3JW7A

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ile-l-tyr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 117
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jw7A01
2OZTA 2OZ3A 3I6TA 4HNLA 4ROPA 3DG6A 1WUFA 1SJCA 3FVDA 2GGJA 2DW7A 3RR1A 2AL2B 3TCSA 2HZGA 1MDLA 3IJIA 4K2SA 4GMEA 5FJOA 4ZA0A 1DTNA 3TWAA 4IL2A 2PTZA 3CXOA 1WUEA 2PPGA 3R0UA 1XPYA 3VA8A 3FXGA 3ZLFA 2GSHA 3PFRA 1KKRA 2RDXA 5BOEA 2FKPA 4IP5A 2PU0A 4K1WA 4MMWA 1PDYA 4ENLA 4G8TA 3TWBA 4MKSA 1YEYA 1JCTA 3KUMA 3R25A 4E6MA 1KCZA 4E8GA 2PSNA 1JPMA 5ENLA 3R10A 1MRAA 3R11A 2QJJA 3CAWA 3DG3A 3FYYA 5BOFA 3FV9A 2OPJA 3GD6A 2OO6A 1ONEA 2GGEA 4A35A 3QPEA 1FHVA 4HCLA 5IDZA 2GGIA 3K1GA 4KWSA 3DG7A 2AKMA 2QQ6A 3DGBA 3H8AA 3OPSA 2OLAA 3ES7A 1BKHA 2P0IA 3P0WA 3D46A 1MDRA 3MKCA 3U4FA 3H12A 2XH4A 2PP3A 3QKEA 4E4FA 3UJEA 2XH0A 2XSXA 1SJBA 2QJNA 3N6HA 4HPNA 1EC7A 3DESA 3V5CA 4DHGA 3ZVIA 3CB3A 3STPA 3H7VA 4ZCWA 4Z17A 1SJAA 3P93A 3SSZA 5EU9A 3N4FA 4KPLA 1EBHA 1XS2A 3MSYA 1JPDX 2PU1A 3DERA 1R0MA 3TOYA 2QDEA 2AL2A 3RO6A 3NZGA 2XH7A 1EC9A 3UXLA 2PTXA 3N6JA 3TJ4A 4M6UA 3CK5A 4DWDA 4KEMA 3BSMA 1TE6A 4JN7A 3ENLA 3OZYA 2P88A 2PGEA 3OW1A 3Q4DA 3MUCA 3T9PA 2O56A 4JN8A 3TJIA 3CYJA 4H2HA 3PK7A 4A3RA 2OQYA 2QVHA 4DX3A 2OFJA 2NQLA 3VFCA 3OTRA 5FJUA 3SN4A 3UJ2A 2PCEA 3S47A 3NFUA 3T6CA 4HN8A 3B97A 3JVAA 1TKKA 1KKOA 1NU5A 4E4UA 3GO2A 3IK4A 3IJLA 3EEZA 1RVKA 1W6TA 2OG9A 4IT1A 3ZLGA 3VDGA 3MZNA 3T8QA 1ECQA 3SN0A 1P43A 4H83A 3S5SA 4GGBA 3DDMA 3QN3A 2OKTA 2HNEA 1P48A 3VCNA 1F9CA 4G7FA 3QLDA 3TTEA 2PTWA 1OEPA 1SJDA 2P3ZA 3NXLA 3RGTA 3V4BA 4IL0A 3T4WA 3FJ4A 2HXUA 3JZUA 1PDZA 3R0KA 4E5TA 3DFHA 1EC8A 4HYRA 4HCDA 3UGVA 4JHMA 3UJSA 2PODA 4EWJA 4GYPA 1IYXA 4YWSA 4DN1A 2AL1A 4GIRA 1BQGA 1R6WA 3MQTA 4KT2A 1NELA 3JW7A 3OP2A 3UCDA 1JDFA 2PTYA 1KD0A 2OVLA 3UXKA 3ZLHA 3GY1A 3IJQA 2QGYA 2PMQA 3ZVHB 2PP1A 3BJSA 3V5FA 3I6EA 4A6GA 4Z1YA 3TW9A 2DW6A 4IHCA 3PWGA 3HPFA 5FJRA 3R1ZA 3RCYA 4F4RA 2ZC8A 2ONEA 3RRAA 6ENLA 3SJNA 2OX4A 4K8GA 4DYEA 3SQSA 2MUCA 1FHUA 2PP0A 4DXKA 3MWCA 7ENLA 3NO1A 3P3BA 1E9IA 3DFYA 2XH2A 3U9IA 3PWIA 4HNCA 2P8CA 3OZMA 3I4KA 4MGGA 3VC6A 1MNSA 2QDDA 3D47A 2OZ8A 5FJPA 2PA6A 3N4EA 3DIPA 4IP4A 4H1ZA 3QTPA 3V3WA 4GGHA 4FI4A 3H70A 3RITA 3BOXA 1MUCA 4J1OA 4GYPC 2OQHA 3UCCA 3MY9A 3SBFA 3TQPA 2MNRA 2ZADA 2AKZA 2XGZA 3UJFA 5J04A 1L8PA 2GDQA 4J3ZA 2HXTA 1ELSA 2PS2A 3VC5A 3FCPA 2I5QA 4M0XA 5FJTA 2GL5A 1TZZA 4GISA 2FYMA 3DEQA 3VCCA 4HCHA 2GGGA 4GFIA 3SN1A 3GC2A 4X2PA 2QJMA 3CT2A 4H19A 2P8BA 3ES8A 2CHRA 4IZGA 2POZA 3Q45A 3THUA 4FP1A 3ZVHA 2PGWA 2GGHA 3UJRA 1EBGA 3EKGA
chains in the Genus database with same CATH superfamily
5CKSA 1Y5VA 1GJUA 3GYEA 4PUUA 3NSNA 1MQRA 3HW2A 4G1KA 3VD5A 1M1BA 5BXTA 1CYGA 3PBVA 1FWSA 1P1MA 3CV2A 5G2WA 2EQDA 1XRFA 2GVEA 1ZAHA 3VCRA 4P8UA 1TR9A 3IJIA 4FR1A 5A6KA 1PSCA 3MBDA 4DO5A 3ISIX 5I78A 2J7FA 1T0OA 4W4QA 3CB8A 3M7WA 5C70A 4WF7A 2GUYA 1LROA 4B9YA 1PKYA 4ZQCA 2UY5A 2QULA 4GIAA 2RDXA 3D3FA 4K7ZA 1CEOA 3PJUA 1BYDA 5AZ0A 1JCNA 3QV9A 4ICNA 2YZ5A 3OVQA 5DLCA 3GIPA 1AMYA 4PUEA 4WOQA 1FFQA 2EXOA 2RJGA 4Y9AA 4HK6A 1MXSA 2E4TA 3AS2A 4CN1A 4GLEA 1XHCA 5F7UA 2OLSA 5IXEA 4GIEA 2CCRA 4GINA 3O6YX 4QE4A 5BOFA 1QHZA 2CERA 4F3HA 3M07A 3GD6A 4GO8A 1ZX9A 4N9DA 1ONEA 2WLZA 3WFAA 1EOMA 4DZ5A 2UY3A 3GU2A 4JFVA 3H23A 3QPEA 3HMCA 2VOMA 1UKQA 2BBFA 5A69A 1X97A 4JQAA 1XIEA 3HPZA 4IIGA 2E3TA 5FF2A 3NURA 4DEFA 1OFAA 2VT0A 3P0WA 2HPMA 2PZ0A 1F7BA 1NAL1 4M8UA 1VYSX 3H12A 3FVMA 1OX4B 4PB4A 4E3VA 2GK1A 1XPGA 2X8GA 4BY3A 3U7VA 4A3YA 1GVOA 2GQ3A 4C6BA 5C55A 3LCHA 4ECLA 2C16A 2HVMA 1YW1A 4MHBA 4Z2HA 1Q6CA 1TO3A 4N42A 2A3EA 2GFTA 2V5BA 3NSMA 4DJEA 2C79A 5EMJA 2Z27A 1XKJA 1SJAA 4Z17A 1R8LA 3WBWA 4QGCA 1RVGA 1W31A 2QCFA 3AS3A 2P53A 2NT1A 4C60A 1U1JA 3QY6A 3SRKA 1PZ0A 5EFDA 2X09A 5GPRA 2P0OA 3G6LA 5C71A 1NWUA 4ZQRA 3R7MA 2IMRA 3N2CA 2CLEA 3SI9A 3BSMA 3C2OA 5FEXA 3QVQA 3CMFA 1K9DA 4L9XA 3U2EA 2ZXQA 5A8NA 3QEZA 1RCXB 4H2HA 3B8WA 4H4ZA 2I5GA 3RLHA 4IIHA 3LU2A 2DZUA 3WUFA 3DH7A 4W7UA 3GDLA 1F05A 3P67A 5D2VA 3H6OA 2WOWA 5I02A 4RCXA 3KFTA 1LG1A 5KZMA 3ZQ9A 4N6EA 2VNCA 1GOOA 2HMCA 3VI2A 3IJLA 5HQLA 1NP2A 4W7VA 2ICSA 3ZMRA 3ATYA 1ZP3A 3LXBA 3DN5A 1Q6GA 3CAKA 3EOLA 3Q94A 3L23A 3W2KA 3BV4A 3T7VA 3W87A 3HGOA 3QN3A 1ZMCA 4LRSA 2BVWA 3TTEA 3AYTA 4DXXA 1KLZA 1OEPA 1YXCA 3KHDA 4ML4A 2WANA 2Y61A 5I0DA 1S5MA 3MMUA 4OFCA 4NX5A 1RJRA 1ZJBA 4HHPA 4US6A 4BF7A 2HROA 5J5DA 3WQVA 3FJ4A 4B3ZA 5U1OA 1CNVA 1OFRA 1KWKA 2C14A 4F0SA 1FDZA 1VLIA 4HYRA 3FIGA 2ISDA 5T9CE 3U48A 5M2FX 1CT5A 2E6FA 4GIRA 5A2CA 4EACA 3S3GA 5G1TA 4FK9A 5HR7A 1G67A 4J2PA 1XV8A 3UCDA 4Y9OA 1KD0A 1F3XA 4FEZA 3GY1A 4MVAA 1OT2A 3XIMA 5BWFA 1WDDA 1UJQA 1GRFA 4Z1YA 1LLWA 4UZUA 5CXPA 4I6VA 3CUZA 5A95A 4PODA 1AL7A 3VDCA 4ZTYA 1RCOB 1G0CA 5HWNA 1BXCA 5L6UA 2ZC8A 4XD4A 3H22A 1GEQA 4JICA 3W07A 4EF8A 3EXSA 3IACA 3LPFA 2EPNA 2MUCA 1NOUA 3L7RA 5JU6A 2CLKA 3L4VA 3WD2A 4R53A 4WDWA 2XH2A 4PUWA 3WY1A 1MEWA 3AHYA 4GQGA 4U2YA 1DJZA 3CYVA 5HJYA 3EPNA 4O28A 1JNDA 4GFSA 4K6AA 1A4LA 5G4EA 1KXTA 4YU1A 3NM3A 2HDJA 4HU4A 4ZSTA 4PRWA 3WEMA 2VFDA 5EMUA 1DP0A 1JCMP 4JNZA 1MUCA 1DJIA 4CVUA 2VWSA 3W70A 1RZMA 4GG9A 2DEPA 1VIWA 1FY6A 2GJRA 2XVNA 3V35A 4AU0A 1DWHM 2MNRA 4QIUA 4KWVA 4UTHA 1JYNA 4IFRA 3A22A 3WLMA 1CGYA 4JYEA 2QV5A 4GQBA 1GYMA 1PS9A 3RXZA 2RGMA 3M47A 4L61A 2DT3A 3B8DA 3S9YA 2DT0A 3N29A 4RL3A 2WVTA 4TTGA 3PZTA 3T42A 3KOWA 2WOIA 3STCA 4LEFA 2XFWA 3VGEA 3QV7A 3TV8A 3SN1A 1HQTA 2BWGA 4IJRA 2ZA1A 4QG8A 4HQVA 3WK3A 3LBOA 5I00A 2E5AA 1NH6A 3FKRA 3WDRA 2CHRA 3MANA 3OLEA 1AUSL 2IPJA 4TXEA 2CKRA 4XZBA 1NDWA 3CQJA 3TU9A 3WJSA 1B90A 2PGWA 3AISA 3EPMA 5HJXA 1IWBA 1UBPC 1U1UA 2AMXA 3OODA 4GQ0A 4JEJA 3G1XA 3VNMA 1W8GA 5CH9A 1VFOA 2FMNA 4GE8A 2A7PA 2JBMA 3RDKA 3U2ZA 2FVLA 3C5QA 4UBPC 4F40A 4R5EA 2E3ZA 3HN3A 4AD3A 1XLAA 3TTSA 3DK8A 1OT1A 3GE7A 2C15A 3S2NA 4F0KA 3O05A 3SEPA 2XN2A 1DE6A 3PTQA 2FHFA 3CH0A 4WRHA 1G4EA 5DRIA 4M51A 1RLCL 1V59A 1V02E 3C2RA 1LUCA 4IP5A 1VHNA 3LLFA 4L1GA 4UR8A 3S1GA 1EEPA 1D2KA 3IANA 4G8TA 1DIKA 3K4DA 3TTOA 4C1KA 5FCZA 4IQJA 2HK1A 3FW6A 4GJJA 4GWEA 3USZA 5CG0A 4ZZ9A 2X1TA 2H9AB 2IS7A 3LEPA 3CAWA 3M0MA 4LWWA 2J6XA 4FNUA 1VFMA 1ZAJA 2VL4A 1MZRA 2JGQA 3Q58A 3GG7A 4JDYA 1YNPA 2A1YA 2B4GA 2PDMA 2NV9A 5DMNA 1B54A 3L4UA 2DGAA 3THCA 3M5YA 2G37A 3W7MA 4CVWA 1XLIA 3VPLA 1MWOA 1UWUA 3G1VA 4JX6A 3TOPA 3M0JA 4WX2A 4F9JA 1O1HA 3UNTA 2J27A 3R12A 2XZ7A 2P3EA 3QV8A 3VE7A 3NPVA 1EC7A 4PULA 3S6OA 3R2GA 1ONXA 4DBUA 1ME8A 1H1NA 3GK0A 1SM9A 4LALA 1EP1A 2FLIA 3ZVIA 2E9BA 2ZUNA 3PN8A 6A3HA 5HULA 1IZCA 2G3FA 1OCNA 4L9YA 4KPLA 4P7RA 3ONBA 4ZGYA 1RP8A 4XV0A 3LM7A 1C9WA 2REQB 3WF0A 2VHLA 5JMUA 5LNRA 3O16A 3ARYA 3VZYA 3RO8A 2JF6A 1UR4A 3T0TA 4FDCB 1ONFA 2QIIA 2GSEA 3ITLA 2PDWA 3OBAA 3FSTA 1EUAA 1KGXA 3NDOA 1DWGM 2RJHA 4LBSA 4D9PA 4FOUA 2WP6A 1WZKA 2CZ5A 3RU8X 2A7RA 1ZGDA 5GQBA 1LOQA 4QRNA 2FDSA 2WPGA 5U7SA 5HWMA 1O5XA 3BH4A 2XIIA 4CNUA 4DLMA 4KCUA 3HBLA 3VFCA 5CPQA 5HNNA 2EPMX 1UPMB 3RFAA 3L0KA 4QDMA 3PANA 1FFRA 2V5JA 3NXFA 4R7WA 3C0QA 3U2CA 2X0YA 1IXOA 4IPNB 2JK2A 4OECA 5BOOA 4I9JA 1K03A 2VI0A 3SB0A 1SZGA 4Q22A 1VYPX 2G50A 5CPTA 4Q4OA 1CXKA 4N9BA 4DJFA 1JJKA 1K9TA 2ZZ3A 4FS9A 3IJ9A 2CLHA 1EL3A 2W9MA 3T0CA 1ODUA 2C91A 1XXXA 1VBGA 3L2MA 1M7XA 3AXKA 2BGQA 1AH3A 3LPOA 1KWGA 1E1CB 3K46A 3FX4A 3LN3A 3O3RA 4HPHA 2P1FA 4LF1A 3V4BA 2CESA 3T4WA 3UG3A 1JD9A 4C6MA 3BSGA 1NFGA 4DBEA 3QPZA 5LNWA 2BOFX 1IT0A 1G4SA 2YCEA 3EDFA 4S3DA 4G1NA 3W7QA 3B0XA 1GOQA 3MYOA 4REQB 4ERGA 4GYPA 1IYXA 3FG2P 1P6CA 4IF2A 2YPIA 1WZLA 5F4WA 4U3CA 9XIAA 3MQTA 2XM2A 4LTSA 3E0WA 3CU2A 2X40A 1WO2A 1IXPA 3MSRA 4CEXC 2EPHA 4S3FA 3FA3A 3LY0A 1AVAA 4ATLA 3IJQA 3CGBA 1XYBA 1QK2A 3WMBA 1G7UA 4B5UA 3PPHA 1E6SM 3ZO9A 3PY2A 1GEUA 3M0IA 4D8ZA 4C1NA 1V6WA 2YCKX 3RRAA 3BURA 1N63C 2VFEA 1OGBA 1CIUA 1VC4A 5HANA 1EA0A 1EX1A 2POTA 4NUWA 3UESA 4UFKA 3M7SA 5H2ZA 4H4XA 3RLUA 4B5TA 4DQWA 3LOTA 3DENA 1HIZA 5CAKA 2ASHA 1AJZA 3D47A 2BHUA 3F4NA 5A6TC 2PA6A 5DMYA 1SR9A 3ZJ8A 2VCAA 1J2BA 4FI4A 5CSSA 4ZL1A 2V5CA 3EDJA 3HJEA 1BPLB 1TJ2A 4EX4A 3P61A 5AHFA 2V2CA 1VCVA 1E71M 1WXZA 3VNZA 3M5ZA 4DBSA 5I77A 2J7DA 1YX1A 2R6OA 3DGHA 4P8VA 3N18A 3MY9A 3HGRA 4AY8A 1DIEA 3UPBA 4B5XA 5E93A 1ICQA 5CPSA 1Q13A 4Q8WA 1HJUA 1Q66A 4EPEC 4W87A 2WCGA 1DXEA 1S2UA 3S2LA 3WYZA 1ZFJA 3PB2A 3N2TA 3H2AA 5F2MA 4AZ6A 1YYAA 4N4QA 4F0LA 2JKEA 2PF0A 1K77A 1MEHA 5D9OA 4TVCA 4MG4A 5F2LA 1T7LA 2FYMA 3KOFA 2OQLA 1ZCCA 3DEQA 1DPMA 1VF8A 1BYAA 3TMLA 2QS8A 4TR9A 3LCFA 4O19A 5FMHA 1FRBA 5G1MA 1FHDA 1UROA 5MHBA 4NRSA 4EPBC 4RV3A 3PHAA 1A0DA 3ITOA 1WQ5A 3CGDA 1Q8AA 1W3LA 1Y7VA 3KP0A 4LS1A 4FP1A 4CU8A 2BLEA 4LANA 4IFKB 1UASA 3T40A 5G2IA 3NQEA 3SECA 2QEZA 1SW0A 1H7WA 4B3KA 1DEDA 3GNXA 2J9YA 5D05A 3GXPA 4YXGA 3VIPA 2VXNA 2GDVA 1GETA 1XLGA 1XKYA 4C91A 4AIEA 1AQHA 1PHQA 2BTMA 1PCKA 1V6VA 3GC5A 5M03A 1XD0A 1J93A 1BGAA 4HNTA 4BEUA 1EJUC 1IIHA 4LYPA 1QPKA 2X8RA 3RRXA 2NUXA 3CWOX 1SFJA 1PDYA 4HHHA 3KS6A 3G77A 1RBOB 3TNBA 1NDYA 2HV5A 1J6PA 1OBAA 2BV9A 1W1IE 2ZRXA 3AMLA 2CFYA 3R25A 1TTQA 1TPUA 1FP8A 3PUOA 2PDNA 3R6IA 6ALDA 4UOJA 3KX6A 1B3ZA 3VIKA 4Y9NA 2C7FA 3Q37A 1YDVA 2VZTA 1FWIC 3PUGA 4FX6M 4JYDA 3INPA 1WZMA 5DCBA 3DXIA 2VD8A 2QYGA 2Z2AA 2NV2A 3EX3A 3LNMA 1XDIA 1CBGA 1EPXA 4Y2WA 5C9ZA 1J0IA 4LNCA 1J11A 1XLBA 2W0HA 3W7IA 4XG1A 4ONVA 3B9EA 2DORA 2C71A 1VCFA 4DUXA 1JD7A 3K8LA 4B4FA 4J57A 1GPFA 2Y7FA 2OX1A 5CQ1A 1QW9A 2XIBA 3MT1A 2Y8UA 1PEZA 4HOXA 3F7JA 5CBIA 2VZSA 2OB3A 2GUBA 4JKKA 4XD6A 4PCPA 3URHA 1OY0A 3M1ZA 4IQLA 3SCPA 4KIEA 5MF5A 3H7VA 1UH3A 2YVFA 5I3IA 2NLIA 5EBAA 1PTDA 1DKWA 4KEZA 3SSZA 1Z3NA 1TX0A 3N4FA 3BXWA 3HB9A 4KWWA 1AJ2A 3C6CA 3N73A 3MYPA 2IQ0A 4MWAE 4M80A 3MSYA 3DERA 3UW6A 3IC9A 4L1WA 3VNDA 3W7KA 2AL2A 5HINA 1WAWA 3TC7A 1K7FA 1P7TA 4O17A 1OABA 1FECA 4UOQA 3COTA 2PWGA 1HL8A 4WKAA 1OCBA 5D03A 4QCEA 3TQ0A 1LRNA 4A22A 2WOQA 4BQ3A 3PVFA 2Y1HA 3TTQA 3TXZA 1XIJA 2AAAA 3WQEA 3MBFA 3VTRA 4TVDA 3MU7A 2YOCA 2Y7DA 2QUTA 3VMOA 3PZGA 4DLFA 1JG9A 5EA9A 3DBNA 3CL8A 1Z6KA 1KGUA 4NJIA 1A80A 1TJ1A 4W5UA 4CEUC 1RVKA 2WNNA 4K8EA 3DFQA 1U33A 4Y8EA 4FX9A 3C61A 3BDKA 1QATA 4PMVA 2HISA 3NL5A 1WDQA 4GYKA 2O7SA 3DJGX 2OKTA 1RSCA 3B4UA 1C7SA 4MIMA 4MB1A 1FO4A 3TYBA 1F4HA 2VQUA 3WMCA 3OLGA 4GPNA 3N34A 4O11A 1X8CA 2OOFA 1NJJA 3SADA 4O52A 4J3TA 1PB0A 1V03A 2PODA 2Y4SA 1JI1A 4JIPA 3RJYA 4LB4A 3FHAA 4NXSA 1S39A 3A4JA 1OYBA 2WJZA 1EDQA 3JRKA 2YXXA 5A6JA 1ONWA 2G4FA 3EPOA 3CL6A 5C6MA 2DVUA 2QGYA 2QXWA 3ZFHA 4ZOHB 4EQRA 1V3MA 2QKFA 1RBLA 2YFNA 5FJRA 1OFOA 1OWQA 1RALA 5GJPA 4AEOA 1JEZA 5DT7A 2V5KA 3SUVA 2X99A 4MFEA 5CC6A 3W1XA 5TQLA 3EWUA 3WN6A 4AZCB 1EIXA 4JTCA 1K6AA 5D9NA 4AD2A 3IIXA 4JTJA 1LM1A 2WSRA 2O4MA 2DSVA 3KLJA 5TR3A 3DI0A 4BURA 2PUZA 4EQWA 1A5CA 4ATDA 4ASTA 3DK9A 4NAEA 4H1ZA 4AD1A 3W73A 2J78A 4NIRA 2OWXA 3NOEA 4UUIA 1WOBA 1R30A 3UQNA 4FNPA 5FA5A 5C2CA 3QR1A 2OQHA 4H4RA 2Y2WA 2V3DA 3GDMA 1DV7A 2Q8XA 3MV01 1J8VA 3VD4A 2JIWA 2ZIDA 2FTWA 3UEQA 4EM3A 3LRLA 2E6AA 2B31A 5LNSA 1TIMA 4NZ5A 2NXGA 1L8PA 4H6EA 4KS0A 2PS2A 3AHXA 2I14A 1QVBA 4OVXA 3W00A 1HG3A 4WKHA 4IPLA 1VEMA 1C8QA 5KTLA 4WY0F 2JK6A 4APNA 4UTMA 5CGQA 4D6FA 3RPDA 3FJ6A 1F8IA 4CNOA 1FH9A 1QBBA 1J12A 1TX2A 4J2MA 1NDAA 4BHYA 1UKTA 1Y0EA 2I17A 3ALGA 1WCGA 3E3HA 3M0XA 2FGBA 1RUSA 3LSCA 3ANUA 2IKGA 3GG8A 2D2OA 3ECQA 3TW6A 2WVVB 1LBMA 3VAVA 1P0DA 2OO0A 4L56A 1E4MM 3N9SA 3DG6A 4R7JA 1KBIA 1Z9AA 1SFSA 2XFYA 3E12A 3GD3A 3FXYA 5AHIA 4H4WA 3HV8A 3AIRA 1C91A 4K2SA 3TX9A 3BAJA 5MKGA 1UIOA 4BA0A 2PDKA 2TODA 2PTZA 2R8WA 1CGUA 1WUEA 3L9CA 1TV2A 4KERA 1UR3M 2Z1SA 1TZ9A 4AC7C 4FB7A 1U5HA 1NHPA 2DVXA 1SGJA 3VGBA 1GK8A 4I5RA 1NDVA 4Z2GA 1FCQA 4DELA 1IT8A 4UTWC 2ZUUA 2XJ7A 4H9MA 4MNKA 4XSLA 1X1OA 2EQ9A 2HVNA 5BNKA 4D6CA 4YTQA 3NVWB 2Z7GA 4MUZA 3PFMA 3GG1A 3R10A 1MMFA 3U3HA 3HQOA 4BQ2A 3GNNA 5I24A 4HSOA 3D5HA 4QSFA 1ZHAA 1FOBA 3R58A 4MOZA 1WDPA 4UTTA 3AYVA 1UUOA 3H4GA 1XQKA 2BS9A 4W8AA 1SZRA 1UZHA 2TAAA 4UXDA 1HKMA 1KFKA 4QQUA 4YCOA 3GXFA 3JUGA 4LBRA 2QZRA 4E2OA 2ZX8A 2YW3A 4XISA 3H4KA 3D46A 1V7AA 3W28A 4ZENA 1XLDA 3GXIA 1GXFA 2WO5A 1X39A 2Z6JA 2DZXA 3TZFA 1Z41A 4AQLA 4O8RA 4NI8A 4S38A 4FX8A 4Q7BA 2O9TA 1O94A 4JIEA 2XSAA 2ZXBA 2V9DA 3MVIA 1VJZA 1IHIA 3V5CA 3W1AA 1M53A 1Q6RA 4GC3A 1MI3A 2NQHA 2VQTA 1V6UA 1NF0A 1K02A 1Q6QA 3P93A 5K2ZA 3QW3A 1T8XA 1Q7QA 4N02A 3WJXA 3OB8A 3N12A 3CQIA 1JPDX 4DYKA 3RILA 2Q8LA 1IZJA 3NL2A 4PRTA 1HKJA 4WVXA 1OGGA 1UMYA 3WLNA 3G2GA 5BMWA 3C2EA 2PTXA 3TQKA 2NPXA 1VR6A 4DWDA 2J9XA 1VLWA 3H53A 4M7SA 3TKFA 4DJFC 1XLLA 4KFPA 1SSGA 4RZ4A 1TYTA 3VZZA 3B3DA 3QYQA 3UY7A 2JF7A 1GUVA 1VAHA 3M5VA 2R82A 4GJIA 4GCAA 1YADA 3AMDA 3BLDA 3BG3A 1YBQB 2DVTA 3KRUA 1XIIA 2D2HA 2WMKA 4NT0A 4RDYA 1ICPA 1KKOA 4ZVJA 1NU5A 4ZB2A 4IGHA 2X7WA 1W2VA 3QHOA 4AXKA 2EG7A 1E55A 3F4DA 1AMKA 5G5GB 4RXFA 3QR3A 3RU6A 1HGYA 1DJWA 4RKAA 1KM0A 3CUFA 2X1RA 3KBJA 3E0FA 3GR8A 1GW1A 4LYQA 2XFFA 1GRTA 4V15A 1GG0A 2VZOA 4KGJA 2XGIA 3V1PA 1B1YA 4TQTA 1CXIA 2I57A 5TNVA 3CLMA 2D3LA 2YLLA 3UZXA 1PWLA 4C6FA 3S2JA 1OX4A 5G1YA 3LXAA 3LV6A 4CD4A 2HXUA 3MVTA 4ALDA 3PPCA 3DFHA 1XFBA 3H54A 3LPPA 1RA0A 3A9IA 3BG9A 4B4HA 4O16A 1FWBC 1Y65A 1QI4A 4M81A 3T08A 1F3EA 1L9WA 1NIUA 4KETA 2P10A 4MWAB 1BTCA 1W37A 1P6WA 1EHNA 3W1PA 2VDIA 3C8NA 4A6GA 3V5FA 1DJQA 4URIA 4DZAA 2ADAA 2XU2A 4G2DA 4IMAA 3Q6JA 3AHVA 3QRHA 4C5YA 4BFAA 4K38A 2D0GA 2VC5A 3VGHA 3VUSA 2ONEA 4GO9A 1KRCC 4CKQA 4MZYA 2ZZ0A 4XVEA 1AODA 3NZRA 4EM4A 2XISA 4B15A 1LWHA 1XLCA 4ZOCA 1RY0A 2EKCA 3U9IA 1FWTA 3BGAA 3L67A 2WSQA 1SFTA 1UWQA 1N61C 5EGRA 2BC1A 4I6KA 2WZIA 4FMVA 1FWNA 1TPC1 3N4EA 4LH8A 5FJPA 4G56A 4Q32A 3THDA 3I10A 3SIZA 1KBBA 5F1UA 2TYSA 2QPSA 1E0VA 2X2YA 5K9DA 1TRIA 3ME3A 2QUUA 1Z8AA 2E8ZA 4NNAA 4MKNA 1D3HA 1R3TA 2GVYA 4O53A 1HF6A 2C1HA 1JQVA 3TMQA 3E96A 3R4IA 5J04A 3E0VA 1QO5A 1ZBCA 1WXJA 5E6YA 7XIMA 2QLYA 3W76A 4ZE4A 1LYXA 3UYCA 1UKPA 5LA2A 3W72A 5A5WA 3EB2A 4XB3A 2O55A 3N13A 1W5OA 3VOJA 1JL8A 4JQ1A 4H6RA 2D1ZA 5A6LA 1IGWA 2GGGA 3EB3A 3UVIA 4O0ZA 3VOGA 3LTYA 1I1XA 2J7BA 4MNJA 3CT2A 3O9NA 1S38A 4PEKA 4Z08A 1DWFM 2PE4A 4H3DA 3GDKA 3OU8A 2YX0A 3GM8A 2XM1A 3BSHA 2PRHA 3ES8A 3L2IA 1PKNA 2WM1A 3AJXA 1VJSA 2DSZA 4L6OA 7CGTA 4X63A 4NNBA 1BHGA 1D7KA 1H6VA 3GVVA 1TQJA 4KW2A 2DIJA 1S1RA 1XIHA 3I6TA 3G6MA 4J5NA 4CN6A 5U25A 3F4VA 1XWYA 3EMQA 3II1A 3PBUA 4H00A 1RCQA 1GZGA 3VABA 4TX8A 2ZX7A 2EQ6A 3I7QA 1NHRA 2X8CA 1IWAA 1K7EA 2CLOA 4AG0A 5HNUA 3LLXA 3NO5A 1C90A 4AX7A 2ISSA 3DC0A 1G94A 2J6VA 1WV2A 1NDZA 1XHGA 2YL6A 4M29A 3B8VA 3R5EA 3G8EA 2VEPA 3T05A 3UPWA 4N0RA 3WNKA 3FXGA 1S7MA 4QG6A 4ZB0A 3G1DA 2NLYA 3GUWA 1JXJA 1OIMA 3B0YA 1AW5A 3K8MA 1BG9A 5E5CA 3TN3A 1J0HA 4OBTA 3WK2A 1LPFA 4LUSB 4E8GA 3AN1A 2BASA 5H6HA 7TAAA 1DQUA 1ITCA 4MM1A 5DCEA 1PCWA 4M52A 4GJ1A 4DNMA 5FIPA 4LPCA 2AQWA 1R3YA 1QBAA 4HJWA 1YMYA 4GKTA 3L0GA 4GX9A 3TNOA 3ARQA 1H5VA 3UGRA 1NFBA 4NZ4A 3UZZA 3E6EA 4P7QA 1P0BA 4P7LA 3GW3A 2HQMA 4DUOA 5LIWX 4E8DA 2NQZA 1R5YA 1ADSA 3HO8A 3KLLA 4ATWA 2ACRA 1N82A 2PP3A 1V0NA 4BEQA 3C0SA 3I6RA 5AVNA 1TPVA 1UUMA 3UU0A 3NSXA 3QFBA 4GCXA 1CXHA 2NW0A 5FS6A 1K4HA 3CHVA 3MMWA 2QMKA 3BE7A 1H2IA 4JDBA 5JCNA 4LF2A 1IV8A 2YCJA 3W25A 5AC8A 1MRQA 5KVHA 4KFNA 5I3GA 1OF8A 1XH1A 3MCOA 3BICA 4MZ1A 2PBOA 4U5IA 4CQ9A 3VXGA 1UH4A 1LRQA 2DFAA 3R43A 5H91A 5I79A 4NF7A 3NPXA 3V16A 4O10A 1NY1A 3N4AA 4AZHA 1R9ZA 4C65A 4JFUA 4HNVA 3AAMA 3VIGA 4INFA 3HV9A 4M6UA 2W5FA 2G3IA 3EF6A 3WQPA 4XIMA 1TUXA 1QWKA 4GZJA 3EX2A 1N5XA 4Q8NA 5HDRA 1XL9A 4FNQA 4JKLA 4NP7A 3ZWSA 2Y70A 4FF7A 4LC6A 3PAJA 2BFGA 4GD0A 1T8QA 1BTMA 4S3KA 1O5QA 2VGIA 1E5JA 2TPSA 5B7YA 3KOZA 2CITA 1BKSA 1NWSA 5TBOA 1EDGA 4N7QA 3IJ7A 3T0BA 1GOKA 3PG9A 3O07A 3QFWA 3WLRA 1LUCB 2FZMA 1JDDA 3CTLA 2H9AA 1BXBA 1S5WA 1H7OA 3FDGA 3DYOA 1LWIA 1X1ZA 3C3NA 4IGSA 1V7YA 1C93A 4ZODA 1O60A 2G4JA 2Y8KA 4GUGA 3QGAC 2YZRA 2WSYA 5CJ5A 3V0TA 3MHFA 1UP0A 1SZEA 1K9FA 1VYRA 2TRSA 3NVVB 2CZFA 4JTTA 3PZNA 3HRDC 1H1ZA 1TFVA 2CDUA 1KGWA 4A8IA 3LGGA 1VJIA 4G7FA 3QLDA 3EOOA 4PMXA 3AO0A 3NZPA 3BAYA 1R87A 3OA3A 1I2QA 2P76A 3W2UA 1UUQA 5HXMA 3ABOA 2DIEA 4IMGA 4X2RA 3W9ZA 1VB9A 1MW2A 4FXRA 3FGCB 3UGVA 3QOKA 1GSNA 2Z7KA 5F2IA 1Q45A 3AIBA 2CPUA 1XBYA 2INEA 3OQEA 1W3NA 1Z69A 1ADDA 1FKXA 2REQA 3CC1A 3IVSA 4DO4A 1GKQA 2PP1A 2GDUA 1XYFA 3TW9A 1PX8A 3KTSA 1KV5A 1G4PA 1F6KA 3EOSA 4JEQA 4Z0SA 5T9BG 2VEMA 4W8LA 3OLDA 5BXPA 1X96A 2VFGA 4J3VA 5LKYA 2W66A 4MY9A 3UR7A 4B92A 3V0SA 3ABRA 2H3BA 1JPIA 4D6EA 1XP3A 4WSHA 2Z1KA 2P8CA 3AZSA 3PM6A 2DT1A 3KTXA 3S6DA 3QMTA 2CLFA 1MUWA 2VC9A 3A7RA 1TMHA 2WZTA 5HMSA 2WK2A 2C8NA 3LHZA 1K8ZA 4HNNA 4IISA 5A6SA 1BWKA 3V3WA 3REQB 2OTDA 4O1EA 2E1WA 4XTDA 1PIIA 3LCGA 3W0KA 3TYDA 3GU1A 4CU6A 2YXOA 1A0CA 1F5ZA 3HGJA 3NG3A 5HK4A 3C4UA 2QIWA 2Q3RA 4H8HA 4IXHA 4P8WA 2OT0A 4FA3A 2IPGA 1XLJA 3P8JA 2DIKA 2J24A 4ZOEA 5JIWA 5CPMA 2GDQA 4EPDC 2D20A 1E1CA 2C19A 3K5XA 4I5UA 3DHDA 2GUUA 2G41A 1KM5A 4ZQOA 1TWIA 3E74A 3SURA 4S3AA 4V2XA 2G3NA 2J4GA 3EBVA 3GVWA 3NPUA 4PTDA 3GC4A 1ME9A 2VUNA 2AQVA 4HCHA 5C7VA 4GFIA 2FFCA 3GDBA 4NZFA 4A8RA 3WBEA 2WP5A 1QOPA 1Q65A 2WQPA 4CD7A 4YWIA 3DYMA 1V79A 4PRRA 3FS2A 3O15A 4H9TA 3UCQA 3TIMA 5K4ZA 3G0XA 2ACUA 2ZRZA 4LV9A 1JZ8A 1O1ZA 3H21A 4H6QA 1W9DM 1NF7A 2FQIA 3ARSA 2DUZA 1QW8A 1UIPA 4TO8A 1QU4A 4XAGA 3IPWA 1SU5A 2V69A 4K3ZA 4HNLA 3HMJG 5A3HA 1OQFA 1AQ0A 3SGUA 4XK2A 1JZ7A 2FH8A 2DW7A 1W9PA 1R9YA 1PYMA 1X98A 1MDLA 2WPFA 3GXMA 1OFEA 5FJOA 5LA1A 5C0QA 5FI8A 1K3UA 3LTPA 3BLKA 1OM0A 4HYVA 2IXVA 4KBXA 8XIAA 5I06A 1OX5A 3LG3A 4UTTC 3MJYA 1O5RA 1H11A 4UMCA 3UWQA 1KC7A 1G9HA 3FY1A 2YR1A 1QMLA 1AW2A 4WY0B 3P6LA 2NT0A 3TWBA 4MKSA 4IIFA 2R24A 5A6BD 3FAWA 1F3PA 4C7GA 1LF1A 4GR1A 4FALA 4LYKA 4G9PA 3M43A 4UWMA 2GJXB 3WQGA 4PGLA 4BF9A 1GVFA 3CL7A 4X9SA 4Z2LA 1GYLA 4GY7A 3H2FA 3NNTA 3UWUA 3GIQA 3S9ZA 2OPJA 3A4WA 3VVGA 5KZ6A 5CPOA 5DELA 1KXHA 4US5D 2GGEA 1KCXA 1DHKA 1HP4A 1OC6A 4RNJA 2D69A 4C6QA 4IMCA 3EB4A 1KQZA 3EAOA 1S5TA 2F9RA 5JCLA 1E6RA 3W2JA 3WCZA 3ES7A 4GBUA 4D8LA 1GHRA 1CW2A 3PTMA 3C8FA 1LOLA 4ADWA 4HNOA 5HUOA 2Q3OA 1H62A 1AG1O 1GKRA 3LBMA 3N6HA 1B30A 4J40A 5BRPA 2E0PA 3LZ3A 3PJXA 6REQB 3M9YA 1GG1A 1JIBA 4CD8A 2VEFA 1AZ1A 2D0FA 3SJ3A 8CGTA 4BI7A 1CWYA 2DUXA 4IFKA 4QJ3B 2F7FA 1EBDA 3KVKA 1TREA 3EEGA 1ISXA 2Y63A 5L9FA 2OYMA 3S1VA 4KCVA 1XCXA 1E3XA 1BSIA 5D09A 3LB8A 1KCLA 2J8GA 1G1YA 1GYNA 3B05A 2O7QA 4JHOA 4DO7A 1TE6A 3NQDA 1DJHA 4HGXA 4B2DD 3Q4DA 2VFIA 2Q09A 1KB3A 2R1KA 2NQ5A 4H6KA 1VEPA 3KP1A 4DX3A 3ALFA 2O92A 2OFJA 3A13A 2HCVA 4EAMA 3OTRA 4DRSA 1GHSA 2A5HA 4AIUA 1BWCA 4JTGA 2VZVA 1BG4A 3BQ5A 1XW8A 4UMBA 3VX1A 1E9ZB 3YPIA 3GNOA 5TIMA 3DCPA 4IPPA 1FWEC 1BGGA 3W81A 4PMUA 3PUEA 1IIGA 3ARXA 4KCWA 2IKIA 3SN0A 3KEHA 2VR2A 4DBWA 3UERA 3W6MA 3GS6A 1ZLPA 4GGBA 4WIWA 2HWGA 2GPTA 3UFYA 3B0PA 2YA2A 3OO2A 3TAOA 4GZEA 5ABFB 1YRRA 4I90A 1KTBA 2IKHA 3MB9A 5FAGA 3R0KA 1RK5A 4HCDA 3NCOA 4L64A 2DV0A 2G97A 2B0MA 1DBTA 1XINA 3ZR4A 4QE5A 3W74A 4X0NA 1E56A 2JGYA 3VX0A 3HTWA 3BLIA 4C1LA 4TMBA 3JW7A 4Y90A 4ADSA 2WMGA 3B9OA 3CTTA 3S5YA 4GUJA 1JDFA 4Q33A 3ZIZA 4N9CA 1L6GA 4GVIA 4QITA 3BJSA 3MCNA 4BR1A 3LDVA 5I3KA 2NVDA 3O2LA 4TVYA 1Q6FA 5IHRA 2YDSA 4UQBA 1CLKA 1R2TA 2J7CA 3II4A 1FDJA 1HO1A 1TVLA 1QOXA 2ZZ1A 2ZC1A 4OOUA 2D23A 1H5YA 3U0HA 4Q3MA 2R9ZA 4MNMA 1AL8A 4RZ6A 1V02A 2PP0A 3G1AA 3H4WA 3RM9A 3URQA 2VDHA 2VCBA 4HYWA 2I9UA 2Q8ZA 3EYPA 1RP9A 3UETA 5LSMA 1YNQA 1H7NA 3BAWA 4KRZA 1B4KA 2INZA 4ACZB 4HNCA 1F74A 4HMNA 1CCWB 4V1XA 4QAIA 1AD1A 4YS1A 1FCUA 4C6PA 4DJED 1NWTA 1ITXA 1RM6B 2QDDA 3W86A 3KBWA 1CZ1A 4U2ZA 3DIPA 1BF2A 5FS9A 3A21A 3NOYA 4UR9A 4LS2A 1JXKA 8A3HA 4JHZA 4EQXA 1VFHA 2XHYA 1Z44A 5D9PA 3PR2A 3UXDA 3WX7A 4HK7A 3NL6A 1B31A 4PL1A 1QNRA 1TJ0A 2BY0A 2OR2A 4M24A 3BLPX 4CQAA 1QXLA 4U3AA 4RX0A 5G4WA 4Y96A 4RV8A 1LP6A 3W24A 4PCNA 4DWSD 4JXCA 3UA4A 1CLVA 1U1HA 3WDJA 2QHAA 4XZMX 1GOWA 1UWIA 3GH5A 1ITUA 2XWDA 2XVGA 1FUYA 4GOAA 4JTEA 1F76A 3VKKA 2Q01A 2QR6A 3A47A 3AFBA 3SR6B 2CYGA 1R3QA 2OZ0A 3K13A 1H2JA 4WD0A 3NPWA 5H1WA 5AHNA 4HZ6A 1EF3A 2E7FA 4B16A 4GI6A 3PP7A 3VOIA 1J0YA 1LCOA 1MNZA 5D32A 4JNMA 1NEYA 2RDUA 1W3IA 1J6OA 3W83A 3EMZA 1KM4A 3CUIA 2FPVA 4PMQA 2OZ3A 3KBNA 4QEEA 1H7XA 4YHEA 4L65A 4LCSA 3FVDA 1H09A 4J56A 1ZQ5A 3NYDA 4IWWA 3UT0A 4FLSA 2CKSA 4AZCA 1JCYA 3LGDA 4H8NA 4GI8A 3R0UA 1JZ3A 2H6RA 3U5YA 5AC6A 2GSHA 3DHFA 3N14A 4YYFA 2JIEA 3V0UA 5A6AA 3WLSA 5IFTA 3QGKC 4L4MA 1WKFA 4IJCA 1GRAA 2F8QA 1S5VA 5LIXX 4TV5A 3W22A 3KUMA 2A3HA 1RLDA 2D22A 3P60A 3MMDA 4PUDA 3DBPA 1PZ2A 1ZRQA 1STZA 1Q63A 4JFWA 2GWNA 1EXPA 1C8YA 3LSBA 5JBDA 1R9XA 2WNWA 4MJ2A 3W71A 2Z1XA 2OO6A 1OJTA 3XISA 4RE3A 3G22A 2P50A 4O18A 3SIMA 3ERPA 1TPFA 1HZYA 1HGWA 3GTNA 2WHJA 1ECEA 1GQJA 2Y5SA 4X61A 1E6XM 3CQ0A 3IV8A 3NEHA 4L4OA 3H8AA 3DGBA 4U33A 2OLAA 3WUBA 2PRLA 5I09A 2HJPA 3PZOA 3R0DA 3QMSA 4YL2A 2XH0A 2XSXA 4PBEA 3TVAA 4HOZA 3LXDA 4WR3A 4UQEA 4HOWA 1E0UA 3PSWA 4C6KA 3WLTA 3IGSA 3T1GA 4GUFA 1K6WA 2BVDA 4H01A 2WZMA 4J27A 4D6GA 3NGFA 3JR2A 3IVTA 2WVVA 1A49A 4QLJA 3BWWA 4K36A 2J74A 2OELA 3NQ8A 5CEWA 5LXEA 3WEOA 3BOFA 4W89A 3VD3A 4HHMA 2Z00A 1A50A 2E40A 2V6OA 4EKJA 1KW1A 4NHVA 3I7RA 1R0MA 2XIMA 1AZ2A 1YQZA 3TQVA 3B8UA 1TYGA 2YYUA 2J7HA 3C2FA 3OBEA 1TWZA 2OXNA 3WQ8A 3UBPC 3K30A 5D2TA 3DK4A 3A5VA 4GH3A 2OYKA 2PGEA 5SWUA 3AHZA 2WKJA 1CB7B 3W7JA 1PBGA 2PDGA 2E9LA 3TJIA 2VURA 1QR7A 2C3CA 4A3RA 4TVWA 4QTGA 4DWSB 2ZZBA 2VYOA 5E9AA 2NXHA 3MUIA 1FWCC 2J9ZA 3KRBA 2NX9A 4MNLA 2GLKA 5I2UA 4IGNA 3QZ6A 3IV3A 3N2BA 3VM5A 2VCCA 1V97A 2YL8A 5KETA 3IJ6A 3UR5A 2V30A 1Z7AA 1EGZA 4J3WA 3QBUA 5I3FA 1W6TA 1XR2A 3RK8A 4GVGA 1LQ0A 2WV8A 4XZHA 3ZLGA 2ZUTA 4DPQA 5KEZA 1NTHA 1CGTA 3C0LA 3A3XA 1X2GA 2ODOA 1TPDA 1SYTA 2H8ZA 3VKCA 2X1IA 2PWUA 2VGGA 5DO8A 1EWDA 4KGLA 3UZJA 1XGZA 3A3HA 3M16A 2GH5A 2X50A 1GPWA 3LLDA 1VHCA 1I6NA 1NARA 1ZJHA 3IUIA 3S0CA 1Y5XA 4PMOA 3AUJA 3T2OA 3FOKA 3NQCA 2EO7A 5ECVA 2I16A 3AIQA 4JQ4A 2NSXA 1EOKA 3EKLA 3G0UA 4B5WA 3HURA 2Y89A 1RA5A 4HA4A 3W7DA 2YW4A 4RXGA 1Q4WA 4GACA 6CGTA 4Z0JA 2WJEA 3STEA 1UP3A 1RY8A 1REQB 4N6FA 5BROA 3RX2A 3AWOA 3WDQA 1E40A 3CNYA 4QHRA 3OC4A 1Z89A 2OU4A 2B7QA 2OEKA 5TF0A 2FVMA 1RJPA 2WMIB 1D7FA 2W61A 2QAPA 4DYEA 2QDGA 1PAMA 1QI3A 5I5RA 2XIOA 1PL9A 4OQVA 1FHUA 5CJNA 3UP8A 4NU7A 3GX9A 3DFYA 1JFXA 4LAUA 1EFZA 4OOZA 1HN1A 1YBQA 3G18A 5A8MA 2O4QA 3VGGA 5C54A 2V5LA 1UJPA 2LLEA 2DJXA 4X9YA 3WD0A 4XSMA 1EF2A 4L5ZA 3RJXA 3ARWA 2PDHA 4YWOA 1X8FA 1YTDA 3UA3A 1R85A 4ZO6A 4GK8A 5AYXA 1H4PA 2ZRYA 4Q8QA 4NEVA 2VX7A 3NQFA 2WPBA 1FCBA 2FPTA 8XIMA 2CU0A 1LVLA 4HNUA 1HW6A 4IX2A 2G5WA 4QDWA 1LOSA 3AIWA 5D30A 1JRPA 2YA0A 3OVRA 3WO8A 5I3HA 4AUBA 2VEIA 3FCPA 3OHMB 5E6ZA 3FLUA 4F0HA 1US3A 4JTKA 1UWSA 2QUNA 1ZNNA 5G2HA 4IMDA 4EK7A 4IUGA 4IIDA 1XSKA 1QTWA 3CGTA 3ZT6A 1OZQA 4NG3A 3GC2A 2PDFA 3CHEA 4WUIA 1BEUA 4JIQA 3CHFA 4KH2A 4S1FA 1SPQA 4QX4A 4HB7A 2DP3A 5I07A 1S1PA 4TOQA 2ABBA 3PJTA 2W67A 4PH6A 4MWAA 3T07A 5E70A 4AWTA 4JL2A 3PTKA 3TW7A 1VFFA 4OKDA 1A5LC 1TV5A 2EG8A 5IHSA 2XG9A 1NHSA 1F4AA 4I7UA 2VEKA 2EPKX 2PCQA 2SFPA 4FF5A 3SUUA 1CXEA 3W7LA 2OGYA 1ZALA 2WHLA 1TJPA 5ABHA 1S3TC 2BG5A 4D6DA 5GNXA 4M6QA 3OLIA 2A2IA 2DH2A 5JRBA 3LI1A 1XC6A 2GSJA 5EKYA 4ERAA 2PDQA 3AIEA 2GOKA 2WMJA 1XPYA 1VFSA 4K7VA 1XDMA 1UG6A 4B9ZA 1NPXA 4EANA 3QR0A 3VUPA 3HPSA 1FP9A 1C92A 1M6JA 4N9EA 4DF2A 4QFUA 2OCZA 1H0IA 3S1UA 2A21A 3GUGA 1I9CB 1YXDA 3R89A 3W7CA 4EOUA 1DTUA 2C1IA 3LCXA 3ONCA 4D1IA 3LQLA 1EJXC 5AYYA 1J0JA 1JPMA 2I7GA 3JS3A 1GCYA 2C0HA 3AMGA 3HU7A 3SM0A 1N2VA 1RD6A 3TXVA 1FTXA 5D2WA 3W1LA 5CZJA 1VH7A 3J7HA 2ZVIA 4ORIA 4OUEA 3GW0A 4H4QA 3URBA 3KBSA 3BAXA 1I60A 2WSKA 1E1EA 3CQHA 1TPB1 2IQTA 3ITXA 4LY8A 2E25A 3W6LA 1TWWA 5JH2A 3S2MA 3PNZA 1WP6A 1JDEA 1K4GA 3RLGA 4YCPA 1QDSA 2ZZ7A 4Q8UA 4WGHA 4X0VA 1KLYA 2Z25A 2WCSA 3STPA 3L5OA 3IWPA 1E6PA 1E0WA 3W75A 1E15A 4C90A 1Y5WA 3H55A 4ILSA 2R91A 3B8SA 2VKZG 4EAYA 4UMAA 1IE7C 5F2GA 3AMZA 3LBCA 1XIGA 1R46A 4MLJA 2EPOA 4MPKA 1ZCOA 2PDPA 4GBDA 4UNIA 4CNPA 1Z32X 5AYBA 4XAYA 3P8IA 2QMJA 3SUWA 4XIAA 4KEMA 1W54A 1NM9A 3QF0A 2A6NA 1WBHA 4DB7A 1VS1A 5M3WA 5JBFA 3ID7A 4ZEPA 5E1QA 3CV7A 3MC5A 5FEZA 1PKLA 2O56A 1XBVA 4JN8A 4UFJA 4ACYA 3TK7A 3CMGA 1KFLA 1W9UA 4FR6A 4MB5A 3UPMA 5JVLA 4J3XA 3UJ2A 5PTDA 1YXYA 4W84A 3NFUA 3B03A 5HNRA 4O13A 3T6CA 4HTYA 4LUSA 3A7UA 3ABQA 1TKKA 1UZ1A 3LUTA 2BHYA 2PWVA 3DOPA 4OIFA 5CCZA 3GHUA 4MB4A 2E9MA 4E8CA 4AD0A 1XYAA 4D71A 1XSJA 3KDNA 4YYCA 1OK6A 1UC4A 4E0CA 4W93A 2W79A 2BSLA 4H83A 3QC0A 3U5UA 4C6CA 1D3CA 4LQ1A 4MFDA 3QKZA 2QJGA 2GVGA 3NQBA 5IBXA 3NDYA 1MXDA 1GJPA 3B06A 1OCJA 4MLRA 1SJDA 3IJDA 2Z6IA 3CHCA 2TMDA 1JCXA 1FWJC 4W8BA 1U5JA 3N1AA 1JOAA 5C9WA 4QCFA 2WAGA 4HA0A 4XKMA 1UYQA 1C3FA 1VPXA 3MHGA 2DZVA 4JIIX 4DZHA 1XCWA 5AHLA 7TIMA 3B8TA 4XBKA 4PCSA 1QFEA 3W82A 1HO4A 2CZVA 1JCJA 2VRQA 4K68A 3NO3A 3OP2A 4L1XA 3SQMA 1ME7A 3CT7A 1D9EA 3BLOA 3WLIA 3CZKA 3NVYB 3B9DA 1OCQA 2OVLA 4AAJA 4S2CA 3VIMA 4EWND 4LB3A 3TSDA 1VEOA 3I6EA 1EWEA 1YPIA 4MY8A 3P2VA 2PD9A 2CLIA 1A4MA 3V5OA 1JPKA 2X1SA 3GQYA 4UTJA 4OGZA 3KOYA 1XM3A 3RCYA 1X2HA 5C9XA 3QSRA 1PZ1A 1S2VA 3WJZA 2E1DA 2PRMA 1VENA 4OT7A 3NA8A 2I1OA 4LS0A 2GQAA 4HU0A 2PWFA 4ML9A 3GRIA 4PYSA 2WNQA 2VC6A 4IP4A 2QCGA 4GGHA 2B7NA 4CQDA 2J47A 1P1XA 1UZDA 3LCWA 3VKDA 2Q02A 1SW7A 1VBJA 1DXFA 5AZ1A 4DJDD 3ICJA 2V68A 3ZWTA 5KINA 1DOSA 4JY9A 1KQYA 2GJNA 4HN4A 1VD6A 1W3JA 5JH1A 4DM2A 1EX5A 3WQ6A 4P8XA 1HT6A 4LFYA 2X30A 2YBVA 3UWYA 4JYFA 3VDAA 1XBXA 4R33A 4TV6A 1LRTA 3A12A 4WZHA 6PTDA 1ZBWA 4UTWA 4TU1A 1V93A 2XVKA 5A2AA 1BRLB 1M9HA 1W1YA 3O63A 3LCIA 4JQ2A 5F4XA 5DY2A 1E9LA 1QOQA 3FGCA 2PB1A 5C8BB 1OG0A 1YHTA 2WHMA 3CH9A 4F9DA 1OHLA 1ZKQA 4FSAA 3UY8A 1KNWA 4D8AA 3PBWA 2ZCGA 3P5YA 3CO8A 2E5DA 4NZ3A 1O7AA 1W2PA 4AYSA 2WXDM 2NSOA 1EHAA 4EVZA 5JCKA 2HS8A 2OZTA 5EY5A 3W88A 3DFPA 3RM4A 5A8PA 1DQXA 1KBLA 1QK0A 1DJXA 1VRXA 2KZHA 3TCSA 2ATSA 2Y0FA 1AH4A 3NUKA 3RUBL 4IL2A 7A3HA 5HBFA 3VE9A 4EMWA 2BVYA 3CXOA 1TZ7A 3KZSA 3F5KA 2EJ1A 3GZ3A 1Z48A 1NWRA 3SDOA 1K7XA 1BWLA 3PPFA 4GRSA 4WQ6A 2PDIA 2DZWA 2XYLA 1QNQA 4W9TA 4MMWA 3WELA 1T3QC 3REQA 3CUGA 4FIQA 2PDUA 3ZYZA 2W54A 3IJ8A 1I75A 3M5XA 3SO7A 4RPQA 3SCQA 3DFSA 1TCDA 3V1HA 2G3JA 4PTVA 3QY7A 5ENLA 1X6NA 4QE1A 4LVDA 2QJJA 3SCNA 3TONA 1GRGA 3WFZA 4ES4A 4CQ8A 4CCEA 5I23A 2ACQA 1KBJA 3I3EA 1ZJAA 3PBGA 3MMTA 3O6AA 2GJLA 2YFOA 3QMRA 4TIMA 1FHVA 3TCEA 4GHRA 2Z1WA 3A6OA 3G0SA 2ZA2A 4I9MA 4O4VA 2FVKA 5RUBA 5DQPA 2GGIA 1VBRA 3K1GA 2D0HA 4PCFA 4HPGA 1DL3A 3WLJA 4RE4A 4HD5A 4AD4A 2QQ6A 4XD5A 1FH8A 3AZTA 1BYBA 2Z28A 2WLYA 1T99A 3OZPA 3OVGA 3BCJA 1E3ZA 1CI1A 1CGWA 3KLKA 3VDHA 4KKXA 4LV4A 5T8GA 4DHGA 1QI0A 3CB3A 1W5MA 4Z1AA 3AXXA 4R9XA 4LC8A 4DF0A 1R2RA 4HZ7A 1XS2A 2X1UA 3CIWA 1FBAA 4RNFA 5KMYA 2PLKA 1PIGA 2DU2A 2XH7A 3ZJ7A 3LZ5A 1HVXA 2RAGA 4LRTA 4O50A 3ZS4A 1VRDA 2ZE3A 3KL5A 2GZXA 2PC8A 3CK5A 4WCJA 2AAQA 2CBIA 1DXIA 1M65A 4YJ5A 5HQMA 5E0FA 3GWQA 1TPWA 2ZUVA 4JDRA 4D2JA 4MJMA 4MUPA 2ZZ5A 1GQIA 4R27A 3WQOA 2W91A 4K39A 1WX0A 2HS6A 3WJYA 1ZU8A 2NQLA 3LX9A 4WY0A 4GKLA 4D1JA 4ZBCA 3LTSA 1JFHA 3TYZA 4KQNA 3B97A 4J28A 4PN2A 3URAA 1TELA 3CHDA 2GJXA 3GO2A 1UR1A 2C1GA 3BQ6A 2A0NA 5EMLA 3L4WA 3N2MA 5DMMA 4Z2KA 1Q3NA 4AC1X 3RX3A 5AY7A 1ECQA 4JPGA 3UXIA 4OWGA 1W1TA 5FJIA 4I5XA 3IIPA 2AOSA 1XH0A 1JZ2A 1E70M 4I9TA 1UMLA 3GFZA 3QHMA 1A3WA 2RDWA 4E38A 1M3UA 3SY5A 3W37A 1RJQA 3CAVA 4IL0A 2W0UA 4LA1A 4G5DA 1V3KA 4NYYA 4H4TA 1H61A 2V5DA 1JNEA 1A3HA 2D73A 1XYCA 6REQA 5H8UA 1WDSA 3UJSA 2ZA3A 4XWUA 4O54A 1UBSA 1H7RA 4PTMA 3WF1A 2CFFA 4PSRA 4POCA 4H4PA 1PIFA 3L4TA 3N04A 1W32A 3FA5A 1JCLA 3FAXA 1EZWA 2PTYA 2ESCA 2ZZ6A 3ZVHB 3VIHA 1V8EA 2W3RA 2A7NA 2HE5A 1W1ZA 1BLIA 3NQ2A 4IHCA 4J9JA 1YE4A 4PFMA 3GHSA 2EGZA 4F4RA 3HZ3A 1Z42A 4YTUA 5BXRA 3W7NA 3QOMA 3P84A 3AXHA 4O8AA 3ATZA 4AW7A 1FWRA 4M6VA 3TSMA 1JULA 3M46A 3EKZA 4R85A 3PWIA 3A3WA 3TN4A 2WC4A 1J4EA 3K4WA 3MP4A 3BV7A 1JR1A 3TEVA 5D04C 2O9OA 3NAVA 2HNHA 1C7TA 4HU8A 2ZXDA 3L21A 2ZICA 3HOJA 2V0TA 3H70A 4J1OA 1O68A 3PPGA 4R88A 5DN1A 1F73A 1ISVA 3QQ1A 4U31A 4ZO7A 2J7GA 3UCCA 1EO7A 3S1XA 1A5UA 3PG6A 1KV8A 2CZDA 2DZTA 4BKNA 2V8ZA 1OD8A 5HATA 3SBFA 3TQPA 4RDZA 1PX3A 2AKZA 3PBYA 1BFNA 1JF5A 2QGHA 5FD0A 2QCDB 2BDQA 1HTIA 4PMJA 4MWAC 4J3ZA 1L6WA 1B3YA 2YIHA 3B9JB 3B9NA 4X22A 3KBVA 5ABFA 3W53A 2PD5A 3OHIA 2BHZA 3JZEA 3VCCA 3W84A 4LVGA 3AIVA 1MO0A 2PDLA 3BAIA 3UYIA 1XLKA 5F1VA 5HPCA 4X60A 4LVFA 2V82A 2YDQA 1LWJA 2VELA 4B91A 5CZKA 2JE8A 3G1HA 3DFTA 4DPPA 5KITA 3EWZA 1OF6A 3DJJA 4IZGA 1O4UA 1KR0A 3MI6A 3VYLA 2GGHA 3WNPA 5JUVA 1UZ4A 2BGNE 3BVJA 1EBGA 2CW6A 4WGXA 3PB0A 1S46A 1J0ZA 4A4AA 4QQ3A 1W1VA 2QNEA 1F6YA 2O0TA 1DWAM 2EBNA 5ABGA 4GABA 1US0A 4PFHA 2OSYA 2FTYA 1HJSA 1UB3A 2HZGA 5HA7A 4US5A 4H9VA 2ZOXA 2UV8G 1ZK7A 1W9XA 1L2UA 3GVRA 2VP8A 2DH3A 2HQAA 1SO3A 3A9BA 1AQFA 4ACZA 2X0HA 4Z1DA 1M03A 2Y62A 3VA8A 3EDEA 5H8MA 4V28A 2IKJA 4ZQNA 2QDHA 5EFFA 3EOUA 1F8WA 2PU0A 3BW2A 8TIMA 1P5BA 4QISA 2XIQA 2OOGA 1GVSA 1C8XA 1XQLA 4GY0A 1R7AA 4XBJA 3NQMA 2AGTA 3EWYA 3LMZA 1WE5A 1JAEA 1PE1A 1W5QA 4I7WA 4W5ZA 3GU9A 1AD4A 3FK4A 4C6OA 1VQZA 3B9AA 2ABAA 2V81A 3NQGA 5AC5A 4AWEA 3SCWA 1LTDA 5C9UA 2WWCA 4W7WA 1E5NA 1NVMA 4UC5A 3GDTA 2IQDA 3KCJA 1MVYA 4HCLA 5IDZA 1N5WC 3GBDA 3WBXA 2V3BA 3PF3A 2AKMA 1XGDA 1KFCA 1OVDA 2V3AA 2AMGA 1BKHA 5I3JA 5DBTA 3AUOA 5BU6A 2ALRA 2XH4A 1OYCA 3L2LA 1E0TA 2XZ9A 2YB1A 4GQQA 1OINA 4GI4A 3ZT7A 4HPNA 4QJ4B 1XLMA 1XIFA 3L5AA 4LIIA 1RV8A 3DESA 4ADUA 3T81A 4NJKA 4LYRA 2E28A 3SGZA 4LCRA 4FOJA 2Y6ZA 2PTDA 3VGFA 1SUXA 1HKIA 3FFSA 3ARUA 3WLKX 5EU9A 4IJBA 3NS1B 4WEVX 1QT1A 3EUB3 3RNMA 4QR6A 3O6DA 3CEPA 1L2QA 4PBGA 4IP7A 3TOYA 4HVXA 3OYXA 4O57A 3AROA 3SAZA 1EP2A 3UXLA 4E3TA 3ARZA 4M56A 3AU6A 3L68A 1XRTA 4E2BA 4JZ5A 3CZGA 4IG2B 4JN7A 5AHMA 4I3GA 2PEVA 2R9RA 3K2GA 3ITTA 1V3HA 3IIZA 3T2PA 3WH7A 3KDOA 2W27A 3CZEA 2QVHA 1PTAA 2G8ZA 5XIMA 5IBXC 2ZDRA 2ZX5A 3U2OA 2X2GA 2YLAA 4NL1A 2DSUA 4UQAA 2EJAA 4HN8A 3SCRA 1FEBA 3AIUA 5HWJA 4W85A 2PLJA 1OYAA 1IEQA 3GB6A 5CLTA 1KFEA 3GTHA 2NVAA 1A5AA 1UWTA 1QI5A 3GTXA 2VVSA 3HIJA 4DYJA 4PB5A 1JRBA 4BS0A 4QM1A 1JGIA 3L4XA 1EYWA 1JPHA 3E5BA 3URNA 4JOMA 2PTWA 1GRHA 2P3ZA 3IIOA 1QNPA 4U4MA 4HMEA 1Q5MA 4PEEA 3QV6A 3LRKA 1W3HA 3U8GA 2IUZA 4J7RA 3W29A 3W1RA 1YQ2A 4MJZA 1RH9A 4ZXLA 4JTHA 1EYEA 2PLMA 1CGVA 1OB0A 2AL1A 3VDBA 1BQGA 5BCAA 1HJXA 4CQBA 3GH7A 4KT2A 4WJEA 1CENA 2J13A 3RX4A 4M7TA 1KA9F 3EDDA 2V3FA 1Q6EA 2INFA 4JTAA 1V6YA 4PSPA 3TLLA 1OADA 5GJNA 2WC3A 3BC9A 3MDWA 1W9BM 3W7EA 2DZBA 3P74A 4NI3A 2FZ8A 3UWZA 1KO0A 1M7PA 1W1A1 2NV1A 4XAZA 4UFIA 1V5XA 1V6TA 4DAFA 3ABXA 1KXQA 3RMEA 2VOTA 4A3QA 5A2BA 3VKBA 4CNNA 3CWNA 2ZWZA 4Z42C 4A2SA 2OKOA 2TSYA 2EAWA 3SQSA 3M0YA 5T26A 4JQ9A 4IM4A 5A6MA 2FDMA 1OX6A 4ZSUA 7ENLA 1SR0A 1XRVA 3AOFA 4DWSA 4JFTA 3RAOA 1ZDLA 3RF9A 4PMNA 3ITVA 1TG7A 2GOUA 3BCFA 5JXQA 4OTKA 3F2CA 1OG6A 1E73M 2MANA 3JU2A 3MI3A 4YNGA 1AH0A 1UH2A 4QAWA 4TTUA 3QTPA 3BW4A 3NTYA 4IGMA 4KIRA 4LAZA 2YJQA 3M41A 4QJ1A 1AJ0A 4WXYA 1V3JA 2G96A 5D02A 4KRTA 3UG5A 1TPEA 3PULA 4QLKA 1H50A 1JZ5A 1VDVA 5CC3A 1YKWA 2ZRWA 4AIBA 2WOVA 5CGTA 3VNJA 1LBFA 3BGGA 2VUYA 3F2BA 2PFHA 1J0KA 3KCOA 4L4LA 3OVPA 4I9AA 3MUAA 5DMLA 1L6YA 5HOSA 5FJTA 1LL7A 3GNRA 4GISA 4RLIA 3ITCA 5FF7A 1GREA 1TUFA 1A47A 2CC0A 2XTKA 3BMVA 4ZQMA 4X2PA 4LCQA 4AZBA 3WIJA 4A8NA 2F2KA 3FEQA 2P8BA 4KF1A 1EIBA 2NUWA 3RN6A 1ZY8A 4D6HA 3I3DA 1EUNA 4AD5A 2WPCA 1A5OC 1REQA 5BMXA 2GJPA 4C6LA 3HPAA 3MO7A 3CZJA 3ZJ6A 4CUCA 6XIMA 3CIXA 4LT9A 2R1LA 2WMIA 1JI2A 3R07C 3GG0A 2QF8A 3OOQA 3P81A 3MW7A 1T6MA 5FEWA 3RR1A 4AYGA 3GR7A 1XJBA 4S3CA 1B3WA 1UP2A 1FFVC 2YVJA 3KTCA 3WH5A 1FWWA 3KAOA 2PF8A 1R38A 4UQCA 2ZX9A 4L6HA 2FKPA 2X16A 2FGZA 3BLFA 2NX1A 2ZRUA 4AMAA 4WDTA 2D2GA 4CQCA 1FVPA 1LQAA 2VGBA 1A5NC 1PHWA 4G7EA 1FXPA 1JCTA 4C7FA 1UCWA 4E6MA 1KFBA 1ZXIC 5ECUA 3OG3A 4H9ZA 1ZAIA 3TA9A 5GNZA 1ZUAX 2XVPA 1B5TA 4IQEA 3ZOAA 4R3UA 1H1YA 1EJWC 1VGAA 3QY8A 3MP3A 4RDWA 1V77A 5DFAA 4O1AA 3W27A 3WUEA 1ISZA 2AGKA 3UR8A 4H50A 3AALA 4QROA 3LS9A 1H7PA 3QYSA 5J8LA 6XIAA 1J18A 4KWSA 2Y88A 1XRSA 4CCCA 1NQ6A 3WF3A 3EX1A 1UKOA 2GWGA 3U4FA 1MDRA 2TPRA 4IIEA 1KM6A 4UQDA 2WKGA 4IUOA 2O9PA 2F84A 2YXGA 1MFVA 3V36A 1RR2A 2Y5JA 5EPDA 4BZYA 4LUTB 1UD6A 2Z2BA 4O1BA 4A8LA 2GVLA 2QCMA 2VO5A 3ZM8A 4ZCWA 1MW3A 4GVHA 1QNVA 3Q2DA 2DZSA 1EBHA 4GNJA 4UTLA 4RW3A 2GQ8A 1YTKA 3R13A 2OWWA 6TIMA 3KCLA 1GOXA 1MZHA 4EXAA 3S46A 4LX4A 1B3XA 3GFXA 3W4RA 2EHHA 5AB3A 3C56A 4FIRA 2Y8VA 1HXJA 1DYSA 2ZTKA 4XUYA 2JFEX 1EJVC 4BK9A 2RDTA 4LVAA 2P88A 1R47A 4JIRA 4H8UA 2ZFAA 4A29A 3KL0A 4CNTA 3MS8A 4L80A 4RJEA 3AXMA 3UR2A 2FIQA 4Z2IA 3SN4A 2EPLX 1EEXA 2XN0A 3CZLA 3GAKA 1TB3A 4GY1A 1OK4A 1DE5A 2V63A 5DXYA 2W63A 5DEZA 3R94A 2BMBA 1NSJA 4RNHA 4LVBA 3N2OA 3SQPA 5CAHA 4TVUA 3WBYA 3FJNA 3TYEA 3SW6A 2ZUWA 3EEZA 4DBDA 3MI2A 2J79A 5K9CA 1KRAC 3W38A 5TD4A 4XZIA 2XPKA 1EA9C 4NILA 3S5SA 3WH8A 4ZR8A 3OIXA 4WLCA 4NXKA 3CUXA 1FIQB 3BMXA 3DKJA 5KZDA 1W9VA 2DQWA 3MWAA 1M04A 4WJXA 4BJHA 2J77A 2WQDA 1DXLA 1Q7ZA 4GX8A 1BVWA 3VNIA 1PUDA 2R1NA 3IARA 2QAFA 1VFLA 1FHLA 4PUJA 3CEUA 2QVNA 3JZUA 4AEFA 4C6EA 1X6UA 1GW9A 3AZRA 4JHMA 4L9ZA 4FXSA 2HK0A 3ZZ1A 3LK6A 2ZZ2A 2YL5A 3IAPA 1NELA 3CBWA 4LJ3A 2WMHA 3KVMA 4IIBA 3KS5A 1IEIA 4KCTA 3AU2A 3UXKA 2DUAA 1JVNA 1LL4A 2PMQA 3G24A 2EG6A 3TROA 1Q2RA 1N60C 1QJWA 3R8RA 1TVNA 2NQJA 3GHTA 3NVZB 1TV3A 3O8AA 4ZFCA 3R1ZA 4DIAA 4AF0B 1XD1A 1SQ7A 1M7JA 4S3EA 3VMPA 3ANVA 2ZWYA 1KM2A 3RIKA 1BAGA 3MUY1 3WDPP 3S42A 2NZLA 3MWCA 1RXOB 4Z2JA 9CGTA 2ALDA 2FHCA 3ZR5A 4CNSA 4XBSA 4LBUA 1CB2A 1Q6OA 2YCIX 3A4AA 3BCDA 2WYSA 3WEZA 1QI2A 1XDLA 4J35A 3TE9A 4RZBA 1B3OA 4L7ZA 2NVCA 3SFWA 4RR4A 1UW9A 1TVPA 5D37A 4QS5A 2OZ8A 3VMNA 1WKDA 1YDOA 3BJFA 4Z1BA 2CXGA 3HJZA 4AEEA 5F4SA 3GZAA 1EDTA 3WK1A 3BOXA 1F6PA 1YDNA 1E4IA 2IW0A 4GH1A 1GVIA 3L8KA 1OJXA 4BI5A 1QRQA 4FAMA 1GJWA 2BOGX 4BWLA 2CEQA 2PURA 4AMCA 1I2PA 5CZSA 5IM51 4EMJA 4H4SA 3G3DA 3VIOA 4W88A 1WOAA 2PGFA 3E9AA 2WHKA 4YHGA 4UTUA 2ZUMA 5EYWA 5I6SA 5FOOA 4DUVA 4AZ7A 1QWGA 3W02A 2VGFA 2WB5A 3MHUA 2PDBA 1TWSA 1BF6A 3W01A 5FSDC 4XAPA 4MAZA 4LAKA 2X42A 3QHNA 3HPXA 4HMCA 2PGRA 4NRRA 5HMEA 1GONA 3B0UX 1FH7A 3S8HA 5FS7A 3Q45A 3L0NA 1JZ4A 4JX5A 1P0KA 5I3DA 1NHQA 3FJLA 1HNYA 3APTA 4ROPA 2OWCA 2VX4A 1U2YA 4YVPA 3V18A 2W55A 2GGJA 1ZPTA 3DC8A 1ISYA 3EWCA 3H2OA 1NQKA 4Q4KA 3NL3A 5DANA 3T44A 1O12A 1CECA 4O14A 3LB0A 3E02A 5D38A 1U5VA 1O6IA 4QS6A 1SZFA 3AM9A 3MO4A 1E6NA 4H41A 4ZB5A 5GJMA 3QZAA 3ZLFA 4F2BA 1L8NA 4UQ9A 4S39A 1C8VA 4MDOA 2ISWA 5GNYA 4WXZA 1MQQA 3NZQA 3W1TA 1PJ9A 4DI8A 4S3BA 1YEYA 3WFLA 2OEJA 1PVNA 2DPEA 7REQB 3DUGA 5BZAA 4C6DA 2ZVRA 4PMRA 1IR2A 3OBKA 3D3AA 3WQDA 3R11A 4NX0A 4JY8A 3SFKA 5FL0A 5LXXA 4LSBA 1WA3A 3LHYA 4H7ZA 3QC3A 2Z1VA 2R14A 2NX3A 1S2AA 1VKFA 1S3HA 1V0KA 3SZ8A 1B2YA 4E4PA 4P7NA 1PV8A 1I45A 4GUHA 3UZYA 4RNIA 5BYWA 2WCAA 4DM1A 4ZXOA 1UR2A 1BRLA 2VRJA 1KFWA 1GTHA 3QLLA 1G5AA 3THAA 1B9BA 3CWHA 1LLZA 5CSUA 4F0RA 2WBKA 1PYFA 2QJNA 3LYEA 1H0GA 4KESA 5HAOA 2UZ9A 3I68A 3DU0A 4U28A 1WAUA 1W91A 4C6NA 2RHGA 2FFIA 4LUIA 3RYSA 2E8YA 3EXTA 5CGMA 2G95A 1P0EA 3ZSSA 4YMZA 3SGGA 1Q6LA 4XKYB 4I8DA 2V2DA 1OFBA 4PC8A 4C7DA 2H8XA 1HL2A 4AY1A 3C86A 3E49A 1NOFA 2YSWA 3OEXA 3S1WA 1EC9A 3WNMA 3TAKA 1J79A 1WB0A 2W4XA 5I7GA 2PWHA 3K8KA 1UWAA 3R8HA 1FFUC 3MUCA 2WBGA 3CYJA 4XZWA 1JQXA 5BU9A 1GWJA 3W2NA 1WZAA 3Q65A 3DAQA 4TUFA 5FJUA 1CGXA 2FHBA 2BZNA 1MQPA 4RPPA 3L4YA 5DXXA 4B5SA 3BARA 4KPRA 1H63A 1AQMA 4CCDA 2FJKA 4YPJA 3LHTA 1XLFA 1GGOA 1N8IA 2WZEA 2EEXA 3N9KA 4KEVA 5DY3A 5D4YA 1US2A 2PLCA 4GXWA 5B7ZA 4H4IA 1QCWA 3VDGA 4KMQA 1K8YA 2WJDA 3VZXA 3T8QA 2I56A 2XIJA 3C3UA 5JCMA 2WPEA 4DJEC 1TWDA 4GYFA 4YVXA 3HG4A 1X6LA 4FNTA 1QNSA 4ADTA 3WF2A 4H8VA 1A3XA 3LD5A 3DI1A 3TFCA 4HTBA 4K1GA 1RQBA 2H3DA 5LIUX 3LGEA 5AOUA 4XQ6A 3DZ1A 4DXVA 1DWJM 1YNYA 1LORA 1SB3B 1TA3B 3OZOA 1UD2A 3I7SA 1BZLA 5A94A 2ZXAA 3H7RA 4JTUA 4E5TA 3KVLA 1POKA 2QV4A 1GNXA 3QPYA 1KN0A 1XFCA 3IRDA 5ABTA 4MYXA 3P7YA 4HP5A 2L5HA 3AICA 3E2VA 2NWSA 4WSKA 2YCLB 2X41A 1VFUA 4DWSC 2J75A 3WMLA 1I8JA 4GYJA 3BG5A 4DJDA 2F61A 3AYRA 4YTRA 3BGJA 3L12A 1O95A 3M64A 2CLMA 3VOHA 3KXQA 5CBJA 1OGSA 1UD3A 1R86A 2J25A 5AVHA 5C7HA 1Q1RA 4LXFA 1RPKA 3LHVA 3PSVA 4JX4A 3UWVA 4IQDA 1ISWA 3EWBX 1VBUA 1UR0A 4JTQA 3S2CA 1E9IA 3M6YA 4DAIA 2HBXA 3GTIA 2QPUA 2E68A 1IEVA 1VZWA 2YYTA 2Z29A 2BXYA 4FXJA 1YE6A 5A8OA 2BB0A 3NEVA 4IX0A 3POCA 4BQ5A 4XZ9A 4MKVA 5A8GA 4NAFB 2VEGA 3P5ZA 3SY1A 1LLOA 3RITA 3DECA 5HJLA 3CPUA 5G5IA 3TFXA 1ZP4A 3PNUA 3MSGA 2A6LA 1M6IA 5K3VA 3QH2A 2ZADA 1T5AA 4KWOA 1XIDA 4JTDA 3BLEA 3U7BA 3BANA 4XX6A 3R8GA 3T2QA 2GQWA 5KZEA 1HKKA 4RDVA 4NY2A 3WL1A 1XLEA 1IF2A 2EQ7A 4FPSA 3PJWA 1SVDA 1WYIA 2I5QA 2X05A 3DX5A 3GBEA 1FEAA 1WYGA 3EZ4A 1V3IA 1QHPA 1UQZA 4JAWA 1D3GA 3ZXWA 4A3HA 3WK0A 4JIHA 3P82A 2BCPA 3EAUA 3E2QA 4H19A 5M17A 1HJQA 5FJJA 3WLPA 3RMJA 3MZ2A 2BP1A 4AZGA 3CV1A 2WC7A 2HRWA 4JR5A 1HKVA 1EKOA 1N8FA 4ZE5A 2VJXA 1V3LA 5EL1A 1I4NA 3ZVHA 1FWGC 2JEQA 4Q6XA 4AFYA 3NGJA 1U83A 3N9RA 2W92A 1XLHA 1LBLA 2XN1A 4FOKA 3N6QA 1WUFA 3CZ8A 3QQ0A 3TJXA 3OYZA 3G3MA 5LHFA 1MOKA 5H8PA 1N7KA 4WJ8A 4H4UA 2E6YA 4M5PA 3W2MA 1GESA 4GMEA 1XSIA 4ZA0A 3FN9A 2ZUSA 1H51A 3L65A 1ZB5A 5FAJA 2QCCA 2PPGA 3MPGA 2A3LA 3PFRA 2VFFA 4K1WA 3VKAA 5LHEA 1PXGA 2YGYA 1QPQA 3GYCA 3D9XA 3ORWA 3SY8A 5REQB 1E4LA 3PWAA 1RHCA 4PE8A 4B90A 2FZ9A 2DT2A 1T96A 2PDXA 2RABA 1KBKA 4Y7EA 2OYLA 2QCEA 3P0XA 5CLWA 3GDRA 4UZSA 2J8TA 4XVDA 4OV9A 3IGXA 1GZJA 2B7PA 1P4CA 2QF7A 1IEXA 1F07A 1DIDA 1EO5A 2ZX6A 3FV9A 2F38A 4PA8A 4RW5A 1RD5A 3QXBA 2QCDA 3KOXA 3GNDA 3CMJA 2CIPA 2W62A 4A35A 3AQUA 2GQ9A 4ZTXA 6TAAA 3SSJA 3OJGA 1MEIA 3TYCA 3WQ4A 1ESWA 4K37A 1E9YB 1FX6A 2C3DA 1MO9A 4C6IA 5LNVA 2Y5EA 4S23A 3AS0A 3MKCA 1K70A 1XIMA 4EXBA 4AHQA 4ERIA 3MKKA 2BOEX 3WF4A 2QCHA 4ZO9A 3UG8A 1ALDA 2VZUA 1LL6A 2A8XA 3FYPA 2PDCA 1QPNA 2J8FA 2CHOA 3WLHA 3NM1A 1E51A 3EMCA 5TAOA 2J7EA 3WQWA 1B9ZA 3KW3A 3MKVA 3W7OA 3WD1A 3EX4A 2OMAA 1E6ZA 1L6FA 2WNZA 3TN6A 4CGTA 2W3ZA 4NSBA 4QJ5B 4GIYA 4BCEA 1J10A 4GC4A 4AWSA 1V4YA 3VILA 3I65A 2PZNA 3M0HA 4M82A 4IXXA 4OHQA 2NQ9A 1R2SA 2ZTJA 3TJ4A 4ZQPA 7ODCA 4XO7A 2F6KA 3LI0A 1X38A 3XINA 2V3EA 2NVKX 4JBRA 1C29A 3T9PA 1QPOA 3TN5A 2OSWA 1UA3A 4Q4MA 4UTFA 1ZBKA 5GRTA 4EMIA 3W23A 2UBPC 1T41A 1J5TA 4MWAD 1VFTA 2D3NA 8RUCA 4F66A 3JVAA 3BO9A 1W1PA 3IEBA 3N19B 4OJYA 3LNPA 1Q2SA 1ZL1A 3W26A 5G4HC 4E4UA 3IK4A 3N11A 3KE0A 4JS3A 4PMDA 3E2RA 4C5ZA 1EJRC 4IT1A 5EMMA 3B04A 3M0LA 1QPRA 1RQEA 4EPKA 2XVLA 2CHNA 3QTGA 1BSLA 3HFYA 3ETRB 3S83A 2H90A 1Q85A 2KAUC 1QASA 3CLWA 4J3UA 3VCNA 2WM0A 4M6PA 4K8DA 1HP5A 2EF9A 4DZIA 4DY1A 3WBAA 4EXQA 3CO4A 3O6CA 2R1MA 2E6DA 5AC4A 5G5HB 1FWFC 3W1UA 3RGTA 1F61A 1NP0A 1QNOA 3FYOA 2A3CA 3S9IA 2VFHA 3ITGA 1E72M 3K1DA 2BX7A 1PPIA 1TR1A 4DN1A 5AC7A 4NKCA 1YLVA 3ITYA 3WNOA 4HPJA 2GR2A 1ZBVA 5JCIA 1JUKA 3SCVA 3O0KA 3APGA 4EP8C 3VOCA 4H2CA 1BYCA 2YBTA 3ZLHA 1H41A 5CC5A 1MFUA 2PWEA 1XUUA 3PWGA 2HTMA 2XGBA 4O1FA 1WDWA 2QCLA 4GXMA 1PKMA 2B81A 3HQNA 3GVGA 2G3MA 1YIXA 4IG2A 6ENLA 3SJNA 4HA3A 1RPXA 2QJHA 1R3VA 3M0KA 3G1SA 3HM7A 1TYPA 1PX4A 3WLOA 1MXGA 3MJMA 4JL1A 3S4TA 4YIWA 3TLQA 1X1NA 2F6UA 1AW1A 2WBAA 4IOTA 4HBKA 4RE0A 4BWLC 3STGA 3OGVA 3PUDA 1MNSA 3NVDA 3IGHX 1OFQA 5FESA 1HKWA 2JEPA 4PTXA 3HGSA 5DRCA 2YDRA 3VK5A 5AFDA 1B57A 2E5CA 3H2NA 2D24A 1ZS2A 1DJNA 1K8CA 2FZNA 4PTWA 1ADOA 2IPFA 4GYPC 3B40A 3CIVA 3HFTA 1OD0A 2DSKA 4JNYA 3USBA 1NFPA 4M1BA 4TX9A 4CU7A 1Q8JA 2V6AA 2ZZCA 4UCFA 1K4QA 2VR5A 4H9YA 5C9RA 3M4HA 1G4TA 4LU0A 4BQ4A 2IXUA 2RFGA 1ELSA 3WLQA 1BVZA 1TRDA 3VC5A 3EGJA 1DJGA 1F2JA 4PMYA 1GQLA 1D8WA 4O12A 3F5JA 5FF4A 5A8QA 2WWDA 2Y7GA 1JYVA 4FLOA 2DDXA 4Q7IA 2QJMA 1H49A 3CS2A 4MYAA 4PCTA 1CX9A 2GK1B 3L5MA 2B7OA 3EA3A 4ZMGA 3DH9A 1POJA 2C3ZA 2VENA 4OE7A 5XINA 4Q8OA 1UWRA 3LA4A 1A0EA 1KTNA 3UJRA 3AS1A 3VNLA 3UZWA 3EKGA 4I8YA 4DUWA 5XIAA 3CM4A 3A5FA 4UIOA 3WQCA 3D6NA 2HPIA 1OC5A 2VM8A 4CD6A 2C6QA 2GR0A 2CLLA 3QM3A 3STFA 2ANUA 5CBBA 1TCMA 1BXNA 1L6SA 2YQUA 4LAOA 3WG6A 3AYSA 2D2JA 1TV7A 4UNLA 4ZO8A 1GORA 2BY2A 4ORMA 3CGEA 1KXVA 4LOCA 2E67A 4O1DA 4M3PA 1C9DA 3VM7A 3L66A 5IFPA 5DCDA 4FHAA 3VU2A 1KKRA 3OGSA 2WKLA 1VQTA 3ANYA 3APYA 1QO2A 2WSPA 3QFEA 1H60A 3NVTA 4AISA 2CBUA 1XG4A 1ONRA 1LJYA 4HK5A 5ABEA 2QUVA 5AYZA 3BZJA 2UWFA 2WZHA 1EGVA 2PSNA 3A24A 3NYZA 4XD3A 3NQVA 1FWAC 3FYYA 3UG4A 3THQA 2BODX 3WNNA 4MY1A 3QJAA 3RHGA 5B80A 3KRZA 4DNHA 2OSXA 3EOEA 3O0FA 5C2XA 1LZOA 3QFAA 3TYUA 5AHEA 9XIMA 1AFSA 3CPGA 4CN4A 1YPFA 3SUTA 4KRUA 5LYRA 4XO6A 4OU1A 3RM8A 2P0IA 3OG2A 4PBFA 4F79A 3POHA 5K7JA 5CZ0A 1UD4A 2QUMA 3U6WA 3UJEA 4F0MA 4Y6GA 4EE9A 3W6YA 3M0ZA 3KZPA 1IXNA 1XH2A 2V2HA 1RBAA 2IPWA 1FA2A 4UTIA 1O5KA 4PUKA 5U4NA 2PAJA 4QP0A 3HQ1A 4XAFA 4AY7A 4JFSA 2HSAA 5JBEA 3SRFA 3RO6A 2X7VA 5M1TA 1WKEA 4H9XA 1KM3A 3UWEA 5LNUA 1YPXA 1XC4A 3BTNA 2ZQ0A 2A85A 4LUYA 1S2TA 3TH6A 2GR1A 1KRBC 3KM8A 3OW1A 2ATMA 5HQEA 3C2VA 5JIPA 3BOLA 2OQYA 4LNYA 3PC0A 1XGEA 3M0VA 3M44A 4P7OA 3T0AA 4B3LA 3S47A 4QXIA 3FHQA 4Q4QA 1XICA 4FLRA 1Q1WA 3EDKA 1D8CA 3GVQA 3DFNA 3H7UA <