3JVKA

Crystal structure of bromodomain 1 of mouse brd4 in complex with histone h3-k(ac)14
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
AMGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 42
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3jvkA01
5LJ1A 3MB3A 4QR3A 3TLPA 5IGLA 2RS9B 4A9KA 4YC9A 5A82A 4TZ2A 5ENBA 4BHWA 3MQMA 5L99A 2RNWA 5HLSA 4CUUA 5AMEA 3O33A 3IU6A 4N4HA 4OGJA 2RNYA 4HXRA 5C87A 3FKMX 5JI8A 2D82A 2YW5A 4QYLA 4C66A 5FB1A 4CLBA 4MEPA 5D3RA 5CY9A 1WUMA 5E0RA 4ZW1A 4N4GA 2DVRA 5D3HA 4MR5A 4HBXA 5FB0A 5TB6A 5D25A 5FE2A 4NR7A 5F63A 3ONIA 5CQ5A 5A5OA 5HFRA 5D3LA 4WIVA 3MB4A 4IOQA 5IGMA 5FFVA 4O7AA 5AD3A 5EPRA 2MJVB 2FSAA 3UW9A 4IORA 5DLZA 5C7NA 2F6JA 5A5QA 3QZSA 3UV4A 5F1LA 3AADA 3U5JA 1ZS5A 5IIDA 5FE3A 5H1UA 5CUGA 2DATA 4QUTA 4HXSA 4YBSA 5HEMA 4O7CA 4NRBA 5ENHA 3QZTA 4OUFA 2RI7A 3ZYUA 2D9EA 4HXOA 4J1PA 4YH3A 5HRVA 3P1DA 4QC1A 5CQAA 4ZQLA 5HRXA 4YYGA 4A9JA 4PCEA 4UYDA 5FE1A 5D3TA 2L84A 3JVLA 3LXJA 5C89A 4QUUA 3UVYA 4QNSA 2NXBA 5D3PA 5ENCA 4O74A 5EWWA 5IG6A 4LYIA 4YYNA 4YABA 4CFKA 5II2A 1JM4B 5I7YA 5I88A 5FG6A 5L98A 5ENEA 5F3AA 5DFCA 5ENGA 2L85A 4MR6A 1JSPB 3JVKA 4UIVA 3P1CA 2F6NA 5KO4A 5F25A 5FBXA 5A7CA 5KU3A 4YYMA 5EGUA 3G0LA 5G4RA 2WP2A 3JVJA 4LRGA 4XY8A 3UVXA 4IR6A 4HXLA 4YYDA 4QSSA 4NUDA 5IGKA 5CUAA 1WUGA 1N72A 2WP1A 5DYXA 5FE6A 4IOOA 5EK9A 4BW2A 5G4SA 5ENFA 5LVQA 4YY4A 5D26A 4QR4A 4NR6A 4A9OA 5BT3A 5DKDA 5E73A 5DX4A 5BT4A 5LKUA 4UYEA 5E9LA 5CQ4A 4QSRA 4YATA 3QZVA 4XY9A 5HFQA 4IR5A 5CQ7A 5DYAA 4NRCA 5CUBA 4TTEA 4PCIA 5CUEA 4A9IA 3P1EA 4BW1A 5K29A 5ETBA 3UVWA 4MR3A 4HXPA 4ZC9A 4J0RA 4NQNA 4NYXA 4LZSA 4O78A 5TCMA 4UIWA 3NXBA 4NR4A 4HBYA 4CUQA 1E6IA 5COIA 5EPBA 2RNXA 5E9VA 4PY6A 2RO1A 5EWHA 4YYHA 5E9YA 5LKXA 2YDWA 4YY6A 5C8GA 2L5EA 2R0YA 4O70A 4TT4A 3DWYA 2DVQA 4FLPA 5L8UA 5FE4A 5ACYA 5H1TA 5I29A 3UV5A 4QSPA 3SVFA 5FH6A 2I7KA 5CUDA 5F2PA 4Q0OA 5HJCA 5LVRA 4NUEA 3HMFA 2YELA 5FE7A 3AQAA 3Q2EA 5L96A 4QEWA 5A5SA 1EQFA 5F62A 3IU5A 4QSTA 5F5ZA 4O7BA 5FFWA 2E7OA 5E9IA 4YYKA 5L97A 5EWDA 5HQ6A 4HXNA 4YBTA 5CGPA 5HENA 2GRCA 4QC3A 4A9NA 4TU6A 4A9LA 4NYVA 5I40A 4O7FA 5EQ1A 5H85A 2E3KA 4LYWA 1X0JA 3O36A 5FG4A 2E7NA 3JVMA 5DLXA 5D24A 5F60A 2DVVA 2N9GA 4LYSA 5FE8A 4XYAA 4IR4A 5DY7A 4HBWA 4QEVA 4CUSA 4BJXA 5EP7A 2R0SA 4WHWA 2G4AA 5C85A 2OUOA 4LZ2A 4N3WA 5CQ8A 5EM3A 4Q0NA 5CQ6A 2H60A 4QSVA 2YYNA 2DWWA 4CURA 5EV9A 5E9MA 4NYWA 4Z1SA 4MENA 4LC2A 4KCXA 4J3IA 4C67A 4TS8A 5I80A 4QYDA 4TU4A 4YK0A 5FFYA 3UV2A 5F1HA 5CU8A 5BT5A 5FDZA 5FH8A 3LJWA 3UVDA 3HMEA 4YADA 5EI4A 4GPJA 4YYIA 5ENIA 2R0VA 5HQ5A 4YAXA 4HBVA 3G0JA 4Y03A 4O75A 4Z93A 3SVGA 4KV4A 5IBNA 4NUCA 3D7CA 4QSWA 3LQJA 4J0SA 5E7DA 4RVRA 4Z6HA 5FE5A 5A5RA 3MXFA 4CL9A 5D3NA 4Z1QA 3MUKA 4UIYA 5ETDA 4TQNA 4N4IA 4NR9A 4NXJA 4ALHA 4OGIA 5I7XA 4NR5A 4Z6IA 3P5OA 3S92A 5EU1A 5ENJA 4F3IA 5KHMA 3O37A 3MULA 5HCLA 5E74A 5FG5A 5AMFA 5HM0A 2DVSA 4UIUA 3U5LA 5I86A 4HXMA 5EA1A 5D3JA 4QB3A 5A5NA 5LUUA 3U5PA 5FE0A 4TZ8A 4ALGA 5CFWA 4UITA 5A85A 5FE9A 2R10A 3DAIA 5CS8A 3U5MA 4TT6A 4O76A 3RCWA 4XUAA 5I1QA 5AD2A 3O35A 4YH4A 4CUTA 5DKCA 4QEUA 5IGNA 2DKWA 3I3JA 3K2JA 5II1A 4E96A 5A81A 5DFBA 5CQTA 4O77A 5C4QA 4QY4A 5EWVA 5DW2A 2KTBB 4HXKA 2OO1A 5F61A 4WHUA 4O7EA 4UYFA 3S91A 5HELA 4UYHA 5H1VA 3P1FA 5KTUA 4IR3A 4MEOA 4PTBA 4X2IA 3O34A 3U5KA 5F36A 4NQMA 4UIZA 3LQHA 4LR6A 4KV1A 5CRZA 5EICA 2YQDA 5DW1A 4TT2A 5CP5A 4AKNA 5A83A 4QSXA 4N4FA 4QBMA 4PKLA 3Q2FA 5JWMA 4PS5A 5D3SA 5DBMA 2YEKA 5I89A 2RFJA 5CRMA 2LSPB 5KTXA 5LJ0A 1F68A 5LJ2A 4BW3A 5EWCA 5E9KA 4DONA 5LKTA 4NRAA 5DYUA 3U5OA 4UIXA 5CTLA 5EVAA 5LKZA 4UYGA 4A9HA 4A9EA 5CUCA 2I8NA 4BW4A 5CZGA 3SVHA 5HRWA 5DKHA 4A9MA 4YBMA 3U5NA 4TYLA 4O71A 4O72A 4UYFB 4MEQA 4LZRA 2OSSA 5DYCA 4MR4A 5D0CA 2YEMA 3LQIA 4QR5A 5EPSA 5HQ7A 5A5PA 5KTWA 4LDFA 4NS5A 5EISA 4QSUA 5L8TA 5J0DA 4QSQA 4NR8A 5I83A 5D7XA 4QZSA 5FH7A 5CPEA 3HMHA 5CQ3A 5E3GA 3GG3A 4A9FA 5E3DA 4CFLA 5DFDA 4CUPA 4XUBA 4YYJA
chains in the Genus database with same CATH superfamily
5LJ1A 3MB3A 3D1BA 4QR3A 3TLPA 5IGLA 2RS9B 4A9KA 4YC9A 5A82A 4TZ2A 5ENBA 4BHWA 3MQMA 5L99A 2RNWA 5HLSA 4CUUA 5AMEA 3O33A 3IU6A 4N4HA 4OGJA 2RNYA 4HXRA 5C87A 3FKMX 5JI8A 2D82A 2YW5A 4QYLA 4C66A 5FB1A 4CLBA 4MEPA 5D3RA 5CY9A 1WUMA 5E0RA 4ZW1A 4N4GA 2DVRA 5D3HA 4MR5A 4HBXA 5FB0A 5TB6A 5D25A 5FE2A 4NR7A 5F63A 3ONIA 5CQ5A 5A5OA 5HFRA 5D3LA 4WIVA 3MB4A 4IOQA 5IGMA 5FFVA 4O7AA 5AD3A 5EPRA 2MJVB 2FSAA 3UW9A 4IORA 5DLZA 5C7NA 2F6JA 5A5QA 3QZSA 3UV4A 5F1LA 3AADA 3U5JA 1ZS5A 5IIDA 5FE3A 5H1UA 5CUGA 2DATA 4QUTA 4HXSA 4YBSA 5HEMA 4O7CA 4NRBA 5ENHA 3QZTA 4OUFA 2RI7A 3ZYUA 2D9EA 4HXOA 4J1PA 4YH3A 5HRVA 3P1DA 4QC1A 5CQAA 4ZQLA 5HRXA 4YYGA 4A9JA 4PCEA 4UYDA 5FE1A 5D3TA 2L84A 3JVLA 3LXJA 5C89A 4QUUA 3UVYA 4QNSA 2NXBA 5D3PA 5ENCA 4O74A 5EWWA 5IG6A 4LYIA 4YYNA 4YABA 4CFKA 5II2A 1JM4B 5I7YA 5I88A 5FG6A 5L98A 5ENEA 5F3AA 5DFCA 5ENGA 2L85A 4MR6A 1JSPB 3JVKA 4UIVA 3P1CA 2F6NA 5KO4A 5F25A 5FBXA 5A7CA 5KU3A 4YYMA 5EGUA 3G0LA 5G4RA 2WP2A 3JVJA 4LRGA 4XY8A 3UVXA 4IR6A 4HXLA 4YYDA 4QSSA 4NUDA 5IGKA 5CUAA 1WUGA 1N72A 2WP1A 5DYXA 5FE6A 4IOOA 5EK9A 3VKHA 4BW2A 5G4SA 5ENFA 5LVQA 3D1DA 4YY4A 5D26A 4QR4A 4NR6A 4A9OA 5BT3A 5DKDA 5E73A 5DX4A 5BT4A 5LKUA 4UYEA 5E9LA 5CQ4A 4QSRA 4YATA 3QZVA 4XY9A 5HFQA 4IR5A 5CQ7A 5DYAA 4NRCA 5CUBA 4TTEA 4PCIA 5CUEA 4A9IA 3P1EA 4BW1A 5K29A 5ETBA 3UVWA 4MR3A 4HXPA 4ZC9A 4J0RA 4NQNA 4NYXA 4LZSA 4O78A 5TCMA 4UIWA 3NXBA 4NR4A 4HBYA 4CUQA 1E6IA 5COIA 5EPBA 2RNXA 5E9VA 4PY6A 2RO1A 5EWHA 4YYHA 5E9YA 5LKXA 2YDWA 4YY6A 5C8GA 2L5EA 2R0YA 4O70A 4TT4A 3DWYA 2DVQA 4FLPA 5L8UA 5FE4A 5ACYA 5H1TA 5I29A 3UV5A 4QSPA 3SVFA 5FH6A 2I7KA 5CUDA 5F2PA 4Q0OA 5HJCA 4AKGA 5LVRA 4NUEA 3HMFA 2YELA 5FE7A 3AQAA 3Q2EA 5L96A 4QEWA 5A5SA 1ZKRA 1EQFA 5F62A 3IU5A 4QSTA 5F5ZA 4O7BA 5FFWA 2E7OA 5E9IA 4YYKA 5L97A 5EWDA 5HQ6A 4HXNA 4YBTA 5CGPA 5HENA 2GRCA 4QC3A 4A9NA 4TU6A 4A9LA 4NYVA 5I40A 4O7FA 5EQ1A 5H85A 2E3KA 4LYWA 1X0JA 3O36A 5FG4A 2E7NA 3JVMA 5DLXA 3VKGA 5D24A 5F60A 2DVVA 2N9GA 4LYSA 5FE8A 4XYAA 4IR4A 5DY7A 4HBWA 4QEVA 4CUSA 4BJXA 5EP7A 2R0SA 4WHWA 2G4AA 5C85A 2OUOA 4LZ2A 4N3WA 5CQ8A 5EM3A 4Q0NA 5CQ6A 2H60A 4QSVA 2YYNA 2DWWA 4CURA 5EV9A 5E9MA 4NYWA 4Z1SA 1PUOA 4MENA 4LC2A 4KCXA 4J3IA 4C67A 4TS8A 5I80A 4QYDA 4TU4A 4YK0A 5FFYA 3UV2A 5F1HA 5CU8A 5BT5A 5FDZA 5FH8A 3LJWA 3UVDA 3HMEA 4YADA 5EI4A 4GPJA 4YYIA 5ENIA 2R0VA 2EJNA 5HQ5A 4YAXA 4HBVA 3G0JA 4Y03A 4O75A 4Z93A 3SVGA 4KV4A 5IBNA 4NUCA 3D7CA 4QSWA 3LQJA 4J0SA 5E7DA 4RVRA 4Z6HA 5FE5A 5A5RA 3MXFA 4CL9A 5D3NA 4Z1QA 3MUKA 4UIYA 5ETDA 3ERRA 4TQNA 4N4IA 4NR9A 4NXJA 4ALHA 4OGIA 5I7XA 4NR5A 4Z6IA 3P5OA 3S92A 5EU1A 5ENJA 4F3IA 5KHMA 3O37A 3MULA 5HCLA 5E74A 5FG5A 5AMFA 5HM0A 2DVSA 4UIUA 3U5LA 5I86A 4HXMA 5EA1A 5D3JA 4QB3A 5A5NA 5LUUA 3U5PA 5FE0A 4TZ8A 4ALGA 5CFWA 4UITA 5A85A 5FE9A 2R10A 3DAIA 5CS8A 3U5MA 4TT6A 4O76A 3RCWA 4XUAA 5I1QA 5AD2A 3O35A 4YH4A 4CUTA 5DKCA 4QEUA 5IGNA 2DKWA 3I3JA 3K2JA 5II1A 4E96A 5A81A 5DFBA 5CQTA 4O77A 5C4QA 4QY4A 5EWVA 5DW2A 2KTBB 4HXKA 2OO1A 5F61A 4WHUA 4O7EA 4UYFA 3S91A 5HELA 4UYHA 5H1VA 3P1FA 5KTUA 4IR3A 4MEOA 4PTBA 4X2IA 3O34A 3U5KA 5F36A 4NQMA 4UIZA 3LQHA 4LR6A 4KV1A 5CRZA 5EICA 4AKHA 2YQDA 5DW1A 4TT2A 5CP5A 4AKNA 5A83A 4QSXA 4N4FA 4QBMA 4PKLA 3Q2FA 5JWMA 4PS5A 5D3SA 5DBMA 2YEKA 5I89A 2RFJA 5CRMA 2LSPB 5KTXA 5LJ0A 1F68A 5LJ2A 4BW3A 5EWCA 5E9KA 4DONA 5LKTA 4NRAA 5DYUA 3U5OA 4UIXA 5CTLA 5EVAA 5LKZA 4UYGA 4A9HA 4A9EA 5CUCA 2I8NA 4BW4A 5CZGA 3SVHA 5HRWA 5DKHA 4A9MA 4YBMA 3U5NA 4TYLA 4O71A 4O72A 4AKIA 4UYFB 4MEQA 4LZRA 2OSSA 5DYCA 4MR4A 5D0CA 2YEMA 3LQIA 4QR5A 5EPSA 5HQ7A 5A5PA 5KTWA 4LDFA 4NS5A 5EISA 4QSUA 5L8TA 5J0DA 4QSQA 4NR8A 5I83A 5D7XA 4QZSA 5FH7A 5CPEA 3HMHA 5CQ3A 5E3GA 3GG3A 4A9FA 4AI6A 5E3DA 4CFLA 5DFDA 4CUPA 4XUBA 4YYJA
chains in the Genus database with same CATH topology
5LJ1A 3MB3A 4QR3A 3TLPA 5IGLA 2RS9B 4A9KA 4YC9A 5A82A 4TZ2A 5ENBA 4BHWA 3MQMA 5L99A 2RNWA 5HLSA 4CUUA 5AMEA 3O33A 3IU6A 4N4HA 4OGJA 2RNYA 4HXRA 5C87A 3FKMX 5JI8A 2D82A 2YW5A 4QYLA 4C66A 5FB1A 4CLBA 4MEPA 5D3RA 5CY9A 1WUMA 5E0RA 4ZW1A 4N4GA 2DVRA 5D3HA 4MR5A 4HBXA 5FB0A 5TB6A 5D25A 5FE2A 4NR7A 5F63A 3ONIA 5CQ5A 5A5OA 5HFRA 5D3LA 4WIVA 3MB4A 4IOQA 5IGMA 5FFVA 4O7AA 5AD3A 5EPRA 2MJVB 2FSAA 3UW9A 4IORA 5DLZA 5C7NA 2F6JA 5A5QA 3QZSA 3UV4A 5F1LA 3AADA 3U5JA 1ZS5A 5IIDA 5FE3A 5H1UA 5CUGA 2DATA 4QUTA 4HXSA 4YBSA 5HEMA 4O7CA 4NRBA 5ENHA 3QZTA 4OUFA 2RI7A 3ZYUA 2D9EA 4HXOA 4J1PA 4YH3A 5HRVA 3P1DA 4QC1A 5CQAA 4ZQLA 5HRXA 4YYGA 4A9JA 4PCEA 4UYDA 5FE1A 5D3TA 2L84A 3JVLA 3LXJA 5C89A 4QUUA 3UVYA 4QNSA 2NXBA 5D3PA 5ENCA 4O74A 5EWWA 5IG6A 4LYIA 4YYNA 4YABA 4CFKA 5II2A 1JM4B 5I7YA 5I88A 5FG6A 5L98A 5ENEA 5F3AA 5DFCA 5ENGA 2L85A 4MR6A 1JSPB 3JVKA 4UIVA 3P1CA 2F6NA 5KO4A 5F25A 5FBXA 5A7CA 5KU3A 4YYMA 5EGUA 3G0LA 5G4RA 2WP2A 3JVJA 4LRGA 4XY8A 3UVXA 4IR6A 4HXLA 4YYDA 4QSSA 4NUDA 5IGKA 5CUAA 1WUGA 1N72A 2WP1A 5DYXA 5FE6A 4IOOA 5EK9A 4BW2A 5G4SA 5ENFA 5LVQA 4YY4A 5D26A 4QR4A 4NR6A 4A9OA 5BT3A 5DKDA 5E73A 5DX4A 5BT4A 5LKUA 4UYEA 5E9LA 5CQ4A 4QSRA 4YATA 3QZVA 4XY9A 5HFQA 4IR5A 5CQ7A 5DYAA 4NRCA 5CUBA 4TTEA 4PCIA 5CUEA 4A9IA 3P1EA 4BW1A 5K29A 5ETBA 3UVWA 4MR3A 4HXPA 4ZC9A 4J0RA 4NQNA 4NYXA 4LZSA 4O78A 5TCMA 4UIWA 3NXBA 4NR4A 4HBYA 4CUQA 1E6IA 5COIA 5EPBA 2RNXA 5E9VA 4PY6A 2RO1A 5EWHA 4YYHA 5E9YA 5LKXA 2YDWA 4YY6A 5C8GA 2L5EA 2R0YA 4O70A 4TT4A 3DWYA 2DVQA 4FLPA 5L8UA 5FE4A 5ACYA 5H1TA 5I29A 3UV5A 4QSPA 3SVFA 5FH6A 2I7KA 5CUDA 5F2PA 4Q0OA 5HJCA 5LVRA 4NUEA 3HMFA 2YELA 5FE7A 3AQAA 3Q2EA 5L96A 4QEWA 5A5SA 1EQFA 5F62A 3IU5A 4QSTA 5F5ZA 4O7BA 5FFWA 2E7OA 5E9IA 4YYKA 5L97A 5EWDA 5HQ6A 4HXNA 4YBTA 5CGPA 5HENA 2GRCA 4QC3A 4A9NA 4TU6A 4A9LA 4NYVA 5I40A 4O7FA 5EQ1A 5H85A 2E3KA 4LYWA 1X0JA 3O36A 5FG4A 2E7NA 3JVMA 5DLXA 5D24A 5F60A 2DVVA 2N9GA 4LYSA 5FE8A 4XYAA 4IR4A 5DY7A 4HBWA 4QEVA 4CUSA 4BJXA 5EP7A 2R0SA 4WHWA 2G4AA 5C85A 2OUOA 4LZ2A 4N3WA 5CQ8A 5EM3A 4Q0NA 5CQ6A 2H60A 4QSVA 2YYNA 2DWWA 4CURA 5EV9A 5E9MA 4NYWA 4Z1SA 4MENA 4LC2A 4KCXA 4J3IA 4C67A 4TS8A 5I80A 4QYDA 4TU4A 4YK0A 5FFYA 3UV2A 5F1HA 5CU8A 5BT5A 5FDZA 5FH8A 3LJWA 3UVDA 3HMEA 4YADA 5EI4A 4GPJA 4YYIA 5ENIA 2R0VA 5HQ5A 4YAXA 4HBVA 3G0JA 4Y03A 4O75A 4Z93A 3SVGA 4KV4A 5IBNA 4NUCA 3D7CA 4QSWA 3LQJA 4J0SA 5E7DA 4RVRA 4Z6HA 5FE5A 5A5RA 3MXFA 4CL9A 5D3NA 4Z1QA 3MUKA 4UIYA 5ETDA 4TQNA 4N4IA 4NR9A 4NXJA 4ALHA 4OGIA 5I7XA 4NR5A 4Z6IA 3P5OA 3S92A 5EU1A 5ENJA 4F3IA 5KHMA 3O37A 3MULA 5HCLA 5E74A 5FG5A 5AMFA 5HM0A 2DVSA 4UIUA 3U5LA 5I86A 4HXMA 5EA1A 5D3JA 4QB3A 5A5NA 5LUUA 3U5PA 5FE0A 4TZ8A 4ALGA 5CFWA 4UITA 5A85A 5FE9A 2R10A 3DAIA 5CS8A 3U5MA 4TT6A 4O76A 3RCWA 4XUAA 5I1QA 5AD2A 3O35A 4YH4A 4CUTA 5DKCA 4QEUA 5IGNA 2DKWA 3I3JA 3K2JA 5II1A 4E96A 5A81A 5DFBA 5CQTA 4O77A 5C4QA 4QY4A 5EWVA 5DW2A 2KTBB 4HXKA 2OO1A 5F61A 4WHUA 4O7EA 4UYFA 3S91A 5HELA 4UYHA 5H1VA 3P1FA 5KTUA 4IR3A 4MEOA 4PTBA 4X2IA 3O34A 3U5KA 5F36A 4NQMA 4UIZA 3LQHA 4LR6A 4KV1A 5CRZA 5EICA 2YQDA 5DW1A 4TT2A 5CP5A 4AKNA 5A83A 4QSXA 4N4FA 4QBMA 4PKLA 3Q2FA 5JWMA 4PS5A 5D3SA 5DBMA 2YEKA 5I89A 2RFJA 5CRMA 2LSPB 5KTXA 5LJ0A 1F68A 5LJ2A 4BW3A 5EWCA 5E9KA 4DONA 5LKTA 4NRAA 5DYUA 3U5OA 4UIXA 5CTLA 5EVAA 5LKZA 4UYGA 4A9HA 4A9EA 5CUCA 2I8NA 4BW4A 5CZGA 3SVHA 5HRWA 5DKHA 4A9MA 4YBMA 3U5NA 4TYLA 4O71A 4O72A 4UYFB 4MEQA 4LZRA 2OSSA 5DYCA 4MR4A 5D0CA 2YEMA 3LQIA 4QR5A 5EPSA 5HQ7A 5A5PA 5KTWA 4LDFA 4NS5A 5EISA 4QSUA 5L8TA 5J0DA 4QSQA 4NR8A 5I83A 5D7XA 4QZSA 5FH7A 5CPEA 3HMHA 5CQ3A 5E3GA 3GG3A 4A9FA 5E3DA 4CFLA 5DFDA 4CUPA 4XUBA 4YYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ1 A;  3MB3 A;  4QR3 A;  3TLP A;  5IGL A;  2RS9 B;  4A9K A;  4YC9 A;  5A82 A;  4TZ2 A;  5ENB A;  4BHW A;  3MQM A;  5L99 A;  2RNW A;  5HLS A;  4CUU A;  5AME A;  3O33 A;  3IU6 A;  4N4H A;  4OGJ A;  2RNY A;  4HXR A;  5C87 A;  3FKM X;  5JI8 A;  2D82 A;  2YW5 A;  4QYL A;  4C66 A;  5FB1 A;  4CLB A;  4MEP A;  5D3R A;  5CY9 A;  1WUM A;  5E0R A;  4ZW1 A;  4N4G A;  2DVR A;  5D3H A;  4MR5 A;  4HBX A;  5FB0 A;  5TB6 A;  5D25 A;  5FE2 A;  4NR7 A;  5F63 A;  3ONI A;  5CQ5 A;  5A5O A;  5HFR A;  5D3L A;  4WIV A;  3MB4 A;  4IOQ A;  5IGM A;  5FFV A;  4O7A A;  5AD3 A;  5EPR A;  2MJV B;  2FSA A;  3UW9 A;  4IOR A;  5DLZ A;  5C7N A;  2F6J A;  5A5Q A;  3QZS A;  3UV4 A;  5F1L A;  3AAD A;  3U5J A;  1ZS5 A;  5IID A;  5FE3 A;  5H1U A;  5CUG A;  2DAT A;  4QUT A;  4HXS A;  4YBS A;  5HEM A;  4O7C A;  4NRB A;  5ENH A;  3QZT A;  4OUF A;  2RI7 A;  3ZYU A;  2D9E A;  4HXO A;  4J1P A;  4YH3 A;  5HRV A;  3P1D A;  4QC1 A;  5CQA A;  4ZQL A;  5HRX A;  4YYG A;  4A9J A;  4PCE A;  4UYD A;  5FE1 A;  5D3T A;  2L84 A;  3JVL A;  3LXJ A;  5C89 A;  4QUU A;  3UVY A;  4QNS A;  2NXB A;  5D3P A;  5ENC A;  4O74 A;  5EWW A;  5IG6 A;  4LYI A;  4YYN A;  4YAB A;  4CFK A;  5II2 A;  1JM4 B;  5I7Y A;  5I88 A;  5FG6 A;  5L98 A;  5ENE A;  5F3A A;  5DFC A;  5ENG A;  2L85 A;  4MR6 A;  1JSP B;  3JVK A;  4UIV A;  3P1C A;  2F6N A;  5KO4 A;  5F25 A;  5FBX A;  5A7C A;  5KU3 A;  4YYM A;  5EGU A;  3G0L A;  5G4R A;  2WP2 A;  3JVJ A;  4LRG A;  4XY8 A;  3UVX A;  4IR6 A;  4HXL A;  4YYD A;  4QSS A;  4NUD A;  5IGK A;  5CUA A;  1WUG A;  1N72 A;  2WP1 A;  5DYX A;  5FE6 A;  4IOO A;  5EK9 A;  4BW2 A;  5G4S A;  5ENF A;  5LVQ A;  4YY4 A;  5D26 A;  4QR4 A;  4NR6 A;  4A9O A;  5BT3 A;  5DKD A;  5E73 A;  5DX4 A;  5BT4 A;  5LKU A;  4UYE A;  5E9L A;  5CQ4 A;  4QSR A;  4YAT A;  3QZV A;  4XY9 A;  5HFQ A;  4IR5 A;  5CQ7 A;  5DYA A;  4NRC A;  5CUB A;  4TTE A;  4PCI A;  5CUE A;  4A9I A;  3P1E A;  4BW1 A;  5K29 A;  5ETB A;  3UVW A;  4MR3 A;  4HXP A;  4ZC9 A;  4J0R A;  4NQN A;  4NYX A;  4LZS A;  4O78 A;  5TCM A;  4UIW A;  3NXB A;  4NR4 A;  4HBY A;  4CUQ A;  1E6I A;  5COI A;  5EPB A;  2RNX A;  5E9V A;  4PY6 A;  2RO1 A;  5EWH A;  4YYH A;  5E9Y A;  5LKX A;  2YDW A;  4YY6 A;  5C8G A;  2L5E A;  2R0Y A;  4O70 A;  4TT4 A;  3DWY A;  2DVQ A;  4FLP A;  5L8U A;  5FE4 A;  5ACY A;  5H1T A;  5I29 A;  3UV5 A;  4QSP A;  3SVF A;  5FH6 A;  2I7K A;  5CUD A;  5F2P A;  4Q0O A;  5HJC A;  5LVR A;  4NUE A;  3HMF A;  2YEL A;  5FE7 A;  3AQA A;  3Q2E A;  5L96 A;  4QEW A;  5A5S A;  1EQF A;  5F62 A;  3IU5 A;  4QST A;  5F5Z A;  4O7B A;  5FFW A;  2E7O A;  5E9I A;  4YYK A;  5L97 A;  5EWD A;  5HQ6 A;  4HXN A;  4YBT A;  5CGP A;  5HEN A;  2GRC A;  4QC3 A;  4A9N A;  4TU6 A;  4A9L A;  4NYV A;  5I40 A;  4O7F A;  5EQ1 A;  5H85 A;  2E3K A;  4LYW A;  1X0J A;  3O36 A;  5FG4 A;  2E7N A;  3JVM A;  5DLX A;  5D24 A;  5F60 A;  2DVV A;  2N9G A;  4LYS A;  5FE8 A;  4XYA A;  4IR4 A;  5DY7 A;  4HBW A;  4QEV A;  4CUS A;  4BJX A;  5EP7 A;  2R0S A;  4WHW A;  2G4A A;  5C85 A;  2OUO A;  4LZ2 A;  4N3W A;  5CQ8 A;  5EM3 A;  4Q0N A;  5CQ6 A;  2H60 A;  4QSV A;  2YYN A;  2DWW A;  4CUR A;  5EV9 A;  5E9M A;  4NYW A;  4Z1S A;  4MEN A;  4LC2 A;  4KCX A;  4J3I A;  4C67 A;  4TS8 A;  5I80 A;  4QYD A;  4TU4 A;  4YK0 A;  5FFY A;  3UV2 A;  5F1H A;  5CU8 A;  5BT5 A;  5FDZ A;  5FH8 A;  3LJW A;  3UVD A;  3HME A;  4YAD A;  5EI4 A;  4GPJ A;  4YYI A;  5ENI A;  2R0V A;  5HQ5 A;  4YAX A;  4HBV A;  3G0J A;  4Y03 A;  4O75 A;  4Z93 A;  3SVG A;  4KV4 A;  5IBN A;  4NUC A;  3D7C A;  4QSW A;  3LQJ A;  4J0S A;  5E7D A;  4RVR A;  4Z6H A;  5FE5 A;  5A5R A;  3MXF A;  4CL9 A;  5D3N A;  4Z1Q A;  3MUK A;  4UIY A;  5ETD A;  4TQN A;  4N4I A;  4NR9 A;  4NXJ A;  4ALH A;  4OGI A;  5I7X A;  4NR5 A;  4Z6I A;  3P5O A;  3S92 A;  5EU1 A;  5ENJ A;  4F3I A;  5KHM A;  3O37 A;  3MUL A;  5HCL A;  5E74 A;  5FG5 A;  5AMF A;  5HM0 A;  2DVS A;  4UIU A;  3U5L A;  5I86 A;  4HXM A;  5EA1 A;  5D3J A;  4QB3 A;  5A5N A;  5LUU A;  3U5P A;  5FE0 A;  4TZ8 A;  4ALG A;  5CFW A;  4UIT A;  5A85 A;  5FE9 A;  2R10 A;  3DAI A;  5CS8 A;  3U5M A;  4TT6 A;  4O76 A;  3RCW A;  4XUA A;  5I1Q A;  5AD2 A;  3O35 A;  4YH4 A;  4CUT A;  5DKC A;  4QEU A;  5IGN A;  2DKW A;  3I3J A;  3K2J A;  5II1 A;  4E96 A;  5A81 A;  5DFB A;  5CQT A;  4O77 A;  5C4Q A;  4QY4 A;  5EWV A;  5DW2 A;  2KTB B;  4HXK A;  2OO1 A;  5F61 A;  4WHU A;  4O7E A;  4UYF A;  3S91 A;  5HEL A;  4UYH A;  5H1V A;  3P1F A;  5KTU A;  4IR3 A;  4MEO A;  4PTB A;  4X2I A;  3O34 A;  3U5K A;  5F36 A;  4NQM A;  4UIZ A;  3LQH A;  4LR6 A;  4KV1 A;  5CRZ A;  5EIC A;  2YQD A;  5DW1 A;  4TT2 A;  5CP5 A;  4AKN A;  5A83 A;  4QSX A;  4N4F A;  4QBM A;  4PKL A;  3Q2F A;  5JWM A;  4PS5 A;  5D3S A;  5DBM A;  2YEK A;  5I89 A;  2RFJ A;  5CRM A;  2LSP B;  5KTX A;  5LJ0 A;  1F68 A;  5LJ2 A;  4BW3 A;  5EWC A;  5E9K A;  4DON A;  5LKT A;  4NRA A;  5DYU A;  3U5O A;  4UIX A;  5CTL A;  5EVA A;  5LKZ A;  4UYG A;  4A9H A;  4A9E A;  5CUC A;  2I8N A;  4BW4 A;  5CZG A;  3SVH A;  5HRW A;  5DKH A;  4A9M A;  4YBM A;  3U5N A;  4TYL A;  4O71 A;  4O72 A;  4UYF B;  4MEQ A;  4LZR A;  2OSS A;  5DYC A;  4MR4 A;  5D0C A;  2YEM A;  3LQI A;  4QR5 A;  5EPS A;  5HQ7 A;  5A5P A;  5KTW A;  4LDF A;  4NS5 A;  5EIS A;  4QSU A;  5L8T A;  5J0D A;  4QSQ A;  4NR8 A;  5I83 A;  5D7X A;  4QZS A;  5FH7 A;  5CPE A;  3HMH A;  5CQ3 A;  5E3G A;  3GG3 A;  4A9F A;  5E3D A;  4CFL A;  5DFD A;  4CUP A;  4XUB A;  4YYJ A; 
#chains in the Genus database with same CATH topology
 5LJ1 A;  3MB3 A;  3D1B A;  4QR3 A;  3TLP A;  5IGL A;  2RS9 B;  4A9K A;  4YC9 A;  5A82 A;  4TZ2 A;  5ENB A;  4BHW A;  3MQM A;  5L99 A;  2RNW A;  5HLS A;  4CUU A;  5AME A;  3O33 A;  3IU6 A;  4N4H A;  4OGJ A;  2RNY A;  4HXR A;  5C87 A;  3FKM X;  5JI8 A;  2D82 A;  2YW5 A;  4QYL A;  4C66 A;  5FB1 A;  4CLB A;  4MEP A;  5D3R A;  5CY9 A;  1WUM A;  5E0R A;  4ZW1 A;  4N4G A;  2DVR A;  5D3H A;  4MR5 A;  4HBX A;  5FB0 A;  5TB6 A;  5D25 A;  5FE2 A;  4NR7 A;  5F63 A;  3ONI A;  5CQ5 A;  5A5O A;  5HFR A;  5D3L A;  4WIV A;  3MB4 A;  4IOQ A;  5IGM A;  5FFV A;  4O7A A;  5AD3 A;  5EPR A;  2MJV B;  2FSA A;  3UW9 A;  4IOR A;  5DLZ A;  5C7N A;  2F6J A;  5A5Q A;  3QZS A;  3UV4 A;  5F1L A;  3AAD A;  3U5J A;  1ZS5 A;  5IID A;  5FE3 A;  5H1U A;  5CUG A;  2DAT A;  4QUT A;  4HXS A;  4YBS A;  5HEM A;  4O7C A;  4NRB A;  5ENH A;  3QZT A;  4OUF A;  2RI7 A;  3ZYU A;  2D9E A;  4HXO A;  4J1P A;  4YH3 A;  5HRV A;  3P1D A;  4QC1 A;  5CQA A;  4ZQL A;  5HRX A;  4YYG A;  4A9J A;  4PCE A;  4UYD A;  5FE1 A;  5D3T A;  2L84 A;  3JVL A;  3LXJ A;  5C89 A;  4QUU A;  3UVY A;  4QNS A;  2NXB A;  5D3P A;  5ENC A;  4O74 A;  5EWW A;  5IG6 A;  4LYI A;  4YYN A;  4YAB A;  4CFK A;  5II2 A;  1JM4 B;  5I7Y A;  5I88 A;  5FG6 A;  5L98 A;  5ENE A;  5F3A A;  5DFC A;  5ENG A;  2L85 A;  4MR6 A;  1JSP B;  3JVK A;  4UIV A;  3P1C A;  2F6N A;  5KO4 A;  5F25 A;  5FBX A;  5A7C A;  5KU3 A;  4YYM A;  5EGU A;  3G0L A;  5G4R A;  2WP2 A;  3JVJ A;  4LRG A;  4XY8 A;  3UVX A;  4IR6 A;  4HXL A;  4YYD A;  4QSS A;  4NUD A;  5IGK A;  5CUA A;  1WUG A;  1N72 A;  2WP1 A;  5DYX A;  5FE6 A;  4IOO A;  5EK9 A;  3VKH A;  4BW2 A;  5G4S A;  5ENF A;  5LVQ A;  3D1D A;  4YY4 A;  5D26 A;  4QR4 A;  4NR6 A;  4A9O A;  5BT3 A;  5DKD A;  5E73 A;  5DX4 A;  5BT4 A;  5LKU A;  4UYE A;  5E9L A;  5CQ4 A;  4QSR A;  4YAT A;  3QZV A;  4XY9 A;  5HFQ A;  4IR5 A;  5CQ7 A;  5DYA A;  4NRC A;  5CUB A;  4TTE A;  4PCI A;  5CUE A;  4A9I A;  3P1E A;  4BW1 A;  5K29 A;  5ETB A;  3UVW A;  4MR3 A;  4HXP A;  4ZC9 A;  4J0R A;  4NQN A;  4NYX A;  4LZS A;  4O78 A;  5TCM A;  4UIW A;  3NXB A;  4NR4 A;  4HBY A;  4CUQ A;  1E6I A;  5COI A;  5EPB A;  2RNX A;  5E9V A;  4PY6 A;  2RO1 A;  5EWH A;  4YYH A;  5E9Y A;  5LKX A;  2YDW A;  4YY6 A;  5C8G A;  2L5E A;  2R0Y A;  4O70 A;  4TT4 A;  3DWY A;  2DVQ A;  4FLP A;  5L8U A;  5FE4 A;  5ACY A;  5H1T A;  5I29 A;  3UV5 A;  4QSP A;  3SVF A;  5FH6 A;  2I7K A;  5CUD A;  5F2P A;  4Q0O A;  5HJC A;  4AKG A;  5LVR A;  4NUE A;  3HMF A;  2YEL A;  5FE7 A;  3AQA A;  3Q2E A;  5L96 A;  4QEW A;  5A5S A;  1ZKR A;  1EQF A;  5F62 A;  3IU5 A;  4QST A;  5F5Z A;  4O7B A;  5FFW A;  2E7O A;  5E9I A;  4YYK A;  5L97 A;  5EWD A;  5HQ6 A;  4HXN A;  4YBT A;  5CGP A;  5HEN A;  2GRC A;  4QC3 A;  4A9N A;  4TU6 A;  4A9L A;  4NYV A;  5I40 A;  4O7F A;  5EQ1 A;  5H85 A;  2E3K A;  4LYW A;  1X0J A;  3O36 A;  5FG4 A;  2E7N A;  3JVM A;  5DLX A;  3VKG A;  5D24 A;  5F60 A;  2DVV A;  2N9G A;  4LYS A;  5FE8 A;  4XYA A;  4IR4 A;  5DY7 A;  4HBW A;  4QEV A;  4CUS A;  4BJX A;  5EP7 A;  2R0S A;  4WHW A;  2G4A A;  5C85 A;  2OUO A;  4LZ2 A;  4N3W A;  5CQ8 A;  5EM3 A;  4Q0N A;  5CQ6 A;  2H60 A;  4QSV A;  2YYN A;  2DWW A;  4CUR A;  5EV9 A;  5E9M A;  4NYW A;  4Z1S A;  1PUO A;  4MEN A;  4LC2 A;  4KCX A;  4J3I A;  4C67 A;  4TS8 A;  5I80 A;  4QYD A;  4TU4 A;  4YK0 A;  5FFY A;  3UV2 A;  5F1H A;  5CU8 A;  5BT5 A;  5FDZ A;  5FH8 A;  3LJW A;  3UVD A;  3HME A;  4YAD A;  5EI4 A;  4GPJ A;  4YYI A;  5ENI A;  2R0V A;  2EJN A;  5HQ5 A;  4YAX A;  4HBV A;  3G0J A;  4Y03 A;  4O75 A;  4Z93 A;  3SVG A;  4KV4 A;  5IBN A;  4NUC A;  3D7C A;  4QSW A;  3LQJ A;  4J0S A;  5E7D A;  4RVR A;  4Z6H A;  5FE5 A;  5A5R A;  3MXF A;  4CL9 A;  5D3N A;  4Z1Q A;  3MUK A;  4UIY A;  5ETD A;  3ERR A;  4TQN A;  4N4I A;  4NR9 A;  4NXJ A;  4ALH A;  4OGI A;  5I7X A;  4NR5 A;  4Z6I A;  3P5O A;  3S92 A;  5EU1 A;  5ENJ A;  4F3I A;  5KHM A;  3O37 A;  3MUL A;  5HCL A;  5E74 A;  5FG5 A;  5AMF A;  5HM0 A;  2DVS A;  4UIU A;  3U5L A;  5I86 A;  4HXM A;  5EA1 A;  5D3J A;  4QB3 A;  5A5N A;  5LUU A;  3U5P A;  5FE0 A;  4TZ8 A;  4ALG A;  5CFW A;  4UIT A;  5A85 A;  5FE9 A;  2R10 A;  3DAI A;  5CS8 A;  3U5M A;  4TT6 A;  4O76 A;  3RCW A;  4XUA A;  5I1Q A;  5AD2 A;  3O35 A;  4YH4 A;  4CUT A;  5DKC A;  4QEU A;  5IGN A;  2DKW A;  3I3J A;  3K2J A;  5II1 A;  4E96 A;  5A81 A;  5DFB A;  5CQT A;  4O77 A;  5C4Q A;  4QY4 A;  5EWV A;  5DW2 A;  2KTB B;  4HXK A;  2OO1 A;  5F61 A;  4WHU A;  4O7E A;  4UYF A;  3S91 A;  5HEL A;  4UYH A;  5H1V A;  3P1F A;  5KTU A;  4IR3 A;  4MEO A;  4PTB A;  4X2I A;  3O34 A;  3U5K A;  5F36 A;  4NQM A;  4UIZ A;  3LQH A;  4LR6 A;  4KV1 A;  5CRZ A;  5EIC A;  4AKH A;  2YQD A;  5DW1 A;  4TT2 A;  5CP5 A;  4AKN A;  5A83 A;  4QSX A;  4N4F A;  4QBM A;  4PKL A;  3Q2F A;  5JWM A;  4PS5 A;  5D3S A;  5DBM A;  2YEK A;  5I89 A;  2RFJ A;  5CRM A;  2LSP B;  5KTX A;  5LJ0 A;  1F68 A;  5LJ2 A;  4BW3 A;  5EWC A;  5E9K A;  4DON A;  5LKT A;  4NRA A;  5DYU A;  3U5O A;  4UIX A;  5CTL A;  5EVA A;  5LKZ A;  4UYG A;  4A9H A;  4A9E A;  5CUC A;  2I8N A;  4BW4 A;  5CZG A;  3SVH A;  5HRW A;  5DKH A;  4A9M A;  4YBM A;  3U5N A;  4TYL A;  4O71 A;  4O72 A;  4AKI A;  4UYF B;  4MEQ A;  4LZR A;  2OSS A;  5DYC A;  4MR4 A;  5D0C A;  2YEM A;  3LQI A;  4QR5 A;  5EPS A;  5HQ7 A;  5A5P A;  5KTW A;  4LDF A;  4NS5 A;  5EIS A;  4QSU A;  5L8T A;  5J0D A;  4QSQ A;  4NR8 A;  5I83 A;  5D7X A;  4QZS A;  5FH7 A;  5CPE A;  3HMH A;  5CQ3 A;  5E3G A;  3GG3 A;  4A9F A;  4AI6 A;  5E3D A;  4CFL A;  5DFD A;  4CUP A;  4XUB A;  4YYJ A; 
#chains in the Genus database with same CATH homology
 5LJ1 A;  3MB3 A;  4QR3 A;  3TLP A;  5IGL A;  2RS9 B;  4A9K A;  4YC9 A;  5A82 A;  4TZ2 A;  5ENB A;  4BHW A;  3MQM A;  5L99 A;  2RNW A;  5HLS A;  4CUU A;  5AME A;  3O33 A;  3IU6 A;  4N4H A;  4OGJ A;  2RNY A;  4HXR A;  5C87 A;  3FKM X;  5JI8 A;  2D82 A;  2YW5 A;  4QYL A;  4C66 A;  5FB1 A;  4CLB A;  4MEP A;  5D3R A;  5CY9 A;  1WUM A;  5E0R A;  4ZW1 A;  4N4G A;  2DVR A;  5D3H A;  4MR5 A;  4HBX A;  5FB0 A;  5TB6 A;  5D25 A;  5FE2 A;  4NR7 A;  5F63 A;  3ONI A;  5CQ5 A;  5A5O A;  5HFR A;  5D3L A;  4WIV A;  3MB4 A;  4IOQ A;  5IGM A;  5FFV A;  4O7A A;  5AD3 A;  5EPR A;  2MJV B;  2FSA A;  3UW9 A;  4IOR A;  5DLZ A;  5C7N A;  2F6J A;  5A5Q A;  3QZS A;  3UV4 A;  5F1L A;  3AAD A;  3U5J A;  1ZS5 A;  5IID A;  5FE3 A;  5H1U A;  5CUG A;  2DAT A;  4QUT A;  4HXS A;  4YBS A;  5HEM A;  4O7C A;  4NRB A;  5ENH A;  3QZT A;  4OUF A;  2RI7 A;  3ZYU A;  2D9E A;  4HXO A;  4J1P A;  4YH3 A;  5HRV A;  3P1D A;  4QC1 A;  5CQA A;  4ZQL A;  5HRX A;  4YYG A;  4A9J A;  4PCE A;  4UYD A;  5FE1 A;  5D3T A;  2L84 A;  3JVL A;  3LXJ A;  5C89 A;  4QUU A;  3UVY A;  4QNS A;  2NXB A;  5D3P A;  5ENC A;  4O74 A;  5EWW A;  5IG6 A;  4LYI A;  4YYN A;  4YAB A;  4CFK A;  5II2 A;  1JM4 B;  5I7Y A;  5I88 A;  5FG6 A;  5L98 A;  5ENE A;  5F3A A;  5DFC A;  5ENG A;  2L85 A;  4MR6 A;  1JSP B;  3JVK A;  4UIV A;  3P1C A;  2F6N A;  5KO4 A;  5F25 A;  5FBX A;  5A7C A;  5KU3 A;  4YYM A;  5EGU A;  3G0L A;  5G4R A;  2WP2 A;  3JVJ A;  4LRG A;  4XY8 A;  3UVX A;  4IR6 A;  4HXL A;  4YYD A;  4QSS A;  4NUD A;  5IGK A;  5CUA A;  1WUG A;  1N72 A;  2WP1 A;  5DYX A;  5FE6 A;  4IOO A;  5EK9 A;  4BW2 A;  5G4S A;  5ENF A;  5LVQ A;  4YY4 A;  5D26 A;  4QR4 A;  4NR6 A;  4A9O A;  5BT3 A;  5DKD A;  5E73 A;  5DX4 A;  5BT4 A;  5LKU A;  4UYE A;  5E9L A;  5CQ4 A;  4QSR A;  4YAT A;  3QZV A;  4XY9 A;  5HFQ A;  4IR5 A;  5CQ7 A;  5DYA A;  4NRC A;  5CUB A;  4TTE A;  4PCI A;  5CUE A;  4A9I A;  3P1E A;  4BW1 A;  5K29 A;  5ETB A;  3UVW A;  4MR3 A;  4HXP A;  4ZC9 A;  4J0R A;  4NQN A;  4NYX A;  4LZS A;  4O78 A;  5TCM A;  4UIW A;  3NXB A;  4NR4 A;  4HBY A;  4CUQ A;  1E6I A;  5COI A;  5EPB A;  2RNX A;  5E9V A;  4PY6 A;  2RO1 A;  5EWH A;  4YYH A;  5E9Y A;  5LKX A;  2YDW A;  4YY6 A;  5C8G A;  2L5E A;  2R0Y A;  4O70 A;  4TT4 A;  3DWY A;  2DVQ A;  4FLP A;  5L8U A;  5FE4 A;  5ACY A;  5H1T A;  5I29 A;  3UV5 A;  4QSP A;  3SVF A;  5FH6 A;  2I7K A;  5CUD A;  5F2P A;  4Q0O A;  5HJC A;  5LVR A;  4NUE A;  3HMF A;  2YEL A;  5FE7 A;  3AQA A;  3Q2E A;  5L96 A;  4QEW A;  5A5S A;  1EQF A;  5F62 A;  3IU5 A;  4QST A;  5F5Z A;  4O7B A;  5FFW A;  2E7O A;  5E9I A;  4YYK A;  5L97 A;  5EWD A;  5HQ6 A;  4HXN A;  4YBT A;  5CGP A;  5HEN A;  2GRC A;  4QC3 A;  4A9N A;  4TU6 A;  4A9L A;  4NYV A;  5I40 A;  4O7F A;  5EQ1 A;  5H85 A;  2E3K A;  4LYW A;  1X0J A;  3O36 A;  5FG4 A;  2E7N A;  3JVM A;  5DLX A;  5D24 A;  5F60 A;  2DVV A;  2N9G A;  4LYS A;  5FE8 A;  4XYA A;  4IR4 A;  5DY7 A;  4HBW A;  4QEV A;  4CUS A;  4BJX A;  5EP7 A;  2R0S A;  4WHW A;  2G4A A;  5C85 A;  2OUO A;  4LZ2 A;  4N3W A;  5CQ8 A;  5EM3 A;  4Q0N A;  5CQ6 A;  2H60 A;  4QSV A;  2YYN A;  2DWW A;  4CUR A;  5EV9 A;  5E9M A;  4NYW A;  4Z1S A;  4MEN A;  4LC2 A;  4KCX A;  4J3I A;  4C67 A;  4TS8 A;  5I80 A;  4QYD A;  4TU4 A;  4YK0 A;  5FFY A;  3UV2 A;  5F1H A;  5CU8 A;  5BT5 A;  5FDZ A;  5FH8 A;  3LJW A;  3UVD A;  3HME A;  4YAD A;  5EI4 A;  4GPJ A;  4YYI A;  5ENI A;  2R0V A;  5HQ5 A;  4YAX A;  4HBV A;  3G0J A;  4Y03 A;  4O75 A;  4Z93 A;  3SVG A;  4KV4 A;  5IBN A;  4NUC A;  3D7C A;  4QSW A;  3LQJ A;  4J0S A;  5E7D A;  4RVR A;  4Z6H A;  5FE5 A;  5A5R A;  3MXF A;  4CL9 A;  5D3N A;  4Z1Q A;  3MUK A;  4UIY A;  5ETD A;  4TQN A;  4N4I A;  4NR9 A;  4NXJ A;  4ALH A;  4OGI A;  5I7X A;  4NR5 A;  4Z6I A;  3P5O A;  3S92 A;  5EU1 A;  5ENJ A;  4F3I A;  5KHM A;  3O37 A;  3MUL A;  5HCL A;  5E74 A;  5FG5 A;  5AMF A;  5HM0 A;  2DVS A;  4UIU A;  3U5L A;  5I86 A;  4HXM A;  5EA1 A;  5D3J A;  4QB3 A;  5A5N A;  5LUU A;  3U5P A;  5FE0 A;  4TZ8 A;  4ALG A;  5CFW A;  4UIT A;  5A85 A;  5FE9 A;  2R10 A;  3DAI A;  5CS8 A;  3U5M A;  4TT6 A;  4O76 A;  3RCW A;  4XUA A;  5I1Q A;  5AD2 A;  3O35 A;  4YH4 A;  4CUT A;  5DKC A;  4QEU A;  5IGN A;  2DKW A;  3I3J A;  3K2J A;  5II1 A;  4E96 A;  5A81 A;  5DFB A;  5CQT A;  4O77 A;  5C4Q A;  4QY4 A;  5EWV A;  5DW2 A;  2KTB B;  4HXK A;  2OO1 A;  5F61 A;  4WHU A;  4O7E A;  4UYF A;  3S91 A;  5HEL A;  4UYH A;  5H1V A;  3P1F A;  5KTU A;  4IR3 A;  4MEO A;  4PTB A;  4X2I A;  3O34 A;  3U5K A;  5F36 A;  4NQM A;  4UIZ A;  3LQH A;  4LR6 A;  4KV1 A;  5CRZ A;  5EIC A;  2YQD A;  5DW1 A;  4TT2 A;  5CP5 A;  4AKN A;  5A83 A;  4QSX A;  4N4F A;  4QBM A;  4PKL A;  3Q2F A;  5JWM A;  4PS5 A;  5D3S A;  5DBM A;  2YEK A;  5I89 A;  2RFJ A;  5CRM A;  2LSP B;  5KTX A;  5LJ0 A;  1F68 A;  5LJ2 A;  4BW3 A;  5EWC A;  5E9K A;  4DON A;  5LKT A;  4NRA A;  5DYU A;  3U5O A;  4UIX A;  5CTL A;  5EVA A;  5LKZ A;  4UYG A;  4A9H A;  4A9E A;  5CUC A;  2I8N A;  4BW4 A;  5CZG A;  3SVH A;  5HRW A;  5DKH A;  4A9M A;  4YBM A;  3U5N A;  4TYL A;  4O71 A;  4O72 A;  4UYF B;  4MEQ A;  4LZR A;  2OSS A;  5DYC A;  4MR4 A;  5D0C A;  2YEM A;  3LQI A;  4QR5 A;  5EPS A;  5HQ7 A;  5A5P A;  5KTW A;  4LDF A;  4NS5 A;  5EIS A;  4QSU A;  5L8T A;  5J0D A;  4QSQ A;  4NR8 A;  5I83 A;  5D7X A;  4QZS A;  5FH7 A;  5CPE A;  3HMH A;  5CQ3 A;  5E3G A;  3GG3 A;  4A9F A;  5E3D A;  4CFL A;  5DFD A;  4CUP A;  4XUB A;  4YYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...