3JW7A

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ile-l-tyr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
353
structure length
353
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 117
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jw7A01
2GDQA 2OX4A 3NFUA 3RRAA 3B97A 4E4FA 1IYXA 2OVLA 3MSYA 3P93A 4JHMA 3DG6A 5ENLA 1PDZA 1KKRA 3FJ4A 3OZYA 4DYEA 1W6TA 3R0UA 1BKHA 3N6HA 3JZUA 3IK4A 2PSNA 4Z1YA 2AKZA 4K1WA 1WUFA 3IJQA 3RR1A 1E9IA 3TW9A 2OO6A 1BQGA 2ZADA 4MMWA 5BOFA 2PTYA 3ZLFA 3CXOA 1EC8A 2P8CA 1FHVA 1MNSA 4GIRA 1WUEA 3QPEA 4JN7A 3V5FA 1ELSA 3STPA 2XH4A 3OP2A 2PMQA 5J04A 2HNEA 5FJRA 2XH2A 3N4FA 3R0KA 4IP5A 4G7FA 3P0WA 4DHGA 3RCYA 4F4RA 4GFIA 1MUCA 2QVHA 3R10A 3ES7A 2MNRA 3ZVIA 2PTZA 3V5CA 2AL2A 3PWGA 3I6TA 4IL0A 4HNCA 4GGHA 4ZCWA 1F9CA 2PGWA 4KT2A 3PWIA 3VC5A 3ES8A 3CAWA 3DFYA 3T4WA 4KEMA 1MRAA 3VFCA 4K2SA 3S5SA 4MGGA 3MY9A 1YEYA 2OKTA 3SJNA 3GO2A 3N4EA 4JN8A 4H2HA 4HCDA 2GL5A 3ENLA 4A3RA 3UCCA 3T9PA 3BOXA 4GMEA 2QJMA 2GGIA 4DN1A 2AL2B 1XS2A 3FV9A 2PP0A 4YWSA 4E8GA 1JCTA 3U9IA 3VDGA 1DTNA 4DWDA 2PTXA 1SJAA 4J1OA 4HPNA 4K8GA 3QTPA 3CYJA 2P8BA 1SJCA 3CT2A 3ZVHB 3EEZA 2P88A 3TJ4A 3UCDA 3DEQA 4DX3A 2PP3A 1SJBA 2XH0A 3Q4DA 3PK7A 1JPMA 3U4FA 2GGGA 4H83A 2OZ3A 2GGHA 2QDDA 3T8QA 2OQHA 3KUMA 3TTEA 2GGJA 1OEPA 2OPJA 2OFJA 3H7VA 3SSZA 6ENLA 2PGEA 4E6MA 2PPGA 3ZLHA 1RVKA 3DG7A 3UJRA 2RDXA 5FJUA 3NXLA 2PU1A 4DXKA 3DESA 3UJEA 3VC6A 3UXKA 3TWBA 4M6UA 4IL2A 2XGZA 3UJSA 3V4BA 4HCHA 1TE6A 2O56A 3GD6A 3P3BA 3RO6A 4FP1A 2DW7A 2ONEA 4Z17A 4KPLA 2OZTA 5FJPA 1R0MA 4E5TA 3HPFA 3VCCA 4ZA0A 3R25A 2ZC8A 3R1ZA 3THUA 4M0XA 3S47A 4ENLA 3Q45A 3ZVHA 2I5QA 2PA6A 1L8PA 1EBGA 4MKSA 3FXGA 4HCLA 3JW7A 2PU0A 3SBFA 3OW1A 2PCEA 3OTRA 3DGBA 5FJTA 3PFRA 4IT1A 1XPYA 3UJFA 5EU9A 4KWSA 2OQYA 3UGVA 4GYPC 3MUCA 2FYMA 1EBHA 4IZGA 4J3ZA 4A35A 4HYRA 3GC2A 3FYYA 3H12A 3H8AA 2QGYA 4H19A 2MUCA 3SN0A 3OZMA 3FCPA 3OPSA 1KKOA 3TCSA 1ONEA 3DFHA 2PS2A 3SN1A 2OZ8A 3UXLA 4IP4A 1KD0A 2OG9A 1JPDX 2PP1A 1EC9A 3T6CA 2QJNA 1FHUA 3GY1A 4G8TA 3RGTA 3SQSA 2QDEA 4H1ZA 1P43A 1JDFA 2HZGA 1R6WA 3QN3A 3I4KA 3JVAA 3DERA 2P0IA 3IJIA 4IHCA 4A6GA 4FI4A 4GISA 3IJLA 3VCNA 3QLDA 3I6EA 2NQLA 3RITA 3TJIA 5BOEA 3D46A 3K1GA 2XH7A 3SN4A 2POZA 1PDYA 4X2PA 1TZZA 2PODA 1MDRA 4EWJA 4GYPA 1ECQA 3FVDA 3MKCA 3BJSA 3MQTA 1P48A 5IDZA 3BSMA 2CHRA 3DDMA 3TQPA 3DIPA 2XSXA 3UJ2A 3CB3A 2AKMA 1KCZA 3NZGA 3QKEA 2AL1A 4E4UA 2GGEA 3H70A 2DW6A 2HXUA 3EKGA 1NU5A 4HN8A 3V3WA 1EC7A 2QJJA 2OLAA 3CK5A 4GGBA 3TWAA 7ENLA 4HNLA 3D47A 2P3ZA 3NO1A 1TKKA 1MDLA 5FJOA 3VA8A 3DG3A 3TOYA 2QQ6A 1SJDA 2GSHA 4ROPA 3N6JA 2HXTA 2FKPA 3MZNA 3ZLGA 1NELA 3R11A 3MWCA 2PTWA
chains in the Genus database with same CATH superfamily
1ZAIA 1DHKA 3RRAA 5I3HA 2PDMA 4RDYA 5HQMA 3DJGX 3P93A 1QK0A 2DP3A 4AF0B 1PDZA 1XDLA 1LF1A 3FA5A 1H41A 2C1HA 1ODUA 3RXZA 2ZZ3A 4AZCA 3N17A 4WSKA 3NO5A 4E8CA 3OBKA 3TDFA 3E0FA 1RUSA 4ZQPA 4IQJA 4D6HA 3QGKC 3HO8A 1BQGA 3HIJA 4FXJA 3TMLA 4DY1A 1XX1A 4PGLA 4LYRA 1E6SM 1B2YA 3M43A 2NQ5A 1JG9A 3TSDA 3PZGA 2X1TA 3TN5A 4GVIA 2Y0FA 1FX6A 1KM0A 3V35A 3RCMA 2J7FA 1QOQA 3CLMA 3SY8A 1OBAA 4NY2A 4OTKA 1TA3A 1KCXA 4DJFD 3TFXA 2J8GA 1L6FA 3VNLA 2E9MA 3BUVA 4QSFA 3W02A 2XN0A 1KRMA 3QR0A 1SO5A 2PDYA 3HQOA 3L4UA 1XDMA 4JTIA 1KM2A 3UG3A 1C7SA 5LNWA 2JEPA 3W85A 1HNYA 3KS5A 1AJ2A 3W73A 1UWRA 4JHOA 3W7PA 1N8FA 2ZDRA 2HROA 1Q45A 1PZ0A 5C71A 4LVGA 3L5MA 1UR8A 2PZ0A 2DFAA 2O4MA 1XBZA 1A5LC 3S4TA 1OC5A 3PZMA 4RE4A 2F84A 1MRQA 1P7TB 4HYVA 1XHCA 1UKSA 3BL3A 5FL0A 4JTJA 2UWFA 1XISA 3AIUA 3MY9A 2OKTA 2X0SA 5HOSA 2HNHA 1EDQA 1GQJA 1IWBA 3S2CA 1HF6A 1JXKA 3GBEA 4DQWA 3PP7A 2Y63A 4A3RA 5FEWA 2FH6A 5HINA 3GUWA 2ODOA 1Q65A 3BCDA 4D6IA 3MV11 2XDFA 3AICA 1ITXA 5HMFA 4BS0A 1BXBA 1XD0A 4E8GA 1JCTA 2VUNA 2OWCA 4LRTA 3DYPA 5CQ1A 2YXXA 1ADSA 3NDZA 5JBDA 3WK1A 2VENA 4PMRA 2PDKA 4JY8A 2BG5A 1OJXA 1IT8A 2QULA 3GE7A 3HTWA 1QASA 2XH0A 2FDMA 4LUTA 2XIJA 1SM9A 1WKEA 4O1BA 3CHDA 4B5XA 3AXIA 4L56A 4J9JA 5BMWA 4TO8A 4V27A 2ATMA 1VQZA 3EB4A 4AWTA 4U2YA 2ZUNA 4KRTA 1BRLA 6ENLA 2ZTJA 3C0QA 4IJBA 3C0LA 3UJEA 3HPSA 5C9WA 3L65A 3LNPA 4MTVA 1DQUA 2QPSA 5E1QA 3CL6A 5CPMA 3LD5A 3U7VA 4PSPA 3ZR5A 2XISA 4HCHA 4GBUA 2J9ZA 1XGZA 3VOJA 1M7PA 3WBWA 2J7CA 3A5VA 4QXIA 1Q7QA 1VP5A 3NR0A 4EPEC 4MFEA 4UTIA 2BDQA 4AQLA 4M0XA 4Q8OA 3M64A 2A3LA 2ANUA 3LB8A 4N2YA 3TNOA 1KFEA 1QOPA 3GTHA 5D9PA 2RDTA 3U2ZA 3VM5A 2NX9A 1UOZA 1VR6A 3GG8A 3VCRA 1PIGA 2VGBA 1XLKA 4KF1A 3DFOA 5MF5A 4I9TA 1FWGC 1UKOA 4C6FA 1UIPA 1ICSA 4I7UA 3OC4A 3UPBA 3ZM8A 1KV5A 3L5LA 3V1PA 4GYPC 1P1MA 3MUCA 4GINA 4LT9A 3R07C 1ICPA 1W9BM 3L66A 4IMCA 2ZX9A 1H6VA 5C9RA 2CXEA 4S3EA 5E70A 4LVAA 1KRCC 4J3WA 1N82A 1CXLA 5LIYX 2R1MA 3CV6A 3L68A 3HGOA 5BRQA 4NT0A 4WY0F 4AIBA 1ISWA 4UNKA 3W7OA 5GNYA 5IFTA 3G6LA 1C9DA 3T6CA 5KSWA 4NZCA 3S1UA 3RIKA 3WFAA 3LPOA 4JEQA 2GR3A 2W79A 4G8TA 1TUXA 3RGTA 1M7XA 1XM3A 2FB2A 3TTQA 4ZO9A 2CWXA 4WY0B 4Y96A 4M29A 4MLRA 4N0RA 5G2IA 1ML1A 1O1HA 3W9ZA 3L8KA 3KBNA 2YB4A 2WZMA 3KOYA 3LSCA 3GFYA 4DZ5A 3RITA 5BOEA 1TMQA 3KRSA 3G5EA 2R82A 3AUOA 3NG3A 4BKNA 1ZJAA 1PIIA 1JZ6A 4NJHA 2ZX7A 2WC7A 4MOZA 4MWAE 3BLPX 1GK8A 4JYFA 5JRBA 2I57A 2R1PA 4MAVA 5FF2A 3UVIA 1N2VA 3GKAA 2V38A 1XKYA 3DGZA 5ABFB 3MQTA 1IIGA 1ZXIC 1NDAA 4UTTA 1Q1WA 4V28A 2O7SA 4V1YA 5IDIA 4LGXA 1BHGA 5T26A 1HL2A 4HZ7A 1QBAA 2Q02A 4NIRA 2VCBA 5DY3A 3NL6A 4MNJA 1M03A 2AGTA 3C2FA 3HZ3A 3CMJA 4JOMA 4G56A 5A3HA 4AH7A 3WQGA 1C91A 1MO9A 1CGYA 1JCXA 1G0CA 4BQ3A 4PEEA 4AEEA 3NQCA 2Z2BA 1CB7B 1X6NA 2XWDA 1JFHA 5KEZA 1K70A 4US6A 3A5FA 1JI1A 3W7EA 1FOBA 1W17A 2DU2A 2C13A 2GDQA 4JDYA 2Q01A 3ITXA 5I3GA 1XXXA 1Z41A 3C8FA 1PX3A 2QZRA 1K6AA 3WDHA 1EKOA 4JIRA 5ECUA 2VGFA 1X7FA 1O4UA 1YQZA 2QCEA 2HE8A 1ZENA 1VIWA 4YTRA 3N73A 3B9JB 2H6RA 3R0UA 4TMBA 5FA5A 4Y9PA 3C3NA 4EMWA 2WQPA 3RLGA 3N2TA 3NQGA 3HW2A 4IWWA 4OT7A 2BLEA 4P7QA 3GQYA 3DFPA 3QV9A 3N9SA 2A3CA 1R3QA 3RX4A 3SO7A 1CLXA 4ML9A 1AZ2A 3A64A 2VFFA 1BF2A 3CXOA 5KZMA 2SFPA 3BCFA 4DJDD 3ZSTA 3O6DA 4FR1A 4AYGA 4O54A 5D05A 1YPXA 3V5FA 3QV7A 3STPA 4S2BA 1K6WA 4E8DA 3UETA 2WHLA 2GDVA 4C1KA 2Y5SA 4JIPA 2DZWA 3LCLA 3ARPA 3O2LA 4I90A 4XSLA 2V0TA 1Y0EA 3T40A 1A50A 3BG5A 3QH2A 2BXZA 1I8JA 1A4LA 2I14A 2RAGA 4IPPA 3MU7A 1GGOA 2V30A 7REQA 4NYYA 4O10A 1T8XA 3W1TA 4DI8A 4H9XA 3ELFA 1GRBA 4HNCA 2CLLA 3AFBA 3B04A 3FS2A 2GWNA 2VFHA 1KV8A 5HPOA 3EOOA 4LJ3A 3EWBX 3SR7A 3LHZA 5FF3A 4GUFA 4CQDA 1F05A 1V3KA 3H2NA 3DFYA 3VE9A 1IR1A 2YB1A 2FDSA 1JPHA 4DPPA 1ZJBA 1BEUA 3S5SA 3IVSA 5KVHA 1JZ5A 4IG2B 1XD1A 1LOSA 3BVJA 1MQPA 4JICA 4PUNA 3L12A 5A8MA 5FJJA 4QSHA 3UCCA 1V8EA 1FWJC 4DO5A 3ITYA 2C6QA 5L9FA 4HK5A 3W7MA 4UTWC 1JDAA 3PTKA 2HK0A 5D2YA 5BXRA 3VZYA 3U9IA 3FX4A 3NTYA 1HKIA 1QT1A 3B4UA 1TTQA 3RFAA 4K8GA 3H2MA 3EEZA 2QUTA 2Y7FA 5FS9A 3IV8A 3LU2A 5TNVA 3WBYA 5F7UA 4UC5A 2BX7A 3CWOX 1KWGA 4X60A 4NJJA 3Q6JA 2TPSA 2Z7KA 5EMJA 3GW0A 3FK4A 2QDDA 3GR4A 4MB4A 3UZ5A 1BWKA 5D2VA 2A4AA 3I10A 3KOWA 5BW6A 3WUFA 3HA1A 1JPKA 1WDQA 2Y61A 3W87A 3QVQA 2E77A 3K30A 3M5XA 1V0NA 1POJA 1DOSA 4C7FA 3TZNA 1PKNA 1PZ3A 3NXLA 1JEZA 5CGMA 2PU1A 3OGSA 4DXKA 2B0MA 1EO7A 1SU5A 3GDBA 3P84A 4RE3A 1MW2A 3BPWA 2J7DA 4CD8A 3MMUA 3GWQA 2EPMX 3ZMRA 1W32A 4REQA 3W2LA 5A6SA 3W7GA 1KW1A 3KP1A 3NEHA 4N4PA 4XUYA 3CZJA 1EUAA 2CDUA 1SUXA 4YVXA 1RCOB 1V5XA 4K39A 1VAHA 2J9XA 4Z17A 1YNYA 3LCHA 1F6PA 1XLGA 1Q13A 2QUUA 2Q3OA 4ZA0A 4TX9A 3BWWA 4HTYA 3AIRA 2ZRUA 2P1FA 3MV01 1PVNA 1LG1A 1QNSA 4LSBA 1MZRA 4K7YA 2I5QA 2PWGA 3B9EA 3B0XA 3IJ8A 5HNUA 2EAWA 3XINA 5HQEA 5T91A 1FEAA 4HPJA 3B06A 4QJ1A 1L2QA 2E67A 1X2HA 4J3XA 4JTFA 3EYPA 3VKDA 1KM4A 4PUEA 2P50A 1XH1A 5CEWA 1WA3A 3MMDA 2NLYA 4LAZA 2CLFA 1C3FA 2D2JA 3KRUA 3POHA 3PNZA 4A3HA 1GRAA 4HA1A 1ME7A 1R5YA 4UQEA 2Y8VA 2DZUA 2VM8A 2FGBA 4D6FA 1FEBA 3KBWA 1LM1A 4FF5A 3A12A 5ECVA 1POKA 1UD4A 3V36A 5G2WA 1N5XA 2XM1A 4AEOA 2GSJA 3SY1A 3DHFA 3CQIA 4B9YA 2X42A 4HKPA 4Z0SA 1Q8AA 3QR1A 4NRRA 2PDCA 1XBVA 2GUUA 1CLVA 4RXFA 2ISFA 4CCZA 1YE6A 2PLKA 3NL3A 3EB2A 4DXXA 1PYMA 3WLMA 3A4AA 5D2TA 3MS8A 3NQEA 2X16A 2BMBA 4GISA 2ZIDA 3ZT7A 3OLEA 3I6EA 1XANA 3H4KA 1XLHA 1XC6A 2W3ZA 5LGZA 3WH5A 1A3HA 3ERPA 1SGJA 1WAWA 4FLOA 3IWPA 2XIMA 4UR7A 7PTDA 4IIHA 2WJZA 5BU9A 3POCA 5CZJA 4EM3A 4EWJA 1EXPA 2D24A 4C7GA 5CPTA 4E38A 4MWAA 4BQ5A 1WBHA 3LZ5A 1J0YA 2D2HA 1REQB 1JXJA 1O6IA 1O5QA 1KGWA 3W7HA 1GKQA 2ZVIA 1OK4A 4Z2IA 3CUHA 3OB8A 4WQ6A 4TVDA 4HNOA 3PM6A 1Y8BA 4GRSA 4NNBA 3L4YA 4QEHA 4DO4A 2NUXA 2DZXA 3LI0A 3IAQA 1JCMP 4ADSA 4U2ZA 1FO4A 3KL0A 1KRAC 2WBGA 2J25A 1RA5A 4MB1A 1D3HA 3UR5A 4OFCA 1LVLA 1UKTA 4Z08A 4NNCA 4DB7A 1S46A 3TJLA 1SMAA 2OX4A 3NOYA 1N63C 3HN3A 1Z9AA 2DZBA 3RYSA 1LLWA 2OVLA 4R5EA 2JFEX 1S2VA 4JX4A 4P8UA 3QQ1A 3CGEA 1RCQA 3THDA 1AQHA 4OBRA 3OGVA 1SW3A 5E0CA 4LAOA 4Z0JA 3U7BA 1NEYA 3OVQA 3B0UX 3PZOA 1ZP4A 1S5NA 2ZXDA 3VI2A 3IRSA 2NLIA 1XDIA 2R1NA 3RR1A 3WLPA 3ABZA 1JYNA 3W76A 1CT5A 4TUFA 1GOKA 3NYZA 4HSHA 5EPDA 1WQ5A 5DT5A 3E5BA 1UROA 3DKJA 2OEJA 2BVDA 3FSTA 1QNRA 1YXDA 2PC8A 1E9ZB 4B91A 2J7BA 3CC1A 1FY6A 1P7TA 3KAOA 1XF0A 1F3XA 3DECA 1F6KA 1QI3A 3DYOA 4K8EA 3QFEA 2OYKA 2XH2A 3CZKA 3LY0A 1FCUA 1DQXA 4MVAA 4ICMA 4MWAD 4CCEA 1P0KA 5DMNA 3W29A 1UR9A 3LERA 3VXGA 4F0KA 2G37A 2QVHA 4GABA 4E2VA 3VIHA 5G4WA 4YTTA 2R91A 1QI5A 4S38A 3BO9A 1CXIA 2D3NA 4ZE5A 2X0HA 3WUBA 1VJZA 2X8RA 5U1OA 3EX3A 5BZAA 3EA1A 1TYTA 3W23A 4PCSA 3N18A 3E3HA 5BXSA 1WZLA 1GERA 3KLKA 4BI7A 3UWQA 2WJDA 4WKFA 4MGGA 4FX8A 4ZQOA 4H4IA 3CH9A 2PCQA 1YEYA 2XGIA 1XRSA 3W0KA 1HL9A 3NVYB 1EJUC 2VT0A 4URIA 2PUZA 3ABSA 5BXTA 1N8WA 3LYEA 1PTAA 2WBKA 2AAAA 4EF9A 1QPNA 3ME3A 3H7UA 5FS8A 3KL5A 3T9PA 3WENA 2WZTA 1U5HA 3S9ZA 4AIOA 3VD4A 5ABTA 1EJ7L 3OLDA 4GHRA 5FD0A 4GJIA 1UYQA 2VVSA 5FEXA 7CGTA 1DTNA 3GH5A 2DDXA 3R8GA 3Q58A 4J1OA 2AAQA 4KWOA 5G1TA 1IR2A 5KZEA 1NFPA 4AC1X 1HFBA 2J74A 5D38A 4JNMA 2VWTA 1OVDA 2V6AA 1VBJA 1Q63A 1EIXA 1SJBA 4QG9A 2XIIA 2BGQA 3IJ7A 5EB8A 1BVZA 1JOAA 4LFYA 3JR2A 1BKSA 1ITCA 1XGEA 4GZEA 2R1KA 2WZIA 4Q8UA 1DIEA 2EPOA 1VPYA 1MMFA 1R2RA 4TU1A 4LCRA 3VC6A 1UP3A 3SEPA 4L9ZA 5FACA 4AMCA 2YZ5A 1KBBA 4HNUA 3QFBA 4Q33A 3EOSA 2W3RA 2PBOA 1V6UA 2TODA 2DW7A 3MSDA 1NIUA 3PFMA 2TPRA 1XYZA 1WDDA 5FJPA 1R0MA 4DYKA 1IEWA 3HPFA 2VL4A 1UPMB 3VCCA 4QAIA 3UY7A 4PEKA 2Z1KA 4BHYA 1WXYA 1VPQA 3Q45A 4IIFA 2J78A 2BB0A 3SIZA 4MKSA 3H26A 2PCEA 1LORA 1XIMA 1YXYA 1Z48A 2ZZCA 1PKLA 3BV7A 3URNA 5K3VA 3MC5A 1XPYA 5JCMA 3DENA 1R30A 1X38A 2XIBA 2PDNA 5A6KA 2C3DA 4EWND 3TC6A 1S39A 2QKFA 2WXDM 4KS0A 3CMGA 5I24A 1RA0A 2E7FA 2O9TA 1AW5A 1N5WC 4J3ZA 1Q6DA 4TTGA 1JDEA 3GC2A 1DJIA 2QUNA 6A3HA 2BY0A 2NUWA 3CQ0A 2DVXA 4M6QA 1M5WA 3T42A 3ZJ6A 3AXXA 4QLLA 2QUVA 1GWJA 5CC5A 4Z1CA 4U28A 1E4NA 3ARRA 3DFTA 4LS0A 4Q7IA 1EC9A 1W8SA 4CLMA 2HISA 2YOCA 4PZVA 1Q7ZA 4D72A 5F2IA 4JL2A 3SRKA 1X1ZA 2Z2AA 2FPVA 1RVGA 1W1IE 3R89A 3GVGA 3R43A 1FCQA 4ERAA 3NEVA 5JH1A 3A13A 2BGSA 4IHCA 3B8WA 1XIFA 2GVLA 4FI4A 1TX2A 4XD4A 3AM9A 1B3XA 3ATYA 3WLKX 3LPFA 4XISA 3AMLA 3N11A 4YU1A 4WUIA 1SYTA 4ZTYA 5C9XA 1YTKA 5KITA 1UZHA 5CJMA 1KFJA 1UCWA 2QF8A 4GX8A 4GY0A 3CASA 1IHIA 3NYDA 4ZOAA 3AC0A 3TW6A 3WK3A 3NWRA 4GYPA 4H4YA 3FYOA 1PWLA 1A5AA 2EF9A 3BJSA 3E12A 4NAFB 2WJEA 1DBTA 3CT7A 1XH2A 5IDZA 1QHPA 3RRXA 1S5MA 3VUSA 3I68A 2CKSA 1DXFA 1JUKA 4H41A 3AYTA 4W8LA 1JUEA 4IQDA 3KTXA 2DW6A 1NU5A 4HN8A 2W4XA 3SCTA 2A7RA 2DEPA 2WNZA 1LL6A 3RCNA 1YHTA 3A3XA 3NSXA 5E9AA 2WMJA 3L4VA 1TELA 4XX6A 4BI5A 1NWRA 4JTQA 1TKKA 3W1QA 4P8VA 4PTMA 3N6JA 3GYEA 1DL3A 4N4QA 1V97A 1R46A 3GU2A 1DJNA 3GDTA 3ORWA 3URAA 3VK5A 5E6YA 4W84A 3MMTA 4V2XA 1E15A 2G41A 4LNYA 1H4PA 1ZK7A 7ODCA 2OOGA 2WCAA 1GZ1A 3WLOA 4PMUA 2QJGA 4JDRA 3USBA 1I4NA 4ZGYA 1V0LA 4KIRA 4W4QA 3T55A 4P7RA 3FAWA 5DRIA 3IK4A 4YCPA 4YLWA 4OECA 1W5NA 2XTKA 2G4JA 4UFJA 1QNVA 2Q71A 1R3SA 2ZADA 3W00A 4QE5A 3ITCA 3SUUA 3FG2P 4JTKA 2OTDA 3NZRA 3MCMA 1UP0A 3SFWA 3PUDA 5JVLA 1OHLA 4NXSA 1C8QA 3QPEA 4JN7A 4JHZA 1YXCA 5CPQA 1F3WA 4X3ZA 5FI8A 3S8HA 3CIWA 3HJEA 1E3ZA 5A6JA 2IKIA 3OP2A 3CO4A 4MDPA 1A0DA 4QIUA 4IQLA 2A7PA 4LS2A 3A23A 2X1SA 3VIFA 1Z7AA 2DUXA 1OY0A 1M7JA 4IP5A 3SM0A 2ZUWA 4GXPA 4JAWA 4ERGA 2BXYA 3SCRA 4GFIA 3M0VA 3CV7A 4O1EA 1TR9A 1XYCA 1W2PA 3C0JA 3VGEA 2C79A 1E0XA 1GOWA 1UZ1A 4NASA 1EZ2A 2JEQA 4AY8A 2VMFA 3EX2A 5AHNA 1MUMA 2DZPA 4Q4MA 1EHAA 3PF3A 4ZCWA 4X9YA 3CU2A 4UTUA 4O0ZA 1PTDA 4GIAA 3PB2A 2F38A 2CYGA 4MNLA 4MSSA 2BZNA 9XIAA 1BSLA 1E40A 2IQ0A 1LQ0A 4K3ZA 3ARXA 5CPLA 3T07A 3HJZA 4FNPA 5IHRA 2WLZA 3TE9A 3CS2A 1TV3A 4JZ5A 5DFAA 1VCVA 2QMKA 4TV6A 4GYKA 2W54A 4H2CA 3WMBA 2Z6IA 3GO2A 3OOQA 1ZBKA 3FLUA 4JN8A 3PBWA 3IRDA 3WK0A 1ZTVA 1GW9A 4DJEA 4OZOA 2HVNA 5DBTA 3B4YA 2QCFA 1QNOA 2QJMA 4Q8TA 5FOOA 4YHEA 4WVXA 4XTIA 1J93A 1NFBA 2ACQA 4L4PA 3IIZA 4RW5A 4GK8A 5D37A 4H8UA 1BYAA 4OJYA 3EOUA 1ITQA 2EKGA 3MYPA 4JTHA 2OEMA 3AISA 3VU2A 1FUYA 4IGNA 1AFSA 3TNBA 4F9DA 3DEQA 1YPFA 3S2MA 4K6AA 2Y89A 4C7DA 1AK5A 2NV1A 3B9OA 4ZXLA 3KM8A 1IXOA 3AMKA 1KB3A 1RXOB 1E1CA 4BURA 1A3WA 4WRHA 1UR4A 1K8XA 3UBPC 1U1UA 5FMHA 3KVLA 2R8WA 1VENA 2WW5A 3BMXA 3GNRA 3NQDA 4QITA 3PJXA 1JULA 1N55A 4QJ4B 1GZJA 2CCRA 3W7RA 5FCZA 3LCFA 4ZMGA 3P74A 2VC9A 2O56A 3BOFA 3QHNA 5AHIA 1Q66A 4WXYA 1S5WA 2ONEA 3K8MA 1G67A 4WSJA 4QBXA 4C6MA 2ZFAA 4UTWA 1SZRA 3UZJA 3R25A 5F4XA 3EMCA 1RD5A 3R1ZA 1EP3A 1S5TA 3F4VA 3R2GA 4NJIA 3S47A 5A94A 4UXDA 3VYLA 4C91A 3B9DA 2HPMA 1EQCA 1FWEC 4PTDA 4S23A 4CVWA 1BWLA 4QP0A 4F9JA 1KFLA 1EBGA 1LOQA 3WH6A 1V03A 1UKQA 1ZFJA 1NARA 4FNSA 4A8LA 3RDKA 3SQMA 1XSIA 1J96A 1QW7A 2CITA 4DJED 5EMKA 3S46A 3WL1A 3L0NA 4W8BA 1SO6A 3UGVA 2YSWA 3GH7A 3P61A 1FWNA 1W1YA 1WZMA 2O4QA 5XIAA 1GPWA 3PG9A 4UQAA 1OSEA 1NOWA 4HYRA 1FDYA 4QS5A 1XBXA 1XYBA 2DIJA 1WDSA 2AAMA 3DXIA 4PUWA 4ROQA 5FS6A 2DSUA 4PUUA 1PCKA 2G3MA 1NY1A 3ARWA 3EA2A 1XP3A 2AGKA 2VFGA 2ZWYA 2BHZA 1FWHC 1NAL1 4RJEA 2PP1A 1NWTA 4O0QA 1LZOA 3DCPA 3HURA 1KR1A 1AZ1A 1VS1A 3WLHA 4H1ZA 3U8GA 3THCA 1REQA 3PPHA 2FQIA 2VEIA 3SGGA 2WVTA 2JGQA 2ZCGA 2VX7A 2VO5A 5BRPA 4YPJA 1XLFA 2P0IA 4O57A 1EHNA 1W1ZA 3OG3A 2YPIA 4HZ8A 2Y24A 4AXKA 3AXKA 3W88A 1MXGA 1Q2SA 1BSIA 3TXVA 1B9BA 1HJXA 3C56A 1PDYA 5HPCA 1KBLA 4BV6A 4BQ2A 2HS6A 2W61A 5HWNA 1UWTA 1MDRA 3ZQ9A 1J10A 1OX4B 4POCA 2FTPA 3AWNA 3MKCA 4DWSC 3HQ1A 7TIMA 4EMJA 2A3EA 2OSYA 4EPBC 4F0LA 4H4WA 3IGUA 3OQ8A 4DNHA 1H7NA 2BVTA 2VX4A 2VZTA 5I77A 3C2RA 3AIQA 3RPDA 2PD9A 1IT0A 1E5JA 1J0IA 3U4AA 4M6VA 1Y5WA 5PTDA 4BQ4A 1XIDA 1G7VA 5HBFA 1ZHAA 4DELA 3F4DA 2P3ZA 3G1YA 4XVDA 3AHYA 2EQ8A 4YWIA 1W3JA 3N4AA 3NVDA 2GUBA 3OODA 3U6WA 5HMSA 3SRFA 3QC3A 2JF6A 2WMHA 1CI1A 2D73A 3MP4A 2DZTA 3LHTA 1H2IA 4PMJA 4F2TA 2C14A 2WBAA 4GNJA 4Z2JA 1QVBA 1JF5A 3S42A 1OG6A 1PZ1A 3B8UA 3MZ2A 1T96A 5I03A 4Q6XA 4PRWA 2Z00A 2FTWA 4R88A 5FF4A 3WLSA 3I7SA 3U2EA 3K5XA 4PCPA 4DYEA 2A1YA 1E72M 1QWGA 5D8WA 4CQBA 2WOQA 3EXSA 4Y7EA 4K1WA 1OFRA 5G1YA 3F4WA 3AIEA 4O4WA 2G3IA 3WQ4A 2OODA 4L9YA 4AXNA 5DY2A 1T5AA 3C61A 3NAVA 1M6IA 2UY3A 1YDOA 3QZAA 3N19B 3N1AA 1FHVA 5EMYA 2NW0A 4UTHA 3AO0A 3WLRA 1FH9A 2PWVA 1PIFA 1GEUA 1ZMDA 3M44A 2W63A 4FDCB 4C6QA 4WJXA 3CM4A 1UD2A 2UY2A 1V51A 2XN1A 2JALA 3ARYA 1D9EA 3KHJA 4KKXA 2CZDA 3TYAA 1FECA 4GVHA 1XCWA 2WKJA 3P0WA 2E1WA 4WDUA 3BOLA 4F0SA 2DZVA 5AVHA 1MUCA 2RJHA 2ZZ2A 3B40A 4DWSB 4L4MA 2QW5A 1KXHA 2YDQA 1ONFA 1OFAA 3W37A 4D1IA 4MM1A 2D20A 3M07A 1T99A 4GGHA 3Q2DA 3L2LA 3ES8A 2FHCA 3VNKA 1IXNA 2QCDB 3CAWA 3WUGA 5I3IA 4HU3A 2ZUSA 4IPNB 3ABOA 3TR2A 5EMMA 1D8WA 3N9KA 2I9UA 2VDHA 1EQPA 3QOKA 5A5WA 1BTCA 3O3RA 1UWSA 3KRBA 2VR2A 5LNVA 1EDTA 5A69A 1XIHA 1KCLA 1NDYA 1GOIA 3BOXA 1V79A 4RR4A 3UWEA 4DN1A 2AL2B 2Z24A 5F4SA 3IARA 5EYWA 2WVUA 1GVFA 2Z27A 2YZRA 3W7QA 2QVNA 3KBSA 3TK7A 4GC4A 2VVNA 1E43A 1CDGA 4YWOA 2D0HA 2HQAA 2RDUA 1AH3A 1NJJA 1W31A 3TXZA 3EANA 3CYJA 4C6IA 1F8MA 4AD2A 1LBMA 1NQ6A 3UCDA 8XIMA 3UG5A 4ALDA 4IPJA 4NP7A 1L0PA 2H8XA 1UD5A 3QEZA 3U4FA 1JCYA 4JKLA 1FWWA 1R3TA 4B2DA 4QS6A 4H4ZA 2E4TA 4GUGA 3OA3A 1Q4WA 4UTMA 1KRBC 3CAQA 5FSDC 3PJTA 4RX0A 1TWDA 3CO8A 1OEPA 4ZQMA 4UQCA 4QLKA 1BYBA 5M17A 3AQUA 1LJYA 1V4YA 4IGSA 4US5A 4CEUC 4DBEA 3TSMA 1UZDA 3IUIA 3LLFA 4AYSA 1SZNA 2VR4A 4IL2A 2XGZA 1RBAA 3GR7A 4AB4A 3GXIA 4AY1A 5A6BA 3VOHA 3FXYA 3IS4A 5HJLA 2OU4A 1U22A 4MAZA 1MSSA 5IHSA 4GQRA 4AVNA 4LAKA 2Z1XA 3GDLA 2X2GA 4XZHA 4AUBA 4ZENA 2VELA 2IPWA 3WD0A 1DJQA 4JY9A 4IICA 4IPLA 3W25A 3S6OA 1OGSA 4PTNA 3WBEA 2Q8ZA 1B0IA 3DU0A 3WLQA 3WF0A 1D7KA 1F7BA 1WDPA 1P0NA 2QXWA 5REQB 4FNUA 4RPPA 2A3BA 1X6UA 5JU6A 3LV5A 4H9MA 2CIPA 1WKDA 4L6OA 4H3DA 2WLYA 1V3HA 2HTMA 3HGJA 4XV0A 4LOCA 5XIMA 3TEVA 5I06A 1NDVA 4LYKA 3II4A 3H8AA 2DV0A 1JR1A 1IEQA 1VBRA 3CHFA 2YFNA 3SN0A 3BC9A 3H55A 2WYSA 4APNA 1UZ4A 4EOUA 3FEMA 4HTBA 5G2HA 3VNJA 5C2GA 3TP4A 2A79A 2D2GA 2DQXA 1V3LA 3OBEA 5I7GA 4NAFA 4B2DD 2WVVB 3VUPA 1IEVA 3NQ2A 5A6LA 5AY7A 1QPKA 3T78A 1P43A 1KQZA 3NM1A 5G4EA 1WOAA 1BG4A 4A4AA 4HA4A 2XUCA 2VOMA 3A7UA 2GVGA 4J3UA 2F6XA 2E09A 4O12A 3CUZA 4DM2A 3WLTA 4US5D 2ZOXA 3QLDA 3PZ9A 5IFPA 3MJYA 3CGBA 2DSVA 2Z7GA 2TYSA 3AJ7A 4GFSA 3E0WA 3ISIX 5CXPA 3FOKA 4XZWA 5A6BD 3TFCA 4M24A 4X2PA 5EMUA 1V3JA 4K38A 4CD5A 2I9EA 1CXFA 2OJPA 3ZYZA 4Q8MA 1EJSC 1AJZA 3GXDA 3B9NA 4X2RA 4MG4A 5DCBA 6REQB 2WVSA 1EJXC 3EPNA 5G5GB 1P48A 1I2PA 2G95A 4X9SA 4Z2KA 3ZSSA 2XFRA 2FHBA 4KCTA 1DJZA 3TOPA 3LB0A 1PYFA 1XYFA 3KVKA 2ZUVA 4KCWA 4J3SA 1YDVA 3A7RA 4B90A 5JCIA 2CPUA 2X09A 3VNZA 4GGBA 3GH4A 3CUIA 1RR2A 3RM9A 4DZHA 4HNLA 1UD3A 3FNDA 1SW7A 1E0TA 3KBMA 2BVWA 1GG0A 4O8RA 1CLKA 2O7QA 2W91A 4HK7A 4HMDA 4L7ZA 2QQ6A 3ZR6A 3F2CA 1JZ2A 2YQUA 3SSJA 1TA3B 3U48A 1TJPA 1W5OA 1DJWA 9XIMA 1QW9A 3G18A 3O15A 1JCNA 1GORA 3NSNA 2EGZA 1RQEA 2QGHA 1XIBA 4FNTA 3LCWA 1BQCA 4LVFA 3RO8A 3W2JA 1E6ZA 4Q4QA 1VBGA 3RLHA 1MI3A 4NILA 4JTSA 2OSXA 2J7GA 5GVJA 3GHUA 4A8NA 2Q8XA 5KZDA 3AU6A 3KVMA 3S5ZA 3W24A 1YX1A 2IPFA 2C91A 1KGXA 4G6CA 1NPXA 2EBNA 3BLDA 4MY9A 5KINA 5M2FX 1XYMA 3WQOA 4XIAA 2JK2A 3WEZA 1E6QM 1NHPA 3LRKA 1GSNA 4DZIA 4AAJA 2E1DA 1H61A 2G8ZA 4C90A 1IZKA 3UY8A 3N9RA 4HNNA 4H9UA 2PRHA 3KWSA 4YMZA 1E1EA 4UMBA 5I5RA 5I09A 3E2VA 3H2EA 3B8TA 3H23A 5J04A 4HA0A 1K9TA 1S38A 1X8FA 3KOXA 3N29A 1ZSXA 3F5LA 1ZLPA 2H9AB 4LX4A 5EA9A 4GYFA 4PMZA 1E9YB 2RH9A 3G6MA 1XLCA 4RV3A 3BW3A 4GJJA 2H8ZA 1A5SA 2ZDSA 4XAFA 4QQ3A 5M3WA 1H63A 2B81A 4ZZ9A 4AD3A 4E3VA 3GNDA 5F2LA 5LHEA 4NX0A 2PZNA 1R3WA 1VIZA 4PB4A 2PGWA 1T41A 4P61A 4PODA 3NOEA 1Q8JA 3GG0A 3HQPA 1VFSA 2GSEA 2ACRA 1PO9A 1J5TA 1X1NA 4J4KA 4DJDC 4ATLA 1JYVA 2YVFA 1MEHA 1K9DA 1BRLB 3SJ3A 4FLRA 1EGMA 1EWDA 1YYAA 4D6EA 2FMOA 5AB3A 3WD3A 4I9JA 3UW6A 4FIRA 2X50A 1ZAHA 2TMDA 1IWAA 2X7WA 4JFUA 1XCXA 1DWAM 4L61A 1XS2A 1W9PA 2ZRWA 3ONBA 3UYIA 1Q6CA 1GQIA 4AFYA 3SRDA 3VKKA 3CGTA 3P8IA 4HU0A 3NJ3A 4NRSA 2GQ3A 5CAKA 3DBPA 3KCOA 2RFGA 3CUGA 4WJEA 2BODX 2PTXA 3TC3A 1J18A 1Q85A 3FW6A 4LS1A 2P8BA 1J2WA 1YE4A 2CHOA 4LUIA 2FGLA 3UPMA 4KQNA 3A47A 3EWWA 1R85A 3CXBA 4H83A 1KTNA 3ID7A 2OEKA 2DSWA 2UZ9A 5K2ZA 1VFOA 1V6WA 3SSZA 3ICJA 3PTDA 3GU1A 4UTJA 5T9CE 3HBLA 2NV9A 1EF2A 3ZLHA 1DQWA 2CBUA 3ZS4A 2DT3A 3IGXA 2O9RA 3CTLA 5H1WA 1NF7A 1H3GA 4KMQA 2ZRVA 1E0WA 1CCWB 1W2VA 3DI0A 2E5AA 3C52A 1E6RA 1M04A 4JYDA 5LGXA 3AOFA 3VO0A 2YA0A 2C7FA 4L65A 1K7EA 4NEWA 2FZ8A 2CXGA 2X1RA 2PA6A 4QCFA 4Z42C 5LSMA 4B5NA 2R9RA 3UCQA 3JW7A 4C6OA 3THQA 3DGBA 1WOBA 1TJ0A 3F1QA 1I2NA 2ACUA 3A21A 1EWEA 3T0BA 3PFRA 1O94A 3AJXA 5C0QA 4CNSA 2W27A 1W54A 3TTOA 3B9AA 2BFGA 1DORA 3PPFA 4ML4A 4J35A 4U31A 1ZBCA 3QMSA 4JKMA 4MUZA 5C9UA 3N13A 1RPKA 2V5DA 3CIXA 3NXFA 1PPIA 3HG4A 1L6YA 1EBHA 3WDJA 2Y5JA 4W8AA 3STGA 2QR6A 3FYYA 2R9ZA 3KBVA 3NPVA 1TPB1 2MUCA 1A80A 2G4FA 3HPAA 2QIWA 4IIBA 1I9CB 2C8NA 3VIGA 3GRIA 5BMXA 4C6BA 1F74A 2VJXA 3WH7A 4IXHA 1KFCA 2PGRA 4CEXC 2PTDA 5ABGA 2PE4A 3EDDA 1KBJA 1PEZA 3PG8A 4B16A 1TV7A 1KTBA 4PUJA 3L23A 1YDNA 4XAZA 1WPCA 1O68A 1LPFA 1J0JA 2C19A 4O50A 3TKFA 2Z1VA 5CC6A 3EZ4A 3W38A 1EZWA 3PY2A 5AHFA 3VINA 2WSRA 4QNWA 3G1DA 1TG7A 4XSMA 2NSXA 1QWKA 3WNKA 5FESA 2NQLA 1N7KA 3M0YA 1H09A 3BLIA 1LDCA 4EQXA 3SFKA 3GUGA 4UFKA 2OT1A 1UOKA 5EKYA 2VEGA 2P10A 1D3CA 2YBTA 2VWSA 1TCMA 4HPGA 1UH2A 4C6PA 3S9YA 4B3LA 2FB3A 3T8LA 1YQ2A 1GVSA 1H0GA 5A95A 4WX2A 2IS7A 4H7VA 2YGYA 1LWHA 4HMNA 3VMNA 4W86A 3DFSA 4TX6A 4YNGA 3M0HA 4W7UA 4HPXA 3VM7A 2PWFA 1TZ9A 1QCWA 1UPPA 2BVYA 2G50A 1TJ2A 3LDVA 1UW9A 4HD5A 1C29A 2C3CA 4K1GA 4HP5A 1GG1A 3TC7A 5HNRA 4XZLX 3LRMA 5HXMA 2QV5A 1M53A 5AYBA 1J0KA 4N9EA 4GPNA 2FVKA 2J4GA 3LXCA 2XHYA 3IACA 2W0HA 3JU2A 3G8RA 5I3DA 4HYWA 1JGMA 2X40A 1UR0A 4CNUA 3NFUA 1UA7A 4E4FA 1IYXA 1E71M 3RM4A 3NQBA 2CZVA 2YLLA 4NZ3A 1D8CA 4CNPA 5D9MA 1E1FA 4JHMA 4K7ZA 3HF3A 4G1KA 4TTUA 1FFRA 3ARQA 4JIIX 1JRBA 2Z25A 1R7OA 3WNPA 1KBKA 1GQNA 3FHAA 4UTFA 2ZZBA 2D0GA 1KCKA 4NAEA 2ZZ1A 4DWSA 2CZFA 4LBUA 1WYGA 3UERA 1ZDLA 3CIVA 1K1DA 4I7VA 5GJMA 3SRHA 1I2RA 4FLSA 1FRBA 2G3JA 2B31A 1ZBWA 4GVGA 2CU0A 3GC5A 3VKAA 3LRLA 3RR4A 4EACA 2ZA3A 4QNEA 3AHXA 1US3A 1J79A 3SCWA 1W0MA 2QCDA 3PANA 3KTCA 1FCBA 1SPQA 1J6PA 4JQ3A 4X0NA 1YW1A 4LPCA 1RJQA 2E40A 3MVIA 3DUGA 3APYA 2P0OA 2NVKX 4DHGA 3WQPA 1UASA 1FWAC 3SDOA 2BY1A 5CH9A 4IMAA 3VIPA 1QNQA 1OADA 2AQVA 3TQVA 3CYVA 3O7UA 2AL2A 3FYPA 3TTYA 1AVAA 1UUQA 3OVRA 3KLLA 5DF0A 3WH8A 4NKCA 3VMPA 2V5JA 4RE2A 3CTTA 2ZKMX 1XW8A 2R14A 3T2PA 1GREA 5C7VA 4S3GA 1GYNA 4GCXA 1UWIA 1LRNA 1KTCA 1SZEA 1KM6A 3F5JA 4GKTA 5EFFA 2HQMA 3BGJA 3WFLA 1NP2A 4NHVA 4A22A 1Y7VA 1TV4A 2QCHA 5AYIA 3MYOA 5A8NA 4D8LA 3LCIA 2OYLA 4REQB 2J24A 1GHRA 2OB3A 5F2MA 4A21A 4D6DA 2DZSA 1W3IA 3FV9A 4DBWA 1M7OA 5A8PA 4MWAC 2JKEA 1GKRA 3ZO9A 2ZRXA 4EK7A 4RUBA 2O55A 3A22A 4DWSD 4AHOA 1PAMA 3EXRA 2V82A 4FXFA 3NIYA 6PTDA 4N6EA 4QLJA 4DBDA 3P82A 1WXJA 3CB8A 4FNRA 1OD8A 3OVGA 4QE4A 4JQ9A 4GQQA 4DRSA 1TMLA 3PWAA 3S1VA 2D22A 2UV8G 4OUIA 3QKZA 1PTGA 1JRCA 3PS7A 3UFYA 3MO4A 4GWEA 5AC7A 4E2BA 2J88A 3G1AA 5DELA 3RPTA 1VYPX 4B5UA 3W27A 3H7VA 4JXCA 1W5MA 4TVCA 3PBGA 1LWIA 1HUVA 4EQRA 3OLGA 1C7TA 3DG7A 3UJRA 5FJUA 2E28A 3GDKA 3DESA 2NQHA 1SW0A 3ARVA 2WOVA 4JFTA 3UJSA 3MCNA 3GXNA 1RSCA 2V68A 4TX8A 1XLBA 2POTA 2H3DA 5D09A 4E5TA 3VKCA 4BJHA 2Z6JA 3W74A 2CLEA 1SR9A 1U1HA 2BHYA 3GDRA 1QUMA 4BCEA 5GPRA 3K4WA 5I79A 4JPGA 4R85A 1EP1A 3NQFA 1CZ1A 1WV2A 2PU0A 4TV5A 3OTRA 4I6KA 3TN4A 2GQAA 3G1RA 4RDVA 2R94A 2WVVA 5I0DA 4WEVX 4GH3A 2YCKX 4XQ6A 2P76A 3VOCA 5EU9A 1MUWA 3O1NA 3H4XA 4QAWA 1KFWA 3Q67A 3BGAA 1S2TA 3W2KA 1HZYA 3EKLA 3NQMA 2OWXA 4A35A 3SCNA 2GJRA 4IPIA 4MWAB 3LPGA 1PSCA 2DVTA 4NQ1A 2XM2A 2GOUA 5TAOA 2WC3A 3W7IA 1B3VA 3OPSA 1XLAA 4W88A 4ZO8A 5A2CA 2I5IA 1ZCCA 2PF8A 1KD0A 1R2SA 4DLFA 3RNDA 1G4TA 4NNAA 6REQA 1JCJA 1IGWA 4D1JA 1XGDA 2ZRYA 2W3SA 4R27A 4H00A 1KBIA 1UBPC 4LTSA 2GLKA 5CBIA 1CYGA 1GOOA 5DXXA 3QY8A 4O52A 4FMVA 4Y2WA 3TZFA 3MI2A 5A6MA 1AD1A 2VC6A 3P2VA 4LUSA 4XO7A 1TV2A 4S3AA 3QSRA 3SQPA 4A3UA 1JAKA 2IPGA 1H7WA 5CZ0A 1SFTA 2HCVA 4IIGA 2LLEA 3RAOA 3WF2A 3SURA 4PE8A 3DK9A 1BZLA 1ECQA 3MUY1 2PBGA 2PI6A 2OKOA 1W9VA 3E2RA 3G3MA 3O16A 2OLSA 4H4XA 4IP7A 2CHRA 1F07A 3O05A 4EPKA 4YTSA 2YBVA 3O0FA 4JKKA 3KEHA 3NZGA 3H6OA 2HXUA 4PL2A 3LGGA 1M65A 3SGUA 1EC7A 4GIEA 3WG6A 1FP9A 1ONRA 3VKJA 4D2JA 3LI1A 4MF4A 1OCJA 3UESA 2WNWA 1MDLA 1MW1A 2XFFA 1DV7A 4WIWA 5HMEA 3OBAA 3L67A 3BSHA 1SJDA 3MBFA 1R3YA 4JTEA 2JGYA 2FKPA 5CG0A 3MZNA 1O5KA 3IPWA 3HG2A 3L5AA 1ME9A 1R7AA 1JI2A 3A7AA 2X41A 2Q09A 1R38A 2J75A 2O0TA 4HIBA 4QDMA 1RD6A 1W5PA 2E6DA 1FBAA 1Q6QA 3D6NA 2CLOA 4KCVA 3NA8A 3NQ7A 2H9AA 3T44A 1OFPA 1ISVA 1VRDA 1WX0A 3LGEA 1DP0A 3MUZ1 1TR1A 3AZSA 4HGXA 1ZAJA 3L4XA 3HPXA 3MWAA 2G97A 4KGLA 4DM1A 5BOFA 4QGCA 4HHPA 2WMIB 1X1OA 1UH4A 2P8CA 3LZ3A 5A2BA 4ONVA 4YTUA 4PTVA 4FB7A 1HJUA 3BMWA 3IUHA 5CC3A 5CKSA 9CGTA 1XKJA 5IRPA 3LOTA 1O1ZA 3GXMA 4ZB0A 1IIHA 3K13A 1GNXA 4QDPA 2GPTA 1DJXA 1TWZA 1CGXA 4OBSA 3R0KA 2XWEA 4G7FA 4RXGA 4F4RA 1OT1A 3S1WA 4M1RA 1MW0A 3LTYA 4MZ1A 1G4EA 3CPUA 3VABA 2ZZ5A 3P0XA 2INZA 1ZBVA 4EPDC 4GO9A 2RHGA 3L4TA 3VOIA 2GOKA 4HU4A 2Y4SA 3BK0A 3FA3A 1PUDA 4ZXOA 5C2XA 5FEPA 3M0JA 3HFYA 3WDQA 3LEPA 1GT8A 2QHAA 1K8YA 3R0DA 4G9PA 5CZSA 1BYCA 3N2MA 1D7YA 1GPFA 1E6PA 3TU9A 2C15A 4RLIA 3N4EA 1JZ7A 4AW7A 3D0CA 3VGDA 2E5CA 3EX1A 4HNVA 2KX9A 4TVWA 3O8AA 3ENLA 1A49A 1E51A 1QXLA 4FPSA 3CZGA 2GGIA 4H4TA 3W83A 1RBOB 1OCQA 1VJIA 5A2AA 3IVTA 1VHNA 7XIMA 4DXVA 2C0AA 1CGWA 4HPNA 5JUVA 2BC0A 3W1UA 1JEHA 3NVVB 3TJ4A 1HX0A 1B3ZA 1X97A 2QLYA 4JEJA 4Q8VA 1K7FA 1XSJA 3PK7A 4ORIA 1ZS2A 3OZPA 4LEQA 3O63A 5TR3A 3E96A 1RHCA 4JTDA 5LXEA 1JPMA 4UMCA 2OZ3A 2ZA1A 2GGHA 5IM51 1QJWA 3P14A 4LALA 3T8QA 3S2NA 2FLIA 4WR3A 4H6EA 2YKKA 3ITOA 3GNXA 4OBTA 5JCNA 1EGZA 4GXWA 4WKHA 4DJDA 4U5IA 2WZHA 4NZ5A 2W6RA 2G5WA 4E0CA 5HNTA 1YNQA 3UWWA 3EF6A 1O60A 3JUGA 1AL8A 5CSYA 1K4QA 4LAMA 2PDBA 4BA0A 1GQKA 4R7JA 2B7OA 4AWSA 3LENA 1YKWA 4CNNA 2JK6A 3GSMA 4ZODA 3AYVA 1KGUA 4UOJA 2CC0A 3O9NA 4GLEA 1VJSA 3LBMA 1SFSA 2WJFA 2WANA 3S2LA 2YL5A 1NTHA 4PTWA 2J47A 3P80A 3QQWA 3IJ6A 3RJYA 1KC7A 5HATA 1FWSA 3RX2A 4MZYA 3R5EA 1BLIA 3ZVHA 2ZZ6A 3AXHA 3W1NA 1E6XM 3C5QA 4GIYA 5K9CA 3B03A 4AY7A 3PSVA 5I07A 2CEQA 3I7QA 1QK2A 4L4LA 4CKQA 3WJWA 3PBYA 3NGFA 1BD0A 4KFOA 3K8LA 3W1LA 1TV5A 4DBUA 4MY1A 1V77A 2PWUA 4X63A 2GJNA 3ALFA 4O18A 1UQYA 2F5ZA 1RZMA 1R2TA 1RPXA 5AHLA 4IOTA 2QGYA 3ITLA 1PWMA 4KESA 2YYUA 4YS1A 4GA8A 2CETA 3OZMA 3K2GA 1KO0A 3GTIA 1PV8A 2PS2A 1TYGA 2GJLA 3AS0A 1QO2A 1VHCA 3SN1A 1XLJA 3FDKA 2DY3A 4B9ZA 1FHLA 2PFHA 2PDUA 4QISA 3HG5A 1L6SA 3U2CA 1G9HA 1ICQA 1BXCA 1R6WA 2E8ZA 3RU8X 3LADA 5LA1A 4AIUA 3P5YA 4PMYA 3EUB3 1PZ2A 4DJEC 1JUBA 5AHMA 1MXDA 2FVLA 4TXEA 1W1TA 3PVFA 4G7EA 1PL9A 2DSKA 1U2YA 1EIBA 4MNKA 4XO6A 5C6MA 4LC8A 3I3DA 1TZZA 1V08A 2WSPA 4XZIA 1TX0A 1STZA 1M6JA 4INFA 4MB5A 4FOJA 3PZUA 2R1LA 1X39A 4KFPA 4NSBA 4QEEA 3SCOA 4J56A 1H0IA 2NWRA 2WPCA 1ZL1A 5LHFA 5AVNA 2HWGA 4L6HA 3V0SA 1EOMA 1GKPA 3LSBA 3W7DA 5E0KA 4C6NA 4JBRA 3H2FA 4DAIA 1AA1B 2NVDA 3MB9A 3RX3A 3HRDC 1XWYA 1WNOA 4YCOA 3A6OA 2VKZG 1NHQA 4AMAA 1GVYA 4HOZA 4GR1A 3TOYA 3S6DA 2FZMA 1G1YA 5FSEC 3TV8A 1HJSA 4RNFA 3CLWA 3ZFHA 1DKWA 2QUMA 3LA4A 2VRJA 4RZ5A 4UUIA 3LXDA 3H7RA 4B3KA 1BGAA 5A8OA 1PCWA 4AISA 3TVAA 4PUMA 4TVUA 3N34A 2C1GA 1X8CA 5LYRA 4Y9OA 1AH0A 3RF9A 3DH7A 1W6TA 4CD7A 4RNIA 1GJUA 3FJNA 1XQKA 1BKHA 4ZO6A 3D5HA 1BVWA 2Z0IA 4O14A 1XINA 5B80A 3UZWA 2J77A 1Q5MA 1TWSA 3QF0A 1JZ8A 4DNAA 1MNSA 4H8NA 3WMCA 2ZQ0A 1X98A 3M0KA 2ZX8A 3NGJA 4CN4A 3UXDA 4CU7A 3VZZA 5H8MA 4KEVA 3W7CA 2Y7DA 4ACZA 3EDJA 2VYOA 3HMJG 1RJRA 4AHPA 3VTRA 3GTXA 3BV4A 5A8QA 4ZQCA 4AVFA 1U5JA 4HT3A 3V16A 3SCVA 3TN6A 2FIQA 3BE7A 1FWRA 5A8GA 3S5OA 1LRTA 1NDZA 2ZUMA 2IKGA 1LT8A 3ES7A 1OC7A 3C6CA 4XIMA 3WBXA 3L7RA 3NO3A 4ERIA 3GB6A 2VFDA 1W8GA 4HK6A 3UD6A 3PWIA 3ARTA 1DWIM 3VC5A 1J8VA 4LAUA 3ONCA 1E1CB 1M9HA 4O53A 4NZ1A 4YL2A 1DWHM 1SQ7A 4GZ7A 4U5KA 4ZFMA 2WSQA 1W1VA 4H7CA 2HV5A 1TQJA 3TQ0A 1V6XA 2WPBA 1R86A 2Q6ZA 4RDZA 4C6LA 2B4GA 3URQA 1V6VA 3MVTA 1H2JA 2JIWA 1OFOA 4DYJA 4U3AA 1AL7A 3UP8A 3R12A 4C6JA 4UTLA 1O5RA 4E3TA 1I2QA 4D8AA 2CNCA 2G3NA 1S1RA 4ZEPA 5TF0A 4UQ9A 3U57A 1YBQA 2WCSA 1A5KC 3VNMA 1LUCA 1Z42A 1FWDC 3CUJA 3KX6A 4GUJA 4Q8NA 4IQEA 1QI2A 3V0TA 2E9LA 4S3DA 4WCJA 3LXAA 1K7XA 1DIOA 4Q7NA 1EBDA 4NZJA 3CGCA 1TREA 2YJQA 3FHQA 5JIPA 3AHZA 3GXPA 2XFYA 4CD4A 5T9BG 1Z8AA 4K8HA 4XAYA 4A3QA 3G1HA 3ZWTA 5J8LA 3PTMA 1NHSA 4H6RA 3BMVA 3BGGA 1GVIA 1JJKA 4IUGA 4GZJA 1GONA 3RHGA 3E74A 3LHWA 3WD2A 1QRQA 4M7SA 3DN5A 4I8YA 2EJAA 4H4PA 3CWHA 2IKHA 1RY0A 1V3IA 1C90A 4M5PA 1VLIA 1XLLA 2E6YA 1P5BA 4FP1A 1UR2A 1Q6FA 4IGMA 3G0XA 4HZMA 3KE0A 1FH8A 1MW3A 4OE7A 4HPHA 1RM6B 3WO8A 3NQ6A 4JCLA 2WZEA 5HA7A 2BXVA 4XWUA 3NPUA 1ALDA 1DWFM 2BY2A 1L8PA 3WK2A 1K9FA 4B15A 5DN1A 4HCLA 1V7YA 1RLDA 5AC5A 1I60A 1QI0A 2E68A 2XINA 1E6NA 2I56A 4KWSA 6TAAA 4MYAA 1GW1A 2WM1A 4RKAA 3XIMA 3EWCA 4QQUA 3G1XA 4IMEA 3WNOA 3E1F1 2WP5A 3CHVA 2PDJA 2CERA 1UBSA 3IIOA 8XIAA 3M0IA 3L0KA 3GRTA 1XIIA 2CLHA 1UD8A 4W93A 1PX4A 4Q4RA 4H8HA 2OZ8A 4UTKA 5JQ9A 4QE1A 4HZ6A 5MHBA 3M7SA 3LMYA 3CQHA 3LK6A 2VRQA 5FF0A 4HJWA 3DC0A 2DT0A 3B05A 4UZSA 4LCQA 3W1MA 1MWOA 2FHFA 3CAKA 3GC4A 2EJ1A 2HVMA 1EJRC 1MQQA 3KDNA 5J5RA 3QY7A 1T40A 1EO5A 3AMGA 3VOFA 5JMUA 3S9IA 1NH6A 3HV9A 4BWLC 4MJZA 2WSKA 3W7LA 5LIUX 2GVYA 1XYAA 4WDXA 3URBA 1EFZA 3VIKA 3LMZA 3TSBA 1W56A 3PZVA 3SCQA 3WMLA 1FP8A 2GR1A 1OX5A 1VFTA 3S3GA 1NQKA 2YDRA 1F6YA 1Q3NA 3QXBA 2E3TA 5I02A 4KH2A 1LT7A 1XUUA 4RZBA 3ETRB 4F0MA 1OF6A 5D04C 1OYCA 1H7OA 1CWYA 5JH2A 1H7RA 2CLKA 4ZQNA 3W82A 1AMKA 5I3KA 1CX9A 2CZ5A 4M51A 4OIFA 3EKGA 3V18A 2QJJA 3VGBA 3ZOAA 1I75A 3FDGA 3PZIA 1S5VA 3UXIA 1W3KA 2OO0A 4W5UA 1TPC1 1OC6A 2PDLA 4FHAA 1DVJA 1CNVA 2VGIA 1WP6A 2WMIA 4R7OA 5FKYA 3A3WA 1EJWC 4LW7A 1JL8A 1Q6EA 3PUEA 5CPSA 3RK8A 3AROA 4R9XA 2WMFA 2CW6A 3O06A 1CB2A 2ZYFA 4XG1A 1HQTA 2WSYA 3W1AA 4K7VA 4AZ6A 1DJYA 4XVEA 4CQ8A 4LV4A 2WAGA 2BHUA 3IIVA 1LLOA 5C5YA 1BXNA 3EWUA 3PG6A 1J01A 3BG3A 1GUVA 2W62A 3VD5A 4Z1YA 2WK2A 3WELA 4IX0A 4MKVA 3AIVA 3VDCA 3NRZB 3BAJA 3PR2A 1E9IA 3TW9A 2OO6A 3MTWA 3AMCA 1PXGA 1OFBA 4HHHA 4MMWA 5G5IA 2PTYA 4KIEA 1ESWA 2J6VA 2Z1BA 1W1PA 4JR5A 2W67A 4GI8A 4EVZA 4GY7A 3QV6A 2VDGA 4ILSA 1U83A 5D9NA 4IISA 2X7VA 1TPUA 4Z2GA 4HSOA 1GOXA 1ZB5A 2PDGA 2HNEA 3CHCA 1HJQA 1CXHA 4RNJA 3EBVA 1W1A1 3N4FA 3T09A 4WD0A 3I3EA 5G1MA 3EPOA 5BXPA 2VD8A 4CVUA 4KGJA 4B5SA 1Q7MA 3GTNA 4WSHA 4GQ0A 3UZYA 4KRZA 1F4HA 3PZTA 3HMCA 4YVVA 4JDBA 3VMOA 4DUXA 3WMSA 4LB4A 3CH0A 3UWZA 1A5MC 3W7JA 4PMVA 4ATDA 6XIMA 1O12A 2PAJA 4M82A 3EOLA 1U33A 3LGDA 3GHRA 3SUWA 1TVNA 4I8DA 3QFAA 1RCXB 2W0UA 4V33A 1FH7A 1PKYA 2WHKA 2A5HA 4CQCA 4DNMA 1C8YA 3VNDA 3ZR4A 4HCDA 1RALA 1JAEA 3M46A 2H3BA 5JXQA 3QPYA 3NS1B 3DYMA 5JCKA 3EDFA 3RLVA 2OGYA 3GAKA 4Q4SA 4KRUA 4IIDA 2VEPA 5F1UA 4FSAA 4K36A 1WB0A 4J2PA 3HM7A 2YDSA 1ZJIA 4PTXA 3MSGA 4C60A 4MB3A 1DXLA 4ES4A 1ADDA 1UC5A 4DUWA 4AX6A 3VOGA 4NZ4A 2EG6A 2UY4A 4PMNA 5DLCA 1NP0A 2OCZA 2XIOA 3MI3A 3CT2A 4BF5A 4Q8PA 5C2CA 3IV3A 2OX1A 3CGDA 3G2GA 1QHZA 4J57A 2RGMA 4HNTA 1RP9A 4MADA 4PUKA 5DO8A 3P6LA 3TYCA 1DE5A 1YDYA 4HHMA 1LLZA 3BJTA 2GGJA 3P81A 3UEQA 3N2CA 1ZALA 3OGRA 4WOQA 1LCOA 1BPLB 4AZBA 1R3RA 5DMMA 2PPGA 1HGYA 2RGLA 1TSIA 1VH7A 4A2SA 4H4SA 3JZEA 3PBVA 2GR2A 3ANYA 1HXJA 3AIBA 3QQ0A 4D6GA 5M03A 1SMDA 3I6RA 4XAGA 3RLUA 3GD6A 1MQRA 3UQNA 4PA8A 1UIOA 3G3DA 1FXQA 1UKPA 1G69A 4KPLA 3IVUA 3F03K 3RG6A 1QMLA 1X6LA 1P1XA 2VHLA 4JTCA 2QV4A 5LZLA 2FTYA 3BQ5A 4OV9A 3CZEA 2F61A 1E5NA 3KOFA 3K4DA 3PSWA 4UOZA 2QAPA 3N25A 2DT1A 2FPYA 1EEXA 2OMAA 4O1DA 5E0FA 1P0BA 4XBSA 1VFUA 4LQ1A 1TPFA 3S1XA 2PLJA 3GIYA 2CHNA 1XL9A 3T0DA 3TN3A 3FKRA 1KM3A 4R53A 2PRLA 3UZXA 4I5UA 2NXIA 2GQWA 2ZBTA 4S2CA 2W9MA 4S3JA 1UQZA 3NQVA 3C2EA 3TLQA 2HSAA 4GE8A 5DT7A 4H4UA 4H4RA 3BURA 3GVRA 1D7FA 2BTMA 4EXBA 2PLCA 1JQVA 3D3FA 3UXLA 1H62A 4ZQRA 4ZE4A 5LIXX 3LUTA 3OG2A 4G1NA 3DI1A 2KZHA 4N9DA 3UR7A 4PBFA 1B3YA 2QJNA 4EF8A 1RLCL 3G8EA 3R4IA 1JDFA 3B3DA 3W81A 3BDKA 3H24A 2YYTA 1WDWA 2HZGA 3M9YA 2GR0A 3QW3A 1UH3A 1O95A 3JVAA 3NZ1A 3MA8A 4FXRA 3IJDA 2GK1B 4XD5A 2YL8A 3B8IA 2Z29A 4OGZA 1JD7A 3IGSA 2OT0A 3SIMA 3WH9A 3CHEA 1WCGA 3W26A 4J28A 4MJ4A 4O11A 3N3MA 2XH7A 4QG6A 1JNEA 2QCMA 4PMQA 2V63A 1AOGA 4AWEA 2XZ9A 3VDAA 3EWZA 3QR3A 1I2OA 4LBSA 2NQ9A 1GOQA 4GQGA 4FNQA 5BWFA 3BSMA 3K8KA 3TQPA 3BAIA 4FR6A 4IF2A 3K1DA 3IIPA 1UD6A 5LIKX 3W01A 3H70A 3WJXA 1YTDA 1YLVA 2YCLB 3CK5A 7ENLA 2VEFA 3UNDA 3EWDA 3SUVA 3AYSA 1RJPA 5B7ZA 4CN6A 3COTA 1U1JA 5AFDA 3R79A 3D9XA 4NEVA 3AN1A 4M19A 1HVQA 4PMDA 2NV2A 5C9ZA 3TONA 4IFKB 3ECQA 3V75A 2YXOA 3R13A 3MUAA 2V6OA 3KCJA 1B30A 3FGCB 4JQ4A 4OV4A 1GYMA 3W75A 5F4WA 2ISVA 3WFZA 3WLNA 3VNIA 2NT1A 4B92A 2ZRZA 5CSUA 3LM3A 3DG6A 4PRRA 2PD5A 1OYAA 3EDEA 1KKRA 1Z6KA 4O13A 1C8VA 1G4SA 3L0GA 1OFEA 3EDKA 2PLMA 1O7AA 2H90A 3ABRA 4JQ1A 4LVDA 4LEFA 1J0HA 1H50A 3TLLA 4TIMA 2XVNA 2A21A 1FCVA 3WY1A 3B8DA 5H8PA 1S3HA 1ZU8A 2DUZA 5MKGB 3G77A 4LANA 3E2QA 1JROA 5ER0A 5LNSA 4ZOCA 3FJLA 2V5CA 3MDWA 2PWHA 2V67A 1R87A 2VDIA 1EA0A 2F6UA 5EL1A 1JF6A 4DEFA 1BVNP 2NVAA 3WQ5A 4AVOA 2PDIA 4EXAA 2X1UA 2FZ9A 4FEZA 2DH2A 2PTZA 2V3GA 5AECA 1SZGA 3LS9A 4FALA 2IW0A 3UWVA 3GVVA 1QDSA 4QM1A 5C8BB 4R7WA 3ZZ1A 3R8HA 4R3UA 2AMXA 3BZJA 1JQXA 2VCCA 5AZ0A 2YFOA 3T05A 1IT7A 4FIQA 4HA3A 4U33A 4Q6JA 2I1OA 3VIIA 3E02A 5CPOA 2DUAA 1SFLA 2ALDA 2PC4A 3ITTA 4O28A 3S2JA 4GYJA 1UA3A 3M16A 2ZA2A 3WJYA 3H2OA 4L6DA 4MDOA 1A4MA 1EX1A 3K4AA 5EBUA 3INPA 2V3FA 1UC4A 1XG4A 3REQA 4XZBA 4U3CA 1EPXA 4O1FA 5CBBA 4GMEA 1QATA 4NI3A 3T08A 4CGTA 2BCPA 3Q94A 1CGTA 1G5AA 3VDGA 3WD1A 2JBMA 1SO4A 3AS3A 4DWDA 1KLYA 4H7ZA 3LQGA 2EEXA 3EGJA 4W89A 3APGA 3VD9A 2C71A 2XVKA 1HVXA 3O07A 3N2BA 4IXXA 4YHGA 3F2BA 1A53A 4E2DA 1E55A 1P6CA 3STFA 4Y9AA 3UZZA 3AZTA 2OQHA 5LA2A 3TA6A 3W6YA 1F8IA 2QF7A 2Y5EA 1K9EA 3WZ0E 5HR6A 3BLLA 1I6NA 3LCGA 3SR6B 5CJ5A 2JIEA 4E6MA 2AQWA 1J2BA 3PPGA 1XFBA 2CLIA 3AHTA 1N8IA 3CEUA 1WKFA 4ZVJA 1V6YA 3HQNA 1H5VA 2WCGA 1GESA 3TWBA 3WEMA 4C1NB 3LX9A 3WX7A 3KDOA 2I5GA 3G1SA 2C3ZA 1TE6A 2J3NA 3LHUA 5EBAA 1HT6A 1RK6A 5BRBA 3NL2A 4HU8A 1B5TA 3PZQA 1CECA 4IJCA 2QS8A 1S3TC 2NVCA 4N9BA 2VEKA 4AD1A 3OHMB 2FGZA 3CBWA 3BQ6A 5E9XA 2ZUUA 3W2MA 3U3HA 6ALDA 2BGNE 3S83A 3WCZA 3S6TA 1XI3A 2AQOA 2VURA 2UY5A 1NSJA 1VPXA 3M7WA 2E8YA 1B4EA 1EA9C 2IUZA 5B7YA 3GD3A 3VD3A 1AUSL 4IFOA 1KFKA 3G0UA 2GJPA 5FEZA 1U5VA 2YX0A 4FF7A 2Q3RA 3W6MA 4IZGA 2FVMA 3PBUA 4CQ9A 3M0LA 3WQWA 4CU6A 3LPPA 1ECEA 1W3HA 2OYMA 3FCPA 2YDAA 2V3EA 1TUFA 4S3FA 3TH6A 4ZSTA 3QJAA 4C5YA 1L8NA 1F5ZA 4JIQA 3HGSA 4ZBCA 1TRDA 2ZXBA 3ALGA 1UWUA 4CCDA 1UJPA 4KW2A 4D9PA 3NVWB 1JYXA 3QN3A 4N02A 2E25A 4PCNA 3O0HA 4HBKA 1T8QA 2OWWA 3U2OA 3MUIA 3U5YA 1Y65A 3MHGA 5CAHA 1NOFA 1F73A 4RW3A 4FOUA 4AU0A 3MCOA 1ZJHA 1Q2RA 3AMDA 3TJXA 1GEHA 1F3PA 4HB7A 3RPMA 2XVLA 1AW2A 1FKWA 4JCMA 2VZSA 3NSMA 4PULA 1HG3A 3RN6A 3WF4A 2YLAA 3F2DA 1TPEA 4GX9A 4HN4A 4NAEB 1QAPA 1ZQ5A 1UR3M 3AIWA 3APTA 2AKMA 3VIJA 3CAVA 2WQDA 3T2OA 3NDYA 3KZPA 3B0YA 8TIMA 4A05A 5JCLA 2OLHA 3IJ9A 3V3WA 3EWYA 3H4GA 1EGVA 3MO7A 4PFHA 3ZJ7A 3KP0A 2PDFA 5HJXA 3P62A 5FAJA 1G7UA 1XIEA 4R34A 2J9YA 1VFLA 3U0HA 3PN8A 4GVFA 3VA8A 1M41A 1S2CA 1AD4A 3DG3A 1LRQA 4UNIA 3GM8A 4V15A 1W9UA 2HXTA 3P8JA 4YXGA 3TUUA 1JVNA 1AJ0A 3RUBL 4NYUA 1CIUA 5KVIA 5DMLA 4BWLA 1GVQA 1TO3A 2QT3A 1CTNA 2IMRA 4WDTA 2EG8A 3PAOA 3WQDA 1Q6RA 4N7QA 1GRGA 2IQTA 1O5XA 3FJ4A 4CD6A 1FDJA 8RUCA 2I17A 3EA3A 3KBJA 2PDXA 5CSSA 2WHJA 3W2UA 1VDVA 4O4VA 1TPDA 2YBUA 2Y85A 4G5DA 3ZLFA 3NPWA 3MSRA 5D32A 5CC7A 3QTGA 1UUOA 3WF1A 4EQSA 1V7AA 2EPKX 1DWJM 1WXZA 1PE1A 1F4AA 3L2IA 3AS2A 4EMIA 1EX5A 5K4XA 1OZMA 2EXOA 4C6DA 1UR1A 1ELSA 1GJPA 2DGAA 2QIIA 1B1YA 5CJNA 2PMQA 1H60A 1WAUA 1N60C 1E70M 5KETA 2J27A 5K9DA 5TD4A 4M80A 3UF9A 4FOKA 1K8CA 1A5UA 2J79A 4GNVA 3RCYA 4R9OA 2FMNA 1PKMA 1H1NA 4DUOA 5DCDA 3R10A 1TIMA 4J3TA 5FJIA 4AF0A 3J7HA 3A4WA 2G0WA 2TAAA 2GJXB 3PBMA 4XBJA 5AC6A 1V93A 2OOFA 4LC6A 2CBJA 3FAXA 3BANA 2PB1A 2QJHA 1XUZA 2Z28A 1CPUA 3KWXA 3SZ8A 4F40A 3BCJA 3W1PA 3M5YA 2ZX5A 4H4VA 1OGBA 1R9ZA 5TBOA 3OYZA 4DVOA 5C54A 4W5ZA 1TVLA 2RJGA 4ACYA 5AOUA 3QC0A 2GL5A 1LTDA 4F2UA 3E0VA 4A3YA 1UJQA 1QNPA 1V02E 4MUPA 3C86A 3GZ3A 1MYRA 3DZ1A 2QYGA 3DK8A 2JE8A 3WNLA 1OGGA 2EQDA 1DIKA 4M56A 4QCEA 2Z1WA 2EHHA 4H01A 4Y8FA 8CGTA 4Q32A 2F2KA 2VXNA 3URHA 4GNKB 2HVOA 1S7MA 3KXQA 1ZUAX 3QTPA 2DPEA 1KQYA 1H5YA 3VNYA 2ICSA 3BAWA 4NJKA 1FWCC 2WKGA 3GD4A 1T6MA 1HGWA 5LKYA 3M0ZA 3VFLA 3U5UA 3MUXA 4YN5A 1TB3A 1A0EA 4GI6A 5I00A 3KUMA 3GDMA 3CEPA 5E09A 2A0NA 3L21A 2W5FA 1MZHA 1T7LA 1GHSA 5K7JA 3VGFA 2B7QA 1TMHA 1W3TA 4I6VA 5CZTA 5CCZA 3GHTA 4BR1A 2YR1A 2BS9A 2FFCA 2D23A 1P0EA 1WZKA 3EOEA 1P6BA 5U25A 2A6NA 4L80A 1GETA 4Z1BA 3YPIA 2CWNA 2V2CA 3IK2A 4M8UA 2Y8KA 3GIPA 5LA0A 3TTSA 1OABA 2NT0A 1E56A 4JFWA 3KS6A 2XZ7A 1TFVA 2X05A 2BWGA 4LUSB 3UA3A 1K77A 2E5DA 3A9IA 1FVPA 2VNCA 3OW1A 1QI4A 3GHSA 4LF2A 2GZXA 3UJFA 1VYRA 4IMGA 1HJVA 5H91A 5A1AA 2OQYA 3TA9A 4IH3A 3W84A 3GIQA 4RDWA 3VDHA 3OHIA 2GK1A 2WNNA 2FZNA 3E0LA 4GI4A 1M1BA 2V2HA 2ZC1A 4KERA 1IE7C 2CKRA 4JD4A 5HNNA 2HPIA 1VKFA 3GNNA 4Y9NA 5I6SA 4V1XA 1GOMA 3WLLA 1LOLA 1K4HA 5GQBA 4IP4A 3ABXA 2E3ZA 2ISWA 3W86A 4QROA 4WJ8A 3SW6A 5D02A 5KTLA 4JTTA 1WYIA 3GY1A 2OR2A 3WLJA 1QPQA 1W3NA 3QV8A 3TR9A 1ITUA 1SR0A 2QCNA 2A2IA 1ODZA 3M47A 2PDWA 1QPOA 3W72A 4QX4A 1YNPA 4GACA 3IJIA 1J5SA 3MPGA 2YCLA 5D9OA 4UR9A 1J11A 4NL1A 3VCNA 3TX9A 3NZPA 1J9YA 1Z89A 1KN0A 2YAUA 1HKWA 2J6XA 1UUMA 3GX9A 3DH9A 2YL9A 4GBDA 3SN4A 4Q7BA 4NVTA 4H50A 4JFSA 4IFKA 3LNMA 4J2MA 1IF2A 1ZCOA 2EKCA 4N42A 2BOEX 3EAUA 3FVDA 3M41A 3SQLA 4AG0A 3UG8A 3S5NA 1TTJA 3DHPA 3MHFA 2OELA 3FGCA 4ZOHB 2PGFA 3P5ZA 3MHUA 3DIPA 1LYXA 4JS3A 4Q4PA 1V6TA 3H54A 1SFJA 3VD7A 1DTUA 2QPUA 3I3BA 4BK9A 1GCYA 4EKJA 2DQWA 3TYZA 1Z32X 4NZFA 2Y1HA 3GFZA 1Z3NA 3ZT5A 5C7HA 2OLAA 3D47A 1Z44A 3PAJA 3OVPA 3SY5A 4CU8A 3UXAA 1FWTA 5FJOA 2R6OA 4WY0A 2GSHA 4WHBA 4ROPA 4L1XA 2ADAA 4C6CA 2FZBA 2VCAA 4RK8A 1NELA 3CWNA 5MKGA 3R11A 2A7NA 3FA4A 3WQ8A 2D0FA 1F3TA 2GVJA 3CMFA 1TCDA 3B97A 1FWFC 1KWKA 2DJLA 3OIXA 2OZ0A 4ZOEA 1KM5A 1VF8A 3WF3A 1PS9A 1GQLA 5ENLA 4JTRA 3OEXA 4MFDA 4FX6M 4QTGA 4A2RA 2Y6ZA 4DI9A 1O66A 2DIKA 3V1HA 5ABFA 4B5WA 1AODA 1IEIA 2VI0A 3KW3A 1AQFA 6XIAA 2Y70A 4DUVA 3C4UA 4BI6A 5BCAA 2MANA 5BWAA 3MMWA 3NNTA 4GC3A 2V5LA 3TYBA 2Y7EA 4AD0A 4XZ9A 1BF6A 1VBUA 3T0TA 2J7EA 3AI0A 4I9MA 5IBXC 2YA1A 1WUEA 4RV8A 3AWOA 3PJWA 3AALA 4L4OA 3CV1A 3DFNA 3BLEA 1MVYA 5FJRA 4NX5A 3MJMA 2VZVA 1H7XA 1VBHA 2RABA 3BSGA 1P0DA 4NU7A 3DHUA 1G6CA 4XKYB 4BY3A 2MNRA 1P6WA 1F61A 3AUJA 3ZVIA 4LF1A 3V5CA 1XSKA 2FPTA 1DJGA 3BXWA 2CESA 1VQTA 5KZ6A 3XISA 1VEOA 1V59A 1OIFA 1EOKA 1R3VA 1F9CA 4O19A 3WEOA 4EAMA 3N6QA 4ORMA 1S2WA 1XLMA 5KMYA 4IX2A 3SUTA 3GZAA 3HPZA 3N15A 4PN2A 4JQAA 1EJTC 4HMCA 4OOZA 3F4CA 4KEMA 1MRAA 2Y7GA 3CV2A 1IZCA 2ZE0A 1HKJA 2C16A 3O6CA 3DOPA 4Z1DA 5J5DA 2QNEA 1E4MM 5HUOA 4PUDA 2HS8A 1PHQA 1B57A 4H04A 2DZAA 3CJPA 1P4CA 5AZ1A 5HULA 3WLIA 3T81A 4B4HA 2FH8A 2EQ7A 3WYZA 2PP0A 1V02A 1T3QC 1OJTA 3BLKA 2PWDA 2YXGA 3PB0A 4UQDA 2HMCA 3GAYA 3L4WA 2V5BA 3G1VA 3M6DA 1CW2A 1Q6OA 1H49A 4F79A 4A29A 5HWMA 4C1NA 2AOSA 1I1XA 1VB9A 4L1WA 3VAVA 2R24A 3ZVHB 1TE1A 1VRXA 4UWMA 1Y5XA 2XVGA 3OO2A 4CNOA 2A3HA 2PP3A 4MHBA 4JTGA 1V0MA 1CEOA 4AZ5A 3BAYA 4GUHA 4DO7A 5EFDA 4UFIA 2ZE3A 5GRTA 1CBGA 3AZRA 6CGTA 1GTEA 3AHVA 3KTSA 4LV9A 1S1PA 5AYYA 5AHEA 3C3UA 1OIMA 5CZKA 2BOGX 2VGGA 4IG2A 2PGEA 4PRTA 1EYEA 1ZRQA 5C70A 1L9WA 3B0PA 1EYWA 4X61A 2IQDA 3TW7A 4DZAA 3OLIA 2F9RA 1FHDA 4PCFA 4UCFA 3RILA 4PCTA 3UXKA 2B7NA 1Q6LA 4M6UA 5H6HA 3FKKA 3QLLA 2BNJA 5I2UA 3F5KA 1MFUA 3V4BA 3CQKA 4DAFA 4PFMA 1US2A 5BU6A 4EANA 5DQPA 1XFCA 3E2SA 1XRFA 2V2DA 1TVPA 3KRZA 2VZOA 3A4JA 3I7RA 4O1CA 1ZMCA 5K4ZA 4B5TA 3VGHA 3FXGA 2ZWZA 4OKDA 3GS6A 2VQTA 4H9TA 4FA3A 2VP8A 1VEPA 3SGZA 2X8CA 4IFRA 4LNCA 4G7EB 4UCGA 4I3GA 2IXUA 1OYBA 2PF0A 4IUOA 4DIAA 2P5NA 4I5XA 4P7LA 5DBUA 3ARZA 4KFNA 3SI9A 1TPVA 1XYLA 4TR9A 1KA9F 2FFIA 1JIBA 3WIJA 4B3ZA 2NQJA 4H19A 2GVEA 4H6QA 4DF2A 4L64A 3MW7A 3PTQA 3LHYA 2VD9A 1LBLA 3LHVA 4ATWA 2ZXQA 2ALRA 4BFAA 4QFUA 5BNKA 1DWGM 4F8XA 2BC1A 2A6LA 3PUGA 1VZWA 1ZZMA 3TCEA 4UBPC 3QM3A 3SQSA 2QDEA 2YIHA 4R33A 2YCEA 4UQBA 3DHDA 1JZ3A 4P7OA 3A4XA 1ME8A 3CNYA 1LL4A 1E9LA 4MNMA 5E5CA 2V8ZA 4LU0A 3T1GA 4HMEA 5L6UA 5G4HC 1XIGA 3W3OA 4U10A 3Q65A 1J0ZA 1MEIA 1TJRA 3OU8A 3GVWA 4Z2LA 3LLXA 2DORA 2WO5A 3HGRA 4W87A 3W1RA 1KXQA 1W5QA 2F6KA 3IAPA 1UB3A 2V3AA 4DF0A 3OA5A 4LCSA 1WKYA 2E9BA 4F2BA 5CLTA 3BW4A 4LVBA 4LUJA 3H53A 3UJ2A 3KCLA 1KNWA 3L2MA 3P60A 5H2ZA 1FFVC 4BF7A 5GNZA 2AL1A 2ASHA 2BY3A 2WWDA 4RL3A 2CBIA 4F3HA 3CPRA 1HJWA 2EPLX 5GJNA 5DANA 4K37A 3E49A 3QYQA 2V3BA 3SCSA 4PYSA 4ACZB 1BWVA 3R94A 3WQ6A 4Y8EA 1WDRA 4S39A 4PB3A 1MOKA 2WPGA 1K8ZA 2REQB 1RAKA 4MJMA 4WXZA 1W37A 3WNNA 3HB9A 2J13A 3VGGA 1OX6A 3STCA 1FIQB 3WDRA 3C2YA 1JDCA 3N04A 4C1LA 4S3KA 4TVYA 3MSYA 3NM3A 4EXQA 3QOMA 4KWUA 1XC4A 1OFQA 3CUFA 3WL0A 2VC5A 1ISYA 1V3MA 5HR7A 2J66A 4PBEA 5BROA 5FAGA 3NL5A 3N6HA 1I0BA 3QHMA 3N14A 2ISDA 3T4CA 1I0DA 2RKXA 1WUFA 3PULA 2WC4A 1AW1A 2HJPA 3I65A 4P8XA 3PZNA 1Q6GA 1VFMA 5DEZA 2YL6A 1OZQA 1IV8A 3IANA 4JIHA 3R58A 1GYLA 2GJXA 1S2AA 2XPKA 1TV8A 1JNDA 4GIRA 2NXGA 1KM1A 4GZIA 3SCUA 4E2OA 4IMFA 1GXFA 3WQCA 3IC9A 1L6GA 1C9WA 1NDWA 4AZHA 3H2AA 1GTHA 1US0A 3AXMA 2CFYA 2V81A 1DE6A 2VEMA 1Y5VA 5F1VA 4PC8A 3QMRA 1BFNA 1L2UA 2PDQA 2CLPA 4J5NA 3WJZA 3GU9A 1EP2A 1FKXA 1YBQB 4XZMX 1DPMA 1LUCB 1OG0A 3I6TA 3VX1A 1XPGA 5CG7A 3DC8A 4EX4A 5D30A 1VEMA 2ABBA 5I78A 3MANA 3LXBA 1Q4NX 2NXHA 4NXKA 4F66A 4KT2A 4GCAA 4GD0A 2O9PA 1JDDA 4S3CA 3N12A 1ONWA 4M3PA 1LROA 4ZSUA 4ZFCA 1M01A 5HMDA 1SZFA 3VFCA 4HOXA 3R6IA 7TAAA 2EQ9A 3FSUA 2CFFA 1EF3A 2X0YA 2ZTKA 1XCFA 2V3DA 4RE0A 5CGTA 4H2HA 4OQVA 4C65A 4MY8A 2A3AA 2OSWA 3TIMA 4HHLA 4YWSA 3V7PA 1IWPA 4H8VA 1TPH1 2GYIA 1KFBA 3DGRA 4WF7A 1A3XA 5CGQA 4K68A 5FF7A 4S3BA 4GI9A 1ZKQA 2P88A 5EMLA 2JF7A 3MT1A 3ARSA 3Q4DA 3RM8A 3I4EA 1M68A 3RMEA 5ABHA 2GGGA 2HK1A 2YW4A 3GXFA 4GH1A 3NPXA 3C0SA 2ATSA 2QCLA 4Y6GA 3UGRA 1XLIA 4U4MA 5FS7A 4PSRA 2VFEA 3FVMA 3E5PA 3W70A 3ANUA 2GWGA 3CL7A 4YJ5A 4EAYA 1MFVA 5GNXA 1SO3A 5EY5A 5I3JA 2WHMA 4W7WA 3DJJA 3ZXWA</