3JVAA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
molecule keywords Dipeptide Epimerase
molecule tags Isomerase
source organism Enterococcus faecalis v583
total genus 121
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jvaA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jvaA01
2OX4A 2OPJA 3PWGA 5FJTA 3GY1A 3K1GA 3R10A 3NZGA 4GYPC 3U9IA 3TWAA 5FJRA 1EC7A 2PSNA 1DTNA 1PDYA 2P3ZA 1JCTA 3NXLA 3RITA 2HNEA 4FI4A 3P0WA 3ZVHB 3S47A 3ZLHA 2O56A 1R0MA 1JDFA 4H1ZA 4J3ZA 2PS2A 2PP3A 2P88A 4M0XA 2GGGA 4GISA 2P8BA 4K2SA 4ENLA 3I6TA 4KWSA 2NQLA 2QJNA 3H70A 3RRAA 2QJMA 2OZTA 3MKCA 3DEQA 3JZUA 2HXUA 4E8GA 2AL2B 2PU0A 4IP5A 4KEMA 4H2HA 3B97A 3EEZA 3JW7A 3DG6A 4G8TA 3DIPA 4J1OA 1WUFA 3UJ2A 3GC2A 3ENLA 2GSHA 5ENLA 3RR1A 5BOFA 3VDGA 2QQ6A 3UXLA 2PP0A 1EBHA 1EC8A 3Q45A 2GDQA 3MSYA 2PTWA 1P48A 1KCZA 4K8GA 3THUA 3ZLGA 2PGEA 3UJSA 3OZMA 1FHUA 3KUMA 3DESA 3QLDA 1XPYA 3SJNA 1ECQA 3BOXA 1PDZA 3P3BA 3TW9A 3QKEA 3IK4A 2XH2A 5FJOA 2HZGA 4Z1YA 4EWJA 3UXKA 1BKHA 3RO6A 2XSXA 4KPLA 3UCDA 4JHMA 1KD0A 3V4BA 4YWSA 3Q4DA 3QN3A 4FP1A 3FYYA 2OO6A 1ONEA 3N4EA 3R11A 1KKRA 3MQTA 3PK7A 2PPGA 5EU9A 3UJFA 4IZGA 4IHCA 1EC9A 3SQSA 1MDLA 3DERA 3OW1A 3QPEA 4HN8A 4K1WA 1L8PA 3T4WA 3MZNA 2GGJA 2OZ8A 1BQGA 1OEPA 4HPNA 3IJLA 2GGIA 2PTZA 3DFHA 3JVAA 4HNCA 2PP1A 3CAWA 4DWDA 3IJQA 5BOEA 4GYPA 3SN4A 2I5QA 2MUCA 4F4RA 4DHGA 4GGHA 3D46A 3ZVHA 3EKGA 1IYXA 4HYRA 3CYJA 3N4FA 3RCYA 4G7FA 3R25A 3UJRA 3V3WA 3FXGA 4GMEA 1TZZA 1MRAA 1P43A 2DW6A 3R1ZA 2GL5A 3FVDA 2P0IA 3GO2A 4HCHA 1RVKA 2XGZA 2OLAA 4M6UA 2AKMA 4A3RA 1TKKA 1JPMA 4A6GA 3NFUA 3P93A 3V5FA 1SJDA 3R0KA 3PWIA 2AL2A 4JN8A 2OVLA 2PTYA 4GFIA 2QDDA 4DXKA 4GGBA 7ENLA 3RGTA 2PA6A 2XH0A 1SJBA 3MWCA 4IL0A 3N6HA 2GGHA 3OZYA 3OP2A 1JPDX 1ELSA 3TOYA 2RDXA 2POZA 3CT2A 4HCDA 3IJIA 3DFYA 2OQHA 3SN0A 1XS2A 3DDMA 3FV9A 3FCPA 1SJCA 3S5SA 5J04A 3BJSA 4GIRA 2OFJA 1FHVA 3H8AA 3TJ4A 2QVHA 4IP4A 3VCCA 4ZA0A 2P8CA 2QDEA 2XH7A 5FJUA 3TTEA 4E4UA 2ZC8A 3TQPA 3ZVIA 1E9IA 2MNRA 1W6TA 3UGVA 2PGWA 5FJPA 4H19A 3SBFA 3I4KA 3T6CA 3H7VA 2QGYA 2GGEA 4X2PA 3N6JA 3ZLFA 3UJEA 3D47A 4MGGA 2ONEA 1KKOA 1EBGA 3SSZA 2PTXA 3CK5A 3MUCA 1MUCA 4IT1A 1MNSA 2OKTA 2PODA 3TWBA 3VC6A 5IDZA 3GD6A 3VA8A 4JN7A 4DX3A 2FYMA 4DYEA 4Z17A 1NELA 6ENLA 3CB3A 2XH4A 3QTPA 4KT2A 3OPSA 3STPA 2HXTA 1MDRA 4MKSA 2CHRA 4HCLA 4DN1A 3V5CA 2PU1A 3VFCA 3ES7A 3TCSA 4E6MA 1F9CA 3NO1A 4ZCWA 3DG7A 4A35A 2AKZA 2OZ3A 3UCCA 3H12A 1SJAA 3VC5A 2DW7A 1WUEA 2OG9A 1TE6A 1YEYA 3OTRA 3T9PA 2PCEA 4H83A 1NU5A 2QJJA 3U4FA 3T8QA 4E5TA 2AL1A 2OQYA 3TJIA 4ROPA 1R6WA 3MY9A 3R0UA 3VCNA 4HNLA 2FKPA 4MMWA 2ZADA 3FJ4A 4IL2A 3ES8A 3HPFA 2PMQA 3CXOA 3DG3A 3PFRA 3DGBA 3I6EA 4E4FA 3SN1A 3BSMA
chains in the Genus database with same CATH superfamily
3VKKA 2I17A 4MWAB 4UFMA 3CL7A 4PB3A 3T0TA 1SW3A 4Z0SA 4LVGA 1NOFA 1EJTC 3K5XA 1AL8A 2NQZA 1R9YA 3MTWA 1ZXIC 3WQ8A 1RY0A 1P6WA 5H8MA 3ZVHB 1RR2A 2TYSA 2VCCA 1MOKA 2FQIA 3SR6B 4IJBA 1FWWA 1A5UA 3EWWA 3WD3A 1B4KA 3L0KA 1MW0A 3AIUA 2OMAA 1T0OA 4K2SA 3N2BA 4KWVA 2C3CA 5DMMA 4FNTA 3L4UA 1CGYA 4JKMA 2NQLA 3USZA 3WQWA 2WC3A 2QJMA 3HM7A 4ORIA 1RP8A 2WZIA 3SGUA 4UTHA 4HN4A 2AL2B 4Q8QA 1VBHA 3GNDA 4W9TA 2XN1A 4S2CA 3CUXA 1R3SA 2Q02A 1REQA 1E6XM 2HE5A 2Y70A 3DYPA 3G1SA 4BI6A 3LBCA 4PMZA 3PULA 3IJDA 3UJ2A 3LDVA 1XLKA 7XIMA 3F4NA 4S39A 3UXLA 4AZ5A 4AW7A 2BTMA 2FVLA 4JTTA 3LXAA 2WXDM 4JTHA 4C6CA 4ZSTA 3MV11 4NAEA 3MUZ1 1CT5A 3FJ6A 3PZQA 1F4AA 1I2QA 1C3FA 3QLDA 1NF7A 3HJEA 4EOUA 4CKQA 3SJ3A 2POTA 2PDLA 3LMZA 4CQAA 1TWSA 3URHA 4BQ3A 4TMBA 4IPPA 5HMSA 1R8LA 3IRSA 2XH2A 2WVVA 4AHOA 4Y96A 4DXXA 4E3TA 1IGSA 3GKAA 4S1FA 2JFEX 7PTDA 3G1DA 3DFNA 3CGCA 3V4BA 4HPGA 2HPMA 4P7NA 2X99A 3S2NA 2H6RA 1XRFA 1UYQA 2DH3A 2OO6A 3U4AA 1HKWA 3NQ8A 4EQRA 3FW6A 3AZRA 2XIMA 5C8BB 3A23A 4KEUA 3SW6A 1YPFA 1J01A 5KVHA 4IHCA 3L2IA 2X8GA 1KGUA 5C9RA 4LUJA 3CWHA 3QPEA 5ABTA 3LNPA 4M81A 1KRCC 5AY7A 4ZQPA 3CXBA 1WYIA 3PBUA 1F8IA 3UP8A 3LGEA 2J8TA 2GQAA 1E4MM 1TIMA 1TPC1 1V77A 4GNVA 3PG6A 1WDQA 4A4AA 1XHGA 2ZUNA 5EMMA 3LX9A 4M6VA 3QQWA 3W82A 4BWLA 4LVDA 1GGOA 1NEYA 4YU1A 3QGKC 5AHNA 4JOMA 1EA9C 1IYXA 4AXNA 2ZTKA 3APGA 4GINA 3AICA 3R25A 4PB4A 2XJ7A 1U22A 5CLTA 4OUEA 2W54A 1AQHA 4UMAA 1AODA 3RPDA 1A5AA 1OFBA 3UR2A 3LADA 3LBMA 2P0IA 1ZMDA 4LIIA 1J4EA 5C55A 4XKYA 4V33A 8CGTA 1OZQA 3WLMA 3G6LA 4XSMA 3JS3A 3N18A 4N0RA 4ECLA 3OHMB 4Q4SA 4WGXA 1XIDA 3GG1A 3UG8A 2ZZBA 5A8NA 2IKHA 1FWNA 4ZOCA 3S6TA 3G3MA 6PTDA 3WF0A 2BASA 3W2LA 1PWMA 3GC5A 4XWUA 3MDWA 1QI5A 3KBVA 4F48A 4DY1A 4S3JA 1ELSA 4WY0F 1RSCA 2EKGA 3BJFA 1A5KC 4FEZA 4E2VA 3MYOA 3MCOA 3KS6A 1TPDA 4LBUA 1HQTA 1YDYA 3VD4A 4GBUA 1JDEA 4Y9MA 5CPTA 3ITYA 3MUAA 3PB2A 3C2EA 4UNIA 1H50A 4PRWA 3W1QA 1Q6CA 4W5UA 1B9BA 4AWEA 2VMFA 4MSSA 2J47A 1RCQA 1W37A 4CNTA 3BSHA 1S2VA 5FEPA 4JZ5A 3B0PA 1DE5A 3SQPA 1E9IA 3VDAA 4NX5A 1ECEA 5ABGA 5A8PA 5U1OA 4M5PA 1R2TA 1G9HA 3ABSA 4OQVA 3DK4A 5AC4A 3QC0A 3WLIA 5AN7A 3TJLA 3W7OA 4AD1A 4PB5A 3AS2A 2VFGA 2AQVA 1XBYA 1NHSA 3L7RA 4IQEA 3ZXWA 2ZDSA 3HGJA 1TG7A 5BRQA 3RF9A 2Q3RA 1TYGA 3ELFA 2OKTA 1MWOA 1Z7AA 4QRNA 3TWBA 4ORMA 1VFHA 3PZVA 1PX4A 4TOQA 4XG1A 4I9JA 3GHSA 1X39A 5EMJA 4AHPA 3DUGA 2YXGA 1MEIA 2OOFA 4QLJA 1OCJA 4RE0A 2ICSA 2DORA 3G6MA 2GRTA 3PZUA 3CQKA 1TZ9A 1GOQA 2PAJA 3A4XA 1UWSA 3IIZA 3RDKA 1TPFA 2CLIA 3W7LA 5TQLA 2ZX7A 5DY2A 2VOTA 1AMKA 3QMTA 4L9YA 4LV4A 4ZCWA 3SI9A 4HHMA 5FL0A 2HV5A 4HPJA 5LKYA 4A35A 4TX8A 1H1YA 2FMNA 4R7OA 3VZYA 2GWGA 2E77A 2QMJA 4O1AA 1LP6A 2OG9A 3QKZA 1XSJA 3ZYZA 3R13A 2V3GA 1ZQ5A 3LG3A 4E5TA 3MBDA 5DRIA 1OYCA 3W01A 1GOWA 4A22A 4ROPA 3VCNA 3ARZA 2JE8A 1XX1A 1YXYA 3CQHA 1SFTA 3WLJA 1K7EA 2QZRA 4XZNX 4EAYA 4GO8A 1OINA 3ES8A 1XIFA 3U5YA 1K8XA 3URBA 1BEUA 3OBKA 5HMDA 3CUHA 4DJFD 2WPBA 1ISXA 1K03A 3SCSA 3VGEA 4V28A 2BGQA 1BHGA 4DBUA 3R10A 1PYMA 4GQQA 3A7RA 4DBWA 1FCQA 4O11A 2XVLA 3F03K 2DT1A 2ZWYA 2WC4A 1XBXA 1JRCA 1I9CB 1VD6A 2XZ7A 3APYA 1X7IA 3FK4A 3S3GA 3L5MA 2QVNA 5BROA 1K7XA 2WCGA 5F2GA 3E74A 5BNKA 3E1F1 1X6NA 1TPVA 2BY3A 4HHLA 3TXVA 1DNCA 3DC8A 1KN0A 4AH7A 5CC6A 3WY1A 2Q01A 4KWSA 3AU2A 3PPCA 7REQA 4J3WA 1VEOA 1GW1A 4Z2GA 3EOSA 2VD8A 1Q2RA 4IGMA 4JYFA 2OGJA 1LJYA 3VGFA 4GLEA 4K8HA 1E51A 1G0CA 3TAKA 2YBUA 4QLLA 4FR1A 5I79A 1KFLA 1Q6DA 1IZJA 4DJDA 2QNEA 3B97A 2GK1A 1XH0A 3ZOAA 4J1OA 3GVVA 1DIOA 1HJXA 3AHYA 3ARVA 4AZ6A 1QPNA 3NDOA 2CHNA 3VDGA 4DJFC 3DJGX 3MKKA 1NDZA 5EMLA 5A6MA 4G56A 4Q7NA 3DFPA 2CKRA 2C6QA 2OGYA 3WUEA 4A3QA 3MI3A 1DXLA 2E6DA 2ZTJA 2Z1KA 2ZX9A 1JOAA 1QMLA 2FMOA 4CQ9A 1W9BM 5ABEA 1JEHA 1W1ZA 1O5QA 2ZRUA 4XZMX 2HVNA 3IARA 5E0FA 1IIHA 5LNWA 4LYKA 3W1LA 1JD9A 3EWCA 4RDYA 3EAOA 4QXIA 2QKFA 4UMCA 2ZQ0A 1YBQA 4ADWA 3R11A 4C91A 2VC5A 1DOSA 4CNPA 1KBIA 1K9TA 3IK2A 3UJFA 4B16A 1KNWA 5I23A 3RIKA 2RHGA 2EXOA 1YHTA 3UGRA 1XWYA 4K1WA 1DQXA 3ARPA 4CU7A 3EWUA 3CLWA 3W02A 3CPUA 1JXJA 3T2QA 2JQXA 4NILA 3UNTA 1FWRA 1GRHA 3WQ5A 4L65A 3DFHA 5AB3A 4GUGA 4LJ3A 3N14A 4N4PA 1NM9A 4YLWA 3W81A 4DWDA 1TV5A 3G1XA 4H9TA 5BOEA 4PL1A 3EPNA 3TTYA 3CTLA 3TA9A 3B9AA 1NP2A 1A5SA 3BGGA 1M6IA 2VHLA 4ICMA 1EOMA 1YTDA 2J3NA 4IP7A 4D6GA 3WLKX 1EA0A 4C1LA 5K9DA 5CZSA 3OG3A 1JPHA 3OBAA 3PTMA 1ZENA 1AUSL 3VKDA 1UP2A 2G4FA 3SAZA 4H4RA 2AKMA 3CZGA 3VIIA 2D73A 3NQ7A 1JZ6A 1JPMA 1AL7A 4K36A 4U33A 4LOCA 5K7JA 4FX9A 2VZVA 3TH6A 4HHPA 2B4GA 2GR1A 1GEQA 2FZBA 3BW3A 1D7KA 3HFYA 4JKLA 3AZSA 1MQRA 3VGDA 2JALA 3RGTA 1QDSA 5IFTA 3LHYA 1RQEA 3K4AA 2QCFA 3LBOA 2QLYA 1LRTA 3UD6A 2VT0A 3WQVA 1M7PA 2WB5A 5IOBA 1B3OA 4CEUC 4H9MA 4HCDA 4H4QA 1EQPA 2OQHA 2ODOA 3PSWA 3KHDA 3WD0A 5CBJA 3DDMA 4LFYA 1DQWA 4D1IA 4P7OA 2XIJA 1H4PA 4Z0JA 2OCZA 4Z42C 3G1HA 2QAFA 3VCCA 2QT3A 3CUFA 3UCQA 2V68A 2TSYA 1BTCA 1I2RA 1E0VA 1H7RA 1JCLA 1E9ZB 5DXXA 3KCJA 1VRDA 1ADDA 3DN5A 5DMNA 3BICA 2WNNA 1Q45A 4LS0A 1I60A 1OF6A 1Q63A 8XIAA 2W3RA 4UQCA 1TJRA 2GGEA 1K77A 1J0ZA 1M04A 1C91A 4Q6JA 4E2OA 1CLKA 4Q8TA 5EFDA 1CIUA 1XDJA 4FF5A 4IUGA 2Y24A 2A6LA 4N02A 1EDQA 1BXCA 2C8NA 4L4MA 5D2YA 5LA2A 4KT2A 1A3WA 4QR6A 2B7NA 2IXUA 3GAYA 3W1PA 2D20A 3TR2A 4UTMA 1P6BA 5EB8A 3V5CA 5LA1A 4IUOA 4ZEPA 2OO0A 2VRKA 5LGXA 4KIEA 2HCVA 2Y5JA 1SUXA 5CPQA 1MUMA 2PRLA 4GYFA 1Q8JA 3AYRA 4FOUA 4ATWA 1CXKA 5K2ZA 4WOZA 1WBHA 3SRDA 1FXPA 3L4YA 3EBVA 3AM9A 3EX3A 5JVLA 4Q6XA 1HT6A 1LLZA 1KQYA 3W37A 3F4CA 1KBJA 4NRSA 4K8EA 3VIHA 1VF8A 1BLIA 4HMDA 1U5JA 4MZ8A 2ZRXA 1QASA 2WMJA 1XSIA 1LL4A 3OVGA 2FKPA 3EXRA 4R9OA 3BMXA 2QAPA 2IUZA 4MMWA 1BYDA 4JTRA 4YMZA 1L2QA 4AYGA 3TTQA 4C6JA 4H3DA 3VUSA 1GEHA 3HPFA 4MJ2A 5G5IA 5HPOA 1A5BA 3IVUA 3KL3A 3KS5A 1WNOA 3HMCA 1NQKA 3UZZA 5M1TA 3VPLA 3VOHA 3GZ3A 4JIEA 4S3EA 4HK7A 5H2ZA 3EMQA 2ZFAA 4MDOA 4PH6A 5GQBA 2YFNA 3N3TA 4LYRA 2MANA 2P50A 3KXQA 1J6OA 2ATMA 3CYVA 1OF8A 1CEOA 2YBVA 4PUNA 5KVIA 3ARSA 1UMYA 2DQWA 4ADSA 1ZAHA 1ITCA 5FSDC 1I45A 4JFWA 2ZRWA 1RP9A 4F3HA 3ZQ9A 4MUZA 2ZZ6A 4LPCA 5IFPA 1ITUA 2QR6A 1HKMA 1FDZA 3W84A 5U4NA 4BQ4A 3AHVA 1B31A 2X1IA 2XWDA 4RDZA 1LUCA 3THQA 4YXGA 1U1JA 3F5KA 2QF7A 3RR4A 3TLQA 4WJEA 2BY0A 4FNUA 2GQ9A 3MSGA 2PDPA 1M6JA 1EJ7L 3AQUA 3EPMA 1QHPA 3MMWA 1XLGA 2FJUB 2X0YA 3B0YA 3OHIA 4HKPA 3VE7A 5ENLA 1EOKA 3FN9A 3GWQA 4R7WA 3MSYA 3TTSA 3ONCA 1W32A 3I65A 3MW7A 1OD8A 4IMEA 2YVFA 2ZE0A 3BMVA 2ZOXA 2GVGA 4GI4A 4QDWA 1GW9A 1X2HA 5E9AA 3FA5A 4PUWA 4XO6A 3WNKA 3E5BA 4BEQA 2C91A 4QCFA 4MB3A 5BZAA 1NHPA 3HPZA 3MI2A 4B9YA 3SUTA 5DEZA 4M1BA 2CZVA 4GQBA 2AMXA 1OK4A 2ACRA 4S23A 4IMDA 4Z1YA 3UXKA 1VCGA 4Z1AA 1V0LA 4IICA 4CEXC 1VEPA 1O5RA 2PGRA 2V3EA 4O1CA 4X2RA 1VFUA 3LOTA 1UWIA 3HPSA 1XDIA 3Q4DA 1KR1A 2VENA 1KC7A 4AU0A 4JY8A 5BCAA 1N55A 1GVEA 1GOMA 1GVIA 1ODZA 4JCMA 3L12A 1G4TA 1SZFA 4X3ZA 2OELA 1TWWA 3UVAA 3VNDA 1GJPA 3FEMA 4K6AA 4WXYA 3DAQA 4F40A 4PFMA 4G7EB 1UC4A 1E72M 2D2HA 2O7SA 3S1VA 4B9ZA 3NJ3A 4NNBA 3O3RA 3E3HA 4UQAA 3AXKA 2CBJA 2J74A 3FHAA 5D03A 2EPMX 3WQOA 3SCTA 4QE5A 4MKVA 1W1PA 4J2MA 4D8LA 3W7GA 2VZTA 3IIXA 4XKMA 4GZJA 1Y65A 3I68A 4FLOA 3W71A 5A94A 1TYTA 1JI1A 1F5ZA 1FH9A 4JYEA 4DLFA 1L6FA 4C6OA 5A8OA 2YVGA 1Q7QA 3NSXA 1R9XA 2XVPA 1VDVA 3WH9A 4I6KA 4O0ZA 5FA5A 3VCRA 4JTKA 3G1RA 3JZEA 4HCHA 2YZ5A 1UC5A 1RY8A 3RJXA 4UC5A 2E1DA 2YXXA 3FJNA 1P7TA 5K4ZA 1Z6KA 1SSDA 4OJYA 1H7OA 1V3LA 1NH6A 2OOGA 2QDDA 3EDFA 4BI7A 4QNWA 3FGCB 2VR2A 5A6KA 3EDJA 4RZ5A 4PCPA 4DPPA 1GK8A 4N9BA 5H91A 1GTEA 1QOPA 1UZDA 3U6WA 3WK2A 3CT2A 1DJNA 3W27A 4YVVA 3FKRA 4QSHA 2OT1A 4JTIA 4GYKA 3Q65A 3D5HA 4XAYA 1THFD 2XFFA 4EM4A 2PDIA 3CGDA 4P8UA 1H0GA 3PZGA 1J5SA 4HNUA 5J5DA 1Z32X 4IP4A 1H63A 2CZ5A 4NAFB 2C16A 4PMQA 3B4YA 2R1NA 2WMIA 3GDKA 3P2VA 4M29A 3ARRA 1LG1A 2CLMA 3AZTA 5KZMA 3TYCA 2PGWA 3LUTA 4JQ1A 3O07A 4RX0A 4KESA 4XZLX 3EPOA 1JF6A 1J6PA 1FWJC 2DEPA 1ZHAA 3S8HA 1QI4A 1LTDA 1PHQA 4JXCA 3UZJA 3W87A 5G4WA 4YTRA 2VM8A 1ZCCA 4JIRA 5A8GA 4RNFA 1E56A 4O10A 1XW8A 1SZRA 3SCOA 1DHKA 3KCOA 4S2BA 3RJYA 2PDUA 4KETA 1GPWA 5IDZA 4J35A 4K7YA 3ZSTA 3DBNA 4H4VA 4DO7A 1C8XA 4GOAA 4D6CA 5MF5A 2PLJA 3OIHA 3VM5A 1TWIA 1MFUA 1KCLA 1ME7A 4KBXA 2QUNA 3LTSA 1KFBA 3IGXA 4DELA 1PE1A 1OFPA 1B4EA 5MHBA 3TCSA 2O4MA 1QNOA 1E6RA 1A50A 4JTDA 2XG9A 3LU2A 2W5FA 1ZCOA 3M16A 1GZJA 1XICA 3M5VA 4MKNA 4WJXA 5CLWA 3LTYA 4D9PA 3VC5A 4AWUA 2FPTA 3BJTA 3LCIA 1PXGA 1TE6A 5I6SA 2C19A 2HWGA 1XM3A 4M52A 4JR5A 3CV2A 1GESA 4QDMA 2VCAA 3VIPA 3KBMA 1NAL1 4M82A 3CZLA 2PC4A 3EYPA 1DWHM 4PMUA 2YFOA 2L5HA 3HOJA 2OKOA 1KO0A 2CNCA 3RMJA 1BYCA 4R9XA 3KLJA 2VX5A 1VIWA 4C7DA 1S5NA 5K9CA 2Y5EA 4E4FA 5EKYA 3GTXA 4EACA 2UV8G 4ML9A 4KH2A 3SN1A 3WF3A 3BAJA 3A4WA 2WW5A 3FDGA 1M53A 2J8GA 4PA8A 1C92A 1FTXA 1MNZA 3EOLA 4GIYA 1ZJAA 3VXGA 3R94A 2P3ZA 3N9KA 4FMVA 3TR9A 4J40A 3ZM8A 4QAWA 3QZ6A 4FI4A 3QHMA 2H9AB 1RJRA 3DKLA 3QJAA 4NU7A 1N60C 1GQLA 2Z6IA 1T3QC 5HBFA 2PWHA 2W63A 4A3YA 4UXDA 2XUCA 3QGAC 4J27A 1M03A 4KWOA 4LAUA 1JCMP 4H00A 2D0GA 2CBUA 3UFYA 1GOIA 1XH2A 1UWAA 4BZYA 1IZKA 1JRPA 1NSJA 3WLRA 2QJGA 1OG0A 4OV4A 1AQ0A 1YMYA 2Z00A 3PZTA 4RDVA 5DF0A 3NWRA 2NVKX 3WDRA 2ON3A 3N29A 4BFAA 4G8TA 2OYLA 1UQZA 1OFEA 1P0NA 4GKTA 2QCHA 4LBRA 5FKYA 3RYSA 4ZE5A 3R7MA 2PTWA 2YL8A 1DP0A 1PAMA 1J0HA 3AYSA 2X1SA 3AJXA 3BW2A 2CFYA 1ZB5A 1PHWA 3SIZA 3ONBA 3W75A 5BU9A 3CPRA 4LNYA 5ABHA 1JVNA 3LPGA 4XK2A 2X0HA 1ZBVA 4HZ6A 4LF1A 3RILA 3TFCA 4G6CA 4EWJA 1L0PA 1AG1O 4TX6A 4KPLA 3T40A 2CU0A 1GVQA 3O06A 5CZJA 5F4SA 4FP1A 3FKKA 1VQZA 4OU1A 1A49A 3N4EA 1FXQA 4W8BA 3MQTA 3RX3A 3CWOX 1X8CA 5U7SA 3JUGA 3S46A 2YLAA 4FA3A 1GERA 3SB0A 1EC9A 3GXNA 2FLIA 1VGAA 4RZ6A 1BFNA 1XCFA 3NVZB 2GJPA 2X30A 1UH2A 3W76A 1MZHA 2EKCA 3OGSA 1GEUA 3VOFA 3TX9A 1HL9A 4Z2LA 1MEHA 2C71A 3QQ1A 4CGTA 2CZFA 2CBIA 2GDUA 3TSDA 3QZEA 3CAWA 2V67A 2WOQA 4MFEA 3ZJKA 1FWBC 1KTBA 2VWTA 5JIPA 1XHCA 2IPFA 2J7HA 1TTPA 5AC6A 3I3DA 1XLCA 5C70A 4PTVA 4OIFA 4GE8A 3C4UA 1NJJA 2OR2A 3ZJ7A 3AHTA 4ZO8A 3R1ZA 4XD3A 1P5BA 4FLSA 2ZIDA 4JDRA 3FSUA 2JEQA 1S2TA 4AVNA 1K1DA 4O0QA 1FH8A 1UIOA 4TX9A 1C93A 4BEUA 1DJGA 4GXWA 1I1WA 1U2YA 2J13A 2HJPA 4R34A 1DWGM 2RGMA 2BC0A 1XC6A 2H8ZA 4AX7A 2INFA 5FF3A 1KV8A 2Q09A 3II4A 4EX4A 3BZGA 4AIOA 5DRCA 2VYOA 4RE3A 1ISVA 3VO0A 2AQWA 4DEFA 3IJIA 4IFKA 3L5AA 1AD4A 1JUEA 2CXEA 2ZZ1A 1OBAA 4LVFA 3QRHA 4PMXA 5G2HA 2VC7A 2NW0A 4X61A 1BF6A 3H2EA 1R9ZA 5C9WA 2PD5A 2R1LA 4HNVA 1ME9A 1X7FA 4WDUA 1IWAA 1XLIA 3TQPA 1B0IA 4P7RA 2ZX8A 3NL6A 1Z69A 2LLEA 4QGCA 1F7BA 4TQTA 5D4YA 3EOUA 1PO9A 3B8IA 1U1UA 4H19A 3AWOA 3I4KA 1QNPA 3R8GA 3GLCA 3VIOA 3MO4A 3UG3A 2WNWA 1P1XA 4JX6A 1EF2A 3TSMA 3E0LA 2P0OA 5AYYA 3LB0A 1VEMA 1WZAA 3SSZA 4GH1A 3KBSA 3MPGA 4IIBA 2PTXA 2F38A 3RX2A 1US2A 2QIWA 5CSUA 1C29A 1JYWA 3W2KA 3B8DA 2CESA 1IEQA 2XM1A 1ADSA 3W1MA 2GJXA 4POCA 5HNUA 4ZB5A 3G8RA 3NA8A 3SRFA 2Z1XA 2R9ZA 3UYIA 5I77A 2XFWA 4XUYA 3WN6A 1R3YA 1REQB 1QW7A 3O63A 1R30A 3V16A 4DN1A 3AAMA 2RDTA 1EUAA 4ZTYA 1SO4A 5JMUA 3A13A 4GA8A 3TC7A 2GR3A 4DF0A 5I3JA 4NAEB 3F4VA 1YDVA 1QVBA 2DZSA 3FAXA 1QXLA 3LS9A 4CD7A 5HXMA 4E0CA 2DIJA 2J78A 1HJWA 4R27A 2WVVB 3N9RA 5CZKA 1E4IA 4F2TA 2P10A 3BO9A 3KM8A 4WZHA 1CYGA 3BMWA 4CN1A 2KZHA 4H8HA 2J25A 3ITGA 3KRZA 1SGJA 5FI8A 5AHLA 3WQFA 3NVVB 2FIQA 4H9UA 1YNPA 4HJWA 4NP7A 3VFLA 2CXGA 1ZSXA 1WZMA 2Y1HA 1EJWC 4ZE4A 3W07A 3DFOA 1KB3A 4IG2A 4RL3A 5CH9A 5HUOA 3VDCA 3LM3A 5E6YA 4L80A 2BVYA 2OWCA 1G01A 3SZ8A 1R85A 3DFSA 3GE7A 3CO4A 1IT7A 2CCRA 3LERA 1OYAA 1X1NA 3QW3A 3BG5A 1RBAA 3LPOA 1E6PA 1H7XA 2A21A 1BWCA 5A6BA 4W88A 2XTKA 4XIMA 1FWTA 4GCAA 4HB7A 2VC9A 5G5HB 3L68A 4OWGA 5HR7A 3QOMA 1POJA 3EB4A 4X22A 3MHGA 3CGEA 3SIMA 3EXTA 4ZOAA 4CNSA 3H2NA 4NJGA 2HQMA 4UIOA 3W7JA 3C0SA 3H70A 3GG0A 1VFLA 3UERA 4EXAA 5DY3A 4DZIA 1LVLA 1R47A 4GR1A 1UJPA 4RPPA 3W2NA 2X42A 5AVHA 1V4YA 1YQZA 1R86A 5A1AA 1UJQA 2E67A 1QATA 3OC4A 3BXWA 3N2TA 2DIKA 5I06A 2QDHA 3EA2A 1UOKA 4QDPA 2BV9A 2QYGA 2IMRA 4UTFA 1J0YA 3RU8X 1VFTA 2Z1WA 3IVSA 1F6KA 1GVRA 4JTGA 1Q7MA 1GG1A 3P7YA 4D6JA 4L6HA 4I9AA 3SDOA 3I10A 2W6RA 1BXBA 1CWYA 1P1MA 5HNRA 1QFEA 4C6DA 4AB4A 1Q8AA 4LY8A 1JZ5A 1PTAA 2WWCA 2HZGA 3L0GA 2VDIA 3QYSA 3QZAA 1HL2A 4NRRA 4L4PA 1DXEA 1PCWA 3IJ6A 3H2OA 3VI2A 3PTQA 3DU0A 2XWEA 4C65A 1UP3A 4JY9A 2F6UA 2WOWA 3GU2A 5D8ZA 4W89A 3WNMA 2CFFA 3EUB3 2Z27A 2X7WA 4HSOA 3NDYA 5CG0A 4KCWA 4Q4KA 3A3WA 3AS3A 1IGWA 3G3DA 4HA4A 1IF2A 4JN6A 4AIEA 1J79A 5HK4A 2PLMA 1W5MA 1ICSA 2YCEA 4DI9A 1KFWA 4P7LA 5CKSA 4YPJA 2GOUA 5FF7A 4A05A 3FDKA 5CSYA 3VOJA 3UY7A 3WLNA 1UROA 4RV3A 5A6AA 4AZCA 1QO2A 2NUWA 5B7ZA 1T99A 3RCMA 1IZCA 1WDDA 4G2DA 3F4WA 3O6AA 4RNIA 3B0XA 1OC6A 3DHPA 4CCZA 5I02A 5HOSA 4W5ZA 3SCUA 3GDTA 2F2HA 2WP5A 2VJXA 4FSAA 3VNKA 1MXGA 3GXPA 1VPXA 2G5WA 3T09A 4ZOBA 1DXFA 5C5YA 2IPJA 4PC8A 2PFHA 1RLDA 1V79A 2NWSA 4PMYA 3TKFA 1RVKA 2QCMA 3L9CA 3DHUA 2VTFA 5CBBA 3TW6A 2ACUA 3FFSA 3DHFA 3R0KA 1FEAA 1V5XA 2WMHA 5DT7A 1ZBCA 4GJ1A 4NZFA 3VMPA 4G9PA 1GQKA 2C1IA 4AEFA 2VQTA 4DXKA 3NL5A 4RPQA 1WO2A 1M68A 3UZYA 3UXIA 4UTTA 5HQMA 2XGIA 3V5OA 2GZXA 4R88A 1UD2A 4JQ2A 1GORA 4DVOA 1JUBA 3OO2A 3NQFA 4LANA 3BTNA 3QY7A 1TZ7A 5AYXA 1M9HA 3NVTA 1TV8A 5FD0A 2XHYA 3UR7A 4YWIA 2OFJA 4JD4A 2D0FA 2DSUA 1RK5A 1KRBC 4HA3A 3PZNA 1JFHA 2PDNA 2XH7A 3AJ7A 1CGUA 1H41A 3I3EA 4OBTA 1UPMB 2DZUA 4J3TA 1DWIM 4A2RA 3W7CA 4LYPA 5D2WA 2WAGA 1XRSA 3LCLA 4XAFA 4JKKA 4H4SA 1W6TA 3UGVA 4G1KA 3KDNA 4C7GA 2FTPA 3KCLA 3PHAA 1P0EA 2FZ9A 4MY9A 2ZA1A 2Y7EA 5BRBA 5AHFA 1TTIA 3UJEA 2W0UA 1BWVA 3IGHX 4H4PA 1H2JA 1TUFA 1AA1B 2GSEA 1X1OA 2XVNA 5A6JA 1OZMA 7REQB 5IHSA 2VVNA 4K1GA 4J3VA 1E73M 1EP1A 3LMYA 4DO5A 1NP0A 2ZA2A 3A4AA 1XLDA 4K68A 1GKRA 4CNOA 3VIMA 2XGBA 3QTPA 2G3IA 1PUDA 2GK1B 3QC3A 1GETA 4QHRA 2WVUA 2Z26A 4LV9A 4KCVA 4MKSA 3BL3A 1HTIA 2V2HA 3NPUA 1I1XA 1HP4A 2X40A 3AI0A 1TMLA 1F9CA 4LTSA 1M1BA 3DG7A 4TXEA 2WQPA 3STGA 3QYQA 2HS6A 3BAIA 2ZBTA 3N11A 1KV5A 4IOTA 1I4NA 2PCEA 3MCNA 3UNDA 4JDBA 1JYVA 1XLJA 3ETRB 1Q5MA 1GVOA 5DELA 4C7FA 4W4QA 2NZLA 1JUKA 4AYSA 1W5PA 2V0TA 3AXXA 1ADOA 1IV8A 1YBQB 2A3HA 2Y8UA 2P53A 1RVGA 4MAZA 3OYXA 3W0KA 3VD7A 4AZIA 3H6OA 3HGOA 1FWFC 4ZQNA 1HZYA 1H62A 4YYCA 5A6SA 2FTYA 1A0EA 1XBVA 3TYZA 3EAUA 1YKWA 5EPDA 3PWGA 3CTTA 5FJTA 2UY4A 4XTDA 3SCVA 2Y7GA 3LPPA 3U9IA 4IM4A 2BC1A 4ML4A 3QTGA 1EC7A 4H9VA 1PDYA 4LRTA 3HGRA 3LHWA 3A24A 1V3JA 5E0KA 3F5JA 2WJDA 1XD1A 3K8KA 4B5VA 3II1A 3J7HA 3DJJA 4FLRA 1JDFA 2ISWA 4LS1A 3TQ0A 3KOYA 5E5CA 5I2UA 2X50A 3S9YA 3WLPA 2G41A 4N2YA 4KCTA 3S6DA 4HU8A 1X38A 1LQAA 1OIMA 2ZZCA 3OLGA 4NZ1A 3LHTA 3RK8A 1LDCA 3CH9A 2ADAA 1XYZA 3GVWA 1B3YA 1BWKA 2E3TA 4HQVA 1PWLA 4KERA 2VX4A 4KW2A 3UWVA 1IR1A 2ZA3A 1YPXA 6A3HA 1ME8A 5E0CA 5JH1A 1I8JA 3LCHA 3JW7A 2AGTA 5H1WA 3GTNA 1SFSA 5EFFA 3DIPA 3WF1A 3NEHA 3CS2A 4AD4A 4Q32A 3U3HA 2O92A 2HVMA 3WQ4A 3Q37A 1JL8A 5CPNA 3UYCA 2J7FA 3E38A 1UKTA 3VX1A 3VABA 1LBFA 4CUCA 1UD3A 1AQMA 2VDGA 5DMLA 4LAZA 1ISZA 1VJSA 3FNDA 5I3IA 1CLVA 4TVUA 2VX6A 1W1A1 3WFZA 5J8LA 1GRBA 2W67A 5CCZA 1OX4B 3IK4A 5AZ0A 1D2KA 2J7BA 3B9JB 2ZICA 1XG3A 3T8LA 2DP3A 3STFA 3GM8A 5DXYA 3LXBA 2QGHA 2WSPA 3CWNA 3WH7A 3FYPA 5M17A 1B3XA 2PPGA 4CD6A 2NV1A 4PBGA 4XD6A 4IPJA 1MUWA 3M7SA 4OFCA 2NUXA 4B92A 2O7QA 2ABAA 4X0NA 2GGJA 3UZ5A 1PV8A 2OQLA 2VC6A 3TE9A 2NV9A 4NUWA 4JHZA 3IVTA 1UH3A 4RNJA 2CLHA 2PP1A 2BOGX 2J66A 1G69A 3U48A 1OK6A 3ARYA 3W6MA 3W2JA 2YR1A 1T96A 2PTDA 5A8MA 2I5QA 4DYJA 6REQA 4B15A 4ZMGA 1UUMA 3WH6A 5LYRA 4A3HA 5C2GA 1E55A 4H9YA 3RCYA 3QMSA 1OCQA 5CSSA 1EJXC 3BLPX 4GMEA 2ZRYA 4B5XA 4FALA 2X1TA 1GOOA 3OG2A 1FFUC 3GD4A 3OLIA 2GL5A 2BS9A 3CHCA 1X6UA 3GO2A 3ZJ8A 1ESWA 1TKKA 4Y9OA 4OHQA 2WNZA 4FNQA 3MMDA 3P93A 4MJ4A 3TVAA 3NM1A 3WLOA 1LT8A 1JCYA 2DY3A 5FEZA 2XISA 4TVDA 1MI3A 1MW3A 3WNNA 5C2CA 2BHUA 3TK7A 4MAVA 3EEGA 1OG6A 3GR7A 3S1XA 3OZYA 3T08A 1JPDX 1H11A 3ZMRA 3IIVA 3WJYA 4O16A 5U25A 4QJ4B 2BCPA 3LCGA 2G97A 4LQ1A 3A7AA 1J0KA 4YJ5A 4M19A 2B81A 2PDKA 3S5SA 1PKLA 3E0VA 1X96A 1ZP3A 4GIEA 3MP5A 1P0BA 2A5HA 4GJIA 1ALDA 3OODA 4B5WA 1LQ2A 1A53A 3GNOA 2Y4SA 4PCSA 3WK0A 3G18A 3T0DA 5TF0A 1EX1A 1NVMA 1FHDA 2E40A 4QISA 2YB4A 4OGZA 5DBUA 5G4HC 3VE9A 4FOKA 3GUGA 1K02A 3VNYA 3ITVA 4UTKA 4CD5A 3ZJ6A 4FXRA 1GSNA 3B04A 3OQ8A 3W86A 1YDNA 3URNA 3H7VA 3NRZB 5CPLA 3QF0A 2DV0A 1GRTA 1NOUA 2E09A 1VBGA 1D9EA 5CZTA 1FCUA 2ONEA 5CQ1A 1CB7B 5BWAA 4K8DA 4UQDA 1LUCB 2QHAA 1J0JA 1D3HA 1FFQA 1W8SA 3ARTA 3BGJA 4MFDA 5JCMA 2CEQA 2YL6A 1RALA 3TXZA 3W7IA 3WEOA 3OU8A 4WKAA 3BVJA 1W1IE 1Q6LA 1HGYA 2VEFA 4Z17A 1ONXA 3W1AA 3CB3A 4C5ZA 2I56A 1RJPA 3CHVA 2E3ZA 4DPQA 3VINA 2CHRA 1E6SM 3UG4A 3ITOA 1O1ZA 4Y7EA 1TR9A 3WDJA 1PYFA 1K70A 4IIGA 2ISFA 3M64A 3UWQA 4AD5A 5CJNA 1XANA 3DI0A 2E7FA 4MY1A 4W8LA 3W73A 4MB5A 2R24A 3AYVA 1EO7A 3MUY1 1SZEA 4DAIA 2REQA 1GOKA 2NQ9A 4H9ZA 2X09A 1YEYA 3AIRA 2D23A 1TRDA 2YDSA 4H4XA 3AXIA 1EGZA 3RPMA 3T8QA 4B91A 3B8UA 3T42A 1G94A 2V8ZA 2BODX 2ZE3A 3W2UA 3R0UA 3QPZA 4AQLA 3ALFA 3NYZA 5FS8A 3WEZA 3LZ5A 4AC7C 3GHUA 3NPWA 4C1KA 3HIJA 4GO9A 3FJ4A 1LCOA 2TRSA 4GRTA 1HW6A 3DGBA 1X6LA 3LLDA 2BZNA 4R7JA 4FPSA 4EVZA 2EAWA 4Y9NA 1MRQA 3P84A 1JROA 3UG5A 2Z1SA 1ENUA 1BVZA 4MUPA 5CGMA 4XZWA 4Q8UA 3HQPA 3O9NA 4PUDA 3EXSA 5EMUA 4BY3A 4ALDA 2QJIA 4IGHA 2Q71A 4W85A 3TZNA 4MNKA 3ANVA 2G96A 4L4OA 5LIUX 4GZ7A 4IIFA 1VLIA 4JTEA 1UKOA 5HJXA 3N34A 4P2VA 1DPMA 1QWKA 4M0XA 1EPVA 4HJFA 4MZ1A 4HU4A 4GK8A 2YDRA 4DAFA 1NDAA 3BAYA 4ENLA 5BW6A 4HT3A 4EF9A 1E4NA 1WXYA 4UUIA 3GQYA 3WJSA 2OZTA 4TMCA 2D1ZA 3L4XA 1P7TB 2R82A 3IUIA 1GWJA 1K6WA 2XU2A 1UUOA 3GFYA 3B06A 3KW3A 5HA7A 3AIVA 2GYIA 2Z1VA 4US6A 2QQ6A 4CVUA 4EQXA 3VIJA 5TD4A 2E6AA 3BCJA 4PEEA 1BG9A 1DJHA 3PUEA 3O1NA 3WH5A 1G4EA 4UOJA 4WRHA 1MW1A 1NFGA 4UWMA 4XIAA 1XI3A 1XLHA 1A5OC 1Y7VA 1V51A 3SJNA 3WH8A 4HZMA 4KF1A 3B9EA 2XIQA 1GHSA 4F0KA 1K9FA 1STZA 1S5VA 3TW9A 1OY0A 3KP1A 5A6LA 1HL8A 3THAA 4LAOA 1XYLA 4XTIA 1H7WA 4UCGA 2X7VA 5GJNA 3MBFA 2WMGA 2VKZG 4PTDA 3KX6A 1FWEC 2WMIB 1KM4A 3TNOA 1S3HA 5FSEC 5I09A 1JAEA 1V02E 2WCAA 2XPKA 1SPQA 1MZRA 2G8ZA 1T8QA 5T9CE 3NS1B 3M41A 3OZOA 2IKIA 1SW7A 3V18A 4UB9A 3ITCA 3MUXA 3R8RA 5KZ6A 2OT0A 4LCQA 5DCBA 2PRHA 3LRKA 3RX4A 3W28A 3HG2A 1CECA 2ASHA 2Y5SA 3FIGA 3K30A 4O53A 3A7UA 1UWUA 2UWFA 4GVIA 1OFOA 5D05A 1KXTA 1RD6A 1GZGA 1OFQA 5T91A 1N8IA 3R6IA 1NOWA 3NGFA 1I0BA 4DJED 4GVFA 3BSGA 2FDMA 1LYXA 1HIZA 2V5DA 4QITA 3G0SA 4G7FA 3R0DA 3TZFA 3CPGA 4DUVA 4ZZ9A 4AEOA 2JF6A 1UZHA 1E0WA 3TN3A 2PBGA 4M3PA 4QCEA 3TV8A 1DIKA 2X8RA 1OD0A 1YTEA 3P5YA 6TIMA 2WZTA 4W7VA 2Q6ZA 4IXXA 4HYVA 3V5FA 3A12A 5HMFA 4BV6A 3MC5A 1BRLA 4J7RA 2VZSA 3CIWA 4WCJA 1BYBA 2A7RA 4M24A 1D8WA 1JQVA 3KOFA 2C1HA 2WKGA 1N62C 1XKJA 3AFBA 5GNZA 1QO5A 1W5NA 3CIVA 1GRFA 4IL0A 3WLSA 3FYOA 4NJKA 5G1YA 5E09A 5FOOA 1TQXA 3NO5A 4FX8A 3A47A 4ZQRA 1NIUA 1YIXA 5BWFA 2POZA 1UD4A 3N13A 2BXVA 3ZO9A 3S5ZA 2O9TA 4Z2KA 2V5CA 2JKAA 4GABA 3PBYA 2V6AA 4DJEC 4YL2A 1UZ1A 1BGGA 1XSKA 1IT8A 1HKIA 4C6IA 1LOLA 5F1VA 2B31A 2ISSA 4UTWA 2QULA 2HTMA 5LSMA 2WZMA 4PMVA 1LL7A 2BX7A 2Q8XA 2WQDA 4N9EA 2WKLA 3B9DA 3G5EA 3IEBA 2DZPA 3ECQA 4E4UA 2ZC8A 4PFHA 4PYSA 2JKEA 3D6NA 3R07C 5H8UA 3AUOA 4LF2A 4KFPA 3W24A 1RV8A 3CL6A 4JNZA 2ZUVA 3CEPA 5EA9A 3N6JA 5JCLA 3QW4B 4AC1X 2VGBA 2HROA 5FEXA 4HNNA 5D9PA 3GU1A 2RABA 4DBDA 1S5MA 3RLGA 4FIRA 1JXKA 1KXHA 3V1HA 3P8IA 1FY6A 2OX1A 4MWAD 2NX1A 2HVOA 2FYMA 4EMWA 3LRLA 1XYBA 4QQUA 1UR1A 3W1RA 5C71A 3PZIA 5D37A 2J7DA 1S46A 3VKAA 4DWSB 1UD6A 3DGRA 2AGKA 4OUIA 2VFDA 2PU1A 1V02A 1DJQA 5LIKX 5F7UA 1Y8BA 1TV3A 1GZ1A 3ZT5A 3MJMA 4A21A 4ES4A 4O19A 3CMFA 4P8WA 2QUUA 5FACA 4CCDA 1BKSA 4D72A 4L1XA 3GH7A 5KITA 5AYBA 5T9BG 2AKZA 2WJFA 3TP4A 5D09A 3H22A 3NM3A 2VRJA 3W29A 2QJJA 4DWSD 1ZPTA 2VEMA 4Y2WA 3TJIA 3L21A 4JCLA 3JRKA 1JI2A 2X16A 3RPTA 3CAQA 4RCXA 1IR2A 1BTMA 3TN5A 3WEMA 2PWFA 4UR9A 2ACSA 4FAMA 2YDQA 3CT7A 3TW7A 3CXOA 4JIPA 4MWAC 3T2OA 4QNEA 2YL5A 1XIJA 1DJIA 3U2OA 1VH7A 4A8IA 3FAWA 4IH3A 3P81A 3EGJA 3W23A 3GH4A 1TPUA 1UR9A 3K1GA 2V3DA 1RPXA 3M0XA 1ONFA 1F74A 1XLFA 1S1RA 3K4WA 1DTUA 4I9MA 1JCTA 5CC5A 4H6EA 1AJZA 1ZP4A 6TAAA 3DZ1A 1LM1A 1KM6A 4PMRA 4GI8A 1PZ2A 4M80A 1M7JA 1FDYA 2W27A 4YTUA 4GHRA 4LXFA 1JD7A 2OZ0A 4GBDA 2PP3A 4C6NA 1KGXA 4FNRA 1KCKA 2P88A 4DIAA 2V30A 4DWSC 1GG0A 3AHXA 3WBAA 4AIUA 2NT1A 1Z9AA 1EGVA 2RDWA 4GFSA 1JYXA 5C0QA 4I90A 4IFOA 3C61A 1KRAC 3TQKA 3JU2A 5LA0A 3M0YA 3SURA 3MI6A 2PWEA 3S42A 1TV4A 2FDSA 5D30A 1U30A 3EEZA 2I14A 1O95A 1W3TA 2XIOA 3MVIA 1E9LA 4NIRA 1ZAIA 3U7BA 1QTWA 3LGGA 4J4KA 1H7PA 2BB0A 5C7VA 2NLYA 2FPVA 1B54A 3HQ1A 4AMAA 5A2CA 3HN3A 3MV01 3O6CA 1OYBA 1EJVC 1RK6A 1O5KA 4ACZA 4IFKB 4UR7A 5AYZA 3W7HA 1VYRA 3XIMA 2JK2A 3H53A 1XPYA 3WIJA 1GTHA 1LF1A 3WX7A 5JCNA 2GR2A 4JS3A 3B8SA 3N2CA 4APNA 3W1XA 3SCRA 1C90A 2JIWA 2CLPA 3ATZA 4N42A 5GJMA 1TR1A 3RXZA 3PY2A 1C7SA 1V93A 4DI8A 3FS2A 1V8EA 4BHYA 4DNHA 3HG4A 4BR1A 1R38A 1L9WA 1SR9A 3MU7A 2ZZ0A 2W62A 3MJYA 2X8CA 4Q8OA 4H8UA 2JF7A 4WLCA 4JICA 3QVQA 1ZUAX 3UR8A 3SCPA 1CXIA 3KTXA 4LAKA 4V1YA 3V75A 5GPRA 1K4HA 1PZ0A 5C9XA 5EMKA 1OFRA 4I9TA 1QAPA 2GJXB 2VL4A 1E1EA 2WMFA 5HPCA 2BP1A 3IJQA 4HZ8A 4M7TA 4E4PA 3PN8A 4M6QA 1T5AA 3BLLA 3ARXA 2IQDA 2P5NA 4XVEA 1N82A 1TZZA 5I0DA 3W74A 3TROA 5A95A 1ZMCA 1TJ1A 3FVDA 4X0VA 1I0DA 3NXFA 3H21A 2EQ9A 4E2DA 1W9XA 2G50A 2ZVIA 1G6CA 4IWWA 4K38A 3PPFA 3NFUA 4DYKA 1SQ7A 4JL2A 3VNLA 1OC5A 4DBSA 5C2XA 2V38A 3GXIA 2I16A 4GGBA 1XIEA 3B8VA 3PBGA 1JJKA 1J10A 3PANA 4W93A 3Q94A 4MHBA 3G77A 3HV8A 4PCNA 4X9YA 3BG3A 4P7QA 3OYZA 1RAKA 4GG9A 3L0NA 4S3BA 4UCFA 1WB0A 1H60A 4IG2B 2UY5A 1SJCA 3C2FA 1ZJIA 1XYCA 2CZDA 3GB6A 1KFEA 5TIMA 3VVGA 2RH9A 4UBPC 1KM0A 1H7NA 1V0MA 3M0MA 4DM1A 4YTQA 1J2WA 1YX1A 1N2VA 1FWGC 3REQA 4HP5A 1O7AA 3EA3A 4DZ5A 1WPCA 1W9VA 2PRMA 1V59A 1HUVA 1QNRA 3KVJA 3KTSA 4L1GA 2ZRVA 1P4CA 4F2UA 1HFBA 3BE7A 2QGYA 3P82A 3ZLFA 4L64A 3SSJA 3AIQA 3RU6A 2Y2WA 1CX9A 3C0LA 1FWSA 2X0SA 3FX4A 4DNAA 2Z6JA 1RUSA 2OU4A 2C1GA 3HMJG 5FF4A 3WJWA 2QW5A 3L4ZA 1BGAA 4QQ3A 3PPHA 4LYQA 1I2NA 4JGDA 5PTDA 1ZL1A 2PLKA 6ENLA 4AD3A 3M7WA 5HAOA 4DZAA 3GXMA 1KFKA 2HXTA 1LROA 3VNJA 3ES7A 4HK6A 4CD8A 1E1CA 4QAIA 2RUSA 5F4XA 2VDHA 3VM7A 1EBDA 3L2LA 4O1EA 1UQYA 4BQ2A 2DW7A 2EPOA 1EFZA 3B0VC 1A5CA 3OTRA 3LENA 1M65A 1FWAC 4AVFA 1KXVA 2D22A 2WZEA 1R3QA 3CZJA 4ACYA 3NSNA 1J12A 1O5XA 3EWDA 2VO5A 1F4HA 1UOZA 3LLFA 6ALDA 2A8XA 1BYAA 1KBKA 1BVWA 1C7TA 2PDCA 1YPIA 3GKFA 3AWNA 2WSRA 4GVHA 4RK8A 4XBJA 4H7VA 4L4LA 3GYCA 2WLYA 3PFRA 1ZY8A 4TVWA 1W3JA 3O8AA 1KTCA 1Q3NA 3WENA 5GVJA 3ZZ1A 3QR1A 2OPJA 2AQOA 3RFAA 2VGFA 4OECA 1FIQB 3FHQA 3S5OA 1WOBA 2E6FA 4U5KA 1B57A 1YXDA 2Y8KA 1AFSA 3LRMA 5D2XA 4AZCB 3TYAA 3D3AA 3F2BA 1S5WA 3TU9A 3F2DA 1YQ2A 2HNEA 4HVXA 3WDPP 3G0XA 4NSBA 1UZ4A 1R0MA 3OOQA 4AZHA 3LTPA 4C6BA 3UZXA 3DX5A 1XIHA 4H4WA 3BG9A 1PKNA 5AC8A 1OJXA 3IACA 4O50A 3V36A 5F4WA 4IFRA 1HXJA 3GNPA 3GVRA 1V3KA 3PNZA 5G2IA 1RHCA 3TSBA 1N61C 1EO5A 1AMYA 2ESCA 3TMLA 1F6YA 1CXFA 3E96A 3ALGA 2GJRA 4H4ZA 2C0AA 1OCBA 2IS7A 2D2OA 1EQCA 3WQDA 1QPQA 1DKWA 5IRPA 2WO5A 4GUJA 1J18A 3RR1A 8TIMA 3VKCA 3BC9A 4LH8A 1UR3M 3IPWA 1OSEA 1NHQA 3PFMA 3Q45A 3QV9A 4AIBA 3LHVA 4PMOA 3VMNA 2NQJA 4K8GA 1OGBA 4Q4OA 4WHBA 5DLCA 4CNNA 1MYRA 2RGLA 3AXMA 5I3DA 1EJSC 3PVFA 4QEHA 3C0JA 3OA5A 2CERA 3ARQA 2ZUSA 1HJSA 2E5AA 3RUBL 4RZBA 2BXZA 3MB9A 9CGTA 5LNSA 4EANA 3E6EA 4P5UA 4PUKA 1EHNA 3ZIZA 4BK9A 4LGXA 1OABA 1EIXA 4L9ZA 1TSIA 4A8LA 3GDMA 3N15A 3AUJA 2IW0A 1AQFA 3QN3A 2YDAA 1HF6A 3BGAA 3GIQA 4W87A 4ONVA 4MPKA 2A7NA 3M43A 3BLKA 4U2YA 3BCDA 1SO3A 3PK7A 3T78A 4RLIA 4FIQA 2XM2A 4NY2A 4QS5A 4UZSA 3EDEA 1F6PA 3ID7A 4HN8A 1CTNA 1LOQA 2VEGA 3CB8A 2A2IA 3GBEA 3PS7A 5EYWA 3S1GA 2DZXA 3N1AA 4PUMA 4KPRA 1NWRA 3QR0A 5IBXA 4PGLA 1I75A 4QG6A 3DFQA 2RFGA 3CGBA 1L6GA 2W91A 1XC4A 4XVDA 2E8YA 3VX0A 3Q2DA 1GYLA 4KRTA 1HVXA 3N4FA 4GZEA 1SYTA 2A6NA 3NGJA 3LYEA 2CKSA 1VC4A 4GACA 4QG8A 2CW6A 1KLZA 3VU2A 2DZWA 2ZUUA 1PL9A 3PZ9A 4YYFA 1K4GA 1XGEA 3RMEA 3P5ZA 1OC7A 4Q7IA 4ROQA 3KOWA 3EZ4A 1VQTA 2D2GA 1SZNA 1VLWA 1UG6A 2XSAA 3AIEA 2NV2A 3O05A 2QPUA 2HK0A 2O9PA 2XH0A 4AZGA 4IMCA 3RLVA 4LT9A 3BQ5A 5AKQA 5LXEA 3L23A 4WQ6A 3SM0A 4V2XA 1WKFA 2RDXA 1LL6A 4F0HA 3UA3A 5ER0A 1CGXA 3NVDA 1DL3A 2ZVRA 4JTSA 5DN1A 3GNXA 1X97A 3H4XA 2QCCA 3AMDA 4ZXOA 1V3IA 1H61A 1I6NA 3D0CA 1TTJA 4FNPA 5KZDA 2ZRZA 4BF9A 4GXMA 3G1AA 4BKNA 4GIRA 2Y7DA 1A4LA 2KX9A 4Z2IA 9XIAA 1LG2A 4GVGA 2YCJA 2E5CA 3NR0A 1FKXA 2G3NA 1GVYA 2O0TA 5BMXA 3LV5A 3A64A 3MA8A 1CNVA 3IIOA 3CUZA 3GR4A 1FCBA 5L6UA 3W7EA 1W1YA 4GH3A 3SBFA 2V6OA 2XIBA 4YWOA 4JTAA 4HOXA 1PPIA 3NQ6A 4IPLA 1PKMA 4QJ5B 3MUCA 1W2PA 1R2RA 1GT8A 2GVLA 4O4WA 1FQ0A 2J79A 2V5KA 3W7DA 3FVMA 1UWTA 3GD6A 3DKJA 3CZ8A 4DX3A 4KEZA 1S5TA 5IM51 2VFHA 2NSOA 4YHEA 2Z25A 1QCWA 5ABFA 1AZ1A 1MDRA 4S3CA 3QFBA 5FESA 3NQEA 3KHJA 4CCEA 5DX7A 2WWDA 4BCEA 1S38A 2D3LA 4HMEA 3QSTA 3CO8A 1BZLA 1FFVC 5TR3A 1AH4A 1DEDA 1F2JA 2YCLA 3LHUA 3VYLA 2NT0A 3KRSA 3T0BA 1Z89A 1FWHC 4IIEA 2DSWA 3GS6A 2VEIA 3BLDA 3RAOA 1WYGA 1GVFA 2BWGA 3H12A 1WCGA 3A5VA 4RJEA 4US5D 4BF7A 3E2QA 4H83A 4B5TA 3U4FA 2PWDA 4N6EA 1IEXA 3LM7A 3CUJA 1FECA 2WM1A 2V82A 5I00A 3DH7A 1H5YA 3Q58A 4N9DA 5DT5A 5A6TC 3MMTA 4O57A 5GRTA 5I3HA 5DO8A 4O28A 3VOGA 2E5BA 3B40A 2UZ9A 2E4TA 1AH3A 2OXNA 5LNRA 2HSAA 2PDJA 4A2SA 2PDWA 4AAJA 5XINA 2PF8A 2ALDA 4QS6A 4GQGA 2FH8A 2PMQA 1VS1A 3BK0A 5IHRA 2FJKA 2QXWA 4Q4PA 1EDTA 1W31A 3LD5A 1FHLA 4TTUA 2NX3A 3NQAA 4CQ8A 2QMKA 3BSMA 5D2VA 4LCSA 4KCUA 2JIEA 4EPEC 4LWWA 2PE4A 4QG9A 3QPYA 3HQNA 3NL3A 4HPXA 4PR4A 1EXPA 3NZGA 4GYPC 3M0IA 1AW2A 3B8TA 3P62A 3U2ZA 2VFFA 4A29A 3PG9A 3CU2A 2VZOA 4C1NA 2CDUA 3ZWTA 4L6OA 2DUXA 2OLSA 4PCTA 6REQB 1F8WA 2FFIA 3MHUA 3C6CA 3RO8A 1F3XA 1V7YA 1HO1A 1K8YA 4CQDA 2ZUMA 3M5XA 3BOFA 4J3ZA 4Z2JA 4RV8A 2W66A 3BWWA 2EBNA 1NF0A 2EHHA 4H8NA 1KM3A 1NQ6A 3MMUA 5LIWX 2VFEA 1QHOA 1JGMA 3WDQA 4GZIA 1IEWA 3N19B 3LLXA 3BV4A 1K9EA 2GUYA 4Z1BA 3UXDA 4UOQA 1EGMA 3RG6A 1O94A 4GUHA 4AF0B 1A3HA 2BDQA 4NNAA 1ZBKA 3S5NA 4W84A 4H2HA 3KLLA 2VCBA 2WHLA 1S2WA 1PX8A 2BVTA 3ITXA 4GD0A 2GQ3A 3IC9A 1XP3A 4B3LA 2WVTA 2VELA 3GC2A 4ZQCA 1A47A 3W7RA 1RA5A 3N2XA 3UWWA 4D8AA 3SGGA 1E70M 1A0CA 4URIA 3NZPA 3L67A 4GYJA 3S9IA 3ZLGA 3EX2A 3CQJA 5E70A 4ZXLA 1D3GA 1WQ5A 1MQPA 1WKDA 4C5YA 4D1JA 3O0KA 5FF2A 3OZMA 3LHZA 4MNJA 1HP5A 4DRSA 3L2MA 1DVJA 3YPIA 4FK9A 3KAOA 4DB7A 4NG3A 2XSBA 2VNCA 1AD1A 1RBLA 1U1HA 2CWNA 4OOUA 4JTQA 1EPXA 4JHMA 4GUFA 2PZ0A 3U2EA 3CJPA 1XF0A 5FJJA 4KWUA 2FZ8A 2YX0A 4QJ1A 1PCKA 3HB9A 3SY1A 4MNLA 5D32A 2BMBA 4ERIA 4H7CA 2Q8LA 1H09A 1T8XA 1DJYA 4IZGA 2DZVA 1W2VA 1OT2A 1V97A 3EWZA 3GTFA 2ZDRA 3SQLA 4M51A 1W3LA 2WP6A 3TQVA 1YNQA 2EPLX 4CQCA 4KKXA 4HPHA 1W8GA 2QCNA 1GQIA 1DE6A 4HPNA 1RCOB 4CU6A 3ZFHA 2J24A 1W3KA 3HG5A 3ITLA 3IJLA 3AN1A 2GGIA 1ZTVA 2IKJA 3CBWA 4HIBA 2X1UA 4ZTXA 2PWGA 2C18A 1SM9A 1XINA 2QUTA 2JGQA 4RKAA 4LUTA 1JF5A 2AAAA 2V3FA 4W7UA 2NVDA 4DHGA 4J2PA 4HYRA 3LY0A 3WUGA 5AHIA 2HMCA 4DM2A 1E40A 3V3WA 3WMLA 2VI0A 5HQLA 2W79A 2YA2A 4D6EA 4ZB2A 5E93A 2ZCGA 2FGLA 1KR0A 1J93A 1HJQA 4M6UA 4GX8A 1DV7A 4A6GA 3R4IA 2REQB 1GKPA 1XCXA 3H2CA 3CUGA 3ZR5A 1RLCL 2Y61A 4O18A 3T4CA 4RXGA 1UR4A 5K4XA 2FZNA 2INZA 4Y90A 3VNZA 2CLLA 4TUFA 2WPEA 4U5IA 3W1TA 3C8NA 1JCNA 2GGHA 4DQWA 3IS4A 2EF9A 2Z2AA 2QF8A 1BQCA 1GONA 1CXEA 4KS0A 2JEPA 4S3DA 3WNPA 3STEA 3RRXA 3SN0A 3KWSA 3FV9A 1KBBA 3FCPA 4HZ7A 5F2MA 2VGIA 4NF7A 1C9WA 2GLKA 3WJZA 1IXNA 4MNMA 4NZCA 4LUSA 2AOSA 3IJ9A 1FHVA 1OFAA 3S1WA 3WUFA 2QVHA 4XUGA 5JXQA 1S3TC 1PIIA 1KW1A 2QV5A 1VR6A 3C86A 5FJUA 1SU5A 3T55A 4PN2A 1WXZA 1EHAA 5JBFA 4REQA 1XQKA 3B8WA 3WMBA 5FJPA 1N8FA 2WOVA 1JDAA 3E12A 3S5YA 2QDGA 3TAOA 1WZKA 4IPIA 3VZXA 3D47A 4HU3A 4INFA 4QTGA 1U5VA 3S2MA 5I5RA 3ATYA 4LCRA 3TONA 3M0VA 1TQJA 5EY5A 4IF2A 2AAQA 1XXXA 1SZGA 1XLAA 3GD3A 3M5YA 3NURA 4DUXA 3VDHA 4LC6A 2EPKX 2W3ZA 5FS9A 1GHRA 4JTCA 3WBXA 2Q8ZA 2R1KA 3EWBX 1VKFA 4NJIA 3MZ2A 4HCLA 1IIGA 4Q8PA 3GIYA 1FH7A 1TX2A 1KA9F 1GREA 2GVYA 1GYNA 4HNTA 3NO1A 1V08A 3UW6A 5D38A 2YQUA 3IJ8A 1WV2A 1S39A 2OSXA 1RQHA 3BLEA 1XR2A 1TO3A 2VR4A 1VYPX 2GQ8A 3SCNA 3VIFA 2WPFA 3T81A 3N25A 4PSRA 3PP7A 2E0PA 4M8UA 2WJZA 1UWQA 3VGBA 4EQSA 2WK2A 3A4JA 4Z1CA 3QY6A 2WHJA 1UR0A 1DWFM 4R85A 4YS1A 3ABOA 3STCA 3MY9A 5A8QA 4GXPA 2V63A 1O6IA 3NG3A 4JDYA 4J56A 3PJUA 4O14A 3N4AA 3MT1A 1W5QA 3CV7A 3G22A 4H6KA 3EF6A 2D0HA 3INPA 1CENA 4GI9A 5C9ZA 2CLEA 1I2OA 1YADA 1XDMA 4EF8A 1Z48A 2B0MA 3UF9A 1L6SA 7TIMA 3QQ0A 3BZJA 4ZO9A 1NWUA 2VP8A 2VGGA 4UNKA 4NZ5A 3DYMA 4NHVA 2QCLA 2CC0A 1YW1A 4JFSA 5FJRA 1TCMA 3KDOA 3OA3A 1PB0A 4Y9AA 3DCPA 1DTNA 4HTYA 3CMGA 3KBWA 1M7XA 4DUWA 3HV9A 3RITA 3SUWA 2VURA 5L9FA 2WOIA 4LB4A 2ZZ2A 4JFTA 1BAGA 3QLLA 4XZBA 1XIMA 4H1ZA 4I5XA 2WBKA 5MKGB 3ANUA 1PSCA 3C8FA 1T6MA 2PS2A 1ZZMA 4IMAA 1X2GA 4DZHA 1UHVA 2DDXA 2OLHA 4UQEA 1LLWA 5BU6A 3O0HA 1DHPA 1TELA 2YIHA 3CASA 1XL9A 3SCQA 3H4KA 1UIPA 3CZKA 4IMFA 3WNOA 2OEKA 3GNRA 1BRLB 3PBVA 5G4EA 4ZR8A 4MJMA 4QE1A 2NXHA 3OJGA 5H8PA 4JFVA 3DG6A 3SY8A 1A4MA 2ZUTA 1MMFA 1NY1A 3EX6A 3T07A 1Q65A 4FHAA 1NPXA 4AD0A 2NXGA 1WZLA 1DBTA 3SCWA 3OVRA 1B9ZA 1W17A 3UQNA 1MXDA 1E6QM 1JPKA 3UJSA 5ECVA 1W91A 3PJWA 3U8GA 3S0CA 1JIBA 2QPSA 3E49A 1N8WA 1US0A 2PC8A 2VR5A 4BF5A 1KTNA 3QKEA 3SUUA 2KAUC 2V3BA 3PAOA 3PUGA 2E9BA 2TPSA 3L8KA 2HNHA 2XSXA 1H0IA 1US3A 2DZBA 3EX1A 1V6YA 1XLLA 1Z44A 1KWKA 1TPEA 2VRQA 1KKRA 4AISA 4WOQA 2YB1A 2NPXA 4LEQA 2YZRA 4F66A 1DXIA 5T8GA 3GK0A 3EOOA 4LC8A 1DQUA 3BQ6A 3H24A 3MZNA 2VVSA 4JYDA 1A3XA 4HA1A 2FPYA 4F79A 4AX6A 1YNYA 2AMGA 4AHQA 2HRWA 5F2LA 3QM3A 4C90A 3A3HA 4C6FA 2FB3A 4C60A 1XLMA 1DWJM 4F4RA 3DGHA 4GGHA 3EKGA 4J57A 1EUNA 2DVXA 5LNVA 4QLKA 3NAVA 3RHGA 1ZK7A 1DYSA 3W7NA 4I7UA 4F0SA 4GIAA 1MVYA 3WQCA 2Y85A 3ISIX 1UR2A 2VFIA 1AW5A 2F84A 3NCOA 3A9IA 1XRVA 2YW4A 4O1BA 2DIEA 3PTKA 1MFVA 2ZZ4A 3LXCA 4L7ZA 3WQEA 1MXSA 2V81A 2QUMA 1TIWA 4Q3MA 4EMJA 3HQOA 4JN8A 2VZUA 4RZ4A 1B90A 1L8NA 1CXLA 4Z08A 8XIMA 1OQFA 3GIPA 2ZZ7A 3I4EA 1N7KA 1HGWA 4GJJA 4XQ6A 3I7QA 1S1PA 3LN3A 2PA6A 3WL0A 4UTWC 4FOJA 1SJBA 3NQCA 5HWMA 2DVUA 1SB3B 3WUBA 1TMHA 3UA4A 3B9NA 3UPMA 4X9SA 1VP5A 3UPBA 1LRQA 2INEA 4U28A 3PPGA 4LS2A 3G1YA 1YRRA 4B4HA 2Q3OA 1QPOA 1KWGA 3D3FA 1PZ3A 3WELA 4QJ3B 1VAHA 1XG4A 3P14A 1Q6FA 4JTUA 4YVPA 2FGBA 1IEIA 1TVPA 4MB4A 3L5OA 5AHEA 2C0HA 4BURA 2ACQA 3IV8A 3W00A 1PJ9A 5DFAA 1UR8A 1VJZA 2DVTA 3W70A 4J28A 4BI5A 3TEVA 5SWUA 3GW0A 4EMIA 3HO8A 3DK9A 5C9UA 4V15A 2YXOA 4JNMA 3OB8A 2Y0FA 1PZ1A 2GJNA 4QIUA 3DC0A 2W92A 1UBSA 3KTCA 3PR2A 2FZDA 4B3ZA 3TN6A 1EBGA 1V6XA 3OVPA 1W1VA 1CZ1A 4L1WA 1MUCA 4O54A 2J6XA 3E9AA 3VC6A 3K8LA 4CN6A 1CLXA 2F6KA 3P6LA 4JN7A 4NJJA 2ZUWA 3IJ7A 3ERPA 1FRBA 1FEBA 4EIVA 1EZWA 2XH4A 4RUBA 5LHFA 2GR0A 1KQZA 2GVEA 4GKLA 5HULA 4XKYB 3G8EA 2J9ZA 3M0HA 2A7PA 3SR7A 3EMZA 1N63C 1Z3NA 3VFCA 1GQJA 3N12A 3FOKA 4RDWA 3OVQA 3O15A 3ZS4A 1QPKA 4ICCX 1CI1A 2J9YA 2EG6A 1V6WA 5AC5A 2DPEA 3GTIA 5HJLA 4ACZB 3GFZA 4JAWA 3PAJA 4ZOEA 3MSDA 2C13A 2OZ3A 1IEVA 1C8YA 1GVSA 1SJAA 3E5PA 3VD9A 3HW2A 4KFNA 4ZO6A 1IXOA 3W2MA 2WKJA 3OLDA 1OIFA 3F7JA 3BDKA 4OKDA 1TJ0A 4NI3A 3H7RA 3QV7A 4GY1A 1LWHA 1QU4A 3WMCA 1O68A 3CAKA 1XCWA 3E0FA 1G1YA 2A3LA 4GCXA 1UUQA 1OWQA 4N4QA 4XO7A 1TB3A 3UWUA 1OX4A 4PODA 3D9XA 3HPAA 4IL2A 3NQGA 4KIRA 4ILSA 2OSWA 1EJRC 5XIAA 1W3IA 1DWAM 4XD4A 1VBJA 2H3BA 1XGZA 1V7AA 3MWAA 3H2FA 3NZRA 4TVCA 4AY8A 4NJHA 3KRBA 3HA1A 4O15A 1WKYA 1XRTA 3UU0A 4BWLC 1EIBA 2G3FA 4PUJA 4S3KA 3H4GA 1TJ2A 3M0ZA 1FDJA 2X8HA 4CCCA 2X41A 3GVGA 3NQDA 3TCEA 4WSJA 3GYEA 1OB0A 4HOZA 3H4WA 4P8XA 4HHHA 3PM6A 3NIYA 2HBXA 1CGWA 1KFCA 1UCWA 4GISA 3WMSA 3O16A 3PZMA 4HYWA 1NTHA 2CWXA 2IKGA 2PGFA 4QEEA 1K6AA 4O12A 3AXHA 2FTWA 1CCWB 3E0IA 3AMLA 4F0RA 5FJIA 2X2GA 1TJPA 4IJCA 1TA3A 3WYZA 1TE1A 4B5NA 3BUVA 2P76A 3DBPA 2OJPA 5BOFA 2NVCA 2ZXDA 2GDQA 3IAQA 4FXJA 4AFYA 3THUA 4I8DA 1X1ZA 3KVKA 5I3FA 3AS1A 4EAMA 6CGTA 5LIYX 1PX3A 1FHUA 3G0UA 3WLLA 2YAUA 1QBBA 3K46A 3BOXA 4AXKA 2ZXAA 4N6FA 5B80A 4UTJA 1G4SA 3BARA 4PEKA 5CC3A 2EJAA 1NFBA 3UY8A 4AVOA 1LPFA 1YE4A 1YDOA 1KD0A 3REQB 5FL1A 1SR0A 4E8DA 4IX2A 2Z1BA 2HE8A 3GRIA 4WSHA 3POCA 3EDKA 3F2CA 4O17A 5A5WA 4H4YA 4HK5A 1NHRA 1FWDC 1UKPA 4ASTA 4ATDA 3DXIA 3EB2A 2OB3A 3K2GA 5HJYA 1QUMA 1EH9A 4XAZA 1D7FA 1W5OA 2EJ1A 5KINA 4D6DA 3IGSA 3GDBA 1XIIA 1BSLA 1JRBA 1AH0A 1QPRA 4WXZA 2TMDA 2Z4GA 3G2GA 2PTZA 1AW1A 3PC0A 4U10A 2GFTA 3WLHA 4Y9PA 1XFBA 3P61A 1FVPA 4H4UA 1E4LA 3HU7A 1EXBA 2HEJA 3MO7A 3FSTA 2J27A 3CYJA 4M7SA 2Z0IA 3GC4A 3FXGA 1SFJA 3ARWA 3FG2P 5LHEA 3FY1A 3A3XA 3LI1A 4I7WA 1E1CB 3T44A 2G3JA 1R3VA 3V0SA 5I03A 2TAAA 2WYSA 4K7ZA 1T7LA 3L5LA 1LWJA 1VHNA 1VBUA 1N5XA 4UTIA 3TC6A 2PDXA 1WDWA 3S9ZA 2PTYA 3GDRA 1R3TA 1JZ7A 4LA1A 3RNDA 4WK9A 1P0DA 1E9YB 1ITQA 1XH1A 4DBEA 2XFYA 4L9XA 3KBJA 4GNJA 3LQLA 4DJDD 1UMLA 2HPIA 3IANA 4Q8NA 2RAGA 1X98A 4QE4A 3DFTA 1D8CA 4LEFA 4HNOA 2A79A 3N2MA 4CNUA 2YKKA 2F5ZA 3KLKA 3C0QA 1XFCA 4GY0A 2VOMA 1WXJA 1XLBA 2DUAA 5I3KA 2EQ6A 2A85A 2PURA 2WJEA 1D3CA 2OODA 3C3NA 1XBZA 1H2IA 2GSJA 4WY0A 3C2YA 4WDXA 2QDEA 4IGSA 1RXOB 4NYYA 5I07A 3LSCA 4W86A 1VFFA 1I2PA 3QOKA 4G5DA 5TAOA 3WFAA 3WBWA 3M0LA 5HDRA 1MO0A 3ABRA 1KBLA 1GOXA 4CU8A 3BW4A 2CITA 3B03A 1Z8AA 1HJUA 2DT3A 4XZ9A 3W7PA 3SRHA 3KWXA 3E2RA 5LIXX 3E02A 2DT2A 1B3VA 4AG0A 4UMBA 1TV2A 4O13A 4MGGA 2WBGA 4AD2A 1XPGA 2NWRA 4S3FA 5K9XA 3FEQA 5IXEA 5M2FX 2A3BA 3ANYA 4IXHA 4GWEA 2BGSA 2V9DA 3PG8A 4IT1A 4DF1A 1T41A 4TVYA 4DJDC 5DCDA 1M41A 4D6IA 4X63A 1JQXA 4NZJA 4TR9A 3CEUA 3WD4A 3PBWA 2ABBA 1GV4A 4DYEA 2W55A 5REQA 1AZ2A 3GVQA 5G1MA 1F8MA 1E6ZA 2R9RA 2A1YA 1TFVA 1J11A 3BLFA 2FGZA 4B4FA 1SFLA 1PEZA 4JIIX 1SSGA 3W4RA 1FO4A 2YBTA 4E6MA 3TLLA 3HPXA 3ABZA 4OVXA 2WPCA 5AC7A 4MWAE 4Y6GA 1BF2A 1QNSA 1V3HA 3L4TA 5CPSA 5HNNA 5FAJA 3HJZA 2DQXA 3VOCA 1ZRQA 1XISA 1WUEA 2FVKA 3LCWA 3TTOA 1S7MA 3WQPA 1GRGA 1R3WA 1W9PA 4F8XA 1D7YA 3NSMA 3S4TA 3AMKA 5BXPA 1KM2A 1K7FA 3QY8A 3THCA 3VAVA 1TTQA 1OM0A 4RW5A 1BD0A 2W9MA 5A2AA 5KTLA 4NI8A 2NXIA 3RM9A 3M44A 3W22A 7A3HA 1GJWA 1EZ2A 3M4HA 3FJLA 2E9MA 3AMGA 1YE6A 1WDPA 4M6PA 4JTJA 1WBJA 1ODUA 2NSXA 5H6HA 2HDJA 3OZPA 1JCXA 3BAWA 3TYEA 2NLIA 4MB1A 3LPFA 1IHIA 4GRSA 4GNKB 4DJEA 3WQGA 4ZO7A 5JUVA 3PF3A 1E6NA 2YSWA 3S83A 3RNMA 3IUDA 4B3KA 3TWAA 1XKYA 1LORA 3S6OA 4O1FA 4PTWA 2O55A 1MW2A 1SMDA 1UPPA 1G4PA 3UWZA 4DNMA 4JPGA 4NQ1A 1VCFA 3KOZA 3NXLA 3S47A 1QOXA 2G4JA 1Y0EA 2J7GA 1JGIA 4NL1A 2BBFA 3GAKA 1LQ0A 4EP8C 3QSRA 1KLYA 3WO8A 4RW3A 4O52A 2UY2A 3V0TA 3MP4A 4OBRA 1LT7A 3LK6A 4FX7A 2C3ZA 4MIMA 2QJNA 5KEZA 2E8ZA 4UR8A 4MYXA 3B9OA 3UZWA 1ZU8A 1WE5A 3KOXA 2WZHA 3JZUA 2NQ5A 1ZJBA 3N6QA 1X8FA 4E8GA 4TU1A 1HVQA 2DZAA 1F3WA 2PU0A 5BXTA 2ZXBA 3SO7A 3UR5A 1B5TA 4Q8MA 4XSLA 1PKYA 5M03A 4IIDA 1WUFA 2QCDA 1GRAA 3QR3A 3W85A 3O6DA 4ZL1A 5AYIA 3AO0A 2E25A 2IPGA 3M6DA 3PJXA 3ZR6A 1P48A 2IQTA 3QFWA 3OEXA 4LU0A 5A3HA 5JBEA 2DH2A 1LZOA 4NKCA 1RBOB 4BS0A 1RCXB 2J88A 4MTVA 4B2DA 5EBKA 1A0DA 1F05A 3I6RA 2PLCA 4J3SA 1L6YA 3AALA 3COTA 3A5FA 3K13A 2PD9A 3PTDA 2DJXA 1OT1A 2DU2A 4NXSA 5JBDA 3R8HA 4OT7A 3UCDA 4EWND 3BH4A 2ZC1A 2QV4A 2GJLA 2OWWA 7TAAA 1E43A 4KEVA 1VFOA 2D3NA 3VNIA 1BPLB 5IBXC 1JAKA 4ERAA 4H6RA 4WF7A 3GU9A 2H3DA 2FZMA 2YOCA 5EU9A 4JNYA 5HNTA 4BA0A 2XFRA 3RLUA 2P1FA 1HN1A 4FNSA 4MWAA 5XIMA 3N9SA 3CV1A 3B3DA 1OEPA 2D2JA 3SY5A 1ICQA 5RUBA 2C15A 3SUSA 3JVAA 3N3MA 1CGTA 5FMHA 3WJXA 4Q4QA 4MPQA 4LBSA 2B7QA 4OBSA 1HG3A 1J0IA 2YW3A 3RM8A 3ZVHA 4OE7A 3C52A 5ABFB 2Y8VA 1VHCA 2BNJA 3E0WA 3W38A 3UJRA 1F73A 3WF4A 2DJLA 3BV7A 1LBMA 5GNXA 4HMNA 2DW6A 3TN4A 1W3NA 4IQDA 1CGVA 1E71M 1TPB1 2YCLB 3HFTA 2XGZA 4DWSA 3IAPA 4Z1DA 3TIMA 4TIMA 5CGQA 1XIGA 2WSYA 3EA1A 1QK0A 2AL2A 3AU6A 2AAMA 1JZ8A 5AOUA 3AS0A 5D9OA 2PDFA 2VEKA 5D8WA 2CYGA 2PDYA 1W54A 2QPXA 4A8RA 1BSIA 5EBAA 3N6HA 1RQBA 5B7YA 3OP2A 3QMRA 3TOYA 1M5WA 4WVXA 3AHZA 3EDDA 3PZOA 4PE8A 2VUYA 5JCKA 3ZSSA 5HWNA 3I7SA 1AOGA 1WDSA 1M7OA 3AC0A 7CGTA 3DH9A 2CPUA 2HQAA 4U2ZA 3PNUA 1EP2A 4F9JA 1GCYA 4KQNA 4ZA0A 1F76A 2EPNA 2I57A 3MCMA 1VPYA 4RE4A 4Y8EA 2QAEA 4PTMA 4J3XA 4F0LA 4TV5A 2E1WA 1E3ZA 4C1NB 4ZQMA 3NQ2A 4L61A 2H8XA 2G3MA 3ABXA 4LSBA 1XD0A 3W72A 2V2DA 1JPIA 2J7CA 3KE0A 4EQWA 1OX6A 4X2PA 3GXFA 3G24A 3VGHA 5C6MA 1B3ZA 4WR3A 3GHTA 3APTA 5A2BA 4XBKA 1KKOA 3CHFA 3NQVA 3NZ1A 4JIQA 4JQ4A 1E15A 1JEZA 1P6CA 3CK5A 4IPNB 2W3SA 1A5NC 4C6MA 5I24A 1MNSA 7ODCA 3AMZA 3U0HA 3EKLA 5BYWA 3XINA 4YHGA 1LLOA 2YCKX 4N7QA 8A3HA 3HRDC 3W25A 4H04A 4MZYA 4PULA 3NDZA 2DSKA 2OYMA 1CPUA 1SMAA 4H2CA 5D9NA 4LB3A 3N2OA 1CDGA 4ZODA 3SFKA 2ZWZA 4A8NA 1K3UA 1LOSA 1VENA 4MG4A 2WSQA 3VK5A 1YLVA 3SRKA 1TYPA 4LVAA 1W1TA 2GQWA 1QK2A 2PB1A 2WBAA 1XUUA 5I7GA 5FCZA 2F9RA 1V6VA 2ZZ5A 1QW8A 2WNQA 2BOFX 4PBEA 1R7OA 3NVYB 4JIHA 3KEHA 3LCXA 4AWSA 5FS6A 4WD0A 1B30A 3N17A 2I9EA 4I3GA 4JEQA 3L4WA 2RJGA 3W26A 5KETA 1A80A 3ABQA 1ZLPA 4Y8FA 1J5TA 1E0UA 3POHA 4YCPA 2FHFA 4JQ9A 3WD1A 4PUUA 1PVNA 4I7VA 3BLOA 3BOLA 1XV8A 4RE2A 4RXFA 1HNYA 3PUOA 1EWEA 1UWRA 4PTNA 3KZSA 1FWIC 2A3AA 3CNYA 5FS7A 2Y62A 4HMCA 1WKEA 5AZ1A 4MJZA 2C79A 3H55A 1A5LC 2DT0A 1OX5A 1U83A 1GYMA 2B7OA 1GNXA 3KL5A 3URQA 2PBOA 3CAVA 2PSNA 3AROA 1W1B1 4LUTB 4K37A 4JFUA 4AEEA 4MM1A 3GUWA 6XIMA 3H7UA 9XIMA 2Y89A 3ZLHA 4J9JA 4YTSA 3FLUA 3KBNA 2PWVA 1JFXA 3HF3A 1HKKA 1TWZA 4P8VA 3IIPA 3F4DA 3NVWB 3E2SA 3T7VA 4ZSUA 5BXSA 3I6TA 4Q22A 1VFMA 4OV9A 2FB2A 1UB3A 2YYTA 2UBPC 3ZT7A 1G5AA 3MKCA 2I7GA 3C2RA 3O0FA 4GI6A 2XN2A 2O9OA 3QHOA 4C6QA 2YLLA 4IP5A 3H26A 1ZY9A 4RR4A 4EXQA 3UWEA 3MS8A 2D24A 3V1PA 3HZ3A 2DGAA 3C56A 3CQIA 4W7WA 3WBEA 5FIPA 3UETA 1N5WC 1Q85A 3A6OA 2PP0A 4WIWA 4D6FA 4R3UA 3W53A 1KCZA 2IQ0A 1XIBA 4V27A 3RM4A 4ZB0A 4UFJA 4FLQA 3NPXA 4HU0A 3DESA 4Q33A 3ZR4A 1J96A 1M01A 2ZZ3A 1PDZA 4LUSB 3P3BA 4L6DA 3GZAA 3NQBA 1DJZA 3P8JA 3OBEA 2JBMA 2J9XA 4CQBA 4DJFA 3RO6A 2WLZA 4ZENA 4GY7A 3MANA 4H7ZA 4MLJA 3ZT6A 1GUVA 4REQB 1ONEA 2G0WA 3H54A 1EJUC 3TA6A 4NASA 4NEVA 3EWXA 2BY2A 1QNQA 2PDMA 3LEPA 4WKFA 3CM4A 1UBPC 3BAXA 3TYUA 3K8MA 5BOOA 2CETA 2OZ8A 3W1NA 5LGZA 1BQGA 5G1TA 3GXDA 2F61A 3DI1A 3FXYA 1RZMA 4CN4A 5DMYA 3CIXA 1ZFJA 1SO6A 1TVNA 1FP9A 5JIWA 1KFJA 3C2OA 3P60A 4QP0A 1U33A 3WF2A 3WK1A 3VILA 2MUCA 3EOEA 4PCFA 4NT0A 3PBMA 5EL1A 4UFKA 2WANA 3AMCA 3P0XA 1QRQA 3LNMA 3WQ6A 2ISDA 4YCOA 1ITXA 1MQQA 3CLMA 4M56A 3TOPA 4D71A 1MRAA 5EBUA 2DUZA 1BWLA 4ZFMA 4IQJA 1DIDA 4XZIA 3R2GA 2XDFA 4EXBA 4O1DA 2OLAA 3ICJA 4HBKA 3V7PA 1MO9A 5FF0A 2X05A 4ZVJA 4A3RA 2IPWA <