A2RA 3MCMA 4XUGA 4GRSA 2FDMA 2VEIA 4N42A 2P1FA 1Q7QA 5XIAA 3NQFA 4LAKA 4N0RA 4KRTA 3EMZA 4H1ZA 1VFOA 4KESA 2DEPA 4S38A 4ORIA 4WSJA 5LIWX 5D2YA 2PF8A 1K8XA 1KCXA 3W7KA 2VELA 2X1RA 1CXFA 4HA1A 2CC0A 4US5D 1XLAA 3AJ7A 4QLKA 5EL1A 3TEVA 3GW0A 5TIMA 4PMVA 4CNSA 2Z6IA 1EA0A 4IHCA 1ZLPA 3UR5A 2UY2A 3C2YA 4GISA 2PTXA 3VVGA 1TTJA 3NA8A 2XIMA 5C7HA 4O1EA 3WD3A 4OIFA 4MYXA 1KCKA 3G1YA 1ZJAA 1BAGA 3LQLA 3N15A 4IMAA 2J9XA 2YXXA 4PRRA 1AUSL 4FEZA 1ONXA 4FR1A 3NVTA 1OC7A 2NV1A 2FPTA 3UWWA 4GKLA 3TQVA 1J96A 3NG3A 4AVOA 5IHSA 2WKJA 4UTKA 2O4MA 4NX0A 2PCEA 3ABQA 1YDOA 3DC8A 1UD2A 2WJDA 4ZO8A 2OMAA 1Q2RA 3NZRA 1CLVA 3MB9A 3AROA 3S42A 3OIHA 3BVJA 4GO8A 4MHBA 3MP3A 1KFWA 3BTNA 2VEGA 5MF5A 3WNNA 1OX5A 5KINA 4F66A 4XD3A 1EWDA 1JIBA 3E0FA 4M3PA 3WQPA 1A5LC 4HZMA 3IGHX 1Y65A 1K02A 2BGSA 1QI3A 1WKFA 1GEUA 4L64A 4KFPA 3K13A 4EKJA 3EX2A 2XN2A 1JGMA 3O3RA 4K68A 2YJQA 1W5NA 2ZQ0A 5I3GA 3KS5A 3VCRA 4ASTA 4CLMA 2J8GA 3LEPA 4AWUA 3C8FA 3CQJA 1ISXA 3G5EA 2BC0A 5A8GA 1JAKA 4B5SA 4REQB 4NAFA 3VNZA 4C6MA 3PWIA 3HZ3A 4DWSC 1QAPA 3QOMA 3PBWA 3URQA 3RXZA 4JNMA 4HU4A 4DHGA 1B3XA 1E51A 1LBMA 1I0BA 2F9RA 3KBJA 1V93A 5CC5A 2EG6A 2WMIB 1X1ZA 2Y85A 4JYDA 3NL5A 2OEJA 4RPPA 3URHA 3D3FA 1TWDA 1U1JA 4QHRA 1A5NC 1W1A1 1ALDA 1VJIA 1LJYA 3R11A 4PCPA 1ZAIA 3OVPA 2NUYA 3QXBA 1DQUA 4ATWA 1WYGA 5E0CA 4JIHA 3UWQA 3ZT5A 5D4YA 4HSOA 2DT2A 3NSMA 3STPA 2PWDA 3W01A 3VOJA 4XVDA 3I4KA 2DT3A 3BARA 1UR8A 3TJXA 1BYAA 3P61A 3P7YA 4W7WA 4KMQA 1EIXA 2GGIA 1VD6A 1UUOA 3CUFA 3AHVA 3WMLA 2G3NA 1UBSA 8CGTA 2C0AA 5BNKA 5FJPA 1OFDA 3L4VA 4IP5A 3VNYA 3KZPA 3R25A 1LOQA 3CJPA 2MNRA 1DHKA 2I5QA 3EYPA 3GAKA 1B9ZA 4CCDA 4UTHA 3WNPA 7CGTA 3U0HA 3WD2A 3MI3A 3F03K 4JIRA 2CEQA 5FAJA 2QJGA 3WL0A 2BGQA 3ZJ6A 2FMNA 3EXSA 3H2FA 4UR7A 3IV3A 1R3WA 4B5WA 4KEVA 2G4JA 2WZHA 3K30A 1YLVA 1H41A 3W7EA 2YL9A 3CQKA 1LT8A 4GY7A 4LAUA 4CD5A 3TTEA 4L4MA 3R0DA 2XSBA 4I5XA 3HGJA 2NZLA 4DM1A 1N61C 3UXIA 5LNVA 3NM1A 4OOUA 2DZVA 5TBOA 3ARTA 3CS2A 3W6MA 3IJIA 2NLYA 3V4BA 1A0EA 3MKCA 1J5SA 2ZA2A 2VP8A 3WQOA 3MBFA 4YNGA 4I9JA 4Y8EA 1Z44A 3MVTA 4CQDA 4F2BA 4NZCA 2X1SA 4TVCA 2VFFA 1CDGA 3WLTA 1RA0A 3M0HA 4EQSA 1X6LA 1JG9A 3GDMA 1TCMA 1YNQA 3BLFA 3D9XA 5CC6A 3P74A 3EXRA 3F5KA 5CGTA 2DQWA 5GNZA 4W8AA 1VFTA 5E09A 4J3XA 4AWSA 4QGCA 3TSDA 2X1IA 2ALRA 4KT2A 1A5CA 2OYLA 5A6BD 3ITXA 3WK2A 5FL0A 5DXXA 4I3GA 3ZJ7A 2CLIA 1T8XA 5JBEA 3DJJA 1PKLA 5I07A 4OHQA 4G7EA 3UA3A 5EGRA 2DSZA 4CU6A 1TG7A 4V15A 2A3BA 4GLEA 4G8TA 3QFEA 4M6QA 3SADA 1X2HA 4GBDA 1KA9F 2BVDA 3S6TA 1TE1A 1GVSA 4N9CA 4ENLA 1TCDA 3Q37A 2RUSA 1A5AA 1S3TC 1VC4A 4HJFA 3KWXA 3V75A 3CASA 4HVXA 2EHHA 4LW7A 2BC1A 3A4JA 3N4FA 1QPNA 2UWFA 4LTSA 4WKHA 2PDQA 4HHHA 2FIQA 1HX0A 1FCQA 4EVZA 1UJPA 1X39A 1EZWA 4DVOA 3GZ3A 2NQHA 4MKSA 2XZ9A 3QHOA 2DZXA 2P50A 2IS7A 1IEWA 1C93A 2Y7EA 3BV4A 4IWWA 1HT6A 1KNWA 1WPCA 4AUBA 1AMYA 1FWAC 2YCIX 4M80A 1UPMB 4UQCA 1E72M 1M53A 4C6OA 4AD2A 1RUSA 3ALGA 1S46A 1OGGA 4IZGA 1E71M 4DF1A 3PC0A 4YS1A 4YJ5A 2WW5A 2H9AB 3POCA 3ZZ1A 1SFSA 3ERPA 4IH3A 2EQ6A 2G0WA 2WO5A 3AZTA 3W71A 2NSOA 2W66A 4WUIA 3ABRA 3FGCA 3MSRA 1E1CB 1IIGA 2V67A 2BSLA 5HJLA 3II4A 3E1F1 2HISA 1CXLA 4YMZA 4JS3A 1CXHA 4OBTA 4UOQA 1E3XA 1K6WA 2HWGA 3ARUA 4XZ9A 3MA8A 4YXGA 4DUXA 3UXLA 3WQDA 4NKCA 4LRTA 4MAZA 3BG9A 1NIUA 1TRIA 1XIHA 1DXEA 3BMXA 3TFCA 4MIMA 1DORA 1S5VA 2CBJA 1EGVA 3GU1A 1FWGC 3T8QA 2XINA 5AHMA 1Q7MA 2VKZG 1F05A 2PTDA 1UKQA 3JZEA 4XBKA 1XIMA 3SQPA 4V2XA 2TAAA 4LT9A 3H22A 5I03A 3CQ0A 3W2NA 1B3ZA 1P0NA 1XYMA 2W9MA 5CXPA 1WZAA 3N2TA 3QFAA 1XLGA 5D8WA 3VM5A 4Z0SA 1EDGA 2XH4A 3WX7A 4OJYA 4MB1A 1GUVA 4TX9A 5F1UA 3BZGA 1PHQA 3UWVA 1ZS2A 1RPXA 1H5YA 1K9EA 1TELA 3CAQA 1FHLA 3WK1A 5E0FA 4KGLA 2OR2A 1K70A 1DJYA 2PEVA 2FGLA 4KS0A 3VA8A 3SSJA 4NASA 1HUVA 4ZCWA 2FZDA 3MTWA 4DLFA 4ICCX 1AL8A 1WZMA 3SRKA 3BMWA 4AZ6A 4S2CA 3CQIA 4OKDA 3AXMA 1H7WA 2ZZBA 1E9IA 2OQHA 3P93A 2OZ0A 2PWFA 3E2QA 2BHYA 1EBHA 1CPUA 1R6WA 1A49A 2EBNA 1QI5A 1RPKA 1X8FA 4XIAA 3A7RA 3DG6A 2WJEA 3RYSA 2NQZA 1O1HA 3H4WA 2FFCA 1CYGA 3GHUA 3TTQA 2DVXA 2EJ1A 3GVGA 1XR2A 3PB0A 4X2RA 1QI4A 4UTMA 4AD4A 5A6SA 4WCJA 1PZ2A 4NJIA 1M3UA 5D32A 3WUGA 4ZSUA 2QR6A 4F4RA 4JIQA 4H9MA 1KBKA 3O8AA 3LHZA 3M5YA 4JCMA 3NQBA 4GX8A 1QNRA 1W9BM 3K1GA 3PTDA 3WLPA 2GQWA 2EPOA 3NL2A 1RCQA 4Y9AA 4GC4A 1GOXA 1C3FA 3U57A 2EJAA 1UOZA 1TVPA 2NX1A 4D8LA 3NSXA 3CYVA 1OGSA 2OKOA 2R9RA 4KCWA 3BSHA 1V79A 3HV8A 1JDEA 4PYSA 4EANA 1W3KA 4UXDA 3SUWA 4JKLA 4D6GA 2ZWYA 3UERA 3MKKA 4F9JA 1GREA 3N12A 2TODA 3C2RA 1UR0A 4HU8A 5PTDA 4K1GA 1FEAA 4WZHA 2H6RA 4WOZA 3N2OA 4YL2A 3M0MA 4TVYA 2YPIA 5EFFA 1JNDA 4B9ZA 3LGGA 3WKZA 4JPGA 4IPPA 2OB3A 3EDJA 1TTIA 3QZAA 3W1XA 1KM4A 4XB3A 2RFGA 2WXDM 3WO8A 3IIPA 3V35A 4KRZA 2DUXA 3HMCA 3WFZA 5E93A 2IUZA 2QHAA 1SZFA 3AISA 1E70M 3A64A 2DFAA 4IQDA 2OGJA 2QVNA 5KMYA 1KC7A 1RHCA 1CGTA 2L5HA 2VGFA 4L4LA 3RG6A 2YGYA 5F7UA 3M44A 4KWUA 3GXTA 1GKPA 1W5MA 1RALA 4WVXA 3CWHA 3ZOAA 4QJ5B 2EKGA 2HZGA 4ERAA 4YHEA 1F76A 1QI2A 3NL3A 4UMAA 2QULA 1QWGA 3AIUA 3E2RA 4D8ZA 4J5NA 1RVGA 4O0KA 5EMJA 4IQJA 3LPFA 2GDQA 2INFA 4GOAA 1M6IA 5LYRA 2VZTA 5A2CA 3QPZA 1BRLA 1ESWA 1GVRA 4UTTA 1HIZA 3PSWA 4GUFA 1V77A 2DQXA 3CLWA 3KTSA 5ER0A 4YTQA 3ZT6A 4U3AA 3HN3A 2X30A 1FWBC 1I9CB 2QMJA 3G24A 2CIPA 3OQEA 3IVUA 3FJ6A 4Z1AA 5D03A 2CZVA 1GRAA 4MAVA 1B3VA 1AVAA 1JDCA 1R2RA 4BI6A 1R3RA 2VGBA 4JFWA 4RPQA 3HGRA 1W5OA 4DELA 2X2GA 1UH3A 4GE8A 3N2MA 4ERGA 5AHFA 4PTWA 1MRQA 2ZTJA 1JDFA 1F7BA 1PX8A 2VXNA 1NTHA 1Q7ZA 1N62C 3JUGA 3NVWB 1TV5A 3O6DA 1T7LA 1VAHA 3CZKA 4F40A 1ZALA 2NLIA 4LV9A 4EQRA 3IGSA 3OG3A 1S5WA 1WP6A 5EKYA 1Z6KA 1OSEA 3ES8A 3I10A 4W8LA 1WV2A 5D2XA 1JXJA 1XBVA 4A29A 1T40A 5ABTA 4IGSA 3S47A 1F4AA 1NFPA 3VIFA 4LYRA 1GESA 3OHIA 2PODA 3SFWA 3MDUA 3TTYA 5LA2A 3RPMA 2UZ9A 3A12A 3UCDA 3NS1B 1FXQA 3VZZA 1EDQA 3UZWA 4XKYB 1JZ8A 2OG9A 3MVIA 1IXNA 3NZQA 4UTLA 4E4UA 1EPVA 1UZDA 2YW3A 2R8WA 3GHTA 2E1DA 2QQ6A 1OG0A 2HQAA 3VCCA 1BWVA 1V3LA 2DUAA 3UWYA 3W85A 1Z89A 5AHNA 2UY5A 3D46A 1MZHA 1XCXA 2PUZA 3H2EA 7REQA 3BG5A 1PKYA 2DIJA 4W7UA 4LV4A 2J77A 5EBUA 3DBNA 2ZZ5A 2Y8UA 5HUOA 1ODUA 3LBOA 1R30A 3OQ8A 4DJDD 2XIBA 4HPHA 3SCRA 1MQPA 3U2EA 4MNLA 5LSMA 3W28A 1F3TA 1FOBA 5JUVA 3WLSA 3CL8A 2O56A 3UG8A 1EF2A 2G3FA 4YIWA 4QM1A 3KTCA 4I6KA 4FX9A 4G7EB 5TNVA 1AK5A 4KIEA 3DJGX 2ANUA 4QJ4B 3W1TA 2VRQA 1AW1A 1UQYA 4ZO9A 1WXZA 5EU9A 4DXXA 1XRSA 4O53A 2BOGX 4O1AA 2I5IA 4FP1A 4GYPC 3STFA 2V3FA 4CNOA 3E0IA 1DJHA 1XCWA 1BZLA 3V18A 4DWSB 4H6RA 4O1FA 5F2MA 3IUDA 3W7QA 1K4HA 4WF7A 1H7PA 2V3GA 3DKLA 3U9IA 2XU2A 3OLEA 4ZTYA 1B1YA 1TREA 5DT5A 3AUOA 2Q8ZA 3ES7A 4R7JA 4PEEA 3R5EA 1AH0A 4P61A 5HBFA 1OIMA 5TF0A 4F0KA 4Q8TA 4AW7A 4O12A 2XFYA 3NZPA 1M1BA 1VBGA 3IRDA 2NXHA 2WC7A 2V6OA 1NF0A 5MKGB 5G2HA 4P7QA 3BW2A 4JN8A 2DZAA 3WIJA 3K8KA 4LALA 2AL2A 3W25A 1U5VA 1EPXA 4V27A 2NW0A 4D6HA 1RLCL 3FVMA 1D7FA 2X8RA 2WZMA 4ZOAA 4C5YA 3EWCA 1S2WA 2J8FA 1QK0A 5LA0A 3UVIA 3WQVA 1TUXA 3DG7A 4LH8A 1YPFA 4I5UA 4LUJA 4K38A 3DC0A 4GI8A 4DYKA 3ME3A 2ZZ1A 2IKJA 4Z2HA 4RNJA 3TW6A 1P1MA 3A4WA 3N4EA 1GYLA 1FHDA 3D47A 1E0UA 1JCLA 1VYSX 4BQ3A 4CQ8A 1VHNA 1W8GA 1W91A 2GZXA 4O16A 2V30A 3FGCB 1CXKA 3ZM8A 2HXUA 1JYNA 2YCEA 3BXWA 2X8HA 1A3HA 4XAZA 4ZMGA 5E70A 3H54A 3L12A 1HFBA 3H70A 4IPJA 4XTDA 2WZIA 1CGVA 5ECVA 1F6YA 4B9YA 1FKXA 3H53A 4UUIA 4RDYA 3FK4A 3N9SA 3OZMA 2WP6A 3EA2A 3WQCA 3OBEA 5AKQA 5GQBA 5G5GB 3H8AA 3IIZA 3W4RA 1F3XA 3MZNA 4QE4A 4IL0A 4YTUA 2B31A 3R10A 4US6A 3RM4A 1TIWA 4JTTA 1W1YA 4DBSA 3OVQA 3B03A 4WDXA 2PDHA 4G56A 1U22A 1Q66A 4GQ0A 1VYPX 2O92A 2CXGA 3FJ4A 3USBA 1CTNA 1C90A 4CNUA 3RLUA 2CHRA 9XIMA 3M4HA 3T07A 2FZBA 3T2QA 1SU5A 3HGOA 3MV01 1TMQA 3R79A 3PZUA 3G0UA 5I3KA 3TA6A 4TTGA 3FW6A 4OQVA 2QAPA 4K6AA 1GG0A 2VR4A 3TR2A 4L1WA 3V1HA 4F0LA 3RCMA 2JFEX 5REQB 1L9WA 3A5FA 1K6AA 3DYMA 1C91A 3WG6A 3WMCA 3NPVA 2AMXA 1QBBA 1DJNA 2ZE3A 5A6TC 5I3IA 4EPKA 3M0LA 2ISVA 2WKLA 3BPWA 1MOKA 2CETA 2VC5A 4H9YA 3ITYA 3N1AA 1R9YA 3CTLA 1FWRA 3TYCA 4DWSD 3RAOA 1GVFA 1UD4A 4GX9A 3AYVA 5J5DA 2QF8A 1H1YA 4B92A 4PMQA 1UCWA 2ZXBA 3GXMA 2Z7KA 4M19A 1YQZA 4RE0A 1S2UA 2QJIA 5C6MA 4GI9A 1PIFA 1UJQA 1IWAA 3DFYA 5FF4A 3IJ6A 1PBGA 2DIKA 3LGEA 2PLKA 3LCIA 3V1PA 4LC6A 5AHEA 3DUGA 4IF2A 2VQUA 2GFTA 4M8UA 2MANA 4MJ2A 4IP7A 3QF0A 1DYSA 3P60A 5FCZA 2E3TA 4FLQA 1J8VA 1XDJA 3UZZA 1W1PA 3CGEA 5FA5A 2ACUA 5AC5A 1V97A 1E43A 3T2OA 3AICA 3GDKA 5HPCA 3E9AA 4KEUA 1NWTA 1T96A 1PCWA 2VYOA 3FA3A 3TCEA 4O1BA 1GXFA 3G6LA 1V6TA 3N11A 3TN3A 3QSTA 2CLPA 3SRFA 2P0OA 3WCZA 3GS6A 1T5AA 4NZ3A 2ISDA 3S2MA 4JDYA 2ATMA 1J0IA 4GVHA 2G95A 2CDUA 1TSIA 4AIBA 4H50A 1H51A 1F74A 1I8JA 5D33A 1SZGA 5HMEA 2TSYA 1UWIA 3AC0A 1B31A 1MO9A 1M68A 4MMWA 3R43A 4JD4A 4YTTA 5AZ0A 1W2VA 1IWPA 2G3JA 1OJTA 1KTCA 3RO6A 4R27A 2KZHA 3B8SA 1ZMCA 3TYUA 3QEZA 4K36A 1D8CA 2BV9A 3RIKA 3VOCA 4QX4A 1SSGA 3B8DA 3QTPA 1OT2A 4QLLA 3VFCA 3GNXA 3TFXA 3KBMA 4JQ1A 2BGNE 3MSYA 5CZKA 4A6GA 4NG3A 3IGXA 1BXNA 4JGDA 2A3AA 4XAFA 3LTPA 1YKWA 2GR3A 2HNEA 2D22A 4ZOCA 1AQFA 4QS5A 3W7IA 3LD5A 2OZ3A 3IJQA 1UWRA 3WMBA 3WJSA 3LMYA 5LNWA 3OPSA 1VLIA 4XD4A 1F3PA 4JQ3A 4Z1BA 1N82A 1VENA 3S6OA 3GG7A 5F2GA 5CPTA 1V3KA 2A2IA 5LHEA 2E4TA 3P0WA 1EJSC 3I4EA 1I1WA 3MUCA 1MXSA 3GBDA 1YBQA 3AS0A 4PA8A 1A5SA 4PMZA 3OODA 3FHAA 3DHUA 3EX4A 1A5UA 5ABFB 3EOUA 4IPLA 3WQWA 1SMAA 3RR1A 1ENUA 1PZ3A 3A5VA 1O5RA 1ISZA 4IM4A 3SGGA 1M7XA 3KWSA 1L2UA 4FNSA 1PEZA 2Y7DA 1WKYA 4I5RA 1TKKA 1V3MA 3HF3A 2WPCA 4KPLA 3KS6A 5FESA 3ARQA 3LXDA 1F73A 4DJFA 4D72A 2PDNA 2HNHA 4J1OA 1G67A 4MG4A 3OA3A 5HMSA 3LBMA 3HGSA 5F4XA 2NWSA 4EQWA 3GU9A 1OF6A 3GW3A 3TTOA 2V3BA 2Z29A 3ABOA 5I23A 1ZX9A 4AX6A 1CGWA 1KTNA 3PNZA 4JTUA 2A6NA 4C7DA 4UZSA 5FAGA 4HNOA 1PKNA 4IX0A 3W7DA 2VCCA 2A3CA 2ABAA 3EA1A 2J78A 3CV1A 2A1YA 1OFRA 1UKTA 5G1MA 1N7KA 4QNEA 3ZVHA 3PZQA 3CPRA 3A47A 5I3FA 1ADDA 3C2FA 2FMOA 3U8GA 1QOXA 1TPWA 3OIXA 4IUGA 5FJIA 4EMIA 3WUFA 1EUAA 5BRQA 4UR9A 4BI7A 1XKJA 4UFKA 1H1ZA 1U1HA 4JTSA 1AZ1A 2E0PA 4KCVA 3R12A 4EXQA 3WQ5A 3SN4A 2JK6A 4IGMA 3CGTA 2NT1A 3PN8A 3IUHA 2PBOA 2IKGA 2OOGA 4IG2B 3LM7A 4GJIA 2ZUWA 3CUXA 3O05A 3QJAA 2Y88A 3B8VA 2QUUA 3VKCA 4KFOA 2GJXB 2X0SA 4A35A 4B2DD 1EFZA 4ZGYA 3EDDA 1IGWA 3GVQA 1I4NA 3N34A 4NEWA 2CYGA 1YNYA 4O57A 3G2GA 2B4GA 2Z2AA 3W6YA 2VOMA 4A8LA 2DIEA 1E6NA 2P53A 2TRSA 1SFLA 1JPIA 5HULA 3SCSA 1K8YA 1X7IA 3QFWA 3GK0A 2G4FA 3WELA 2GQ9A 2E9MA 4AZBA 4B15A 2C3ZA 5JIPA 2FPYA 4Q4MA 1UMYA 3RLVA 2IKIA 1KO0A 2FVMA 5DCEA 3IJ8A 2V38A 3VMOA 2VD8A 2QUMA 2W6RA 2YSWA 4LVFA 4DB7A 4YYCA 1ZK7A 3OGVA 1AQHA 4P8UA 3WNLA 2VWSA 4HN4A 1QT1A 3GD6A 1QHOA 1LT7A 4BQ4A 4L1XA 4JEJA 5HMDA 2D24A 3NQ8A 4FO4A 3VAVA 1WKDA 4MPQA 3CGCA 4PL2A 1NARA 1VDVA 2X7VA 3L4TA 3BAXA 3P8IA 5I0DA 1G4SA 2BVTA 1P4CA 1GZGA 3DK8A 2A79A 1F3WA 1XLLA 5M1TA 3ARVA 3KRBA 4R7OA 4ES4A 3RX3A 1XFBA 3GYEA 4HOXA 3SCPA 2EQ9A 1Q4WA 1VR6A 3MC5A 2XFRA 2ZVIA 1MUMA 1J6OA 1J01A 3W27A 4IIBA 4RZ4A 3RM9A 3L65A 4J3VA 3THUA 1EP3A 1ZY8A 3BAKA 4HZ6A 1J6PA 3F1QA 4OBSA 4PUDA 4I9TA 4YCOA 2FVKA 2WHLA 4AHPA 2VCBA 4K8GA 1ZZMA 4XBSA 4CKQA 3CV2A 1V3JA 4CD7A 1J0JA 3G1DA 3LENA 2KX9A 3REQA 1RLDA 4J9JA 3CEUA 1LVLA 1NHPA 3R07C 5LNSA 1KM6A 3FA5A 1F07A 2BHUA 3HG4A 5EMKA 4WJEA 4DNAA 2W55A 3QZ6A 3GSMA 3OHMB 4IMFA 3MMDA 2PF0A 4JIIX 5LXEA 5BW6A 1VFFA 3CPGA 3GDRA 4ADSA 2PZNA 2REQB 5A8OA 1XX1A 1FH7A 1WDQA 1PVNA 3PZVA 3EX1A 4Z2LA 3ARXA 4S23A 3UCQA 3ZIZA 2EAWA 2GRTA 1X7FA 2X1TA 2Z2UA 4KQNA 4Z2IA 2DGAA 2R9ZA 1JPDX 2YFNA 2D20A 1EQPA 1JZ4A 3E12A 4U2YA 4HU0A 4HNCA 4YVVA 4UTUA 2ZX9A 4Q7IA 2BXVA 3W2UA 3C0QA 1LOLA 1ICPA 4Y9OA 1GPWA 1XKYA 1PYFA 2YXGA 3U3HA 5H8UA 2GDUA 1U30A 1FFRA 1TMLA 3BCDA 4GWEA 4X0VA 1XIFA 3QR3A 3FNDA 1Q6FA 1FCBA 3TQPA 3W81A 2I16A 2ACQA 3IVSA 1AW2A 1GG1A 2C18A 4ZFCA 1JZ2A 3TUUA 2PWHA 5K3VA 4ATLA 1Q13A 3MUXA 4PUEA 1BFNA 4XG1A 4H9ZA 1MW1A 1S2VA 4M56A 2PZ0A 3GD3A 3FHQA 3W87A 1EGZA 1T6MA 4L56A 4EXBA 4DO6A 2A5HA 3VKDA 5CC3A 1QVBA 1BWCA 2J7HA 5U1OA 1BGAA 4MFEA 4LCSA 3RCNA 3GH7A 5KETA 1V6XA 4HYVA 3KXQA 1VH7A 2TPRA 4YWOA 3E02A 1H0GA 1NOWA 1V03A 2PS2A 4JYFA 3AMZA 3AWOA 1EHAA 3DI0A 3JU2A 4NRRA 1LLOA 2X40A 3GTIA 3JS3A 5BOEA 3NYDA 1L2QA 3ATYA 3BLIA 3WQ4A 2WBGA 1TZ9A 3O06A 3PAOA 4Q4KA 3DFHA 1ZRQA 3GTXA 4O54A 5FEXA 3NPWA 4HZ8A 3GU2A 1PE1A 4HU3A 3W7PA 4ZQPA 1UKPA 3HRDC 3NNTA 3W7CA 2O9TA 3NGJA 4PR4A 3PM6A 3W7JA 1MW0A 2XG9A 1DV7A 1PSCA 2GQAA 1K9DA 4CGTA 3OZPA 2J7BA 4IMEA 1XBYA 4AZCB 2Z1KA 3UJSA 3ARRA 3KCOA 3QZEA 4WIWA 1R2SA 1R9ZA 3VKKA 2F6KA 2WWDA 3FS2A 4DO5A 1JQVA 1LF1A 4B5TA 3BLPX 5BXTA 3HJZA 5IFTA 4HCDA 1IYXA 4PSRA 4JFTA 4S3GA 3TSBA 1LLWA 2DDXA 3WLLA 4Q8PA 1XUZA 1AJ2A 2YBVA 5IOBA 4MNJA 5DANA 1IF2A 1ZAHA 4GY1A 1LG1A 4UFIA 3ENLA 4GGBA 1B4EA 2XDFA 4WSKA 3THDA 2ZRWA 2XZ7A 4QEHA 3ONBA 1L6GA 4B4FA 1J2WA 3IACA 2BG5A 3CHVA 2YXOA 3BO9A 3CLMA 3T0BA 3L5LA 3PK7A 1XLIA 5DX7A 2IPWA 1N8FA 1WDPA 2B81A 4RNIA 2HDJA 4JIPA 3GB6A 5LHFA 1Q6GA 2NUXA 5F2IA 2YX0A 1AD1A 4YTSA 1KBJA 4HTBA 4A3RA 1RAKA 2EG7A 1FCVA 4PMUA 3FV9A 4C1NB 3EWYA 1PWLA 3UPWA 4PCNA 5HNRA 1C8YA 3FA4A 3UETA 5HJXA 4DM2A 3IAQA 2CBUA 3QC3A 2YZRA 4MLRA 3U2ZA 1UUQA 4WR3A 3C2EA 5E9XA 1XSJA 2BTMA 4BA0A 3KBVA 1BXBA 1JEHA 4RCXA 4FXRA 4LVBA 4NXKA 4GO9A 5C9UA 2WSRA 2WPBA 4I8DA 2ZZ3A 2H3DA 1K9FA 2C91A 3B4UA 5JRBA 3WDJA 2NPXA 1ONEA 5B7ZA 2J7GA 3TZFA 2QCHA 1UWUA 4CQCA 1SYTA 4Z2GA