3JW7A

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ile-l-tyr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
353
structure length
353
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
molecule tags Isomerase
source organism Enterococcus faecalis v583
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
total genus 117
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jw7A01
1ECQA 1R6WA 1EC7A 3TJIA 2OZTA 3RR1A 4IP5A 2OPJA 3ZVIA 3FXGA 1TZZA 1KKRA 3BSMA 3TOYA 3OPSA 3OW1A 1EBHA 3I4KA 3V5FA 3UJRA 1EBGA 3TW9A 4DX3A 3DFYA 2PTXA 1PDZA 3CT2A 2PU1A 4MMWA 3R1ZA 4HCDA 4IL2A 3BOXA 4DHGA 2GDQA 5FJPA 2OZ3A 4K2SA 4JN8A 3SSZA 2PTYA 4H19A 3NO1A 3V4BA 4HNCA 3DG7A 2HNEA 4FP1A 3THUA 3GC2A 2FKPA 2XH2A 5ENLA 2AKZA 3MUCA 7ENLA 3N4EA 1MUCA 3DG6A 3R10A 3V5CA 2DW7A 4HCHA 1MRAA 4GGBA 3DIPA 1JPMA 3VC5A 1MDLA 2HXUA 1ELSA 2PTZA 2MNRA 1MDRA 3MY9A 3OTRA 3H12A 5IDZA 3RO6A 2I5QA 3ENLA 4IHCA 2PP0A 3ES8A 3H7VA 3IJQA 6ENLA 3KUMA 2QJJA 3JVAA 4YWSA 2OO6A 1KCZA 3CXOA 1L8PA 2QQ6A 3QPEA 1SJCA 3VFCA 3P3BA 1TE6A 3T6CA 2OFJA 4HCLA 2OG9A 4GYPC 3VCNA 4ROPA 2QVHA 4IL0A 1JCTA 2PP3A 4KEMA 4GGHA 4HNLA 2P88A 2P8BA 2RDXA 2OLAA 4M6UA 1ONEA 2ZC8A 3D47A 4Z17A 3RRAA 3DESA 2GL5A 3P0WA 3SQSA 3IK4A 3QLDA 3JZUA 2GGHA 1SJAA 3GD6A 3MZNA 2QGYA 3DFHA 4GIRA 3S47A 2FYMA 3TTEA 5FJRA 4E6MA 4H1ZA 2PSNA 2P0IA 4JN7A 3TJ4A 5J04A 2PGWA 2PU0A 3Q4DA 3EKGA 3FVDA 3H70A 4KT2A 4ZCWA 3EEZA 3NFUA 3TQPA 2NQLA 3IJIA 4GMEA 2AKMA 5BOFA 2OX4A 2XH4A 3RCYA 1IYXA 2MUCA 1JPDX 3UGVA 4JHMA 2XGZA 3V3WA 4HN8A 3UCCA 4K8GA 3UXKA 2ONEA 3UCDA 3UXLA 3ZLGA 3OZMA 3VDGA 3N4FA 1OEPA 2PTWA 2QJMA 2XH7A 4HPNA 3OZYA 4F4RA 2PP1A 3ES7A 3D46A 4G7FA 2QJNA 1FHVA 1MNSA 4DXKA 3GY1A 2AL2A 4KPLA 1XPYA 2QDEA 1SJBA 3DERA 1W6TA 4K1WA 4A35A 4J1OA 1NELA 4ENLA 3NZGA 1FHUA 1WUFA 3N6HA 4Z1YA 3PK7A 3DEQA 2GGEA 4X2PA 4H2HA 3T4WA 1P48A 2GSHA 4E4UA 2PPGA 2PS2A 3HPFA 3N6JA 4E8GA 4A3RA 2QDDA 3MWCA 5FJOA 5BOEA 3T8QA 3K1GA 4DWDA 4HYRA 4EWJA 1R0MA 2PGEA 1EC9A 3DG3A 3QN3A 1WUEA 3T9PA 5FJTA 3MQTA 4IP4A 1P43A 3I6TA 3TWAA 1EC8A 3CYJA 1SJDA 2OVLA 3FV9A 3STPA 1YEYA 2OQHA 4FI4A 4MKSA 4M0XA 2PA6A 1KKOA 3PWGA 3UJSA 2XH0A 2OQYA 2GGGA 3DDMA 3SN4A 3ZVHB 3DGBA 4A6GA 3R0KA 5EU9A 3ZLHA 3FCPA 4J3ZA 1NU5A 4G8TA 3U4FA 3PFRA 4KWSA 3TCSA 1JDFA 3IJLA 3FJ4A 3VCCA 3SBFA 3PWIA 3SN1A 3S5SA 2DW6A 3I6EA 1BKHA 3H8AA 3SN0A 4ZA0A 4GYPA 2GGIA 2P8CA 3CB3A 3TWBA 1F9CA 3RITA 1BQGA 4E4FA 3GO2A 2AL2B 2POZA 3QTPA 4GISA 1DTNA 2AL1A 2P3ZA 2HXTA 3Q45A 3UJ2A 3P93A 4IZGA 4DN1A 3OP2A 3UJEA 5FJUA 3QKEA 3UJFA 1RVKA 2OZ8A 3VA8A 4GFIA 3FYYA 3B97A 4IT1A 2OKTA 1XS2A 3R11A 3U9IA 2PMQA 3SJNA 2CHRA 3ZLFA 3R25A 4H83A 2ZADA 1KD0A 1E9IA 4DYEA 2GGJA 3BJSA 2XSXA 1PDYA 2PCEA 3CAWA 3CK5A 2HZGA 4MGGA 3RGTA 1TKKA 4E5TA 2O56A 3MKCA 3R0UA 3VC6A 3ZVHA 3JW7A 3MSYA 2PODA 3NXLA
chains in the Genus database with same CATH superfamily
4GQRA 1TV5A 5G2HA 1RK5A 4IMAA 2F7FA 4H9XA 1VPQA 3H53A 3KXQA 5AYXA 1HJVA 1XISA 3H7RA 3KL5A 3TW9A 4B5VA 3KBNA 1W1IE 3NEVA 1N7KA 4V33A 4NSBA 1F73A 3NDOA 4Q6JA 4KRTA 1GONA 3R6IA 4NRRA 2WB5A 4DHGA 1PX4A 2OLHA 3GNOA 5GNXA 4K2SA 3C2EA 1R3QA 1CGYA 1Q7MA 2WMIA 1QI4A 3ZS4A 3LGEA 4DNMA 4Z1BA 2GUYA 1NWSA 5C9ZA 2POTA 4Q22A 3LTPA 1KGXA 1QWGA 2H9AA 3V18A 1FFVC 4QDMA 1B90A 3L23A 4JD4A 3WLRA 2V69A 1W3JA 3N4EA 4JTFA 2ZIDA 4IFRA 5CGTA 1FY6A 1A3HA 5DT5A 1VLWA 2O9TA 4GVFA 2DH3A 4QDWA 2KX9A 3C61A 1V79A 3SRFA 1U2YA 3GG7A 5REQB 4RPQA 3VU2A 3DC0A 1XDIA 1F8IA 2X42A 5DRCA 2CKSA 2FFIA 2Y4SA 3MDWA 3UG3A 5TQLA 4F8XA 3GUWA 3EDEA 1FECA 2PURA 3BAWA 3AS2A 5CZTA 4HB7A 1BXCA 4GJIA 2WNQA 3O6AA 4C5ZA 4AU0A 2HNHA 1QBBA 1L8PA 2CLLA 3QHMA 5JVLA 1KCXA 1LTDA 4HCLA 3RCNA 2ZRUA 1ZRQA 4EMIA 2RDXA 2OLAA 3M5VA 5C2GA 1L8NA 1K6WA 3CQKA 4NXKA 1KXTA 1MRQA 3URAA 3ZT7A 3GYCA 3LI0A 3ZOAA 1PCWA 4MJ4A 3VZXA 4FK9A 4XBSA 1SJAA 4E4PA 1P6WA 3N6QA 3PPFA 1U33A 4ZQCA 4HJWA 4IISA 1DXIA 1MQQA 3W7QA 4UTWC 2WZTA 4BF9A 5DF0A 4ZTYA 3FVDA 4QLKA 1A5SA 4NEVA 4XIAA 2WMGA 2NV1A 4E2BA 4S3GA 2OMAA 4JPGA 1BSLA 3OIHA 2MUCA 1EP1A 3RPTA 3R7MA 4EF8A 3KLLA 1RBAA 3DHUA 3V3WA 3N13A 2Y85A 3UXKA 5HNTA 2ONEA 4JOMA 3UWYA 1TTIA 3OLGA 4Z0JA 3RF9A 3KL3A 1WDDA 2XZ9A 5E6YA 1FWFC 1ZY9A 3L4TA 3TONA 4F0KA 2PP1A 3E0WA 3HV9A 1PKYA 3WLJA 1E6QM 4WHBA 4HZ6A 2GQWA 1B4KA 3TA9A 1BYDA 4GD0A 1EYWA 3F5LA 3NL3A 3NO3A 4NI3A 4UOZA 1XSIA 1R86A 4DELA 4H6RA 4FO4A 2XSAA 1OK6A 2W5FA 1JG9A 4JTEA 5CAHA 2HS6A 4RL3A 4NQ1A 1VEOA 3EEGA 2GJXA 3HG3A 4D6DA 5JH1A 4JTTA 1ITXA 5I3KA 1K02A 3GM8A 4GOAA 1VYPX 2IPWA 5CC5A 5LSMA 1S5MA 1WBJA 5G1TA 5BOEA 5C9RA 2HV5A 3PANA 4XD6A 1ONRA 3MHFA 3CMGA 4LEQA 3WEOA 2VWSA 3IJDA 3W70A 1I1WA 2AQVA 4H8HA 4RNJA 3D0CA 1M53A 3N2XA 1MFUA 3R94A 1UZ4A 4Q4RA 4EMWA 3N25A 2VCBA 4QE1A 2Y24A 4HZ7A 3QV7A 2DEPA 3GBEA 3WQVA 1QFEA 3RX4A 1EC8A 3OOQA 3LBCA 3SRKA 1J2BA 2WWDA 1DPMA 1GZGA 4QE4A 1W54A 4EQWA 3MMWA 1HP5A 2XIBA 4XUYA 3QFBA 3IIZA 1UZHA 4J3XA 4JHZA 4C6LA 2DZSA 2W63A 3LADA 3PG8A 3JU2A 3RM8A 3GC5A 3R0KA 2RFGA 1POKA 4JFUA 2HE5A 2C6QA 2CU0A 4HMNA 3HRDC 3NYZA 2ISVA 1XCXA 1H41A 2QPUA 3E6EA 3WNKA 1XLAA 4XIMA 1OSEA 3AIRA 3A4AA 1E40A 1SO5A 1VLIA 2R24A 5FIPA 1CX9A 5C8BB 3B9OA 1XANA 1VFLA 3WMCA 1CLKA 1K9EA 2NPXA 3UYCA 4M80A 4KFNA 4XSLA 3EOSA 1J0JA 3M5YA 4TIMA 2X2YA 1IEQA 1TTJA 5DBTA 3FGCB 2GSJA 5M17A 3V0TA 4GINA 4PUNA 4G6CA 4CQAA 3QSTA 4EXBA 1R8LA 1ZJIA 5T26A 4INFA 1TTQA 1YTEA 4B5UA 2E77A 3GLCA 1SW3A 3P93A 3UR5A 1F3TA 4QEHA 3VAVA 4PCSA 5HMEA 4HHPA 3TZNA 1E4NA 1BVWA 3WQCA 1O7AA 3TSBA 3L8KA 3CT7A 4G7EA 3P61A 3ZM8A 1R9YA 2VCAA 1TZ7A 3CZEA 1KGUA 4NJHA 1KTNA 4JEQA 2V0TA 1JCJA 1XIGA 2QEZA 3C0SA 4Q32A 4EQXA 2R91A 2CHRA 4Z2IA 2ZADA 4HOWA 3K46A 1NDAA 1AK5A 3W1PA 1EO5A 3BJSA 4FLSA 3GB6A 1O1HA 2O92A 2V5BA 4DLMA 2PCEA 1FVPA 4WUIA 2G41A 4IF2A 3VNKA 4C1KA 2E40A 2AAAA 3ARWA 1UD8A 5IOBA 2FPYA 4HK5A 1LT8A 4GE8A 1MQRA 1E71M 2FHCA 2PF0A 3FVMA 1EC7A 3NR0A 1J0YA 3CUIA 3VUSA 1HP4A 3EX6A 3ZVIA 2NT0A 5H91A 2C71A 1V3KA 3W02A 4TVYA 1WOAA 3WH9A 2ZTJA 2WPBA 4JTLA 4M7SA 1UWSA 1G94A 3SI9A 3RR4A 2FDMA 4IIDA 3T4CA 3U5UA 1O12A 3IK2A 2ASHA 1KQZA 3EWWA 3QMTA 3E1F1 2VZUA 3NAVA 2VVNA 4IQDA 3E3HA 2BVWA 4PUUA 1LPFA 2XIOA 3CQJA 1EJUC 4J7RA 1QCWA 3CMFA 3ITOA 3TK7A 2DDXA 2HNEA 3PTKA 3RXZA 3VX1A 1GRGA 4LNCA 5GJNA 3F4NA 3EOUA 3RAOA 1EJSC 2V3AA 5EMUA 2Y8VA 1O60A 4ZEPA 3WCZA 3B8VA 5I3GA 1FQ0A 5F1UA 2DIJA 4Y9AA 3V35A 3T8LA 1XLJA 4FLOA 1QU4A 4H4XA 1JPMA 5HXMA 3UWEA 1ML1A 4ZOHB 2CFFA 1W5MA 2QUNA 4QEEA 1M01A 3L4YA 4KW2A 3GXIA 4AZCA 1M7JA 1LORA 1FH8A 2I5QA 2CXGA 1VCFA 1RQEA 1D2KA 4Y9MA 2W62A 2CITA 1UQZA 4V15A 4A2SA 5DXYA 3VIGA 5FEWA 2PWVA 3JVAA 4NYYA 4IFOA 4UQ9A 1Q1RA 4XZBA 3PNUA 4H4IA 4ZQRA 4DJED 3NXFA 4AZHA 1J0ZA 4N7QA 2Y62A 2ZICA 4B16A 1M03A 1E6SM 1ONEA 1PL9A 2GQAA 3RJXA 1V7AA 1YBQA 3PUGA 4F48A 1NARA 5M1TA 4TX8A 2YZRA 1X1ZA 4JZ5A 2X8CA 2QV4A 3VDHA 1GZ1A 5FJRA 4DY1A 3MCNA 3UG5A 1L6FA 3L68A 4JGDA 3HPAA 4PB3A 4KT2A 3WLLA 4L9XA 5FA5A 2JBMA 4GMEA 3SIMA 1PBGA 2WK2A 4DPQA 2DQXA 2G3FA 1G4SA 3GVGA 1YQ2A 3UGVA 3GR7A 4WCJA 3CH9A 3B0XA 2FLIA 3W88A 4K8GA 5I24A 1B3ZA 4ADWA 3GC4A 3ZR4A 5A95A 2VGFA 3P2VA 5JCIA 3AJXA 1Q66A 3QRHA 4L6HA 3BLFA 3ZXWA 1XP3A 3D46A 3AXXA 3VKDA 4RZ4A 4BF5A 4PE8A 2PLMA 4DAFA 4DXKA 2AL2A 2AMGA 4B91A 2DZVA 3MYPA 3FYOA 1VCGA 1WYGA 1HF6A 4RUBA 1I75A 1AD4A 1BG4A 4JKKA 1ENUA 1GJUA 3RK8A 2PWDA 4ATLA 1GESA 5D05A 2BGSA 3EPNA 4IIHA 4B9YA 2CLKA 3OG2A 5FEXA 1UR2A 2PS2A 2VX5A 3CGEA 4RV3A 1EWDA 4MB3A 5E93A 4WOZA 4AYGA 5CG7A 4E38A 1UR9A 3E2SA 4XAFA 4L6OA 2VQUA 4XKYB 2DZUA 2QIWA 1TG7A 1C92A 4PTXA 4XAPA 1NIUA 3GK0A 4JNMA 3WH5A 3LXDA 4TXEA 1C7SA 4WD0A 5JBFA 5CSRA 2PWFA 1GW9A 1H2JA 3AS0A 3W00A 3QHNA 3M0JA 3ZVHB 3D6NA 3DGBA 3LB0A 5CJNA 3S2LA 1KRCC 5G5IA 4YCPA 1VFTA 3UXAA 1R38A 4I5RA 2Z28A 1QTWA 3ICJA 1WDRA 3CB8A 4Q4PA 4B3ZA 2D2GA 1JL8A 5T91A 3GTFA 4M52A 3KOXA 2J78A 2AAQA 2GDVA 3PZVA 4LAKA 3PTMA 1ZJBA 1VRXA 3ZR6A 4H6KA 4HHLA 3HG5A 3SN1A 3NDZA 2DW6A 1C8YA 2B7OA 4MZ8A 2WP5A 1F4HA 3GRSA 2Q02A 4ZXLA 1GOKA 3EUB3 3HF3A 2JEQA 1C91A 1F6KA 3OVRA 4GG9A 3N17A 1OX4A 2X8RA 3QTPA 3R43A 4GISA 2QUTA 8RUCA 3IC9A 2HBVA 1IZCA 4EAMA 1T5AA 2GLKA 3GFYA 1N61C 3WX7A 2PC4A 1GQKA 3GVVA 4IZGA 4DN1A 3E74A 4TMBA 4LS2A 1Y5XA 2A3AA 5CPNA 2V5JA 1J93A 3FY1A 3VD9A 4IGSA 1YLVA 1N8WA 2VX7A 4IT1A 2ALDA 1E1CB 1J01A 1L6YA 4CU6A 3A22A 3N2OA 2ALRA 2J74A 4HSOA 4YS1A 4OIFA 3TLQA 2G5WA 2WCGA 5HWNA 1HKKA 5KTLA 2F5ZA 3ITGA 1PDYA 4E0CA 4PBEA 3T09A 3ZO9A 1WE5A 3LPPA 3PZIA 3BCFA 4DAIA 1BRLA 3H2MA 4M6PA 4A22A 4FIRA 4MWAE 3T2OA 5HWMA 5CEWA 3N14A 4GKTA 4OQVA 1THFD 1DV7A 4H4TA 2D2JA 2Z1KA 5D02A 4RNHA 2OZTA 3LLDA 1NDVA 3GWQA 3GDLA 3N9SA 3UERA 4BS0A 4M24A 3W1XA 1GVSA 3GE7A 3T0DA 3AJ7A 4EPEC 4YMZA 3VOGA 3T44A 2VL4A 1XLKA 3VOIA 1B3VA 1QNPA 4O4VA 3S9IA 2HCVA 3UG4A 1Q6LA 1SSDA 1EPVA 4GI9A 3TIMA 2QCFA 1XD0A 3LCFA 4BA0A 4YIWA 4H9MA 3E12A 1FFUC 4U33A 1KCLA 4Z2LA 3V4BA 3CGTA 5K9XA 3NSMA 3LHWA 3CXBA 2Y5SA 2WQDA 5LYRA 2W55A 5DFAA 1GXFA 4OOUA 2ZYFA 1U1UA 5AN7A 3GIYA 4D1IA 4AG0A 2I17A 3CGBA 2C3DA 3SM0A 3VC5A 4ZL1A 4LQ1A 3MJMA 1L0PA 3KOFA 3BGAA 2MNRA 3W27A 4FR6A 3MSDA 3L5AA 5JBDA 1W5OA 1A4MA 1W3TA 2WSPA 3THDA 3RLHA 3OTRA 2G3MA 4LVFA 3SGGA 1GK8A 2Q8ZA 4J3WA 2B7NA 1HL2A 2WAGA 4R7WA 3ATZA 1OCNA 4RE4A 1QW8A 3AXKA 3KUMA 1QOPA 1Z44A 3AALA 2V6AA 3C86A 2A2IA 3W6LA 1M6JA 1TV4A 3LPGA 4GYJA 4N9BA 2NV9A 3TN3A 1OCJA 2E7FA 4V1XA 5HBFA 3N12A 2A1YA 4IWWA 3AIVA 4TTUA 4C6FA 5LGXA 1VJIA 2DT1A 2DIKA 4NAEB 4QS5A 3WLOA 3GNRA 3PJTA 1FOBA 1OYBA 1UW9A 2YCEA 3COTA 1ZALA 2XISA 5HJXA 1R9XA 2WBAA 1AMKA 4J2MA 3TTEA 1UJPA 4K68A 1E6RA 4L5ZA 5I77A 3N19B 4X61A 1E3ZA 1VIWA 5D2XA 2G50A 1UD3A 3O0KA 3B0UX 2J27A 2VZTA 3H70A 3P14A 3QV8A 4PTWA 2R1KA 2JIEA 1TR9A 3EEZA 1RAKA 5IFPA 1NF7A 1XIDA 2QCDB 3WLPA 4B2DD 1B1YA 4RZBA 4UNIA 2VOTA 1X6NA 4FX7A 3C5QA 4JHMA 1WBHA 3AXIA 1TTPA 3UCCA 1PKNA 1Y5VA 1W8SA 4BCEA 3K2GA 3MU7A 1TMLA 3BK0A 5RUBA 3ETRB 1LRNA 2ABBA 4HPNA 1GKPA 1XH0A 3SUVA 4OGZA 3WD2A 4F66A 2VELA 4DF2A 4GCXA 2VYOA 1K9DA 1TV7A 4NF7A 2TSYA 2BTMA 4LX4A 1ZJHA 4GR1A 2H8XA 3OBEA 3WBAA 4RDVA 2BVTA 4LC8A 1FWHC 1OT1A 5A8GA 4KQNA 1KFCA 5D33A 5CPLA 4OOZA 2PLJA 1W9VA 4LBRA 3QLLA 3P74A 2HSAA 4LFYA 4KRUA 2GGEA 4LSBA 4PRRA 3ITTA 1Q3NA 4X2PA 2GQ9A 2VEPA 1ZBVA 1YXDA 2FHBA 1R7OA 1F3XA 2BDQA 1LBLA 4H4QA 3DH7A 2LLEA 1RY8A 4LVAA 4ZO9A 4RZ6A 5HAOA 4HTBA 3AS1A 4XO6A 2PWUA 3DXIA 1DHPA 2C0AA 3KBMA 4LAMA 2Z7GA 4XTIA 4KEVA 4JTHA 1J5SA 1KW1A 2CETA 4LTSA 1TX0A 4HMCA 1XBXA 4F0HA 1ICPA 2QUMA 2UY4A 2I1OA 1YEYA 3ANYA 4IP7A 3P8JA 2RABA 4QG8A 5HNUA 2QAFA 3SN4A 3VKJA 2YX0A 3LQGA 1UYQA 1RALA 1B3WA 4QJ3B 5LKYA 3P80A 3ZLHA 1OYAA 3XISA 1Q7QA 4J3ZA 4LJ3A 1R3VA 1K8YA 3N9RA 3SZ8A 1NF0A 3FKRA 1TPDA 4US6A 2XIIA 3VCCA 5JIWA 1EQCA 2Y7EA 3STCA 3PZOA 4MAZA 4D6JA 2PDIA 3E0IA 3I6EA 1AQFA 1V02A 1KB3A 3APGA 1W3LA 1Z41A 2A5HA 3P84A 2J9ZA 1K8XA 4G7EB 3R0DA 2HPMA 2H90A 6XIAA 5AB3A 4KMQA 2PWEA 5EFDA 3TC7A 3ARRA 4I3GA 1GRAA 3EWZA 4X60A 5JCLA 3IJ9A 1IZKA 1UH2A 1E15A 4AUBA 3LOTA 4LYPA 2HXTA 4NUWA 2X1UA 4WR3A 4QE5A 1JCLA 4FF7A 2VENA 1XW8A 3HOJA 3M7SA 3UG8A 1DHKA 3LEPA 5FJUA 3PZTA 4Z42C 4TVWA 3OO2A 4KS0A 1XRSA 1LBMA 2OU4A 3FYYA 2QJGA 7TAAA 2HVNA 1TWZA 1KRMA 2DZAA 1DWFM 3Q67A 5HWJA 5I07A 3DK4A 3LZ3A 1QI0A 4MPKA 4QP0A 1YNYA 4JS3A 3E2QA 2TMDA 2XHYA 1SM9A 4A8RA 1EHAA 1SMAA 4AIUA 2YR1A 3SCPA 4MGGA 3PSWA 1C8VA 4URIA 2PDGA 4S39A 5FF2A 3APTA 5EYWA 1SSGA 5KITA 4N02A 3P5YA 3SADA 1CZ1A 3VC6A 3ZVHA 4O4WA 3TUUA 1EJTC 2FHFA 1GZJA 3CV6A 8CGTA 1ECQA 3KBSA 1XJBA 1BPLB 1GYLA 3OYZA 4JICA 4L1GA 4AEOA 5PTDA 4UTLA 3MS8A 6REQB 1UP0A 1N63C 1BRLB 2WANA 1GT8A 3LV6A 1ZHAA 3NVWB 4ILSA 3E0FA 2UWFA 2NUWA 3H2NA 5CAKA 3CBWA 4PGLA 3WLTA 5B80A 1Q2SA 2D24A 5HPOA 2YXGA 1LQ2A 4WDUA 3KRBA 3P8IA 1A0CA 3PWAA 1PKLA 2JK6A 3C0QA 1KLZA 2RJGA 3VIHA 3MMTA 3GKAA 4PB5A 1BF6A 2OSXA 1M3UA 4M51A 5LXXA 1W1A1 4R88A 2FKPA 2ZVIA 2J8FA 4H4SA 1GETA 4HU8A 1J5TA 2VDIA 5U7SA 4FF5A 2DW7A 5I78A 3II4A 4HCHA 2PEVA 3DIPA 3QOMA 4FNRA 3OQEA 2JKPA 4KESA 3N04A 4JY9A 1J0HA 4UMCA 2VEMA 4M29A 3W1MA 3SCSA 5D9NA 5I03A 3MHUA 3TTOA 3IPWA 4W5UA 3QV6A 4EWND 3AS3A 2VEIA 2DQWA 1FEAA 3CO8A 1IEIA 2MANA 3BOLA 5A6TC 3TE9A 5M03A 5G5GB 2FGZA 3O6YX 3P60A 2DUAA 3QPEA 4YVXA 3L0GA 4GI8A 1TMQA 4J2PA 4N4PA 3SY5A 2OFJA 4AC1X 3DAQA 1KQYA 5HANA 4MLRA 4GNKB 3ISIX 1B3YA 1LLZA 3UWUA 1OT2A 3QKZA 1DIDA 3BSHA 1FUYA 3CO4A 3UBPC 1XGEA 3D47A 3KBJA 4S2BA 1FP8A 4CN4A 2PBOA 3FHQA 2PDKA 3QLDA 3MA8A 1SFLA 4HA4A 4DWSD 3W24A 1XD1A 1QATA 4C6PA 4CQDA 4UMBA 3GD6A 1GSNA 2FZBA 4DM1A 3WUGA 1QO5A 1TPWA 2OQLA 3K4AA 5HQMA 3N2BA 5J04A 3RPDA 3C0JA 1HN1A 1I9CB 3F03K 3LYEA 4I9JA 2FQIA 3BDKA 3MUXA 1Q4WA 2WYSA 1V93A 4KBXA 1TE1A 3S1XA 3KP0A 1IWBA 5SWUA 1JULA 2WM1A 1FWWA 1W9DM 1ZX9A 4FLQA 1V3HA 4ERGA 4TVCA 2ZDRA 3TQKA 3WN6A 1H63A 3QJAA 4C7DA 1C93A 4W86A 3WQPA 4LUJA 1OFOA 1IGWA 1X97A 2J75A 1AW2A 1UH4A 3DFPA 1N5WC 2WMKA 1W3IA 2DSZA 3W86A 1LWIA 2X8HA 1M1BA 1H5VA 3FNDA 3SR6B 2BXZA 2NWRA 1XG3A 2PDFA 5AC8A 2NVDA 1PJ9A 4CN6A 2R1LA 1OIMA 1FHUA 2WPCA 3CIXA 4W8BA 2E3TA 1LOSA 1UP3A 5BWAA 5HA7A 1QW7A 4FAMA 1Q5MA 3DEQA 4DWSB 5C2XA 1OADA 5I79A 3F7JA 1KXHA 3CPRA 5EKYA 2EPOA 5DN1A 4FNPA 3IACA 5HOSA 3PB0A 1XFBA 2QDDA 4NHVA 4PFHA 1MO9A 2VM8A 3OEXA 3TMLA 2QCDA 1T6MA 3SEPA 3FSUA 3MV01 4PUDA 2R94A 2A4AA 3GHSA 2CERA 2DP3A 2QDHA 2YKKA 1V8EA 4O0ZA 1WP6A 3N2MA 2ZZ6A 3GRTA 2BX7A 5FJTA 2WJZA 4NVTA 4UUIA 3CYVA 3VIIA 2PLCA 4LUTA 4AWTA 1T7LA 3TP4A 3GAYA 4O0KA 4AWSA 1W1VA 3EPOA 1E72M 3OBKA 4LUTB 1VFFA 4PRTA 4NAEA 2VR4A 4U3AA 5TAOA 2JFEX 2OWCA 1CIUA 4IMFA 4KRZA 3OZOA 1F61A 1BWCA 3UD6A 3BMWA 3KOYA 1JZ6A 4GUGA 1NP2A 4NAFB 4Q8VA 2W79A 2XVKA 4X63A 3W2KA 5LHEA 1EO7A 2CLEA 1OB0A 2XFYA 1TJRA 4HSHA 1DJXA 5J8LA 1OK4A 3SFWA 3QC0A 5I3DA 4MB5A 2V8ZA 1NTHA 1PZ0A 2Q01A 3URHA 3CUFA 3LG3A 1IXNA 2OSYA 3T42A 1EGVA 4RJEA 3ITLA 4AZCB 3WD1A 4UCFA 2IXVA 1OZMA 1LWJA 1XQLA 1WDSA 1XBYA 1AJZA 1AG1O 1JROA 2V6OA 1F2JA 1X96A 1I8JA 3RCMA 1TRIA 1W8GA 3WKZA 3RLUA 2IS7A 2FMNA 1AJ0A 1ZMDA 1B30A 1MXGA 3KL0A 1PYMA 2YA1A 3W7IA 3LTSA 3FGCA 3S2JA 3CQHA 2VX6A 4D8ZA 1NHSA 1E0XA 4Y6GA 3IGXA 1RVKA 2OZ8A 2V2HA 4ERIA 1DE5A 4O1DA 3B97A 4FEZA 2Z1VA 5CJ5A 4QG9A 4O54A 1E0VA 4RXGA 3HTWA 1NDYA 3AYVA 4E8CA 1RV8A 5GNYA 4FXJA 1HFBA 2Z2AA 1H0GA 2ZRXA 1E5JA 2C7FA 2X7WA 1UD2A 3J7HA 4GQGA 4DJEA 4JX5A 2VHLA 3MKVA 2VFDA 2VFIA 4GY0A 4R7JA 4JTQA 3G22A 1JZ2A 5AZ0A 3A7RA 3NZPA 3FEMA 1Q63A 4XBKA 4AVOA 5CPMA 3R0UA 2J6XA 3QFEA 4C6CA 4NZ3A 1GV4A 3NYDA 2Y1HA 3G5EA 2PLKA 4UTFA 1ZL1A 1HIZA 2WPFA 4JTCA 4S38A 1X8CA 2DSWA 5JCKA 1IWAA 4S1FA 4DEFA 4LXFA 3ZWTA 1K4QA 3O0HA 2B81A 5BCAA 2OELA 4ACZA 4AWUA 3SQMA 1B31A 3V0SA 4PL1A 1ITUA 3Q2DA 1O5XA 4PCPA 1KN0A 2TRSA 3HMCA 1CB2A 1EYEA 2Z1BA 4IIBA 5LGZA 3NQ7A 3M5XA 4PTNA 3IIOA 3DYPA 4P7OA 1H7OA 4GH1A 4KGJA 2HVOA 2GWNA 1HL8A 3NQDA 3BAIA 1DOSA 4MYAA 3U7BA 2WJFA 4MKVA 2YDQA 4ZMGA 2VXNA 1W1PA 1XLCA 5KVIA 4B5NA 3G6LA 5K4XA 3KBWA 4XD3A 3M0KA 3W01A 4AH7A 1YDNA 1CI1A 2EJ1A 1MDLA 1PWLA 3MO4A 4C6NA 1R3RA 3TC6A 1V03A 6CGTA 1MDRA 1R9ZA 2RAGA 3NQFA 1RLCL 1QWKA 5BROA 1MFVA 3QY7A 4UTHA 5CG0A 2BY2A 2Z4GA 1EX1A 3BLDA 3A9BA 2VFFA 5D38A 1LCOA 3H21A 4NL1A 3SRDA 2OTDA 2I7GA 3HU7A 4ACZB 3JUGA 3IJQA 6ENLA 3RU6A 2Q71A 1KWKA 1FHDA 1WAUA 2INZA 3MSRA 3LU2A 5T9CE 4YVVA 4JEJA 4ATDA 1VD6A 2E9LA 3SUWA 2V2CA 4G1NA 3RM4A 1JYWA 4UQEA 4JYDA 5I23A 1FBAA 1MVYA 4M1RA 4UZSA 1AQHA 3WENA 1R3WA 8XIAA 2A8XA 1RZMA 5A6SA 4H4VA 2NXIA 4AX7A 4JTDA 4V2XA 4GJJA 4XAZA 1H49A 2VMFA 1NHPA 3WJWA 5AVHA 4AF0B 1T41A 1GEQA 1M5WA 3LHZA 1TV3A 3T78A 4IGMA 1A5UA 1R2SA 4D6IA 1G7VA 3MI2A 2EGZA 3WD3A 1BVNP 4O15A 1CLXA 5FF0A 1R47A 4Z0SA 3RRXA 3NFUA 2PWGA 4I8YA 1VC4A 1KXVA 2XGIA 2ZRWA 2OSWA 5K2ZA 4K1GA 1JPDX 5A8OA 4UR8A 2Q8LA 3QQ1A 2BY0A 3A7AA 3BLKA 1RA0A 3VDGA 3THCA 1AVAA 2GOUA 1ICQA 1QMLA 2YYTA 2X40A 4DZAA 4BKNA 1Y8BA 4F0SA 2W66A 5AYZA 3MWAA 2VCCA 4R33A 3IWPA 2DZPA 1WXYA 3C2OA 1AOGA 2FDSA 3N34A 3AHYA 1X1NA 4KF1A 8XIMA 2ZXDA 3TNBA 1M6IA 3KTSA 2XZ7A 4J40A 4K1WA 2G4JA 4I8DA 1A0DA 2I5IA 1IHIA 2DSKA 1DJYA 4ZZ9A 1A47A 1WNOA 2F2KA 1UWQA 1TIWA 5C71A 4H2HA 1K70A 2BHUA 1VEPA 4LALA 3RNDA 3MVIA 1JDAA 3LCWA 2QPSA 4KEZA 5FESA 4IJRA 4XO7A 5ABFA 1DE6A 2P1FA 3CHDA 1KM6A 4MJZA 1EJVC 2PDBA 4D2JA 1AFSA 4R27A 1BEUA 2PGRA 3RLVA 1CPUA 1ZXIC 3LM7A 4LBUA 2NLIA 5I3HA 1O5QA 5CZKA 2W6RA 4MJ2A 1S3TC 3PWGA 5HNRA 1RJQA 4B4FA 1EH9A 2NVAA 3P0XA 3APYA 1YRRA 4MB1A 1RY0A 4JTUA 2GJRA 3QR1A 2VGBA 5E0KA 5I6SA 2Y6ZA 4AHOA 4DRSA 2CHOA 1DORA 2J7FA 4G8TA 1R85A 1BLIA 4DYKA 1TWIA 2A6LA 1QI5A 4MY9A 4JTGA 4HVXA 1JD9A 4JTSA 4X9SA 3R2GA 1EZWA 1OQFA 3P67A 1ZAIA 1XL9A 5U25A 1GERA 2GUBA 1K03A 2GGIA 2IXUA 3NZQA 2YZ5A 5CKSA 2VJXA 1F3EA 4NJIA 5HK4A 3BAYA 4XZ9A 3EX4A 1GQJA 1K3UA 1V0MA 2FTWA 5KZ6A 1HG3A 3KTXA 4GY7A 3BL3A 5KZDA 4H8UA 3CAKA 4RDWA 3NPVA 4DNHA 3QZ6A 1VBJA 1XKJA 2QR6A 4JX6A 2JEPA 3A23A 3GTHA 1BG9A 4H9YA 3FW6A 2FTPA 2H9AB 3L21A 4WLCA 3VA8A 3AIBA 4JNYA 3SR7A 2X09A 1GREA 4M6VA 1RR2A 4BY3A 5K4ZA 4PBGA 2AGKA 2QAPA 4BHYA 1BKSA 4QFUA 2YAUA 4H83A 4D9PA 2J47A 1XUUA 3PN8A 1JNEA 3BJTA 1JZ8A 1HW6A 4O57A 3B40A 2REQA 4Q7IA 4GQBA 2FVLA 3LDVA 3NPWA 4HHMA 2C18A 3RGTA 1J11A 4B5SA 1TYGA 2VR5A 5E1QA 4US5A 4OZOA 1JAEA 4W7VA 3GSMA 2W0UA 3IEBA 1U30A 3H2EA 2NQZA 1US0A 4TO8A 3U0HA 3NL6A 3VIPA 3LMYA 4MDOA 3UXIA 1R6WA 2CPUA 4CGTA 3ARYA 1EUAA 3TYZA 3A24A 2ESCA 3WLKX 1SW0A 2X41A 2CBUA 3V5FA 4PMYA 2ZUUA 2JGYA 3NUKA 2VC5A 1LVLA 3DFYA 1Z8AA 1UC4A 1S2AA 4H7ZA 3TYUA 5HATA 2G3IA 1CYGA 2A3EA 2WLYA 5LA0A 3EDDA 2FZDA 3KS5A 2UY5A 5HMFA 4AHPA 3WMLA 3IVTA 4GH3A 3WK2A 3EOLA 3UGRA 3T05A 4MKNA 4H04A 1ZMCA 2WOIA 2XN1A 2IUZA 3UESA 2OX1A 1NJJA 4DUWA 2WVTA 4O16A 3V1HA 1F8MA 4LANA 1ZPTA 3PAJA 4ZOBA 5K9DA 3P62A 1DJNA 3ZFHA 1IQ8A 2BMBA 1GGOA 3CS2A 3G24A 3IV3A 1KR1A 1VF8A 3QFWA 2GR1A 4H2CA 5D2TA 4JTRA 3F5KA 3EPMA 4O14A 4F79A 4B9ZA 5ECUA 4J3UA 1U83A 2J8TA 2OYLA 4B4HA 4CCEA 1GG1A 3WF0A 2E25A 3SCRA 1UR8A 3R89A 3NSNA 4MSSA 1EOMA 3ES8A 5D30A 3CC1A 4L61A 2QGHA 3GNPA 3EB3A 4KCTA 4WX2A 4MUZA 4OV4A 3W81A 1FCVA 3WDPP 2VRKA 4U4MA 3A64A 1RBOB 2YL9A 1VS1A 2IMRA 1A50A 2E6FA 3P3BA 3EMCA 1W1ZA 3T6CA 3G3DA 4ROPA 2P5NA 1GOWA 4GGHA 4M6UA 4F3HA 2V67A 1FH9A 5FS7A 3UR8A 1U5VA 3W75A 3SJ3A 2CZEA 3THQA 3M0YA 4LCQA 4PMXA 1D9EA 2J3NA 1TV8A 1QI2A 5JBEA 3HA1A 2XN0A 3BAKA 2ZX7A 4EE9A 1VHCA 3HURA 4A2RA 1PPIA 3QHOA 3WLQA 1R7AA 1V3MA 2AKMA 2OX4A 4LRTA 1P7TB 1UKTA 2PWHA 2E5DA 2C1HA 1PYFA 4JNZA 4N4QA 5HQLA 3EANA 3LM3A 2YBVA 3ANUA 4DJEC 3EA2A 3O7UA 3ZLGA 3FSTA 1XDMA 1GRFA 4D1JA 2EBNA 4LY8A 3T1GA 4DI9A 1MW1A 1SR9A 2NUXA 2RH9A 2H8ZA 1Q8JA 4AD4A 3D3FA 4NT0A 4HNVA 1I2NA 4BURA 1WDQA 2B7PA 3K13A 4IMGA 3KRZA 4DJDD 3OVQA 4B15A 1W6TA 3ITCA 3A7UA 3URQA 4EX4A 4AXKA 4C6IA 3UETA 1GPFA 4Z1YA 1BTCA 1FWDC 2WHMA 1US3A 2BOGX 2CZ5A 3PBMA 2WNZA 4IIFA 1XYCA 3AHVA 1ZAHA 3UCQA 5G2IA 3T55A 2ZZBA 3BWWA 1A0EA 1BGAA 1BQCA 3GR8A 1S1RA 5CSYA 4MOZA 2DV0A 2OOGA 2ZZ7A 4HYRA 3SO7A 4GYFA 4S3KA 1Q8AA 5D32A 3GXDA 5E09A 1EC9A 2RHGA 4GCAA 5MKGB 3VGHA 3U2EA 4WJ8A 1FWIC 3GG0A 4DBWA 4C7GA 1VPYA 1U22A 4JQ9A 4Z2KA 1LRTA 1RD5A 3UZWA 1YHTA 4JFVA 1JCYA 1JNDA 5BRPA 4WVXA 2ZZ3A 1A5KC 3LUTA 5EL1A 1TSIA 3G0XA 2PZ0A 4GQ0A 1OABA 4ATWA 1NWUA 2JQXA 4A6GA 1Q7ZA 5TNVA 3LLFA 4OVXA 3O6CA 2W3ZA 4EACA 4FPSA 5G4WA 2GDUA 2X7VA 2W27A 2WBGA 3S42A 1JDFA 1FCUA 2VEGA 5EGRA 1KM0A 4NZFA 3W7LA 4HYWA 3S8HA 1I2QA 3BLEA 3SBFA 3POCA 1E3XA 3G6MA 3TNOA 1SR0A 2NSOA 3NQBA 4H4YA 1HKJA 3VGDA 3CWNA 3K8MA 2GVYA 1B4EA 1KO0A 2BOFX 2X05A 3AI0A 1DL3A 2ISSA 5DMNA 2YL5A 4ZO6A 4FALA 3F2CA 2HWGA 2AL2B 2OO0A 3I7RA 4HZMA 1XIEA 2X16A 4PSPA 1W1TA 1LBFA 1UIPA 1DJGA 3EYPA 1H7NA 3W6YA 3DJGX 2FFCA 5BMXA 1EB3A 1RUSA 1TWSA 2VKZG 2BV9A 3V5OA 5FF4A 1DIKA 3LGDA 4XZMX 4C1NB 4ES4A 4C6DA 2V9DA 5C7VA 3NOEA 1XGZA 1IE7C 1OD0A 3VO0A 2F6UA 2F6XA 2ZX8A 1OCBA 4DUOA 1XS2A 3L5OA 2PDUA 4NAFA 2D1ZA 2GFTA 4Q3MA 4UQCA 2VWTA 2FH6A 3WNOA 3IRSA 4REQA 4YWOA 4OBTA 2W92A 1GJPA 3MB9A 4OT7A 1E6ZA 2Y8UA 1FWAC 4RDZA 1TYPA 1W32A 2EF9A 3B9EA 5FI8A 3RG6A 1G4TA 1AMYA 2R1NA 3OJGA 3S2NA 3CPUA 1CXHA 4TVUA 1FFQA 2OCZA 2WZMA 4O1CA 1UIOA 1Q85A 2WVSA 3VM5A 3IJ7A 2HE8A 3TJIA 4KFOA 5AFDA 4CQ8A 2OPJA 1D8WA 2BWGA 4P5UA 3Q65A 4YXGA 1E55A 1ODZA 1IR2A 4NXSA 1JF5A 3AMLA 5ABHA 2WQPA 4YN5A 1EZ2A 2W9MA 2E3ZA 1QI3A 1SYTA 3WQDA 5JCNA 5AOUA 2O7QA 1TPFA 1ITCA 4MMWA 1W5PA 4MUPA 2DZTA 4AW7A 4XV0A 3O9NA 3OG3A 4WDTA 5E9AA 5FJPA 3MP5A 4PMVA 1IIHA 3WDIA 1FCQA 5EMJA 3ABXA 3SSZA 2BC0A 3S2CA 3BPWA 4K37A 1QR7A 4QITA 3FLUA 5FACA 4A3QA 3U3HA 3BSGA 3LCIA 4U10A 3ZT5A 2CLOA 5ENLA 1U1HA 4GUIA 3T40A 4UBPC 1KM2A 4X3ZA 3UNDA 5AYIA 2J9YA 3WY1A 2WBKA 2Y89A 5C9UA 1FWNA 4U31A 3QW4B 1O68A 1NHRA 4UXDA 5HPCA 1K7FA 2ZUSA 1BAGA 2DVXA 3CAVA 2V2DA 1WYIA 2ZTKA 2IPJA 3RJYA 3H12A 3OBAA 4Y9NA 3W1RA 4IQLA 4QROA 1XLGA 3WH8A 3ENLA 3NG3A 1F6PA 3IV8A 3VKBA 2Z27A 4GK8A 4CCDA 3W7CA 5BU6A 2QJJA 4P7QA 4JQ3A 4A21A 3WDJA 4BJHA 3RYSA 3TX9A 1TWWA 1FWCC 3NS1B 2G95A 1LUCA 3NOYA 1OG0A 3L4XA 4QXIA 3CIWA 4UR9A 2ZKMX 3MCOA 2Z7KA 3LMZA 1CGXA 3BCJA 5AHNA 4DJDC 1S2WA 5F2MA 4Z17A 1WKEA 2A7RA 3PVFA 3F4WA 1UH3A 3JZUA 4EPDC 3N3MA 3WK3A 1QT1A 4CQBA 3AIQA 3O8AA 1XLEA 1I2OA 3S47A 2ISFA 1K7XA 4ZODA 1FWJC 5H8UA 3UPBA 4WY0F 4DLFA 1LRQA 5A2AA 1AUSL 3EX1A 3G0SA 4LV4A 3DFOA 3SQPA 1NFPA 4L9ZA 3WYZA 5LIYX 1XR2A 2GK1A 1F7BA 4W84A 4RE0A 5K9CA 1XKYA 2Y8KA 2Z1XA 2J79A 4O50A 4AIBA 2GR0A 1UUQA 4HPGA 2BBFA 2GVJA 3WFZA 3B8SA 3HQOA 1X2HA 4FS9A 3ARTA 5FL1A 2HS8A 1CTNA 1F74A 1RK6A 2QJMA 4P8XA 2I14A 2ZE3A 4PA8A 2YJQA 4RK8A 1XHCA 3UEQA 2WM0A 1V3JA 2VRJA 3POHA 1ZP3A 3TC3A 3STGA 1Z6KA 1TV2A 3WBEA 1P1XA 1D7FA 2VTFA 2SFPA 3V7PA 5IBXA 4KPLA 3GDTA 3ITYA 2QDEA 2DPEA 4MFDA 3RN6A 4LA1A 2DIEA 1D3CA 3FA4A 4DBDA 3S6OA 3WDHA 3PZNA 4UFHA 1GOIA 2EPNA 3KVJA 3VFLA 3C0LA 1V0KA 1I1XA 3U6WA 3VOJA 3MVTA 3CL8A 2OKOA 2P76A 1JDEA 4HNUA 1YTDA 1SZNA 4K6AA 2D2HA 4ACYA 4G2DA 2XYLA 1JOAA 3KHDA 2PRHA 3EWUA 4W7UA 2WMJA 4YWIA 3TN4A 3NQMA 4AF0A 1F5ZA 1DWIM 1TFVA 3W53A 3TQVA 1G4PA 2D0GA 5DELA 4Y2WA 1JQXA 2WPGA 3VDBA 5BXRA 2QJIA 3WEZA 3DFQA 3OVPA 1H1ZA 2A0NA 4OUEA 1W3NA 1G7UA 4BEQA 1PXGA 2XVPA 3AZTA 3GH4A 4JL1A 1VBHA 3OHIA 3WMSA 1ZB5A 3IAPA 4G1KA 3AWNA 1W0MA 4UQAA 2GSEA 2A21A 3V1PA 1N82A 4PCFA 3ZJ7A 1FH7A 1TPC1 1V6XA 1SVDA 3GIPA 2EKCA 4LAZA 3GXNA 3CGCA 1ME9A 4TQTA 2J7HA 2RDWA 1XLDA 2Y5JA 1J4EA 1WXZA 5FEPA 1RSCA 1LM1A 3AMKA 1DP0A 5D2VA 4J3TA 2INFA 2AQWA 1EJ7L 4J3SA 1R87A 3R5EA 5TR3A 2JF7A 1VBGA 3N18A 2H6RA 1CLVA 3QQ0A 5JXQA 2HJPA 4N9EA 2XM2A 4CU8A 4NZJA 3MJYA 2R8WA 4ZA0A 4CLMA 1NH6A 1M04A 4O10A 4S23A 2C8NA 1NDZA 3AYRA 4F2BA 5DY2A 4LC6A 2INEA 3ARVA 3CHEA 1B9BA 4H4PA 3GAKA 3NVDA 4RW5A 1GORA 3GO2A 5C55A 1T8QA 2ABAA 5DANA 4MPQA 3S9ZA 4A4AA 3N2TA 3BLLA 3HZ3A 1DBTA 1E6XM 2O9PA 4Y9PA 3MT1A 3SB0A 4LEFA 4P2VA 2QDGA 3QW3A 2O4QA 4CUCA 5ABGA 2V3DA 5FJIA 1OM0A 2GQ8A 4LWWA 3I6RA 4YCOA 2BG5A 2OKTA 3I65A 4I7UA 1PO9A 1ZNNA 2E28A 3OIXA 2YCLB 4GNJA 3HJEA 2WSQA 4CD4A 1KBJA 4BQ4A 1VFHA 2WC7A 3P82A 3A12A 3ONBA 3NVVB 2NQ5A 3G0UA 4JIHA 1S5NA 1L6WA 2FZMA 3EWYA 4EM3A 2Z24A 3A3HA 3Q58A 4S3AA 2UY3A 3WBWA 2WC3A 3PULA 1RXOB 1LG2A 5D04C 4XD5A 2D69A 2FIQA 4TU1A 3ZJKA 1JUBA 2YLLA 2OZ0A 5E0CA 2WNNA 5CBIA 3CH0A 5LA1A 3OC4A 2YFOA 3OPSA 1BVZA 1EBHA 3ABZA 3DHDA 3EWXA 2CFYA 1WB0A 1X6LA 3R4IA 1OY0A 2FPTA 4L1XA 1TQJA 3AROA 2Y70A 4B5WA 5TIMA 3EAOA 2PU1A 1C7TA 3LPFA 2PRLA 1W9BM 4IL2A 1HJXA 3VKAA 1AQMA 3FN9A 1HKWA 1IGSA 1DNCA 5CLTA 3WO8A 3BJFA 2JGQA 3WQOA 1GUVA 3T81A 3WK0A 4UNLA 2A79A 3TA6A 4ZOAA 4DI8A 5EMKA 4ZGYA 1VENA 4QCFA 5T9BG 4FP1A 5IM51 3GC2A 1QPOA 3HFYA 4HGXA 2DJLA 3B9DA 4LRSA 1GKRA 3A6OA 4DUVA 2XDFA 4GY1A 4EXAA 3UXDA 4MNMA 4Z2GA 4G56A 1SZGA 2TPRA 5JQ9A 2XTKA 3GXPA 2EPMX 5A1AA 2CLHA 2F6KA 1GYMA 2OB3A 2ZQ0A 1JVNA 2BLEA 1ZGDA 1GWJA 3RO6A 3WQ4A 4IHCA 3L2MA 1C29A 4RE3A 2C79A 1XCFA 1WO2A 3OU8A 4ICMA 1AA1B 1H5YA 3TJLA 3CPGA 3LNMA 3NJ3A 1JEZA 1EX5A 4PN2A 3HGOA 3TQ0A 2EPHA 1VFMA 4UTJA 3VFCA 1V0LA 4DXXA 3M0VA 3AICA 3QQWA 1IWPA 4MY1A 4DVOA 1ODUA 1V0NA 3RFAA 3M41A 1UWAA 1EIXA 1JCTA 3VOCA 5FEZA 3SCOA 1CCWB 5D8WA 5T8GA 2O0TA 3B3DA 3P6LA 2WWCA 3DKLA 4WF7A 3E5PA 1EA0A 2QAEA 4MWAB 1TCDA 3DU0A 1CNVA 5G2WA 1JUEA 3DH9A 3AHXA 3CTTA 3MZNA 1S1PA 1OIFA 2QGYA 2D3LA 4JIPA 1BTMA 4TTGA 2ZXQA 3EDJA 2V30A 2F61A 1UKPA 4JIIX 1N2VA 4RDYA 1YW1A 2EAWA 1S38A 1TPB1 1W56A 1QNQA 3OHMB 4ZFCA 5A8PA 5FKYA 1IIGA 3VD4A 3GH5A 4M6QA 4TUFA 3L2LA 4EXQA 4KKXA 3CU2A 4O28A 3G1AA 3FFSA 3EX2A 3WQFA 3UXLA 1RM6B 3H2AA 2ZZCA 3OZMA 1KGWA 4UFKA 2BVYA 4DO5A 1VB9A 3ZT6A 1YE6A 5AHLA 4YHGA 2G3JA 4BI7A 1WKDA 5C6MA 1X7FA 5C70A 2RDTA 3WD4A 1TX2A 4EVZA 3ALFA 2D23A 1OJXA 4UTIA 3FKKA 2V81A 1IEWA 4FNSA 3F4CA 3LY0A 3N6HA 3VD7A 2BY3A 2PB1A 4AFYA 4MDPA 1ZBKA 2O55A 1HNYA 3BV4A 3WD0A 4C65A 5DBUA 4E8GA 4A3RA 3G8EA 1UA7A 1XLFA 3W22A 2WCSA 3MUAA 5FJOA 1JR1A 1FKWA 2E9BA 4A05A 4K3ZA 1QVBA 4EWJA 3WUEA 4UTWA 1RA5A 1J79A 2BC1A 3CV7A 2OYKA 1EDTA 2V5LA 1B3OA 3DYMA 4HA3A 4O52A 4XBJA 3F4VA 2ATMA 3Q94A 2VZSA 3CYJA 2IKHA 2BFGA 3HIJA 1OGSA 3U2ZA 3LB8A 3PBYA 2XWDA 1UHVA 3O1NA 3LK6A 2ZUNA 3W82A 4LT9A 3H54A 1QNRA 2C1GA 3MCMA 1W2PA 3SFKA 2XFRA 4B92A 3C3UA 2BSLA 2WKLA 2FMOA 3CGDA 3M47A 1VBUA 1YYAA 3TXVA 1WZAA 1E1CA 4WSKA 4BI5A 2WV8A 3FAWA 4A8IA 3BC9A 5CXPA 3SCTA 4ECLA 2V5DA 3T7VA 3M1ZA 1ZP4A 2QW5A 1ADDA 3WQGA 1J10A 2GJXB 3H4XA 4GWEA 3QSRA 4RKAA 1J18A 4K36A 3PWIA 4NZCA 3S5ZA 3TOPA 4GNVA 5A6AA 4FX6M 1EWEA 3NVTA 4AD0A 4NKCA 2DFAA 3UY7A 3C6CA 2YIHA 1XYZA 4EPKA 4C6EA 4L1WA 3LTYA 2J9XA 4IJBA 5FAJA 1RJPA 4JX4A 4X2RA 1OCQA 2POZA 2Q6ZA 1A5AA 1VJZA 3N4AA 3MI6A 4JCLA 3E96A 3GD3A 4QLLA 3NQ8A 4E8DA 1DXLA 3D3AA 1QPQA 3QKEA 1MUMA 4C6MA 1MOKA 3NPXA 3QR3A 3VNZA 1RLDA 1IT8A 4WK9A 2DUZA 3A4XA 4H8NA 2PMQA 5D8ZA 1YDOA 3NM3A 2QCMA 2GR2A 4JDYA 2ZRZA 1VCVA 2GGJA 1ZJAA 2XU2A 3PBGA 3OLDA 3CAWA 1S5TA 3E38A 4P8UA 4GXPA 2YL8A 4K8DA 2CBIA 2RJHA 1XF0A 3BXWA 2J8GA 4ZQPA 3G1YA 4X22A 3BURA 3VGGA 2IQDA 1OF6A 3DECA 2ISDA 4HT3A 5EPDA 4HU3A 1HGWA 1SZFA 1UASA 3HPSA 4K7VA 3RIKA 3VD3A 1CGUA 1CT5A 5TF0A 6ALDA 3EWCA 4DBUA 1V51A 1PV8A 2DGAA 2VGIA 1UG6A 2CLPA 4KIRA 1Q6FA 2Q09A 4Q8OA 2VDGA 4YVPA 1S3HA 3GW0A 3USZA 1PDZA 1UPMB 3IGUA 1BWVA 3LENA 4GZ7A 2ZC1A 5K7JA 3WH7A 3KOWA 3CM4A 2R9RA 3FJ6A 4Q7BA 2QUVA 5BMWA 2HEJA 3QZEA 3W7KA 3SUTA 4L56A 1Z69A 2YDSA 4C60A 3W29A 1FWSA 3LNPA 4QJ4B 2PE4A 2EKGA 2YBUA 4MHBA 4C90A 3DG6A 3AUJA 2H3DA 5CGQA 3L4VA 1OFQA 3KFTA 1XXXA 5D37A 3WDRA 1NPXA 4CCCA 3G2GA 4UB9A 5U1OA 3A9IA 3VNMA 4RNFA 3IVUA 3JS3A 2GVLA 3MY9A 3B0YA 2NX9A 1HJUA 3W87A 5IDZA 2RUSA 1K8ZA 3GQYA 1VRDA 1V97A 2QT3A 2J7BA 3CASA 1S5WA 3ARXA 3E0LA 2Z6IA 4GX9A 5HQEA 4S3BA 3P81A 3HPXA 2E9MA 1CEOA 1BXNA 4H00A 2G0WA 3RDKA 1NOFA 2AAMA 4AD1A 3FG2P 2QVHA 4O17A 4J35A 5HDRA 5IDIA 1ZBCA 1ZTVA 3GXMA 3SCQA 4IPJA 1EGMA 3SUSA 4LW7A 4IIGA 1CB7B 3DFHA 1B2YA 2YPIA 4XZWA 4QJ1A 1ZCOA 2P50A 2V3FA 2P0IA 1G0CA 1OFBA 2PU0A 1RJRA 2XFFA 4GO8A 2ZZ5A 5I3IA 2O4MA 4J5NA 2PUZA 2VQTA 3WLNA 1I6NA 4IUGA 4M56A 3RCYA 1IYXA 4Q8TA 1V6VA 3B4YA 4PYSA 4ADTA 3C3NA 3IVSA 3EWDA 4HBKA 1EL3A 3GNNA 2VC7A 1WKFA 4UFIA 4BR1A 1RCQA 4HSNA 4KWOA 2Z29A 1GQNA 1MEWA 4CVUA 3OZYA 4K39A 1JEHA 2FJUB 3IUHA 4JHOA 3LZ5A 2XJ7A 2E68A 1Q6EA 1UMLA 2YVGA 1XYLA 2ZRYA 4TV6A 1VDVA 3SCUA 3W28A 1J2WA 4QM1A 4WIWA 1H2IA 1B5TA 4A35A 1V6WA 3O16A 4WSHA 4AVNA 3B0VC 3O07A 1L9WA 5DMYA 1I4NA 2QCGA 3QTGA 4HNTA 2H3BA 4Q4QA 3VD5A 5GQBA 1PSCA 2OR2A 4I6KA 2CCRA 3GG8A 3N2CA 1E9YB 1R5YA 4XSMA 1OGGA 3B9NA 3TYCA 1HTIA 2WC4A 1QJWA 4ZFMA 1UBPC 3GYEA 5MHBA 2VC6A 3TMQA 1MZHA 1HZYA 4MADA 3K4WA 3QN3A 4L65A 3NM1A 3S4TA 1F6YA 1L2UA 3GDBA 3L4UA 2UZ9A 2WOQA 4GQQA 3W07A 1P43A 1EQPA 4F9DA 3THAA 4CQ9A 3PZQA 5IXEA 4D6HA 2OVLA 3M7WA 1ZK7A 1IXPA 3STEA 4CNOA 3PZGA 4JL2A 2YXOA 4IX0A 3PBVA 1HKVA 4RE2A 2PA6A 2XIJA 4FXRA 1DKWA 3UJSA 2XH0A 4JY8A 4AD3A 2I5GA 2ACUA 5A3HA 2QMJA 4A3HA 4H01A 1MO0A 4HQVA 3GXFA 3FK4A 3NRZB 1XSJA 2E1WA 3PJXA 1R2TA 1NU5A 4JKLA 1R3YA 1XIIA 2BB0A 3A5VA 1T0OA 1NFBA 3WUFA 2E1DA 1TELA 3KRSA 3FEQA 3KVMA 3WF3A 1K1DA 1QK0A 4L64A 4LAUA 2V38A 2GQ3A 1SB3B 5A94A 3N1AA 1H62A 2CC0A 2NUYA 4B90A 4P7NA 2CBJA 2TYSA 3S1UA 2I16A 2WHKA 4PC8A 3W1NA 3WF4A 2X0YA 4E2VA 1VFUA 1H7XA 3ERPA 2YQUA 2REQB 3FDKA 5AVNA 4GRSA 1CW2A 1J96A 3H4GA 3EKLA 1C8QA 4W4QA 2WKGA 2PDPA 1GRBA 1UBSA 4MNKA 1VPXA 1ZFJA 3UJEA 5A69A 3L7RA 3W9ZA 3EXRA 3BE7A 5CPOA 3BLIA 5CPQA 2V82A 2XUCA 4PCTA 2W91A 3I7SA 3VOHA 3PM6A 2OGYA 5G5HB 2QCNA 4IJCA 4AYSA 3AN1A 3QC3A 4NEWA 3R11A 1ADOA 5GRTA 1H51A 3O63A 3LRMA 4GVHA 4LS1A 4IXXA 4TR9A 5KETA 4N2YA 3KBVA 3AHTA 3DI0A 3CK5A 1M9HA 2OWXA 3UT0A 2VDHA 4UFJA 3ARZA 2CWNA 4BF7A 5CLWA 2IPGA 1QHPA 2PC8A 5BNKA 4XUGA 1QOQA 2QCLA 4QHRA 5TD4A 1DIOA 3VTRA 1JJKA 3AU2A 3UA4A 1H3GA 1AW1A 4DBSA 2E67A 1RCXB 3HV8A 1KFLA 4XX6A 3RPMA 3M44A 5LIKX 2HRWA 1CBGA 1T99A 4E3VA 4I90A 5I7GA 3VMOA 2PTXA 3CT2A 3GX9A 1XYBA 3VPLA 4MF4A 4WDWA 3S6TA 1CXKA 2R82A 3CZKA 3BOXA 3GDKA 3REQB 1H09A 4IIEA 1O4UA 1GVEA 1GEUA 1VBRA 4A8NA 1EP2A 2R14A 4YYCA 4XVEA 1HJQA 2VFEA 3BOFA 5FMHA 1OFDA 1OX4B 2J77A 2Y61A 1Z48A 1SMDA 4HNCA 1JI1A 2R6OA 3KCOA 1KM4A 1XH1A 4BI6A 4I9MA 3VIFA 2AKZA 4JTAA 7ENLA 3PUOA 4O1BA 3BV7A 1MZRA 3HM7A 2OEKA 3WLHA 4C6QA 2QMKA 1SFSA 3MO7A 1E6PA 2CNCA 1JZ5A 1MSSA 5CQ1A 4IGHA 3I68A 4LYRA 1UUOA 3VKKA 4GXMA 4ZTXA 5C5YA 2AMXA 1XC4A 3CZ8A 2PFHA 3ABOA 3D5HA 1JYXA 1DEDA 1R3TA 1WZKA 2DORA 1T3QC 3G1SA 4ZQNA 9XIAA 5GPRA 4DWSC 2WO5A 4YWSA 1SFTA 3DBNA 4G9PA 4AQLA 1Q65A 1W9XA 4WJXA 1QHZA 1N60C 4K7ZA 4EQSA 2UY2A 3DK9A 3TYEA 2JKEA 3CMJA 4ALDA 1C9WA 1CDGA 2V68A 4R53A 2ZC8A 3WLMA 1JZ7A 3GDMA 2BVDA 3NPUA 4BQ5A 3A4JA 4FNUA 1FRBA 2CDUA 1VJSA 2ZE0A 2YGYA 1X98A 1X8FA 4UQBA 1XI3A 1S2VA 5M3WA 2BY1A 1JGMA 1QNOA 4Y8EA 1OX6A 1MQPA 1KBKA 4R9OA 2VFHA 3E5BA 3ZR5A 1LLOA 1W17A 2XPKA 2RDUA 1RQBA 1BYCA 2NXHA 3GFXA 1CENA 3H55A 3BH4A 1FXQA 1SUXA 3G1RA 2TPSA 4QISA 3ONCA 3BGGA 2VNCA 3C2VA 4AEFA 1KBLA 1H61A 4YLWA 4RCXA 3GW3A 3NVYB 1J9YA 5BXTA 3SCWA 4JCMA 3UYIA 1UD5A 2FZNA 3GKFA 2BXYA 1RH9A 3ES7A 1Q6RA 1S2CA 5DMLA 3CEUA 3IIPA 3U5YA 4ZO7A 3EWBX 2J7CA 4HOZA 4NZ1A 3UR2A 2V3GA 4PZVA 3A3WA 2EG6A 1SZEA 4YTTA 1JFXA 1JI2A 1NWRA 5U4NA 3NZGA 1XRFA 3B0PA 1AL7A 1OFRA 1PX3A 3S3GA 3BZJA 4J9JA 4QLJA 3PS7A 3C8FA 3MP4A 1C90A 3ITVA 1ISWA 3KCLA 2C3CA 2CBVA 4MZ1A 3K1GA 4Q4KA 3TU9A 3GBDA 4L4LA 3WSUA 5IHSA 1YBQB 4PUEA 3KRUA 3EX3A 3CWOX 4PMZA 2A6NA 2NV2A 3T9PA 2GJNA 3BG9A 3DCPA 3LPOA 4IMCA 4AY7A 4FOUA 2ZFAA 4IMDA 5E0FA 4V28A 1MXSA 2DUXA 4FX9A 2D2OA 4U3CA 4FI4A 3UQNA 3LCXA 4TV5A 3K1DA 2OQYA 3M4HA 2HDJA 2TAAA 4BFAA 4OHQA 3II1A 2QV5A 3W37A 1U1JA 3VNDA 3MUY1 1UD6A 3LHVA 3QR0A 1Q6GA 2CW6A 1KBIA 4PMRA 4DB7A 3WQEA 4B2DA 4AZIA 1L2QA 2YVFA 1KFWA 4H4UA 2YDRA 3HGRA 4D72A 4R7OA 1A5LC 1KLYA 5ECVA 2WZEA 2VP8A 1TO3A 3S5SA 3UWWA 4CCZA 4R9XA 1J12A 3GDRA 2HVMA 3LRKA 4GABA 1GOMA 4CEXC 3PZUA 3HGJA 4UTUA 4E4FA 5EMMA 1PEZA 2BNJA 5D9PA 5I2UA 3PB2A 4CD6A 2O7SA 3PG9A 3BQ5A 1Y0EA 3W2JA 2QLYA 2P3ZA 3Q37A 5BRBA 1F3WA 4XAGA 3FJNA 1WX0A 2NQJA 3UZJA 1UKQA 1A49A 1J8VA 3TZFA 5JUVA 4WZHA 3WL0A 1JIBA 4HK6A 3NL5A 1XDLA 4IPIA 3N3TA 4O18A 1UZ1A 3VGFA 3AAMA 4ZB2A 1Q2RA 1XSKA 2JALA 3PY2A 2DJXA 2FTYA 3S1GA 1E9IA 4KH2A 4GA8A 4AMAA 1JAKA 4L4MA 5HJLA 2YFNA 3GHUA 1FWTA 5IRPA 1GOQA 1LLWA 3UR7A 3BG3A 3GNDA 4E5TA 2FZ9A 2G8ZA 1M7PA 2O56A 3SGZA 2PDLA 4KCWA 3W76A 3HW2A 5D9OA 1OHLA 3MMUA 3DI1A 2Y5EA 3B8DA 2J24A 3HG2A 1V4YA 1E5NA 4IP5A 4HHHA 3GZ3A 5BW6A 2X99A 1XQKA 2ODOA 1MXDA 1WKYA 2EQ8A 2VI0A 1MW2A 2X1SA 3OW1A 5XIMA 3I4KA 5HMSA 1A80A 3TN5A 4GO9A 3VYLA 4XB3A 3M07A 3LV5A 1JPIA 2DT2A 3UFYA 5D9MA 2DZXA 2IKIA 4YTRA 3S5YA 5H8MA 3R1ZA 5KMYA 3AQUA 4OWGA 2E5CA 1XGDA 3CV2A 4MG4A 1XCWA 3TTSA 1W91A 4US5D 4FZIA 3NO1A 1S7MA 5BZAA 4PMOA 3LCHA 3CIVA 2ON3A 3DJJA 1RQHA 3AMDA 5CGMA 5I00A 4ZE5A 4I7VA 5H6HA 3AU6A 1MUCA 2WHJA 2J25A 4B3LA 3QEZA 4UOJA 4UNKA 3WJXA 1QDSA 3AXMA 6PTDA 4QDPA 1JYNA 3L4ZA 5JRBA 1QPNA 3WFAA 5AHFA 4J3VA 1HJSA 5D03A 1PB0A 4JIEA 4QX4A 3VE9A 1Q4NX 5C0QA 3KDNA 3XINA 5I3FA 4O1FA 3W84A 3DZ1A 3H6OA 1NM9A 2XINA 5LIWX 3A13A 1GHSA 2ZX9A 4DZ5A 3H7VA 3KWSA 3W7HA 2OEJA 4WKAA 3LQLA 4H6QA 1NP0A 3I10A 1KCZA 1HVXA 6TAAA 1QPKA 3LGGA 2OG9A 4FB7A 3T0TA 4O8AA 1WA3A 2P8BA 2DU2A 4A29A 2YCKX 1ICSA 1TMHA 1FDZA 2PDQA 3SQLA 1DWGM 3CUXA 2FYMA 4YJ5A 3H22A 4J57A 4TOQA 2QULA 3XIMA 3AM9A 1KWGA 1DQWA 4AISA 1KTCA 3HG4A 3TCEA 1Z3NA 1JZ4A 4O11A 2ZA2A 4C6KA 1JPHA 1C8XA 2PZNA 5CZJA 2KAUC 1HKIA 3E2RA 4XZIA 2IW0A 2EQDA 2CKRA 3CLMA 4UFLA 4XZNX 1ADSA 1YTKA 4BV6A 3I7QA 3NNTA 1JYVA 5HULA 2PGFA 3UWQA 3KW3A 3NQGA 3L67A 2F9RA 3CZGA 4O0QA 5FD0A 3W71A 4DJDA 1M41A 1XM3A 3N4FA 1Q6DA 2ZDSA 2XH7A 1KTBA 3U2CA 4Y7EA 4BZYA 5F4WA 3N29A 3GHTA 1MNSA 3MBFA 3BANA 4PMDA 5M5DA 3TVAA 3PHAA 3VILA 1AZ2A 2PBGA 2Z6JA 2OEMA 3CQIA 1LWHA 4S3FA 4ENLA 1Y65A 3U57A 4LVGA 4LCSA 3K4DA 3FA3A 1JRCA 4CD5A 1W2VA 5K3VA 4MAVA 3N9KA 1VAHA 4FLRA 5AZ1A 3T4WA 3W25A 3TROA 3ZMRA 3ATYA 1EGZA 4WDXA 3OB8A 5AKQA 2D22A 2V5KA 4XQ6A 5A6KA 4UFMA 4FXSA 3HPZA 1LT7A 1SU5A 4DWDA 4PR4A 3MKKA 3C56A 3W83A 4ZBCA 2QXWA 4B3KA 3DG3A 4MLJA 3GH7A 3W26A 3OQ8A 4O1AA 2FB2A 1A5OC 3VVGA 1AH3A 4HNOA 1NWTA 3ARUA 3PJWA 3PG6A 3AMZA 1CXFA 2WZHA 1KM3A 4RXFA 3STPA 4GACA 1I60A 3SURA 1S5VA 4N42A 2YB4A 3N11A 3URBA 1I2RA 1P0KA 3B9AA 2A7PA 2GGGA 4QQUA 3NDYA 4UIOA 1DQXA 4OECA 3CQ0A 1KFEA 1H50A 1W3HA 2HTMA 4IUOA 1YDYA 2E6DA 3GTXA 1E9LA 2P3EA 2QUUA 1BYAA 1DJZA 3MP3A 3PC0A 1GPWA 3KLKA 1CGTA 3TCSA 1J0KA 3IJLA 5AYYA 3KAOA 3KOZA 1Y7VA 4FOJA 2AOSA 1RP8A 1RPXA 2OXNA 2XVLA 1HT6A 1FEBA 1PWMA 4OFCA 4KFPA 4QNEA 3RITA 2P0OA 1UWTA 3QYSA 4GIAA 3BLOA 1YMYA 3HN3A 3MPGA 2NW0A 4HTYA 2D73A 4ADSA 3KVLA 4ZENA 3PUEA 2WKJA 4UZUA 1FXPA 4GFIA 3G18A 3WF2A 1JPKA 3VABA 2YYUA 4C6OA 3M0MA 1R46A 1N5XA 4JFWA 3CL7A 1WZMA 3ID7A 3AWOA 4AHQA 1O95A 3E9AA 1EDGA 1FO4A 1BZLA 4Q8UA 1KD0A 3EXTA 1E0TA 3QPZA 4GBDA 2VT0A 2XSXA 1FWEC 2J7EA 4HK7A 1FWRA 1YXYA 1ZUAX 3BW4A 3SY1A 3GR4A 2FVMA 2ICSA 7XIMA 5LNUA 2ACRA 2WLZA 1GKQA 3MW7A 2ZA3A 2X2GA 1AL8A 4R85A 1Y5WA 4FOKA 3WJSA 2PODA 4DO6A 3PF3A 3FJLA 1XLMA 3VNIA 1FCBA 2WSRA 1XIJA 2GJLA 1VFOA 3RUBL 2DT3A 3SECA 2WNWA 1X6UA 3FXGA 2QHAA 3INPA 2FGBA 2CLFA 2BS9A 4H7CA 1E70M 3BSMA 2PD5A 4NYUA 3GD4A 1KV5A 1UPPA 5AHIA 3TN6A 1LOQA 3NL2A 3M0IA 5AC4A 3WQ6A 1PHWA 3NA8A 3TYBA 3VDCA 3GU1A 5LHFA 5C9XA 1RHCA 2X0SA 4HCDA 4W9TA 4GLEA 1E1EA 1B3XA 3UA3A 2DZBA 4JYEA 1NQKA 3UPMA 3N73A 2KZHA 4Z1CA 5A6JA 4NY2A 1TVNA 1LUCB 4CNPA 4WY0A 2ZZ1A 1OYCA 3K8LA 3DG7A 3UY8A 5CSUA 4O8RA 4HJFA 4ORMA 2XH2A 1ZY8A 1ALDA 4NILA 3L9CA 2WVUA 3MUCA 5TBOA 3BARA 1CGVA 5B7YA 1EA9C 3R10A 2QJHA 2FZ8A 5ABTA 3UWZA 1E1FA 3VX0A 1MRAA 4QNWA 4C5YA 1XWYA 4JFTA 1AW5A 4XZHA 3C4UA 4K8EA 3WQ8A 1XDJA 4QAWA 3OGSA 3U7VA 4OE7A 2QPXA 1RD6A 2I56A 4AD2A 4QJ5B 1LQ0A 4O13A 2BGQA 2BHZA 1M7OA 2XVNA 3LLXA 5CBJA 1OC7A 3M43A 4QSHA 3CNYA 4PTVA 3K8KA 4XVDA 3PTQA 2ZZ4A 1DYSA 5G1MA 4LGXA 3AIWA 5A5WA 1EP3A 4BQ3A 2NVKX 4M7TA 4AZGA 3IUDA 1SJCA 2WOVA 1UOZA 1SFJA 2BGNE 1BWLA 1UQYA 4LUIA 4KEMA 2YCJA 2P88A 5XIAA 1VEMA 3MUIA 1SO6A 1VR6A 3GU2A 2GL5A 1CXEA 3IIXA 3SQSA 1I45A 2GGHA 4O12A 1HQTA 4HN4A 2G4FA 4IQEA 3QY8A 3EOEA 1LL4A 4GIRA 3WG6A 3ZQ9A 1EKOA 3R12A 1UWUA 1S39A 5CPTA 2A3CA 4GFSA 1NHQA 5BOOA 1F05A 2JKAA 3R58A 3DC8A 2OYMA 4RZ5A 1O1ZA 4D6EA 2NQLA 3SCNA 1EF2A 1S46A 2E0PA 3EGJA 1B0IA 3KDOA 1MI3A 4ERAA 3EA3A 3EA1A 3JR2A 2ZX6A 3PTDA 5JU6A 4JTIA 4GVGA 1OEPA 1FA2A 4WKFA 3WLIA 3QMSA 4H41A 4WRHA 1ZS2A 1GQIA 4H9ZA 3TSMA 4D71A 5ABFB 2QJNA 4QG6A 3B9JB 3ZJ8A 2GYIA 1FHVA 2Y7FA 1G5AA 5HUPA 3W1QA 4OJYA 4Z1DA 1YKWA 2CZDA 4I9TA 4I9AA 4C1NA 4IICA 4J1OA 1W3KA 3VM7A 4HA0A 1XLHA 3PBWA 1BSIA 2GJPA 2J7GA 2I9EA 3DENA 3U48A 1T40A 1L6SA 4AIOA 2GVEA 4LY4A 4W88A 4MWAD 4EIVA 3CLWA 2QYGA 4ZQMA 2W67A 1UWIA 1OWQA 3RMJA 1RVGA 4CD8A 1EJXC 1KCKA 1P48A 2PI6A 2GSHA 4CU7A 1SPQA 2C13A 4DM2A 2VO5A 1Z89A 2CIPA 3E0VA 3B4UA 3N6JA 3FHAA 7REQB 4O19A 3MWCA 2XFWA 4IPLA 5G4HC 2B0MA 1E51A 1FWBC 4NG3A 1W5QA 4ADUA 4PMJA 3REQA 2ZWZA 4A3YA 1NQ6A 4Z2JA 2E5BA 3T0AA 2PGEA 3W7NA 1BWKA 2A3HA 3U8GA 4APNA 4X0VA 1VIZA 3PAOA 4IMEA 2PDCA 2ZA1A 3O3RA 3QXBA 3SUUA 3RX3A 1PZ3A 3TWAA 3AYTA 4H4RA 3SW6A 1FP9A 1NFGA 1PHQA 4LYQA 1WZLA 5DRIA 1N8FA 4H4ZA 4XKMA 4M0XA 1TPUA 2GUUA 1SW7A 5FF7A 2E6YA 4HU4A 1HO1A 3O6DA 4LV9A 4QSFA 4EANA 4HOXA 2YL6A 4F40A 3WNLA 2NLYA 1HJWA 3BZGA 1GVYA 4J27A 3AFBA 3DGZA 4LAOA 3LHUA 1KNWA 2TODA 4LUSA 3BGJA 9CGTA 2QVNA 3TDFA 1JF6A 3C8NA 7ODCA 3C2RA 4ZE4A 3B04A 3KE0A 1GJWA 1WV2A 4MB4A 1UOKA 2WJDA 1UJQA 2FPVA 3P7YA 1D3HA 3A47A 3LSBA 1KBBA 1BKHA 3PPGA 1QW9A 1V7YA 2XWEA 3NQCA 3SN0A 3TSDA 4AZ5A 1ISXA 3CB3A 4LF2A 1UR0A 3NEHA 4BEUA 2EPLX 2E6AA 3WQWA 1VYRA 2W3RA 1KFJA 3QOKA 3NQVA 2OT0A 5J5DA 5AHMA 3DFTA 3Q45A 1K77A 1DXFA 3LS9A 4AZBA 5CPSA 1F76A 4F0MA 3YPIA 2E8ZA 1TPEA 3VGEA 3W1AA 4WEVX 2ZUVA 3PPHA 1AH0A 3RO8A 3W2MA 1SQ7A 3L0KA 1G1YA 3RNMA 4L9YA 3OYXA 4UTMA 3DYOA 3HQ1A 1C3FA 7A3HA 1A3XA 3KHJA 1LYXA 2NT1A 1XYAA 2C3ZA 4N6EA 4ORIA 1N55A 4PUMA 5H8PA 2ZVRA 4LVDA 4OTKA 4C7FA 1GTHA 3QMRA 3W85A 1UMYA 1OZQA 2OGJA 3M9YA 1E73M 3S46A 4MIMA 3STFA 4RPPA 1NSJA 1P7TA 5FF3A 1VP5A 3V75A 1ME8A 3JW7A 1XIHA 4PMNA 5C2CA 4LCRA 1V3IA 4GPNA 6A3HA 1FHLA 2W54A 1YX1A 3SCVA 1GOOA 1YPFA 3RR1A 4IQJA 4ZR8A 1ZDLA 1QPRA 2ZZ2A 1TZZA 2BASA 3C2YA 2VUYA 1BF2A 3TOYA 3OVGA 1ESWA 3DGHA 3A5FA 4NP7A 1R3SA 1O5KA 4HPHA 1PCKA 1W9PA 3KEHA 1WAWA 3M64A 2WSKA 3S2MA 1UR3M 1H1NA 3W7RA 1UB3A 4NASA 1JUKA 3VNYA 3WNMA 3AZRA 3BAXA 1REQA 1Q6QA 1V5XA 3BQ6A 1CECA 1E4MM 4EF9A 5A2CA 1XC6A 7CGTA 2YXXA 1Q6CA 2GDQA 2GZXA 1XPGA 4GXWA 2OZ3A 4U2YA 3QGAC 4IG2A 3WELA 3ITXA 4C6BA 2WOWA 1MMFA 1YDVA 3B8TA 3BCDA 3BMVA 3GRIA 4CEUC 1LOLA 4I6VA 1ZBWA 1I0DA 1F3PA 1QO2A 4W85A 4NIRA 3I3BA 3CZLA 1TPVA 2FH8A 4W89A 4MNJA 3R07C 6TIMA 3UU0A 2QZRA 1EFZA 1IEVA 1A5BA 5JCMA 3F1QA 5EFFA 3I4EA 3OODA 1OJTA 4IG2B 1QHOA 1JRBA 1A5CA 5CC6A 2IKJA 5DCBA 1XH2A 8TIMA 7PTDA 3GUGA 1TCMA 3KCJA 1XBZA 3M0LA 2PP0A 1A4LA 4FNQA 2Q3RA 4PODA 1AD1A 4C6JA 4P8VA 5BU9A 4F2TA 4U5IA 2ATSA 4RR4A 2QQ6A 3RU8X 1JQVA 1K4HA 1JCXA 4PUKA 3F2DA 4KWUA 4CD7A 3ZIZA 4MYXA 3AO0A 3OGRA 2PTDA 2C14A 4NNCA 1QAPA 3GU9A 3W23A 2EPKX 4NNBA 4GYKA 3G1VA 2ACQA 3PJUA 4HMDA 3IK4A 1I2PA 4KCUA 1V08A 4NJJA 1BXBA 1JDCA 2QCHA 3UP8A 2DVUA 2WMHA 4EOUA 5FS6A 3ANVA 4QR6A 4E6MA 1XLBA 4N9DA 3MZ2A 3Q4DA 4LNYA 5CC7A 5EBAA 4FNTA 4FX8A 4JIRA 3TEVA 4Z1AA 1XX1A 2XGBA 3MV11 4CNSA 5D09A 4PULA 4AD5A 4RX0A 1P4CA 2D20A 1Q1WA 1XHGA 3TYDA 5BWFA 3V36A 2GPTA 3NGFA 2Y7DA 2EG7A 1G67A 3UNTA 3V0UA 1K9TA 3HB9A 1V6YA 4AEEA 3MI3A 4LVBA 4REQB 3TAKA 3RLGA 1ZENA 2P10A 3B06A 2J62A 1KRBC 4KERA 5BXSA 1TUFA 3RX2A 3QF0A 3H2FA 5A6BA 4B5XA 1TQXA 4DZHA 1XIMA 2ZXAA 2YLAA 2PAJA 1VZWA 1PUDA 3TYAA 2G3NA 1GVIA 3IUIA 2DZWA 4U2ZA 5LNVA 5KSWA 1F07A 4DWSA 3L65A 2WW5A 2J66A 4V27A 5XINA 3ARSA 1VGAA 5AC7A 4W8LA 1E56A 3PZ9A 3TW7A 4LS0A 4HZ8A 2CESA 1ONXA 1UR1A 1H11A 1FX6A 2DT0A 3AOFA 1ME7A 1LDCA 3W1UA 5IHRA 1G01A 4ZSUA 1J0IA 3HFTA 3T8QA 1K6AA 4JDRA 2WSYA 3VIJA 1RPKA 2Y63A 3UZYA 3T0BA 3BAJA 1DTUA 3A3XA 4RV8A 4HD5A 1OC6A 1ZAJA 1QBAA 5I3JA 3H23A 1DJQA 4BK9A 3ZJ6A 4IFKA 4DUXA 2XIMA 1XV8A 5D4YA 3PP7A 3T2PA 2VX4A 4LBSA 2NVCA 5I5RA 1DWAM 4IP4A 3B8IA 4AAJA 1ISYA 1MW0A 3KZPA 4Y96A 3GHRA 1H7RA 3AHZA 1EHNA 2GVGA 4DBEA 5D2WA 4JQ4A 1H60A 1V02E 3OLIA 1QK2A 4ZB0A 3VIKA 1PE1A 3VKCA 2YSWA 3FX4A 3WK1A 5F2IA 2VZVA 3O15A 2ZX5A 5CC3A 2AQOA 3DBPA 4I5XA 3AYSA 3KTCA 3KX6A 3L12A 4KWWA 2WHLA 1LJYA 3SRHA 4ZXOA 1UKSA 8A3HA 4AMCA 4WOQA 3VGBA 5AYBA 4GZJA 5LIUX 1P0NA 1GG0A 2XM1A 5EMYA 4YL2A 2YW3A 1FFRA 4UMAA 4QTGA 1T8XA 4JR5A 1UROA 2JE8A 3H8AA 2VGGA 2C91A 1E4IA 2A3BA 2P8CA 1EXBA 2E09A 4WXYA 4D8AA 3BO9A 3CL6A 1PTGA 1M68A 3LCGA 3QPYA 1Z7AA 4NZ5A 2HBXA 1O6IA 3UF9A 1GOXA 1UWRA 2OOFA 3NQ2A 3WDQA 3CHCA 4LYKA 3PPCA 1ISZA 4K8HA 3EDKA 3O06A 2R1PA 4W5ZA 3TTYA 3M0ZA 1QOXA 3UVAA 1WPCA 2Y88A 3R79A 3BICA 4CNNA 1AH4A 3BW3A 1LL6A 4M82A 5LXEA 4Q6XA 3ZLFA 3DOPA 2ADAA 3H26A 5FS9A 1R2RA 3BTNA 2DVTA 1MUWA 3W1LA 2BODX 1NAL1 3G8RA 3WIJA 4K7YA 3ZYZA 5A8MA 3SIZA 3EB2A 3GVWA 4H4WA 3FA5A 3HGSA 1PTAA 2ACSA 3DN5A 4R3UA 1N62C 2EO7A 3ALGA 2HROA 4NX5A 3GNXA 5CH9A 1Z9AA 3TJXA 1A5MC 2B7QA 4HP5A 3LCLA 2HK1A 3ELFA 3LI1A 2A7NA 4WGXA 1KKRA 3QM3A 1POJA 1TIMA 4Q33A 3TW6A 3M6YA 6REQA 7REQA 2L5HA 4EAYA 2G96A 3HBLA 4V1YA 4WQ6A 2J7DA 4DF0A 4I5UA 3WBYA 2G97A 3Q6JA 4M1BA 3DHPA 3M46A 2VD8A 2R9ZA 1VQTA 4QCEA 1IT7A 3OA5A 1VYSX 4BWLC 3RM9A 1D7YA 4Q7NA 2VFGA 4WSJA 4H19A 2WP6A 4FSAA 1AJ2A 4HA1A 1SZRA 2GH5A 3EDFA 4P61A 4C91A 3B05A 3A21A 5DO8A 3S5OA 3QY6A 3PFMA 4WGHA 5DX7A 3KVKA 2VZOA 5AECA 4ZB5A 4MWAC 4DNAA 4IPNB 4F0RA 2IPFA 2HMCA 2CLMA 1P0DA 1AZ1A 2DY3A 3NIYA 3S5NA 3NCOA 1W5NA 2VEFA 2D0HA 4GZIA 3OGVA 3GS6A 1KA9F 4NX0A 2W0HA 1BGGA 1V3LA 4D6GA 3E49A 5E6ZA 4XG1A 1UUMA 1XFCA 4MVAA 2PDYA 4Y9OA 3WLSA 4DO4A 1JD7A 3EZ4A 5KZMA 1XRTA 3LXBA 4NI8A 4KIEA 3OLEA 2ZWYA 1EIBA 2GK1B 1QXLA 1FTXA 3DHFA 1E9ZB 2B31A 2XN2A 1FIQB 1CXIA 3RRAA 2OWWA 3DESA 4QAIA 4H9UA 4EPBC 4ZO8A 2NX1A 2WVVA 4M5PA 5L6UA 4XTDA 4NRSA 2CZVA 3F2BA 1YNQA 4WKHA 4PTDA 4PMUA 1LZOA 2PD9A 1UC5A 3W73A 3EKGA 1KC7A 4ZSTA 2WJEA 1P0EA 4JXCA 5F2GA 3HJZA 4ZCWA 1G6CA 4QGCA 4DYJA 3EAUA 4AY8A 4JYFA 1A3WA 2XH4A 2GOKA 1DJWA 2OLSA 1W1YA 4UCGA 1XG4A 4UTTA 1UP2A 3DUGA 2BOEX 3UCDA 5J5RA 4HPJA 1EXPA 1Z32X 5GJPA 1OVDA 3LERA 1CXLA 4LB4A 1IXOA 3RHGA 4H3DA 1W37A 3M5ZA 4ONVA 4AXNA 3TFCA 4F4RA 1E0UA 3USBA 2DH2A 5A8NA 4TX6A 1DWHM 2QCCA 5DMMA 1F4AA 3GY1A 3ABSA 1XPYA 4F0LA 5HMDA 3DERA 5JMUA 3LHYA 1NELA 3SGUA 1IV8A 3EF6A</