3JVAA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 121
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jvaA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jvaA01
2XSXA 2OLAA 2MUCA 3R10A 6ENLA 3IK4A 3HPFA 3CYJA 4Z1YA 2OZ3A 3RGTA 1L8PA 4X2PA 3DG6A 3UXLA 4H2HA 2P8CA 2P0IA 2QJNA 5EU9A 2XH0A 4K2SA 1XPYA 2OFJA 3VDGA 3D47A 3TJIA 3OP2A 2OZ8A 3FYYA 4IP5A 3VCCA 2FYMA 2DW7A 3QTPA 1FHUA 3BSMA 2OQHA 3V5FA 1YEYA 3EKGA 3SSZA 2OX4A 3UCCA 4J1OA 3V3WA 3MUCA 3R0KA 4M6UA 2CHRA 3RO6A 3P93A 1MRAA 2PPGA 1EC8A 4IT1A 1E9IA 1ECQA 3P0WA 5FJTA 2GGEA 3IJQA 3T9PA 3CAWA 1KD0A 4K8GA 4MMWA 1JPDX 2O56A 3SJNA 3NZGA 3ES7A 3V5CA 2PSNA 3R25A 2GGJA 3MZNA 4HPNA 5FJPA 3EEZA 2POZA 1EBHA 3TW9A 3CK5A 3H7VA 4A3RA 4E4FA 1XS2A 1OEPA 3U9IA 5J04A 3CXOA 2OQYA 2QVHA 3Q4DA 4HYRA 2PGWA 1BQGA 3GY1A 3RR1A 3FV9A 4DXKA 1EBGA 2HXTA 3Q45A 1SJAA 3BJSA 4IHCA 2HNEA 3S5SA 4A6GA 4KT2A 1FHVA 3TWAA 3RITA 3BOXA 2ONEA 2AKMA 3DGBA 3ZLHA 3H8AA 4JN8A 2PODA 3MWCA 4E4UA 3N4FA 3R1ZA 3RCYA 1EC7A 3GD6A 2PTZA 2NQLA 3OZYA 2OPJA 3UXKA 3ENLA 5FJUA 1TE6A 2QJJA 3OPSA 4FI4A 1MDRA 4MKSA 2QDEA 2QQ6A 1TZZA 3I4KA 4DHGA 3PWIA 3TCSA 2DW6A 2OZTA 2PP1A 3UJFA 3FXGA 1BKHA 2GDQA 3OZMA 1PDYA 3JVAA 1NU5A 3DEQA 3CT2A 3UCDA 3H12A 2P88A 1IYXA 3DFHA 3MKCA 1R6WA 4JHMA 4H83A 5ENLA 3MQTA 3S47A 3DFYA 4GGHA 3R11A 4H19A 3P3BA 2PS2A 1EC9A 2PA6A 2PP0A 3U4FA 4GYPC 5FJOA 1ELSA 3TOYA 1F9CA 2GGIA 3VC5A 3SN4A 2OO6A 4IL0A 4E8GA 3NXLA 1R0MA 3DDMA 1NELA 1MNSA 2OKTA 3ZLGA 2AKZA 2QDDA 3H70A 2HZGA 4E5TA 7ENLA 2PCEA 3FVDA 1PDZA 4JN7A 4KPLA 4IZGA 3DERA 4IP4A 3K1GA 4HCLA 4EWJA 3OTRA 2OVLA 4Z17A 3T8QA 3R0UA 4M0XA 4HCDA 4E6MA 3PWGA 2PP3A 4ZA0A 3DG3A 4KEMA 4MGGA 2GGHA 1SJCA 2XH7A 2PMQA 1JCTA 4G8TA 2PTXA 3UJSA 2HXUA 4HCHA 4F4RA 3GO2A 4K1WA 3N4EA 3NO1A 4DWDA 3SQSA 1KKOA 3I6TA 3DESA 3ZLFA 2RDXA 3UJEA 3ZVHB 1SJDA 3ZVHA 2ZADA 2GGGA 2P3ZA 4H1ZA 1RVKA 2PTYA 3UGVA 4GMEA 3SN0A 4ZCWA 5BOEA 1WUFA 3PK7A 3NFUA 2I5QA 1KCZA 3VA8A 2QJMA 3V4BA 4HN8A 2MNRA 4DX3A 4FP1A 3N6JA 2GL5A 4G7FA 3MY9A 3QN3A 4KWSA 4IL2A 3QPEA 4DN1A 1MDLA 3QLDA 1SJBA 5IDZA 1P48A 3TTEA 2PU1A 4GIRA 2AL2B 3DIPA 2AL2A 3VC6A 3FCPA 3UJRA 3FJ4A 2FKPA 2XH4A 1TKKA 5BOFA 3SBFA 3JW7A 2AL1A 3UJ2A 1WUEA 3SN1A 2ZC8A 2XH2A 1MUCA 3QKEA 2GSHA 3TJ4A 3ES8A 3B97A 4ENLA 5FJRA 1W6TA 3MSYA 4ROPA 4GYPA 1P43A 3N6HA 4GFIA 2OG9A 3KUMA 3DG7A 3PFRA 3IJLA 4GGBA 3RRAA 4HNCA 3GC2A 2PU0A 3ZVIA 2PGEA 2XGZA 2P8BA 3I6EA 3STPA 2PTWA 1JPMA 4A35A 4DYEA 3TQPA 3D46A 4YWSA 3JZUA 1JDFA 3T4WA 3IJIA 4GISA 3VCNA 3VFCA 2QGYA 3THUA 3T6CA 1DTNA 4HNLA 4J3ZA 1KKRA 3CB3A 3TWBA 1ONEA 3OW1A
chains in the Genus database with same CATH superfamily
5IFPA 1JFXA 2WNZA 2XSXA 3LHVA 2J3NA 2MUCA 3BLOA 2BP1A 2JBMA 5M2FX 4W7VA 3AU2A 1JF5A 2GJPA 3EXSA 1DWIM 2KX9A 2W0UA 1J5TA 3D0CA 1KM2A 2BC0A 4GNVA 4Y8EA 3WLOA 2J6VA 4LVBA 4ZBCA 2YZ5A 2ISSA 3D47A 3IIZA 4IIFA 1KGXA 3TSDA 5D02A 1RPXA 1Q6GA 2VCBA 2GVYA 1CXKA 1AOGA 3PVFA 2OQHA 1GRTA 1NWUA 2HWGA 4WDUA 2QCDB 3DK4A 4OIFA 2V5BA 2WCGA 4QLKA 3MUCA 3S1GA 5LIWX 2ZYFA 3L12A 4M6UA 2BGNE 4L4OA 1R9XA 2I56A 5CC6A 4EPKA 3MMWA 4LEQA 5EBKA 3WCZA 3VPLA 4AEOA 2ZIDA 1VH7A 5A6BD 3W3OA 1M53A 3R25A 1N5WC 3NVZB 1VC4A 1QU4A 1K7XA 2Z1SA 2DV0A 3SCSA 3OG3A 3E0VA 4Y9NA 1XS2A 3B40A 4P5UA 4IGSA 7A3HA 4I6KA 4XAPA 3W1RA 1I60A 4JKKA 4PBGA 1TO3A 4DAFA 1XF0A 2CLKA 5BMWA 1DPMA 3NTYA 1S39A 3GY1A 4GBDA 4GH1A 5ABFB 4IHCA 1BWVA 5D2WA 1YDOA 3A5FA 4E2BA 3PBVA 1H60A 4F2UA 3M16A 1IQ8A 5U25A 2IXVA 4AVOA 3L4YA 4S2BA 4JTHA 4MIMA 3GH5A 2A85A 5DCDA 5DRIA 3P5YA 5EPDA 4JIEA 1B4KA 4WY0B 1JQVA 4JN8A 3AXXA 3W7QA 4W88A 4MWAC 1ADSA 3M4HA 1OCBA 4DBUA 1UWUA 3R8HA 4XIMA 1OFOA 2WVVA 3GD6A 4GUGA 3VKBA 4GH3A 1R87A 1I6NA 1TV4A 2ZRVA 4TO8A 4C1KA 3KEHA 2DIKA 1JZ4A 1M04A 1JZ2A 5EFFA 4NILA 2PC4A 3LV6A 1DXFA 3CL7A 1XW8A 3FEQA 2HISA 4UOZA 3GD3A 2X8RA 3TCSA 1UASA 4PL1A 1VEMA 2QIIA 3FXGA 4HZ7A 3PR2A 3RNDA 3GTFA 1PCWA 2SFPA 1GOKA 1XLFA 1TFVA 4Y9OA 2YCLB 4ADWA 3MJMA 3UXIA 3RM4A 1W8GA 3PG9A 3B9OA 3IVUA 4H83A 4H9VA 3LYEA 3V1PA 5DY2A 2Z1BA 3CZEA 3N9KA 2IUZA 3CMJA 3ARSA 5LNSA 2PDBA 2GOUA 1CGTA 1D8WA 1UKTA 2DP3A 3WQWA 4MJMA 5C70A 3I7RA 4KFPA 1EP2A 3TOYA 4Y6GA 1FWNA 3PY2A 3W7MA 5A8QA 2NQ9A 4KCTA 1W91A 2J78A 1GKQA 1EQCA 2X1UA 4MWAD 1GETA 3LD5A 4WRHA 3E5PA 2XVKA 4PTXA 4LH8A 3KRBA 2EEXA 2GYIA 4JAWA 1M41A 2ALDA 4E8CA 1OQFA 3F1QA 2ZE0A 1S2TA 1V6VA 2DIEA 4LSBA 2W3ZA 1T96A 3PNUA 2PLKA 4L1WA 3TJXA 4C7GA 3TTOA 4MGGA 4EQXA 3QGAC 4LUSB 2IMRA 1K3UA 4XD4A 3NPWA 2ZRUA 4UFJA 1TV8A 1UH3A 3FG2P 1EDTA 1MEHA 2A7RA 1MO9A 1KKOA 3W1NA 4MWAB 4WDXA 2PZNA 3GYEA 3ABSA 1HFBA 2E6AA 2ZADA 3FGCB 4UBPC 4M80A 2PTYA 2Z2BA 3ARPA 3D6NA 1L6FA 2V82A 1QW7A 5D4YA 1ONXA 3SURA 3TZFA 3IRSA 4C6OA 4JTSA 3O2LA 3RFAA 3WBYA 1SO3A 1FWIC 4TX9A 4DX3A 3W85A 2J75A 4OE7A 4AIOA 3QGKC 1MDLA 3LGEA 3VGBA 1B0IA 4C6PA 4GIRA 1WV2A 3EMCA 3NQEA 3VM5A 3O6CA 1WYGA 3MP5A 4MAVA 3VNIA 3DK8A 2FLIA 1WXJA 4UMBA 1XBVA 4UNLA 4DJED 3SN1A 2CLEA 4HU0A 4JTAA 4EP8C 2E5AA 1F3XA 4QDMA 3P84A 3K4DA 2FZBA 3WUEA 2PDMA 3N6HA 2A2IA 2E3TA 2WLYA 1E0UA 5HJXA 4DO6A 3A9IA 4HN4A 3HN3A 3L0NA 4HNCA 3FOKA 2QPSA 5CLTA 3ID7A 1ZBWA 2WJDA 4H9UA 3THCA 5HMEA 2CETA 4B5NA 1RBLA 4E8DA 1NDVA 4QCEA 4PB4A 1VBHA 3BG9A 1OT2A 4M56A 2INEA 4LRSA 3VGGA 3T4WA 3TW6A 3NQDA 3AXMA 2BVDA 1W1YA 3G0SA 4RZ6A 1DTNA 3VIJA 4GJJA 5A6TC 3JU2A 3W27A 1EUAA 3CT7A 4FX8A 1NFBA 1BRLB 4H2CA 1EGVA 3U7BA 3DYMA 1NDAA 4FLRA 4U33A 3WUBA 3PZOA 1UOZA 2XFFA 1WA3A 4GACA 2OU4A 5HDRA 4ALDA 1TTPA 1KR0A 1L8PA 2RUSA 2CXGA 3RX2A 2FHCA 3U2CA 3FVMA 4XBJA 5FL1A 1HJSA 1CB7B 5BU9A 4GUJA 1EP3A 3OC4A 4IFRA 5BXSA 4PA8A 2PDLA 4LAOA 3W2MA 3GG8A 1F73A 3POHA 1HJQA 1PTGA 2YQUA 3PUGA 4O57A 4QSHA 1W54A 2DT1A 4G1NA 3GX9A 3QV6A 1QNPA 1EJWC 3TZNA 5FACA 2FDMA 2OYLA 1P7TB 3WEOA 1UYQA 1XIDA 3G0XA 1X39A 3GXNA 5M3WA 3IJQA 1PKNA 4AG0A 4B90A 2A3EA 1R3SA 1L6SA 2P10A 5CEWA 6PTDA 2HBXA 1TWSA 5D32A 3NZGA 3WLNA 3THAA 1V03A 2ZFAA 1TCDA 4CD5A 1M7XA 3W53A 4LBSA 5DBUA 4AZ7A 3LPFA 3WF3A 3L5LA 3WEMA 1TWIA 3LI1A 2DVUA 2QUMA 1FOBA 3DH7A 4N6FA 3TYEA 4QNEA 1HZYA 1WAUA 3CXOA 3WQCA 2OQYA 4N42A 4QNWA 1IGWA 3QM3A 2AQWA 1A4MA 3QV9A 1EJSC 2J7DA 1OWQA 1H7RA 2Y63A 3FV9A 5G4EA 2B7PA 3CAQA 4U3AA 1A49A 2H8XA 3MUIA 4L4PA 3SRFA 3MPGA 4I3GA 1FHVA 4RKAA 2YR1A 1Y7VA 3DGBA 1L2UA 4FO4A 2TPSA 1EA9C 1A0DA 3GTNA 1W8SA 4WUIA 2CBVA 2FVMA 4HQVA 3LLDA 2F2KA 3DI1A 1FXQA 3TA6A 1VP5A 5I5RA 4QAWA 3TR2A 4UQDA 2OSWA 3UVIA 3N04A 1RLDA 5EMYA 3UYIA 1IEVA 1XDLA 1F6KA 1P1XA 3CO4A 4GY7A 4F0MA 4IH3A 4JQ2A 3W2JA 5AC6A 3SY8A 3JUGA 1GEQA 4F40A 3I4KA 4FOKA 3GKFA 1VBJA 5I3FA 4HK6A 1L2QA 1V0LA 3BOFA 4FR6A 4PTNA 3I3DA 4N9CA 1NOFA 2ISDA 3IJ8A 1EF2A 1JD7A 2PRMA 3INPA 2WNNA 3VD5A 4ATDA 5TIMA 2WJEA 5G2HA 3MI6A 3OA3A 1OCJA 3CQIA 3BTNA 4UB9A 3GXTA 1T3QC 1A3XA 1TRIA 3AXHA 2PA6A 3ECQA 4A05A 3PJTA 3O1NA 5G4WA 1TIMA 1J6PA 3MBFA 4GR1A 2WHKA 1E5JA 2E9MA 2TRSA 4HTYA 1W56A 2V67A 4LVAA 4C6MA 3II4A 1SPQA 1W1A1 1G5AA 3H70A 4GVHA 2JEPA 3O0HA 4IQLA 4OQVA 2BX7A 5A95A 2J79A 3HURA 2QEZA 3V75A 2ISWA 4LAMA 2YB4A 4ZO8A 1W32A 4Q8UA 3DG3A 2WMJA 4HNVA 2NV1A 4MZ8A 2ZZ7A 1ZK7A 5FEZA 3N73A 4IMAA 5I03A 2IKIA 1QDSA 2F2HA 1MYRA 5C2CA 2NUXA 1H49A 1F07A 5FEXA 4DWDA 3WQEA 1PL9A 3DESA 4QE4A 3IK2A 5GQBA 4F2BA 3BPWA 1H2JA 4ATLA 2WV8A 3EB4A 4YVPA 4PCFA 1AL7A 3QOMA 1GQLA 4FLQA 5CC3A 1E4IA 4R88A 2WBGA 2X99A 2FMNA 4HSNA 2VD8A 5LKYA 4ZO9A 1GZGA 1XQKA 4JY9A 1KCZA 3KP1A 4JYDA 3L0KA 5IHRA 3KFTA 4H50A 4KFNA 5BMXA 1GJWA 3K4AA 4P7NA 4LAKA 4MZ1A 3VKJA 1Z7AA 2C18A 3MV11 4GOAA 4NT0A 3WNOA 1W1PA 3BAYA 3GFZA 3WNNA 1MEWA 1GEHA 1PKLA 1W3LA 5I77A 5SWUA 3WJZA 2EXOA 1R85A 1S46A 3LXDA 4OUIA 3W88A 4DNMA 3TJ4A 3M5XA 3MDUA 1SO6A 5F4XA 5LZLA 2DFAA 3PF3A 2A3AA 2VUYA 4YTRA 3A6OA 5I3JA 2NWSA 4O19A 1IHIA 3IGHX 3KL0A 3UP8A 4YYFA 4DO5A 2YSWA 4AMAA 1IT0A 4JTRA 3GR8A 2NUWA 1JR1A 3K13A 1FH8A 3GBDA 5F7UA 1XFBA 4H6RA 1ADDA 4QDWA 2G3IA 2YVJA 4LS1A 4M1BA 4TQTA 3VD9A 3SRHA 1QJWA 1BFNA 1HIZA 5A69A 2W6RA 1CGWA 4JFVA 1FWJC 2ZRWA 2J8GA 2QGYA 3NDOA 2C0AA 3DK9A 4WHBA 3G6MA 2TAAA 4Q8PA 1AJ2A 1L6WA 3FIGA 5CC5A 3O9NA 1GV4A 3M6YA 1XFCA 4QJ5B 4H4UA 3WY1A 2G3FA 3BGJA 4PCPA 1BF2A 3H2EA 1M6IA 2J13A 1HVXA 3NIYA 1CENA 1H3GA 3TYCA 5LSMA 1WCGA 3P81A 2GJXB 5DFAA 4GE8A 3APGA 1QHPA 4N4PA 2ZDSA 4K2SA 5ABTA 2FPTA 1XIJA 3EA2A 4IM4A 1J2WA 1JCLA 2VHLA 2WSKA 3M47A 2DJLA 5MF5A 2XISA 2Y8VA 2ZWYA 4HBKA 3HGJA 1NSJA 4AHOA 1ISXA 4J1OA 2J7HA 5IRPA 1WX0A 3NEHA 1QNSA 3PUOA 1JRBA 3QFWA 3CGEA 1FHLA 3P93A 2PPGA 3MHGA 5TQLA 3OG2A 4NY2A 2D22A 3CUIA 1GT8A 1TV5A 4Q8TA 1N2VA 2WXDM 3TTQA 3O6DA 1AJ0A 5HK4A 1RCOB 1BVZA 1F3TA 3SJNA 2CU0A 4KWOA 3LSBA 1XJBA 1LUCA 3OBAA 1GKRA 3R79A 1O66A 5CZ0A 1DOSA 2DT0A 3S4TA 4A3RA 3K5XA 1TJPA 4LNCA 6CGTA 2A6NA 3SQLA 4GUHA 5AB3A 2R91A 4D1JA 1ITQA 1FO4A 3PULA 4ZB0A 2CLIA 4TOQA 1TPVA 3QJAA 4QRNA 3HQPA 8XIAA 4MB1A 2QV5A 3N1AA 3H6OA 5HQEA 4ILSA 5M1TA 4DF2A 5FAGA 2XZ7A 3DN5A 3UNTA 3B0YA 2PZ0A 2H6RA 1X1OA 1TVLA 3W7RA 5AC8A 2F6XA 2D3NA 3S2NA 4QS6A 2E1DA 2WOVA 2YCKX 5A5WA 2CZVA 5HR6A 3IPWA 3NM3A 4BY3A 1IEXA 3M9YA 1SYTA 4RZ5A 1KM0A 2ZX9A 4F9JA 5I3DA 1W0MA 2XWEA 3EEGA 1QUMA 1UKOA 4IOTA 2X8HA 1V51A 5CKSA 4XVDA 1IT7A 3LLXA 3E12A 1TYPA 3VZYA 1V7YA 5EY5A 1S7MA 2QQ6A 3W83A 1TMHA 2V0TA 1SZRA 4MKNA 1UP2A 3RX4A 2O4MA 3DENA 1X97A 1HP4A 4J2MA 2OB3A 1E0WA 3PSVA 7TIMA 2QCMA 3S6TA 1XD0A 1US0A 2Y7DA 5ENLA 4HOWA 3SCPA 1XLGA 5LHEA 4GGHA 2AQVA 4BEUA 1QHZA 3S2LA 4XD6A 1KO0A 1KRCC 3CQJA 2QUVA 3STGA 4PMZA 2VX4A 1H7NA 1R3TA 4GYPC 3QHNA 1AJZA 3GXPA 4RE0A 2C79A 4F0KA 3EPMA 4E8GA 1E1EA 1PTAA 3ATYA 3AZSA 3IRDA 3NVDA 2DT3A 4G2DA 2QDDA 1P4CA 3CZGA 4WOZA 3WMCA 1GQNA 1U33A 3MA8A 2ZZ6A 1V4YA 3SCOA 4IMGA 3DERA 1JEZA 4D6CA 3URNA 3QR3A 4C6IA 3PG6A 4YHGA 1H6VA 2ZDRA 1Y8BA 4X63A 4QEHA 3R0UA 3EOOA 3B0XA 1U5VA 1LDCA 3CHVA 4H8HA 2BOFX 3B8UA 1AODA 4AD3A 5D9OA 4ZSTA 1E55A 2I9EA 3IACA 3A4XA 1DVJA 4IXXA 2E5DA 1O68A 4YVXA 4C1NA 1DJNA 1SGJA 3TXVA 1OFRA 2ZUTA 2JKEA 3RIKA 2HXUA 1O6IA 5FMHA 4HTBA 1Y5VA 1ZJBA 4WEVX 1KCKA 2WNQA 1RJQA 2RDXA 3B9AA 1SJDA 1FA2A 4TXEA 2FZMA 4ZEPA 3N2OA 1IZCA 1PB0A 2OOFA 4UNKA 3PBWA 4L9XA 3SN0A 4ERIA 3ERPA 2VFEA 5DQPA 4C6CA 2WHMA 1JAKA 1W9DM 4H8VA 4V33A 4BA0A 1JYWA 3FXYA 2A0NA 3B8IA 1DV7A 2FJUB 4LWWA 1DWFM 4GQRA 3Q65A 3WK2A 1D2KA 3H2AA 3RUBL 3CHCA 5E9AA 4A22A 4UZUA 4DJFA 3DIPA 5H8UA 2EPLX 5E1QA 4WQ6A 2VKZG 3IGSA 3CGTA 1A5LC 1G7UA 1VJIA 1Z44A 4F3HA 2QS8A 3UJ2A 4WJXA 2PDYA 1WUEA 3C0JA 3BE7A 1Q6OA 1QR7A 3W7CA 3L21A 3LB8A 4TVCA 3QKEA 1YHTA 4F79A 4ENLA 2ACRA 3QBUA 2J7GA 4UQBA 2VR5A 3W1UA 4S3KA 1UD3A 3WLRA 3KBMA 4MB4A 3KWSA 1E9YB 5H91A 1EL3A 2CLHA 4R7JA 4GGBA 4RCXA 3W4RA 4WD0A 1XLLA 3SRKA 3VIKA 3LBOA 4HPJA 4Q4MA 2OCZA 3SB0A 5DF0A 4EACA 3GXMA 3G1DA 2PTWA 4UR7A 5KZDA 7REQA 1UKSA 4MYAA 2CIPA 1OFPA 4XSMA 2YOCA 5E0FA 3T09A 3L4WA 3GFYA 3ZOAA 5L9FA 1GRFA 1ALDA 4CKQA 1XXXA 4JTCA 1IWAA 3W22A 3A3HA 4O1CA 2JK6A 3OW1A 3QEZA 4HA3A 2P1FA 4J5NA 1KFJA 4EIVA 5K9DA 4BCEA 4FOUA 1H1NA 1THFD 3DG6A 2VC6A 2V38A 3A21A 4LB3A 4PB5A 2V69A 1RXOB 2OFJA 3OP2A 2JE8A 2ZX7A 3NGFA 4IPPA 3W9ZA 1SFSA 5KEZA 4UTHA 3HV9A 3SGZA 1NHSA 1ZBKA 3VNDA 3NVVB 1U2YA 1YEYA 1TPC1 2ANUA 3GNRA 4YHEA 3VDBA 3ZR5A 3KM8A 1B3ZA 4UQ9A 1EC8A 1KBKA 3ARVA 4QISA 4TIMA 3O0KA 2WQPA 1SQ7A 2IPGA 4U3CA 3P74A 1G67A 1ZNNA 2FGLA 4O15A 5D09A 5I79A 4US5D 1RM6B 4L4MA 4DUVA 2UZ9A 4LF2A 2Z24A 2CZEA 4FALA 5HPCA 4C5YA 4LVFA 3BAJA 3BZJA 3MMTA 4AIUA 3YPIA 2A3HA 2DGAA 1EUNA 1WDRA 2YFOA 2WMHA 5HAOA 1VEPA 4JY8A 4D6EA 2NQZA 4PGLA 1JROA 1DBTA 1XH0A 3RM9A 1XD1A 4C6KA 4AZIA 3R12A 2DZBA 3HPSA 1N61C 4L61A 1ITUA 1EEXA 4OVXA 1IWBA 2ZUSA 4H4SA 5ABFA 2GDUA 1RZMA 1O1ZA 1PYFA 2R1KA 3A22A 3GWQA 1US2A 2QDHA 4KT2A 3CQ0A 4A4AA 1VR6A 4JIIX 5A6LA 1N8IA 3ELFA 3GS6A 1WBHA 1H09A 4PMOA 3AYRA 1BVWA 5E70A 2IW0A 3S6DA 4I5UA 4KH2A 4LYKA 4WY0A 1VFUA 3BUVA 1EWEA 4Q8OA 6TAAA 2D73A 1EIXA 4QJ4B 1B54A 3W25A 3WNMA 1YNYA 1AK5A 3OZPA 4W89A 1XINA 2NQLA 5LNVA 1HNYA 1QPNA 1OC7A 3QV8A 3N2CA 3TFCA 1XSJA 4IPJA 2AAAA 2NT0A 4IPNB 4H6EA 1GVYA 1IEIA 1S2AA 3O16A 2YB1A 3KVLA 5GJPA 3EXRA 4H4XA 1MQPA 1I2RA 5CXPA 1SW7A 4GG9A 1JYVA 3FYOA 6A3HA 1NM9A 2WMFA 3EX2A 2YCLA 3M7SA 4R3UA 3DFHA 1LBMA 4O8AA 3LADA 5CBIA 1EJXC 4Z2IA 3BSHA 4D8ZA 2VZVA 3MTWA 1LL7A 4JHOA 4Q4QA 4ZODA 3V0SA 2YDAA 2O9TA 4ADTA 1XLHA 1KLYA 2NXGA 3FK4A 3SRDA 3S2JA 3W70A 3URQA 1FEAA 1ZBCA 2QULA 5FJOA 2DZUA 2CKSA 2CFFA 3EKLA 2W4XA 4GQ0A 2YDQA 1GOXA 4DY1A 2GWNA 2I14A 1MSSA 3W7DA 1X1ZA 1TPH1 3BG3A 1WDPA 3ZT6A 3AYTA 1WDQA 5A2CA 3UQNA 3SI9A 1WZAA 1MW3A 3LGGA 5CZKA 4IFKB 1HJXA 2Y8KA 4FF5A 3AYVA 1E72M 1F4AA 1GVIA 3K8MA 4ZGYA 3TAOA 3BVJA 1GWJA 4PRTA 2VEKA 4NNAA 3PZIA 3UVAA 4LT9A 1LBFA 1QPOA 3KS6A 4JEJA 4H4ZA 4HCDA 1Q1RA 2WVUA 4TX8A 1J2BA 1TPB1 5EGRA 4KEMA 1MQRA 1U1JA 4XKYB 2O0TA 4G56A 3KBSA 4LUSA 1QNOA 3VINA 4BF9A 3LPGA 4JFUA 4E0CA 2F5ZA 1RD6A 1YTDA 1C91A 3BV7A 1ZKQA 3VTRA 3VFLA 5CBJA 3EAOA 2XIQA 3H2MA 5GPRA 4MJ4A 3ZLFA 4MWAA 1XCWA 3NQ2A 2W55A 1DE5A 1POKA 3PPHA 3NO5A 3FGCA 2CZ5A 4IG2B 4ZQOA 4S3GA 4NJJA 2OLHA 3RXZA 5CC7A 3WH7A 3ZT5A 2VC7A 3EOUA 1FWSA 3KDOA 3AIRA 3V4BA 5PTDA 5F1VA 4FP1A 1I9CB 3W28A 4KWSA 1B3OA 1QPQA 3QPEA 5KVIA 1O5KA 4L7ZA 1ZCCA 3URBA 4PTMA 5BXPA 3WZ0E 3FEMA 1UR1A 5AKQA 4GJIA 3C52A 2WWDA 3CV6A 4LUJA 1H5VA 3LTSA 3EWXA 4RZ4A 2ZA1A 3TKFA 2WB5A 1N63C 2XG9A 4CNSA 1XHCA 1A4LA 3FAXA 3OGVA 2AGTA 3VU2A 3U5UA 1DWAM 5D2YA 4CNNA 4K38A 5KZEA 3VOFA 1TR9A 4M6QA 4LY4A 4ZOEA 2C8NA 2BOGX 2VQUA 4TVUA 3VIGA 1CGYA 3HZ3A 4NZ4A 4O1DA 1W2VA 3OEXA 4KEUA 4UCFA 2EPHA 2BY2A 2GUYA 3AMLA 1W5MA 1CXIA 1TCMA 3V7PA 5BW6A 3NPVA 4NZJA 4BI6A 3L5AA 4YL2A 1N60C 4YWSA 5AHIA 3AIBA 5I3KA 1VIWA 1PZ2A 1T0OA 4HZ8A 2F9RA 2GR0A 4DWSC 3W1TA 4YS1A 2EQ6A 2YXGA 5CJNA 3TWBA 1ONEA 1BRLA 1T99A 3CQHA 1Q13A 1W5PA 2A5HA 3R10A 3BGGA 4K3ZA 1XLDA 4FA3A 4K1GA 5GNZA 2OX1A 3AMCA 1CCWB 2QJNA 3VNYA 3KXQA 5K4ZA 1VLWA 2IKHA 1VEOA 2Y0FA 3TR9A 1RLCL 5DMYA 4PBFA 4DZHA 3WLMA 4QM1A 2XFYA 1PSCA 1EZWA 3UW6A 1CPUA 3SCNA 5CQ1A 3CPRA 2GOKA 3EF6A 3ZJKA 1TPEA 1FECA 3VUSA 3QH2A 4JQ1A 4AISA 1QAPA 4DAIA 1JCXA 2DVTA 2Z7KA 2V2CA 4WGHA 2BY0A 1JNEA 7XIMA 1P7TA 3OVGA 4ERAA 2Z6JA 1ONWA 2AMGA 5A6AA 2KZHA 4QHRA 6XIMA 3R0DA 3OO2A 3VD3A 2ODOA 2QVNA 3E96A 4DYJA 2Y8UA 3V5CA 3CIXA 1FH9A 2BS9A 2W67A 3CXBA 1TYTA 1GESA 3CK5A 4PUWA 3BW4A 4J3WA 3APYA 4JYFA 3LMYA 1JQXA 4HA1A 4HK5A 1AH4A 1L6GA 4W87A 1PIFA 5I24A 1DEDA 1B4EA 1V02A 3QV7A 2FVKA 3K46A 1GREA 3Q45A 4JX5A 3MT1A 1LQ2A 3UWQA 1VRDA 4EQRA 3N2XA 5I00A 2R9ZA 2CLFA 2VO5A 4QGCA 1T6MA 4REQB 4UTWC 1OFBA 2B0MA 1LF1A 4Y9MA 5EMJA 3Q67A 4AZBA 1CXFA 3WDPP 4DXVA 3SCUA 4DWSB 5I3IA 1ZAIA 4UFLA 4TMCA 5AVNA 2FTWA 3MKKA 2V63A 4ZOBA 4GO9A 2PDXA 3G0UA 1OC6A 3ALGA 3NQCA 1HP5A 3W7PA 3WNPA 2NV9A 2QLYA 2WJZA 1DJYA 2OWWA 4PTVA 3N19B 3TEVA 4AUBA 2UBPC 1JIBA 2PC8A 1OF6A 3FLUA 3JRKA 3NZPA 5GJMA 3N9SA 4PEKA 2C16A 4AXKA 4O1FA 1Q8JA 1GG1A 4ES4A 3V35A 5DMNA 1BSLA 5KTLA 1XH1A 5AC5A 2ZUMA 3KE0A 5CLWA 2ZQ0A 4UOJA 1R2SA 3CGBA 4CCDA 4HJFA 2OSYA 2OLSA 2VUNA 1IYXA 1XI3A 2YCEA 4QIUA 2EPNA 3VNLA 4BK9A 4JHMA 4J9JA 2PWEA 3QMRA 1VHNA 3FDKA 1R3RA 1BVNP 3P5ZA 3PZUA 3A64A 1NH6A 3AHVA 4B5WA 3L67A 3PC0A 5I06A 3N17A 5BZAA 2NX1A 3KW3A 3T42A 2PP0A 2GPTA 3BANA 3CO8A 3OQEA 1OIFA 3O05A 1LWHA 4X2RA 5A2BA 2DORA 4IL0A 2YA1A 1QI0A 3VKCA 1Q6DA 2C3DA 1HL9A 4CQ9A 4XQ6A 4W4QA 3VOIA 3L2IA 4Z2HA 4S3FA 3W73A 5H8MA 1OYAA 3WLQA 3L5OA 2J24A 1XWYA 2UY3A 4A3UA 4BF5A 2V3FA 1FH7A 3C2EA 1EOMA 1W9VA 3S1WA 1GQKA 4IP4A 3NOEA 2QKFA 3WX7A 1REQB 1AMKA 3RCNA 3VM7A 5A8MA 1ZAJA 1CEOA 3HGRA 1IEQA 5XIAA 4GYJA 1R5YA 1E6QM 2NVDA 1CDGA 3ITOA 3GFXA 1GQIA 4GIEA 1Q7MA 2PDNA 1Y0EA 5C5YA 3S5OA 5AECA 4JBRA 1VRXA 4W8LA 1VFSA 1P6BA 3UG4A 1J0JA 3EXTA 4HCHA 4F4RA 1VCFA 3GO2A 3WJWA 4I6VA 2E77A 4RPQA 1FWCC 1GTEA 3LUTA 2DZPA 5C7VA 1XPGA 3ZVHB 1YPXA 3BAXA 2I5GA 5CGTA 4S1FA 3CZJA 3TN4A 2DZVA 1PUDA 3WO8A 2CXEA 1E4LA 3UERA 2NXHA 5M03A 3GHRA 4GC3A 3W02A 3PZTA 4GA8A 3VE7A 1ECEA 2YKKA 1NHQA 1XX1A 3MSRA 4AYSA 3Q94A 1UBSA 4BZYA 2B7NA 1I2NA 2O7SA 1SJBA 2XIBA 2XN0A 3G24A 3TP4A 1R2TA 4QR6A 2RAGA 4UQAA 5K4XA 4Z2LA 5G2IA 4WX2A 2H9AB 1BYDA 3L7RA 2Y7GA 3KLLA 3UYCA 2X30A 4DB7A 4IMDA 4LU0A 1E43A 4TUFA 5JCLA 1FCVA 4JTKA 4Q4SA 4NEVA 3LI0A 3BURA 3L65A 4E2OA 3CS2A 4JGDA 1H63A 1E9ZB 1S2WA 3QHOA 3H54A 4FK9A 4YTSA 1K9FA 3GKAA 1VKFA 4FNRA 4B15A 2YL6A 1QI2A 3RNMA 3UA3A 5DLCA 3WENA 2OG9A 3ABQA 1JULA 3VO0A 1O94A 1C7TA 2HCVA 3RG6A 1GW1A 1OJXA 3BOLA 1KFLA 4MAZA 1KV5A 2Z2UA 3DHDA 1WKEA 3DBPA 3H21A 2BLEA 4FOJA 2EKCA 3CBWA 4PUUA 1YNQA 1DWHM 4ROQA 4YLWA 4W8AA 3OLIA 4I9AA 4HZ6A 1FIQB 1WE5A 3AC0A 1DIDA 2WZTA 2Z1WA 1KW1A 3C61A 4P7LA 4KESA 1VF8A 4CNPA 4BR1A 1Q4WA 1RQBA 5JCNA 3HGSA 3PZ9A 4F2TA 3KOZA 3QRHA 2CHNA 5F2MA 3CB8A 1AQFA 3LGDA 4K68A 2Y6ZA 3MO7A 2Y4SA 3VMOA 2NXIA 1SU5A 4S3DA 1V6XA 2BG5A 4XO7A 2BASA 1FFUC 1UROA 4KBXA 4X2PA 2BDQA 2GJXA 1B57A 4GHRA 5HWMA 1XSKA 3AHYA 4C91A 2I9UA 3NEVA 4IUGA 4ADUA 1S38A 3SCQA 2FZNA 3VCCA 5FS8A 4O14A 2CITA 5G1MA 3DC8A 4GZJA 3I4EA 2BZNA 1RD5A 2A3LA 3RRXA 3OYZA 3WLKX 1VDVA 1FP9A 4LIIA 1ZZMA 2GQ8A 5EA9A 3ZT7A 3RF9A 4CCEA 4S3JA 1ITCA 4ZQPA 3A4JA 4EPBC 4WF7A 3S83A 1YNPA 3ICJA 4Q8MA 1VBGA 1V6TA 1W1IE 3RR4A 1QRQA 3MUXA 1EKOA 3GRSA 3OIXA 4UNIA 5CG7A 1JPDX 2QCHA 1DXLA 3B9NA 4FR1A 1BWCA 3F4CA 4JNZA 4UQCA 4YCOA 1K70A 3QW3A 3T07A 3DYOA 3H7VA 3WQGA 2ON3A 1DORA 2OOGA 5LGXA 3LHTA 4DEFA 2EPKX 4J4KA 3CHFA 2NVAA 4OOZA 2BC1A 1HF6A 3MJYA 4UTIA 4F0SA 5HXMA 1YQ2A 3E3HA 2TODA 3W6YA 5BWFA 4QG9A 1A3HA 2Y62A 1JZ7A 1ME7A 2HXTA 7CGTA 2QCNA 3CWHA 4QDPA 3DFQA 4WIWA 2HNEA 1T40A 3UG8A 1C8YA 1FKWA 2CWXA 3SIZA 2WVTA 3UZ5A 1D7FA 4RDWA 5FL0A 1CGXA 3R5EA 4JTGA 2IQDA 2CLPA 3UA4A 3CEUA 2HPMA 3FDGA 4UXDA 1D8CA 1UH2A 3OQ8A 3ZLHA 4GVIA 4OGZA 3PPFA 3NVWB 4NJHA 5JBDA 3UXAA 1KB3A 2BHZA 1SMAA 3MWAA 1N8WA 3PJWA 4OKDA 4PUNA 4PUEA 3MSGA 1XYZA 4Q7BA 3FFSA 1UZ1A 5GNXA 1L8NA 1TZZA 1LORA 3PWIA 5I02A 1W9UA 3LM7A 1DQWA 2I5IA 3FA4A 1BKHA 4A2SA 4RPPA 4D6HA 3TK7A 2NUYA 4NZ3A 4DI8A 1W3TA 2Y24A 3CT2A 3HMCA 2G41A 4YVVA 1GORA 3MZ2A 3TMQA 4IF2A 1SUXA 3SAZA 5KZ6A 1KM3A 5LA0A 2F6UA 1LQAA 4UC5A 3AMDA 3GK0A 3UWUA 1WAWA 2HVNA 2CERA 2GQ9A 3KZPA 3W23A 1Q45A 1PX4A 2GJNA 1E0XA 1D9EA 3GIPA 3VIMA 3PBUA 5TR3A 4Q6XA 1KNWA 1O5XA 1VQZA 5ABEA 3P2VA 2J7CA 3USBA 2OO6A 4JYEA 5AYBA 2ZC1A 1I1WA 4JTTA 1SO4A 2VRKA 3W1AA 3QPYA 1LROA 3DGZA 3REQB 1OM0A 2HJPA 1KFCA 4IX0A 2HZGA 3GTHA 1IR1A 2VCAA 1JL8A 1XC6A 1XLKA 2YBUA 1WDDA 3M5ZA 3QQWA 2Q02A 2ZZ0A 1TWDA 4IIGA 4DIAA 4HNUA 4E6MA 3QW4B 1BLIA 1E6PA 3K30A 5D2XA 1R2RA 5I07A 3DFPA 1JPKA 2JIWA 2VYOA 2V3AA 1XG3A 5A2AA 3HW2A 1KLZA 4AZHA 4R9XA 2EF9A 3NDZA 1MFVA 2VZOA 3U7VA 2Z28A 3N15A 2J47A 1PWMA 4X22A 1PYMA 4HU4A 1WOAA 2CDUA 2VGBA 4IQDA 2WLZA 2C71A 3WQ8A 2FZ8A 4Q3MA 3W71A 4H41A 3IVTA 1BD0A 3ATZA 4XO6A 2AQOA 3M0MA 5HNRA 4DBEA 1QOQA 2WPEA 1R9YA 1EQPA 3TYZA 3QZAA 5C9WA 2PWGA 4ZCWA 2VOTA 1WB0A 3KP0A 2ZOXA 5CPOA 3HMJG 3VA8A 3VIFA 1OYBA 2GQ3A 3KDNA 4G7FA 1D3GA 4HU8A 3GAKA 3WLIA 2V3GA 2YBTA 3ANVA 3XINA 3BLEA 1NVMA 3I65A 2YCIX 5LYRA 2PD5A 3MC5A 2PCQA 1BTCA 2XWDA 2QUNA 3KOYA 4GC4A 1NQ6A 1GHRA 3SBFA 2D0FA 1JJKA 3TIMA 2FDSA 1FCBA 3EB2A 3KWXA 1UWAA 4IQJA 4IJBA 4G6CA 5U7SA 1P6WA 4O50A 3T0TA 4GI6A 1G94A 4GK8A 3BLIA 3O15A 1NFPA 2XSAA 3LY0A 3PJUA 4GYPA 3AOFA 4WKHA 4LBRA 5KSWA 3DGHA 3WIJA 2DDXA 1LRQA 1UD8A 4DO7A 5FKYA 4ML9A 4XUGA 1GPWA 2PU0A 1KWGA 5D8WA 4TX6A 3WQ6A 4S23A 3PB0A 4AHQA 2E6YA 5C0QA 4A35A 4GD0A 2PI6A 4IGNA 2NV2A 1IZJA 4JQAA 3GDRA 4HNOA 3PZQA 4YU1A 3MU7A 5HJLA 4FLSA 4EAMA 1AQMA 4YJ5A 1H62A 3QSTA 4B2DD 4J3ZA 4WY0F 3KVJA 4L6OA 4RDZA 2D0HA 3CUHA 1MQQA 2X42A 2C3CA 9XIAA 2OQLA 1RA0A 2BHYA 3QKZA 1XDIA 4IPIA 4Q4OA 1N5XA 4YYCA 3GC4A 1PO9A 4GWEA 3SUVA 4PSPA 4JCMA 3ONBA 4LC6A 1HJUA 4UMAA 4DZ5A 1UZDA 1ZS2A 1C8QA 3NG3A 1MWOA 1H7WA 3TX9A 3IJ6A 1FHUA 3BSMA 5CPLA 3VZZA 3SUUA 3UCCA 3HF3A 5D9NA 1V3HA 2ZWZA 2Q8XA 4OFCA 1IZKA 3WEZA 1LQ0A 3UNDA 3RO6A 1T41A 3NO3A 5E9XA 3TU9A 2DQXA 1K9DA 3G1RA 1WPCA 1R86A 1STZA 2DZTA 1Q85A 4PRRA 3L4TA 4F9DA 1KCLA 1LLOA 4IUOA 4G1KA 1KD0A 1SFJA 2VZUA 4ZE4A 1GRBA 1YE6A 1ONRA 2JGQA 4N02A 3LHUA 5G1TA 3NSMA 4W8BA 1ISVA 4KIRA 3TSBA 1UWSA 1W3KA 2GVJA 1ZJHA 5E09A 1CB2A 1W3NA 3RLGA 1QPRA 3KCOA 1OX6A 4NI3A 2RFGA 4HYRA 2PGWA 1XCFA 5BRQA 1DXEA 2DSVA 5AYZA 3PTQA 4LA1A 3HG2A 2DZSA 3DAQA 3H4WA 4DJDC 5MKGB 3A24A 2C13A 2IQ0A 5EMUA 1HTIA 1LCOA 2PDHA 1VYRA 2PEVA 3S5YA 1CNVA 1F8MA 4AD4A 1ZGDA 3ZWSA 1RQEA 3AS1A 4MFEA 4W7WA 3GQYA 4NXKA 3PBMA 4ZOCA 3T4CA 3UR2A 1FXPA 5CAKA 2Z0IA 3CPGA 1HKWA 2PODA 1WZLA 1OINA 4UFKA 4B92A 3DKJA 4XX6A 3ZJ6A 4HJWA 1R3VA 3BLKA 3EANA 1HGYA 2HS6A 4J28A 2VDHA 1ZY9A 3HFYA 3QTGA 5FJUA 3AROA 3LCIA 4O0ZA 5BU6A 1LOSA 2PWVA 3CZ8A 5DBTA 1ZDLA 1DYSA 2DUZA 2R8WA 1XISA 3BG5A 2PWHA 4UFMA 3V18A 4E3TA 2VFDA 4KMQA 3SADA 4HHMA 5ECVA 4H4IA 4Z1DA 4LF1A 3HRDC 4JTEA 3SUSA 3DFOA 1ZU8A 4MM1A 4ZQMA 2P88A 4A2RA 1YRRA 3A7RA 3R43A 3DH9A 3KHDA 4BQ2A 3LU2A 2Y5JA 3QZEA 4BS0A 3HPZA 3QFBA 4MNJA 4C1LA 4NRSA 3TQKA 3MUAA 4BI7A 2C1HA 4AD0A 1TE1A 4H19A 3GW0A 5AYIA 2PS2A 4V1YA 3L4UA 3W1XA 4H6KA 4X0VA 5ABHA 3P7YA 1K6WA 3U4FA 4K8DA 4IIHA 4ERGA 3E74A 4Q6JA 1UWIA 3H55A 1W1VA 1UC5A 2VURA 3DDMA 5HMFA 2ACSA 2V3EA 1E1FA 3N12A 1AZ1A 3N14A 1I4NA 4UCGA 3QPZA 1NIUA 4IFKA 3WQFA 3ITCA 2GDVA 3GDBA 4IZGA 3TC3A 1QASA 5IXEA 4U10A 1A80A 3VZXA 3TC6A 5LA2A 3VKKA 1W2PA 3WYZA 2YL8A 4EXQA 1GRAA 1IV8A 4IISA 1TUFA 2QMJA 1SJCA 5FS7A 2VZTA 3OBEA 4XKYA 4ORMA 2E28A 5XINA 1M03A 2DH2A 1KM1A 1QHOA 3WK3A 1CZ1A 2POTA 3GNDA 1UPMB 3CC1A 4HD5A 4JZ5A 4JEQA 3ARQA 3W1QA 3NZQA 1U5JA 2ZA2A 4JDRA 4JTJA 5AN7A 3APTA 2QJIA 2XHYA 1G4PA 1PKYA 4U5IA 3UGVA 3NRZB 4IG2A 4GMEA 1A5SA 1EOKA 3ARUA 3RU6A 5I09A 3FSTA 3GVRA 1L9WA 2FHFA 1HJWA 6ALDA 2X1TA 5AHNA 1WUFA 4HSOA 4V28A 2FZDA 2YXXA 1TTIA 3N6JA 1UKPA 4M6VA 3DI0A 3S0CA 6XIAA 1YLVA 4QJ3B 1W5NA 3NDYA 3ARYA 2VR2A 2F7FA 2ZZ1A 2PU1A 3PFMA 1XKYA 1OF8A 5A8OA 4MTVA 1EJTC 4KRZA 4GCAA 3BAWA 4PMJA 2E6FA 2FKPA 4FDCB 2AL1A 2REQB 4XZBA 1K8XA 2OKOA 1ICQA 3FSUA 2Y5SA 3RPTA 1CI1A 4LYRA 3VKAA 1XIEA 1FY6A 5JRBA 2Y89A 1P43A 1K03A 3VDCA 3T1GA 4FNUA 1Z9AA 2RKXA 4MLJA 2PDCA 4A3HA 3PP7A 4JXCA 1UR8A 3C0QA 4EXAA 2WM0A 3ITLA 1K9TA 4DF1A 5D33A 5CPTA 3VD7A 4JL1A 3HV8A 3EUB3 2X2YA 1ICSA 2E9LA 3C0LA 4HMCA 4J3SA 2DSWA 4M3PA 1GRHA 3IV8A 3GIYA 2PGFA 4QS5A 4GUFA 4DYEA 3T40A 5H2ZA 4DM2A 3E5BA 3MI3A 4H00A 1Q3NA 4H04A 3LN3A 1GJPA 4QG8A 1ZSXA 3CUZA 3MMUA 1XIHA 5HUOA 2FB2A 4LALA 2YA0A 1GGOA 1N62C 2JEQA 2PRLA 2ZICA 4NNCA 1VFHA 3CV2A 3HG3A 3GTXA 3GG1A 1UQZA 4RW3A 1AQHA 3DFSA 3IANA 1VPXA 3WQ4A 5D8ZA 2OO0A 2VFFA 3TNOA 4LC8A 3EX4A 2PDUA 3CYJA 5CZTA 4DQWA 4CEXC 1OGSA 3C2YA 4H2HA 2P0IA 5BRBA 3GU1A 3B8TA 5JU6A 2FH8A 3RN6A 1WZKA 1E40A 3AIWA 3MCOA 5C7HA 4IP5A 2X1RA 4M1RA 4PC8A 2BY3A 2A3CA 4C7DA 3I68A 3MVIA 2JF6A 4X9YA 3KOWA 3MHFA 3B8WA 5B7YA 3GH4A 4JNYA 1M7OA 4J3UA 3BSGA 3NA8A 2ZTKA 3GM8A 3SFWA 1XH2A 3HU7A 1PZ1A 4FB7A 1KXQA 1JOAA 2Q71A 1LT7A 1TIWA 3IAPA 3G8EA 1MRAA 4GZIA 2NSOA 1H1ZA 2Z2AA 4JOMA 2W3SA 1TYGA 1UJQA 1Z6KA 4K8GA 2RGMA 5H6HA 4AWSA 2ZUVA 1C92A 3HOJA 4O10A 3NJ3A 1RP8A 2PTDA 3B4YA 4MADA 1S1RA 2P50A 3BWWA 3P82A 4EVZA 4NEWA 4D1IA 3TW9A 1V6WA 4E4FA 2GR2A 5FSDC 5IBXC 3OVQA 4C6JA 1DTUA 4XZ9A 1W9BM 1EJUC 3AMZA 1ZLPA 2ZUWA 2WW5A 4X9SA 4DUOA 1BQGA 3WDRA 2XZ9A 2B31A 4QBXA 5C71A 3O3RA 2BXVA 3E2QA 1XV8A 4G7EB 2BXZA 4X61A 4LYPA 1HX0A 4XZLX 1KXTA 1TV7A 2WVSA 1XLMA 2GJLA 3CMFA 2F6KA 4DJEC 1V3IA 3LM3A 3VCRA 4REQA 4C6EA 1GVSA 1G4TA 4GNJA 2W91A 2G95A 3RMEA 1TPFA 5TNVA 3H8AA 1BZLA 4WDWA 4DWSA 1BPLB 2WP6A 1O95A 3BMWA 3R1ZA 3B0VC 2CFYA 1EH9A 3L5MA 4MDPA 3SM0A 3F7JA 3LK6A 4UR9A 3C56A 4RXGA 3LNMA 3PBYA 1FDZA 2X1IA 4MOZA 4QXIA 1EX1A 3ENLA 5K2ZA 3A3WA 1QW9A 4L5ZA 1TE6A 4DNHA 2WK2A 3E0WA 1LM1A 2QDEA 4Y7EA 4DUWA 4QAIA 4QQUA 1BKSA 4H9MA 3QY8A 3U5YA 1GYMA 3NZRA 4JQ3A 1OG6A 2XINA 4P61A 1U30A 1E0VA 4RDVA 3GR7A 3JVAA 3VGDA 3LENA 4RV3A 2GVEA 4GBUA 2VWTA 2IKGA 3DFYA 1GK8A 4S2CA 4JIPA 4IJRA 2CLOA 5TBOA 4WLCA 4OTKA 2FJKA 1EX5A 5HOSA 1JF6A 5AHLA 3IIOA 3RDKA 2OT0A 2V81A 1HL2A 1YYAA 2VTFA 5D37A 4LANA 3UZJA 3SN4A 1VS1A 4GYFA 2UV8G 5JMUA 2QF7A 1NF0A 5FOOA 1JD9A 1RPKA 2AKZA 1XUZA 4LX4A 3PB2A 2VWSA 1A5NC 3LXBA 4HMNA 2ZX5A 4URIA 5AYXA 1V3JA 4P8WA 2WOIA 4HCLA 2V2DA 1TPUA 1REQA 1J0YA 4PR4A 5HPOA 2CPUA 1POJA 4MPQA 3T81A 1KM5A 5BYWA 2C14A 3WUFA 2GVLA 2QT3A 1TG7A 5F2GA 3FA3A 1W9PA 4GABA 2AAMA 3WLHA 1TV2A 4CN1A 3WH8A 3LX9A 3NPXA 4UTWA 3LZ5A 4FHAA 5KVHA 1QCWA 5IM51 3NO1A 2WMGA 1DJXA 4W85A 2D3LA 3KVMA 2HDJA 3WELA 3QLLA 1UR4A 4S39A 3ZVHA 3GXIA 3M0HA 3CJPA 4H1ZA 3IC9A 2BHUA 4K7VA 1VQTA 3BJFA 2WC4A 3CUGA 4AB4A 2EBNA 1YTKA 1IIGA 3MI2A 1K7EA 1UBPC 2R6OA 2IPFA 1S5NA 1JVNA 3M44A 4UTKA 1DIEA 4ZZ9A 2GSEA 4UFHA 3EGJA 5FD0A 2EPMX 5IDIA 3QVQA 3CL8A 4WXZA 1ZX9A 1P48A 4ZO7A 4U5KA 4MB5A 3TTEA 4M7SA 4O13A 1T7LA 1QO2A 4FMVA 2W63A 5CG0A 1PEZA 3IS4A 5LNWA 4M5PA 4A8NA 2H9AA 1I45A 1HKJA 1OFDA 5HNUA 3STEA 1S1PA 1RJPA 1RR2A 1SW0A 1Z89A 1C29A 3G1FA 3T2QA 5GJNA 5HNTA 4IFOA 2YJQA 2OWXA 5KITA 3E0IA 1GJUA 3CASA 3MYPA 4L9ZA 2JGYA 3W38A 4JQ4A 2XM2A 5T9CE 4L1GA 4ROPA 1ML1A 2ZZ3A 1HL8A 3CGDA 2O55A 4GXPA 4O18A 3EYPA 5DY3A 3MUZ1 3RYSA 3NQFA 5G4HC 2PDFA 2WC7A 3U2ZA 4HZMA 1KTBA 2DUXA 3H4XA 3PTKA 4LFYA 4P2VA 3LHYA 4LQ1A 1AA1B 2XGZA 1UA7A 1B2YA 4AZGA 3EMQA 1OX5A 3VX1A 3HQNA 1DJWA 1M68A 2EJAA 3G6LA 3VOGA 2WM1A 3BDKA 4NG3A 3EDDA 5HJYA 3BL3A 1JDFA 4Y2WA 2FPYA 4XIAA 2YBVA 2O9OA 2WMIB 1FWGC 3ZFHA 5D2VA 1SSDA 3AICA 4J56A 4NYUA 2YW4A 4RL3A 3TN6A 4PMQA 3OB8A 2HV5A 1Q6CA 4N4QA 3HPFA 4V2XA 3H2OA 4H3DA 6REQB 2LLEA 4F66A 1Q1WA 1ADOA 3EWZA 4TV5A 1QVBA 1FBAA 4HB7A 4KGLA 3AHXA 3AQUA 1VZWA 4B5XA 5A8PA 2VEIA 1JZ5A 4RW5A 3DYPA 2OT1A 1B3YA 5HULA 3WD3A 1F8WA 2YL9A 3O6AA 3WL1A 4BV6A 3Q37A 5I3GA 3OVRA 3GG7A 4Y8FA 4QG6A 3WD4A 4A8LA 3UWVA 1ISWA 1KBIA 4M6PA 3WLSA 4LS0A 1XM3A 4GY0A 3M6DA 1E70M 3FJNA 4MFDA 2WMKA 3T0AA 2ZRXA 2J77A 3DJJA 1F4HA 3HFTA 3DZ1A 3QYQA 3T05A 3WF1A 1JRCA 1JUEA 5FJTA 4C5ZA 4MMWA 5REQB 5A6MA 4UMCA 3PTMA 2O9PA 3AXIA 4NAFB 3W2UA 4PFHA 3CM4A 1BYAA 1TTJA 1FWRA 4M29A 3BC9A 2WCAA 2R9RA 4JX4A 3TFXA 1YTEA 2XU2A 3ZYZA 4LEFA 3BAIA 2EG6A 5J04A 3A47A 3A7AA 1XIBA 1PPIA 1S3HA 3NL6A 2QVHA 2E09A 3SDOA 1L6YA 4Q8QA 2ZZBA 2O7QA 3P0XA 1HO4A 3RR1A 2DSZA 3ISIX 3KLJA 3BJSA 4JDBA 4WKFA 3MSDA 2VJXA 4RE2A 3QR0A 2FMOA 4V27A 2X41A 3VNKA 5FF2A 4LNYA 4C6DA 3AISA 3GVWA 3WD1A 4XAFA 4AX6A 3VGFA 3OBKA 1HKMA 4KWWA 1GONA 2PLMA 3BICA 4GUIA 1TX0A 1X7FA 2RGLA 3CZKA 1TZ9A 1W5QA 4GPNA 3TQ0A 1M5WA 2KAUC 3WQOA 4MZYA 2BVTA 3TE9A 1PIIA 4HMEA 3RX3A 2EQ8A 3HO8A 3OZYA 4B4HA 3E2VA 3UCQA 3HPXA 1EXBA 1MDRA 4KPRA 1E1CB 3EPOA 2CC0A 2TMDA 4GQQA 3UGRA 4PMUA 1MXGA 2DU2A 3ZZ1A 3F03K 5TAOA 5HR7A 2HRWA 2VOMA 5CJMA 5E6ZA 3TTYA 4I8YA 7PTDA 3ARRA 5ECUA 1E4MM 1QATA 3PUDA 3LQLA 4JL2A 3W7IA 3LPOA 3NQVA 3L4XA 1AW5A 4BJHA 3PG8A 1FCQA 1OJTA 3CHDA 3O0FA 4EM4A 2J8FA 2GGIA 5I7GA 2NQJA 3GDTA 1CGVA 1WYIA 1JYXA 5E0CA 4FX7A 1JI1A 2R94A 1NDZA 3REQA 2V2HA 1F05A 4XB3A 4O54A 3LA4A 1NP2A 5JQ9A 1G69A 1A5MC 2D2HA 4PODA 3C8FA 4JCLA 3EX6A 5BRPA 4N2YA 1WXYA 1YDNA 3PZMA 3WF0A 3OTRA 2EG8A 1VFLA 1UWTA 5EFDA 2A3BA 3BV4A 4LUYA 3T44A 3U6WA 1XYBA 1XSIA 2PP3A 2OYKA 1WBJA 4KEZA 4JTUA 3W26A 2XVLA 1UWQA 3LRMA 2Y2WA 1KBBA 2NQHA 3RCMA 2PTXA 1X7IA 4NASA 5DT7A 4RDYA 3UPBA 1GTHA 3P60A 3T7VA 3FJ6A 1IXNA 2CBUA 4H7VA 1Q66A 1ONFA 3TN5A 3LRLA 1LWJA 2YLAA 3NL5A 2DSUA 3W7EA 3W76A 5TD4A 4KRUA 4JTDA 4HP5A 3MDWA 4Z1CA 3HQOA 4IICA 3K8LA 1JCYA 1YPFA 2C6QA 4QSFA 2INFA 2Y1HA 3CMGA 4FNQA 2WQDA 2GL5A 3D5HA 4OBSA 4E38A 1SM9A 3Q2DA 1Y5XA 3LB0A 2CHOA 3JZEA 3EA1A 2X0HA 9RUBA 1GQJA 3BLLA 3UF9A 3UJRA 4EAYA 3FJ4A 1H41A 1TKKA 4JIRA 3R2GA 1TUXA 2PD9A 3LTYA 5FAJA 4CN4A 4O16A 4CLMA 3XISA 3DFNA 2NVKX 5G5IA 1GG0A 3B8DA 1E3XA 4MWAE 2D23A 3B06A 4Q4PA 4GIYA 5CSYA 3GR4A 2YAUA 2V5KA 5DMMA 3SIMA 4L6DA 1GOMA 1OYCA 3VNMA 4EE9A 4E4PA 2QNEA 2A8XA 9CGTA 5D9MA 1S5VA 1EYEA 1R3WA 3P80A 1LZOA 1ISZA 3KRUA 4AZ6A 3VIPA 3ZXWA 2PLCA 3G1AA 3QHMA 5HNNA 2CZDA 4MNLA 1HKVA 2GQAA 1C9DA 3S9IA 3C3NA 2YA2A 1EEPA 1IXPA 2X09A 1J96A 1PJ9A 3JZUA 2H8ZA 4DYKA 3IJIA 3E9AA 4XZIA 2JFEX 2W92A 4RUBA 1EO5A 2OEMA 1RY0A 4DJFD 2V6OA 2QCFA 4S3BA 3TONA 4NJGA 1Z3NA 3EWCA 4F0HA 4LRTA 1TPWA 4HPXA 5IDZA 3T0CA 1CIUA 2OLAA 4PL2A 1DWJM 5D2TA 3LEPA 5JCMA 4AU0A 1VLIA 3ITXA 4TR9A 3TSMA 1OADA 4H4PA 1E9LA 5T91A 1ZRQA 2XH0A 4GRSA 4EKJA 1QW8A 3TJIA 2ZZ2A 1A50A 3R13A 4J7RA 3NL2A 1E5NA 2VX5A 2OGYA 3B8VA 4HMDA 1LLWA 1VD6A 2JQXA 3AI0A 1F6YA 1JPIA 1D3HA 2NQ5A 3RPDA 4AIBA 4B2DA 3B03A 4KRTA 3F4DA 2ZA3A 1C90A 4JNMA 4RX0A 4JN6A 3WDQA 2G0WA 4XZWA 1DHPA 2JIEA 3CL6A 8CGTA 3B9DA 4NZ1A 4GNKB 1MW0A 5LIKX 2NVCA 5HBFA 1DIKA 3PTDA 2GGJA 1XC4A 1JNDA 3BAKA 4DZIA 1WKFA 3ZR6A 2POZA 1LBLA 1EBHA 3CQKA 3HPAA 3NPUA 4DBSA 1GW9A 2WHLA 1B5TA 1I0BA 3VOJA 1XCXA 4JIQA 2WSYA 3GRIA 1JAEA 4CGTA 3CV7A 3WF4A 2HVMA 3GLCA 4Z1AA 2WKLA 5D03A 1Z32X 1CLKA 3BW3A 5MKGA 3WF2A 3BMXA 4JPGA 2VC5A 3UD6A 1TA3B 2E40A 4JFWA 1YX1A 2VXNA 2J9YA 3BOXA 3ZQ9A 3A5VA 2NSXA 4B3KA 1BHGA 1O1HA 4MSSA 1Q63A 3SW6A 3T0DA 1JDAA 1R38A 4UUIA 1KFBA 2WYSA 3AMKA 4MUPA 4LOCA 4B5SA 1J6OA 1Z69A 1Q7QA 4LXFA 2PTZA 1IWPA 4EQSA 3EX3A 2W66A 3P67A 4AY7A 1UH4A 1W1B1 4OU1A 5JH2A 3WH5A 1PXGA 1UIOA 4AXNA 3UG3A 1I0DA 2HTMA 1YBQB 3KZSA 5MHBA 3STCA 1V02E 4S3EA 1S5TA 3GVVA 2DW6A 2PP1A 3I7SA 3SO7A 1V3LA 5J8LA 1KRBC 1B9BA 2HBVA 2J8TA 3G3MA 5AHMA 1LRNA 5LNUA 3PPGA 5D38A 3UY8A 1M9HA 1HQTA 3ITYA 1LYXA 2G50A 4HPHA 3IV3A 4BQ3A 1LLZA 2HNHA 1PIGA 1W3JA 3NQ8A 3S47A 3EBVA 2H3BA 4IGHA 3KL5A 4OV4A 2WBKA 1H7XA 4B5TA 1EO7A 2GWGA 4M7TA 1ZHAA 1ZL1A 4UTMA 1WXZA 4FNTA 4DO4A 1Q2SA 2XGIA 1S2VA 1EHAA 4JFTA 4BQ4A 3W2KA 4D6GA 3H24A 4K39A 1UUMA 1MNSA 4K7YA 1YMYA 5LXEA 2W54A 1AVAA 4AC1X 3SJ3A 2Z27A 3KX6A 2ZXBA 3NOYA 2PCEA 2YDRA 3QOKA 4UFIA 2J66A 1EXPA 4W7UA 3FA5A 1E6RA 4YMZA 1V3KA 4EF9A 1TJRA 3LQGA 3EA3A 4OT7A 4EWJA 3AZRA 1DJQA 2ZTJA 3WKZA 4DJDA 2CYGA 4QX4A 3D3AA 5JCKA 3NQMA 2GGHA 2R24A 2X7WA 3UR8A 4GXMA 3B0PA 4CVWA 4AD1A 1NDWA 2BCPA 3CV1A 1PWLA 4QTGA 3FKKA 3EMZA 3IUDA 4O1AA 2W61A 4K1WA 3N4AA 4NJKA 3GC5A 3SQSA 3I6TA 4GKLA 3VNZA 4ZMGA 4H6QA 3VYLA 1WP6A 1ZQ5A 5K7JA 5IHSA 1HVQA 1ZJAA 3AIUA 4UR8A 4YWOA 3W7LA 1GXFA 1OABA 4KERA 5C9XA 3OIHA 2FGBA 3W37A 5F1UA 1SZNA 2QF8A 4WOQA 5HQMA 4QROA 1UD2A 4I8DA 2ZX8A 1UIPA 4FXRA 4NXSA 4HYVA 4WJEA 3QN3A 1JPHA 3V0TA 4CQDA 5LGZA 4X3ZA 2NPXA 4AY8A 1UQYA 2DEPA 1CT5A 1FEBA 2J7BA 2R82A 1VIZA 3IUIA 4MB3A 1XYLA 3N3TA 2Q01A 2WSRA 5AFDA 2Y85A 4LCQA 4WJ8A 2ZX6A 2REQA 3K1DA 3ME3A 1QI4A 4ZQCA 3W87A 5DANA 1D7KA 2PDKA 1RA5A 4PBEA 3SFKA 1W6TA 3SCTA 2BGQA 1JXJA 4L64A 5DELA 2E7FA 2A7NA 3NAVA 1EBDA 2OWCA 3AHZA 4QCFA 3DUGA 1JEHA 1PVNA 5GNYA 1AW2A 3GC2A 4YPJA 5FEPA 5EBUA 2WKJA 3C2OA 3WDHA 1P6CA 1Q6RA 3P6LA 3PPCA 1Q7ZA 2GUBA 3CLMA 2CW6A 3NZ1A 1PTDA 2C1GA 2QJHA 2QXWA 4MPKA 1B31A 3TQPA 4U2ZA 3VGEA 3QR1A 2WPGA 3W81A 4GISA 5BWAA 3K4WA 4PN2A 3T6CA 2B4GA 5C2GA 1GCYA 3GDLA 4GFSA 1N7KA 3KCJA 5A6BA 4L1XA 5G5GB 1YKWA 4O4WA 4Z0JA 4FZIA 4H4TA 1HT6A 4KF1A 2ZUUA 2P8CA 3BCJA 4AH7A 1TPDA 4O8RA 1A53A 1FUYA 2ZXDA 2Y7EA 4E2VA 1J11A 3W6MA 4FX6M 4QFUA 3RO8A 4GXWA 3PHAA 3UESA 3ALFA 2HPIA 3QMSA 5DXXA 5CGMA 3IJ9A 1GUVA 3EAUA 4KEVA 1EA0A 3TW7A 5DEZA 4E2DA 1XRVA 2QHAA 3BZGA 3B8SA 4IIBA 1J0KA 5T9BG 4C65A 4TTGA 1JG9A 1MFUA 1ECQA 4BQ5A 2X8GA 3C86A 2VEMA 2VRJA 3BO9A 4OWGA 4OHQA 1NFGA 1KM4A 3TYAA 3OZOA 1BWKA 1JDEA 3MP3A 3M0IA 1BGGA 1FWDC 4D6JA 2G3MA 2GFTA 3MZNA 4HPNA 1JUKA 4OBRA 2Q8ZA 1N8FA 1KA9F 1VB9A 4ACZB 1FKXA 3KOXA 3EDKA 3UETA 1FDYA 3UBPC 4MY8A 1UG6A 2R1MA 2VR4A 1JGIA 5FEWA 3E2RA 3Q4DA 1AH0A 2A4AA 2G37A 1PHQA 2VDGA 2EJ1A 1VBRA 1W17A 2WANA 2ZZ4A 1WZMA 3I6RA 3UY7A 4TMBA 4G7EA 3TOPA 3CLWA 4Q8WA 3WK0A 2VVNA 1YDYA 4TVYA 3C2FA 1KRAC 1J8VA 1TJ2A 3MKVA 4RJEA 5LHFA 4XSLA 1MO0A 5FF3A 2C91A 4MYXA 1M1BA 5DRCA 1S5MA 1O7AA 2R1NA 1X2HA 4UQEA 3E6EA 1V59A 1MUWA 3W1MA 4NIRA 2YX0A 2J7EA 1K02A 1OGBA 3CNYA 4YTUA 1BG9A 3KHJA 1XGZA 2ZZ5A 3GB6A 4HK7A 2D2GA 2QJJA 2TSYA 2DIJA 1BGAA 2EG7A 3SUWA 3EPNA 1V7AA 3GE7A 4NQ1A 2DZXA 3P8JA 3WNKA 2ZBTA 2BOEX 1V93A 5JBEA 3N25A 3VE9A 3W24A 3E2SA 3FYPA 5C9UA 3S8HA 3R07C 3TNBA 1UZHA 1SFTA 3UCDA 3GIQA 3H12A 3KVKA 4XD3A 3TYBA 3MKCA 5DT5A 3H53A 2INZA 1LOQA 3EOSA 1QWKA 3LXAA 1K4HA 1JCMP 2E0PA 3GU2A 4ZOAA 3CIVA 2BVWA 3VNJA 4I5XA 3FS2A 2AGKA 1JI2A 4GX8A 4KWVA 1LP6A 2YIHA 4FXFA 5CZJA 1X96A 3GTIA 2VX6A 1EC9A 1FHDA 3HM7A 2NZLA 1ELSA 1TQJA 5CZSA 4C7FA 1DNCA 3VAVA 3C3UA 1R0MA 1H11A 5FIPA 4DBWA 2W0HA 5HUPA 2QAEA 1GVEA 1JCNA 3HJZA 4JS3A 3NUKA 2HE8A 4H9TA 5IBXA 1EYWA 1GOIA 1RQHA 3FVDA 4M8UA 2QPXA 5HA7A 1A5KC 4WK9A 1KXVA 4IQEA 1C8XA 1BTMA 2J9XA 1UR3M 4GY1A 2D0GA 3KRSA 3NYZA 2GR1A 1UZ4A 3W7OA 1XDJA 2A1YA 4AFYA 3THQA 3C8NA 5FF0A 1OD0A 3T8LA 2HK1A 1CW2A 1Q5MA 3BW2A 4RR4A 5BXTA 4OZOA 4R5EA 4OJYA 1JZ6A 4KS0A 4DJEA 1E73M 1M6JA 1RJRA 3ABZA 5A1AA 1BQCA 3UZWA 4AVNA 1OHLA 5HWNA 3U2OA 2V3BA 3UJEA 2DT2A 3L2MA 5CPMA 1QK2A 4JIHA 1XLBA 2R14A 5I23A 5HMSA 2GR3A 1KC7A 3MCMA 2PDJA 3HGOA 3NWRA 3UWWA 3G1VA 3LXCA 2PDQA 2R1PA 2X0SA 4GVGA 2ICSA 3SR7A 2QJMA 3A4WA 2WWCA 1W31A 3TJLA 4YCPA 3WJSA 2MNRA 2RDTA 3OODA 4GVFA 3GXFA 4P7OA 5I2UA 3LCXA 4M51A 2WJFA 4XAZA 1XLIA 2G3NA 3VABA 1UP0A 1GZ1A 1QXLA 4H01A 4PMVA 1XANA 3WMLA 2AL2B 4GIAA 4UTLA 1ZY8A 2Q09A 2WZIA 3GVGA 4IMCA 2Q8LA 2HE5A 2UWFA 5BOFA 1KFKA 1NQKA 2YGYA 3NSNA 3N13A 2H90A 1ZMDA 1XR2A 3CU2A 3W1LA 4ZSUA 1VCGA 2CCRA 3MSYA 2PDWA 3GNNA 3R8RA 1QWGA 2V6AA 3I10A 1CTNA 3WQ5A 4EMJA 4WDTA 1UUQA 1AUSL 3ZSSA 5CSRA 4WZHA 2VP8A 1Y65A 2Q3RA 1OGGA 2V68A 1AD4A 3A13A 4E3VA 4YXGA 4CNTA 1LL4A 3QC3A 1W3IA 2B7OA 4D9PA 3WLTA 1I75A 1P0BA 3RLHA 2NLIA 2G4FA 2RH9A 5FESA 3I6EA 3R94A 1JZ8A 5DXYA 3C2VA 1JPMA 1A0CA 2FPVA 3M64A 1BWLA 1JFHA 5CPNA 4UTJA 3PUEA 1UPPA 2D1ZA 3DHUA 3WDJA 4XAGA 5FS6A 3NQGA 4AD5A 1NWRA 1IEWA 2EAWA 3EX1A 3CUFA 1XUUA 1OK4A 4IGMA 1UW9A 4JDYA 3CGCA 4F0LA 2WMIA 5C8BB 1CXLA 2VENA 1KKRA 3MWCA 2F38A 3WFZA 2XGBA 4DPPA 1FWFC 1PZ0A 3SY1A 4UTTC 3TMLA 6ENLA 4NKCA 4XWUA 1UP3A 2VNCA 3VIHA 3V36A 2OZ3A 4PMYA 3RGTA 1XYMA 5L6UA 4W9TA 2XYLA 4MNMA 6REQA 1M65A 3W29A 1DJIA 2WKGA 2WO5A 1A5UA 2WOQA 4FPSA 4XTIA 4Z2KA 2ZKMX 2BSLA 1OB0A 3QY7A 2FYMA 1MNZA 2D20A 3U57A 2X7VA 1YPIA 4GYKA 1OC5A 1TQXA 2V5CA 1V8EA 4HA4A 4EQWA 5E5CA 3V5FA 3T2OA 2QV4A 4Y90A 2OX4A 1DQUA 2QCGA 4JTQA 3QFEA 4K36A 4PTWA 1ZAHA 3CAVA 4XZMX 3I3BA 3IIVA 3IJDA 3KS5A 4DZAA 4Z1BA 3OU8A 1EDGA 1TELA 3OYXA 1ZALA 1QMLA 3LTPA 5CGQA 4IMFA 5DMLA 4AW7A 4C90A 3MANA 2W27A 4UTUA 3II1A 5REQA 4Q8VA 3MP4A 2O56A 1SO5A 4NAFA 3EOEA 1MZHA 1GOQA 4Q8NA 3EEZA 1YXYA 3HJEA 1SR9A 3OOQA 1FX6A 3FHQA 2QPUA 3VDAA 1ZP3A 2FZ9A 2BY1A 2CZFA 1GRGA 5T26A 4F0RA 5C9ZA 2CESA 4D71A 3VOHA 2VI0A 1H61A 4O17A 2BWGA 4PMRA 2ZUNA 3UWEA 1KTNA 1BXBA 1ISYA 1EBGA 3IGXA 2HQAA 4P7RA 1WQ5A 1UJPA 4PUJA 2XJ7A 3VX0A 3NURA 2J7FA 2HROA 4CD7A 1TJ1A 1HKIA 3RITA 3QFAA 1V6UA 1OZMA 2WC3A 1QFEA 3SEPA 3BK0A 4LPCA 2QR6A 3AS0A 1UUOA 1ZENA 4O12A 2J27A 2BTMA 2AMXA 1G01A 5LNRA 4TVDA 5HATA 1MW2A 1EC7A 5JVLA 4ZQNA 3XIMA 3LCGA 3MV01 5FI8A 1C9WA 1VFTA 9XIMA 2Z29A 3MO4A 3AALA 2O92A 2OPJA 1LG2A 3IWPA 4CCCA 4EF8A 4Z08A 3J7HA 4FLOA 4FI4A 3DBNA 4L6HA 3F5KA 3FNDA 2I17A 4MKSA 3FJLA 1EPXA 2GH5A 4K37A 3M0XA 1V97A 1E1CA 1JDCA 4YTQA 5FF4A 3R8GA 2OZTA 4YWIA 4ZB2A 1K6AA 1KBJA 4PMDA 1XGDA 4LJ3A 1WKYA 4RZBA 5LIYX 1C7SA 3PZVA 4M24A 4XD5A 4AMCA 4FEZA 2GSJA 4LAUA 1J10A 3KBJA 4QE1A 3ZR4A 4B5VA 4IIDA 2VD9A 1OCQA 2RDUA 2D69A 4B16A 3IJ7A 2HMCA 3S1VA 3DFTA 1X1NA 4HVXA 1C8VA 3DC0A 3C5QA 2FH6A 3F5JA 1E6NA 1K4GA 2W62A 4GCXA 1A5CA 3FX4A 3OHIA 3MHUA 3KTSA 4J57A 4FXJA 4APNA 3U2EA 1FWWA 2YXOA 4OUEA 4QP0A 3H4GA 3E1F1 2E1WA 3W1PA 3ARWA 4LYQA 2HSAA 7ENLA 3H2NA 3A12A 4P8XA 3P14A 5A8GA 4H9ZA 4B9ZA 3B3DA 4W5UA 1Q6FA 3S2MA 1HUVA 1YDVA 1GERA 3L9CA 3HA1A 3H23A 3T8QA 4A21A 5I6SA 3VUPA 3EWUA 3UR7A 2JKAA 3WD2A 5FSEC 3KBVA 2QAFA 3AZTA 3ZO9A 1J4EA 2F84A 2P76A 1J0IA 4BWLC 1AG1O 2YVFA 1CXHA 2OGJA 5C6MA 4MLRA 1WO2A 3MB9A 4UOQA 2C0HA 1NOWA 3DCPA 3QQ0A 2PF0A 3E0FA 2Q6ZA 2C7FA 1VAHA 1AZ2A 4ZB5A 5FA5A 4HHLA 1OFEA 3G22A 2WP5A 4P7QA 5AZ1A 2YL5A 3PNZA 1BAGA 3AN1A 3NL3A 3EWDA 3S46A 3O07A 4FSAA 4RNHA 1H7PA 4Q33A 5HANA 2YW3A 3KAOA 4S38A 4BKNA 1ODZA 2C19A 2GJRA 5D05A 4QQ3A 4H4VA 4IL2A 5IFTA 4DN1A 3AWOA 3LNPA 3H2FA 3TUUA 3G8RA 4LUIA 1MI3A 4C6NA 4WSJA 3CIWA 1KRMA 2CBJA 4K6AA 3GW3A 1RCXB 3FCPA 4POCA 2DJXA 3T0BA 3AIVA 3S5NA 1OIMA 4R27A 2B81A 4H7CA 3DHPA 4J40A 3W86A 4FIQA 1GYLA 3TA9A 1QOXA 4JX6A 5CPQA 1MXSA 4V15A 3LPPA 2ZC8A 3LBCA 3M43A 3QC0A 3WJXA 2PDPA 1J9YA 4LUTB 4WR3A 1K8CA 1MUCA 3S42A 5U4NA 2X16A 3PM6A 3H7RA 4ONVA 3CTLA 3CWOX 3WL0A 4OV9A 3V1HA 3ARZA 2PLJA 3WMBA 3AIEA 3RRAA 1ZBVA 1E0TA 4W84A 2PBGA 3G1SA 3RAOA 4H9YA 1XIIA 3M0YA 5AHEA 4UWMA 1FRBA 4N7QA 1KXHA 4S3CA 2V9DA 2OEKA 2PWFA 2WCSA 3WFLA 1UA3A 4NF7A 1VCVA 4EPDC 1NHPA 2E8YA 2GK1B 1LWIA 1P1MA 3THUA 2ATMA 5A3HA 4HNLA 3CH0A 4U31A 5E0KA 3ANUA 3HB9A 3IIXA 1RALA 2PE4A 2WPBA 1F2JA 1H2IA 1F76A 4AZCB 3WBXA 3IK4A 4ZXOA 3F4VA 1X98A 4PUMA 5F2IA 4H4YA 3UXLA 2DQWA 1UB3A 1EFZA 4HOZA 4BEQA 3W2NA 1GVQA 5EMLA 1KM6A 5H1WA 3FYYA 4AY1A 5KETA 2Y7FA 3BLDA 4XBKA 5J5RA 5EBAA 2Z6IA 1KGUA 4PUDA 4PMNA 3O63A 2ADAA 3GYCA 4BI5A 2ISVA 1RK6A 3SSZA 1V6YA 1ZCOA 4PE8A 3BQ6A 1IXOA 1BF6A 1FTXA 2W79A 1Q65A 4CD8A 1AH3A 2QCEA 1BXCA 1K77A 4IT1A 3AXKA 3P0WA 2Z00A 1EJRC 4Z0SA 3FN9A 2GVGA 4JTLA 5CJ5A 4AZ5A 4EOUA 1OBAA 4FNSA 1ITXA 4HU3A 1FWTA 2V8ZA 3ETRB 1OX4B 3LLFA 3GAYA 1KQZA 4ZFCA 3LCFA 1GOOA 3GRTA 2Z4GA 4EK7A 3U9IA 3LOTA 1R30A 2CLMA 2YCJA 1E4NA 3AFBA 2PGRA 1QPKA 3U0HA 5AVHA 1IT8A 3OHMB 4GX9A 3SZ8A 3WK1A 2FB3A 2D24A 3W7NA 3BLPX 4I7VA 3UWYA 1E56A 3AUOA 3WQVA 2B7QA 3W82A 1TA3A 3UZYA 2TYSA 1H0GA 5AY7A 1H51A 4NZFA 1EB3A 2ONEA 3VMPA 2V30A 1ZFJA 2YFNA 2JALA 3LV5A 1FWHC 1Q6EA 2XIJA 1FQ0A 2Y70A 1R46A 2DPEA 3BMVA 1S5WA 3N4FA 1PZ3A 2EHHA 4EPEC 2EO7A 1VHCA 4CNOA 5A94A 3G2GA 1LPFA 1LVLA 3M7WA 2J6XA 1PX8A 3TTSA 1ZPTA 4Q32A 5TF0A 1YBQA 3EZ4A 1HKKA 3VDHA 5KZMA 2OELA 1G7VA 4YIWA 1HJVA 3F2CA 3UJFA 2WOWA 2R1LA 2QCDA 3FW6A 3GH7A 1UR2A 1NU5A 3R58A 1BYBA 2IQTA 4B91A 1MVYA 4O4VA 4GI4A 3VMNA 3WLLA 4NU7A 2EKGA 1LL6A 4C6FA 1R6WA 3M07A 2YLLA 2FGZA 1XIGA 1TVPA 4US6A 1XRTA 7ODCA 1EDQA 3H22A 1J0ZA 3G5EA 1TSIA 5EMKA 4AWUA 2XIMA 3ABOA 4D6IA 3AS2A 4OECA 2ZRYA 5C55A 3LG3A 4R7WA 4AVFA 3C6CA 4CNUA 4P8UA 5JCIA 4NX0A 3PZNA 1I2PA 1EGZA 4O1EA 4D2JA 3H7UA 5LXXA 3BLFA 4XAYA 5KMYA 1TR1A 5JUVA 1W9XA 4PB3A 4W86A 2VGIA 5BROA 4LS2A 4O11A 1KFWA 1MXDA 4E5TA 3KOFA 5HWJA 1CECA 1FFQA 2HQMA 2EQDA 1C3FA 1K9EA 3UXDA 4JN7A 2IXUA 2Z1VA 3ANYA 4XTDA 1C93A 2VCCA 3QSRA 4FX9A 3K1GA 2OJPA 4Z17A 2HS8A 4FS9A 4Z2JA 1NTHA 3PWGA 4EM3A 4ZA0A 4DNAA 2A21A 1KN0A 2PMQA 3UT0A 1JUBA 4G8TA 4I9MA 3IGUA 2AOSA 2V3DA 3UJSA 5JXQA 2Z1XA 1JZ3A 1DE6A 3E0LA 3N4EA 2BVYA 1G4EA 1IF2A 1F6PA 1R8LA 4LAZA 3VVGA 2OEJA 1AW1A 2FIQA 4N9DA 3BXWA 4CU8A 1OT1A 3NQ7A 1IR2A 4ZL1A 1RVKA 3FY1A 4MY9A 4AEFA 4CN6A 3OA5A 4F48A 2PURA 4AD2A 2HEJA 3O6YX 2GRTA 5DO8A 4YTTA 2OSXA 5FJIA 2P3EA 2CLLA 5A6JA 3L4VA 4XG1A 3GHUA 4XVEA 1J18A 1RP9A 3PK7A 3NFUA 2I5QA 1N82A 1PX3A 3IARA 4HKPA 1IIHA 3WUGA 5B7ZA 3WBAA 4ATWA 1FFVC 2A6LA 3OLDA 2GUUA 3A4AA 1XLAA 3KTCA 4MKVA 3AUJA 5A6SA 4LY8A 1H4PA 1EJVC 3RJYA 2XH4A 1KQYA 1PE1A 4KWUA 1RCQA 1HO1A 3EDFA 3VIOA 2ASHA 1XQLA 4C6LA 1ODUA 1AMYA 3MYOA 4FNPA 1J01A 4BF7A 1DQXA 3IIPA 1BG4A 1Q6QA 3BQ5A 1GZJA 5KINA 3GHTA 1QT1A 4UZSA 1X38A 3N2BA 1TREA 3DX5A 4GFIA 3A7UA 3GXDA 2NLYA 4KFOA 2ZZCA 1ZMCA 3NQAA 1H50A 4Q22A 4C6BA 3VOCA 3A23A 4EMWA 5CPSA 5FF7A 4N6EA 1VFOA 3ZVIA 2CNCA 4QITA 2OMAA 2J88A 4ICNA 3AIQA 4ZVJA 1M7PA 1VGAA 3SUTA 4ASTA 2E4TA 1VJSA 4PYSA 1XRFA 2CKRA 3EWBX 2IS7A 4HHPA 4KW2A 5I0DA 8XIMA 4NAEB 2WSPA 1SZFA 3PBGA 1I1XA 3SY5A 3W7JA 2ZXQA 1Z41A 3ORWA 1B3WA 3S3GA 1BYCA 3WH6A 4X0NA 2DZAA 4DXXA 2E67A 3LMZA 4AF0B 3BCFA 1DWGM 1D7YA 1XG4A 1F7BA 1VBUA 4US5A 1OFAA 1E6XM 4W93A 2VDIA 4O1BA 4DELA 3WBEA 2WNWA 3SR6B 4Z1YA 3P8IA 1VJZA 2UY2A 5M17A 1CYGA 2QJGA 1OZQA 4NP7A 4GI8A 3VDGA 1OCNA 3IAQA 3R7MA 1TMLA 3F5LA 1F61A 5BXRA 4ZTYA 3QTPA 1B3VA 4K7ZA 3L68A 1DJHA 1R7AA 1B90A 3H2CA 1PHWA 1EPVA 3N18A 4A29A 3HTWA 3M0LA 5DCBA 1E15A 1RK5A 4L4LA 2BNJA 3R0KA 1RBAA 2CHRA 3AMGA 4GO8A 2QYGA 3JR2A 2PBOA 3ARTA 4INFA 1ZXIC 3UZZA 3MVTA 8RUCA 3T9PA 4PFMA 1UD4A 1RY8A 5EYWA 1CXEA 1V0KA 4AWEA 3GU9A 1Q8AA 3ES7A 4J3TA 2RDWA 5FJPA 3ZM8A 4ACZA 2Y61A 1H7OA 5G1YA 3EDEA 1OEPA 1W3HA 3LRKA 3VI2A 2J25A 2WPFA 1YXDA 3OJGA 2ISFA 3MS8A 1E51A 4ICMA 3WQPA 1TB3A 2QGHA 3B05A 3TDFA 1AD1A 3O7UA 1UMLA 3SCRA 4DXKA 3PN8A 4H4WA 4HPGA 1XYFA 2ABAA 3CWNA 4LBUA 3F2DA 3N2TA 3S5SA 5EL1A 1VPYA 3AHTA 1DKWA 5C9RA 3L66A 1XL9A 3CEPA 2UY4A 4QEEA 3KTXA 3GUWA 1JYNA 2JF7A 3ZIZA 4O28A 2ZXAA 2RABA 4CQAA 4KETA 2WZEA 1EHNA 2IPJA 4J3VA 4W5ZA 3GDKA 4DM1A 1M3UA 1B30A 4XKMA 4ML4A 3RJXA 3AO0A 2WVVB 1HGWA 4NI8A 5FJJA 1ME9A 3U8GA 5C2XA 1EZ2A 3W72A 3WDIA 3RU8X 5B80A 3UFYA 2JKPA 1X8CA 1PKMA 3VILA 1QNRA 4J3XA 1QBAA 3UPMA 4MG4A 1Q4NX 4RNFA 4AEEA 4TVWA 2VGFA 2GDQA 3QXBA 1XKJA 4KKXA 1LT8A 3DEQA 1FCUA 1XGEA 3JS3A 2J4GA 1EIBA 2WZMA 1UR9A 4NL1A 3URHA 5EMMA 3V0UA 4N9BA 1VPQA 3THDA 2QZRA 2F8QA 1XP3A 1K8YA 3R6IA 3MUY1 2ACQA 4AX7A 4FAMA 3R11A 2PWDA 2ALRA 2WZHA 3K8KA 1WDSA 5CBBA 2G97A 4R85A 4ACYA 5AC4A