3JW7A

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-ile-l-tyr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
molecule keywords Dipeptide Epimerase
total genus 117
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jw7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jw7A01
2AL2A 2AKZA 4HPNA 2P0IA 2PMQA 1ECQA 3I4KA 1P43A 3V4BA 3STPA 3RCYA 2AL2B 3TJIA 3RITA 1NELA 2PPGA 3DFHA 1WUEA 4KEMA 3ZVIA 4FI4A 3ZVHA 2NQLA 5FJTA 4H2HA 2OLAA 2OZ8A 3DESA 2OZTA 2AKMA 3PK7A 1XPYA 1MDRA 4GIRA 4IL2A 2ZC8A 2XH2A 3OZMA 3R11A 4F4RA 2GGGA 3QKEA 1MRAA 2QJMA 3FV9A 2AL1A 3MY9A 2XH0A 4EWJA 3R1ZA 1R6WA 1IYXA 4HCHA 4H83A 3DG7A 3ZLFA 1R0MA 3VC5A 3JVAA 4M6UA 2PGEA 3SSZA 2O56A 2OZ3A 3S47A 4GYPA 3QPEA 3KUMA 4GGBA 3P0WA 1MUCA 2CHRA 4E5TA 2XH7A 2HXUA 3TCSA 3OW1A 3SQSA 4FP1A 2PODA 3QTPA 3DGBA 3UJRA 4KT2A 4M0XA 2XGZA 3N6JA 3N4EA 3R10A 1KCZA 1SJAA 1EBHA 4A6GA 2GGEA 3SN1A 3CB3A 4MMWA 1WUFA 3K1GA 4KPLA 2GDQA 3DERA 3ENLA 3VDGA 1ONEA 3OPSA 3CYJA 3DIPA 3S5SA 4IT1A 3T4WA 4HCDA 3QN3A 2DW7A 3SBFA 1SJBA 3P93A 3RR1A 1EC8A 3THUA 4KWSA 3EKGA 2PP0A 5J04A 1SJDA 2RDXA 5BOEA 4GGHA 4IHCA 5FJOA 2OPJA 3VCCA 4IL0A 3TQPA 3FJ4A 2GGHA 3I6EA 4JN8A 4X2PA 1RVKA 3OZYA 3I6TA 1F9CA 3R25A 2OQHA 4JHMA 4K1WA 3MUCA 3N6HA 2PU1A 3GO2A 2FKPA 3VCNA 3ZVHB 2MUCA 2GGJA 3IJQA 3ES8A 3IJLA 4GFIA 2P8BA 3GY1A 3D47A 3TTEA 4E4FA 3JW7A 3ZLHA 2GSHA 1BQGA 1TE6A 5FJRA 3JZUA 3FCPA 3UCCA 3TW9A 1JPDX 3CXOA 1YEYA 2DW6A 2PGWA 2MNRA 7ENLA 4MGGA 4G8TA 2PP3A 3H7VA 1BKHA 5FJPA 1DTNA 3OP2A 3Q4DA 2XH4A 3NO1A 3TOYA 4GISA 3H12A 3RRAA 4K2SA 3B97A 2PS2A 3VFCA 3ES7A 4E8GA 1OEPA 4DHGA 3T8QA 3V5CA 2HXTA 1MDLA 3IJIA 4IP5A 3BSMA 3VC6A 3SN0A 4DYEA 5EU9A 3U9IA 3GD6A 4E4UA 4E6MA 3NZGA 3TWAA 5ENLA 1PDZA 1KKRA 2OKTA 3T6CA 2P8CA 1E9IA 2HNEA 4J1OA 2OVLA 2OG9A 3UJEA 4HCLA 1TZZA 2QVHA 4HNLA 3BOXA 3UXLA 4ENLA 1NU5A 2HZGA 2ONEA 2OO6A 4DWDA 3Q45A 1XS2A 1FHUA 1SJCA 3MWCA 2PP1A 4A35A 2QJJA 1L8PA 2P3ZA 3R0KA 4IZGA 4K8GA 3TWBA 4IP4A 2QDDA 4DN1A 2PTWA 2GGIA 3VA8A 3ZLGA 3D46A 4YWSA 1PDYA 1MNSA 3DFYA 1KD0A 1JCTA 4JN7A 3FXGA 3H70A 3U4FA 3V3WA 3NFUA 1EC7A 3NXLA 3UXKA 1TKKA 3QLDA 3UCDA 3MZNA 1EBGA 3RGTA 4H1ZA 2P88A 3CT2A 5IDZA 3PFRA 2PTYA 3PWIA 3SN4A 2ZADA 4ROPA 6ENLA 2PTXA 3DDMA 4ZCWA 3V5FA 3CK5A 2QGYA 4GYPC 2OFJA 3UJSA 2QQ6A 1EC9A 2I5QA 3IK4A 2OX4A 4HN8A 3R0UA 2PTZA 4H19A 4DX3A 3CAWA 4G7FA 2FYMA 3HPFA 4A3RA 3GC2A 4HNCA 4DXKA 3FVDA 3MKCA 1ELSA 2PCEA 3UJ2A 3RO6A 3PWGA 4HYRA 2GL5A 1KKOA 4J3ZA 3H8AA 3EEZA 4Z17A 2XSXA 3MSYA 3UGVA 3BJSA 2PU0A 1JPMA 4Z1YA 3OTRA 4ZA0A 2QDEA 3MQTA 2QJNA 2OQYA 3TJ4A 1FHVA 1JDFA 2PSNA 3SJNA 3UJFA 4GMEA 3FYYA 3P3BA 1P48A 2POZA 3DG3A 3DG6A 2PA6A 4MKSA 3T9PA 3DEQA 1W6TA 3N4FA 5FJUA 5BOFA
chains in the Genus database with same CATH superfamily
1KTCA 4Q8OA 3WD3A 2HK1A 3O1NA 1HL8A 1TIMA 1VFHA 1H7OA 4H7ZA 4AIOA 3N18A 1XLIA 2V3DA 1QW8A 2OGJA 1QMLA 1EWDA 1R3TA 1WXZA 5HQMA 1W9PA 3TQKA 1C9DA 4KMQA 3ITXA 4LCQA 3WF1A 4M6PA 2YBTA 1JUBA 5D2VA 3D6NA 1PB0A 4H2HA 2YVFA 1FWBC 1RH9A 4MKNA 4R34A 1V3JA 2V0TA 4Y6GA 2CESA 1YXDA 4YTQA 3OZMA 2YDAA 1PHQA 4IFKA 2UY5A 4OGZA 3W3OA 1MRAA 3WQWA 4LA1A 1F4AA 4FB7A 1OGGA 5D2WA 5GQBA 2W4XA 1XUZA 2FTYA 3KL0A 1IYXA 3F5LA 4LUSA 1R0MA 4NRRA 2OKOA 3QHOA 2WK2A 3EXRA 1SO6A 5B7YA 2ZA3A 1V6UA 3RJYA 2E77A 3MU7A 4RV3A 1GOQA 3PBUA 2J3NA 3IGUA 4NJJA 1AL8A 1GRAA 2J9XA 3I7RA 3LDVA 5M17A 4OECA 4O12A 5BW6A 3OG3A 3BVJA 1E0WA 4HD5A 1ZJAA 2XWDA 3ZFHA 4QS5A 1OY0A 3ARYA 4JCMA 4IIHA 3P84A 1FDJA 5K3VA 3GNOA 1TPEA 3AMKA 1XXXA 1MUMA 2D0HA 2DPEA 3S42A 3VNJA 4Q4KA 5CAHA 1QK0A 2GGEA 3KP1A 4D72A 4ILSA 4C60A 2CDUA 1WUFA 3K1GA 1V6VA 1WDSA 3CYJA 1BKSA 3KBSA 3TK7A 1BF6A 3S2MA 1US0A 1CCWB 4O14A 4UOQA 2GQAA 1XYBA 4QDPA 3R94A 3WDPP 2NXIA 4V2XA 5A8PA 3QXBA 4E2DA 4GGHA 4IHCA 1D3CA 3WL1A 4B5UA 4B5SA 2WNNA 1ZBWA 2IPFA 1V59A 4L6OA 1HJUA 5F7UA 1HIZA 5FAJA 4PMQA 2QV4A 1GONA 4NYYA 4N9BA 5J5DA 1GEUA 4KCVA 3BO9A 5E5CA 4JDYA 1A4LA 1XL9A 4NKCA 1WKEA 1TPUA 1FWHC 2GYIA 2V3GA 2O55A 1OZMA 3SUSA 2GWNA 3T44A 1OJXA 3M5XA 1IQ8A 3MYOA 3WJYA 2C3ZA 3G22A 2V63A 2NSXA 3IRDA 4N9DA 4XBSA 4LUYA 1JDCA 2R6OA 2EKCA 2PWHA 1JAEA 1H62A 3UZ5A 3EBVA 1ISXA 5A8MA 5KVIA 7TAAA 2ZE0A 3R13A 3KP0A 4GH3A 3RX2A 3TLLA 4MIMA 4LVAA 3V18A 3PHAA 3MYPA 2DZXA 3WQOA 3TKFA 3K5XA 2XIOA 4ZGYA 3VTRA 3IIXA 3DAQA 4DYKA 4JTKA 2WWDA 3TIMA 2YLLA 3PAJA 3MHGA 1HKIA 1V02A 4UQDA 2POTA 3IUHA 2QCDB 4GI6A 3WNLA 2EJAA 2UY2A 3V5OA 3L4XA 2A7PA 2G4FA 2VX7A 3DBNA 4LNCA 3DCPA 4YWOA 1JYNA 1HJWA 1TPB1 2WOIA 3FW6A 4IMGA 4NAEA 1OX4B 3PZMA 1GSNA 5ENLA 4H8HA 5I3DA 4L1GA 3TYBA 2NUWA 4DPQA 5EMMA 2UY3A 3MBDA 3C8FA 4KCWA 2DZBA 4WD0A 5DEZA 3E0VA 5GRTA 1ZP4A 4BK9A 3QBUA 3HPXA 1YTEA 2OU4A 2ZUSA 1NU5A 1Q6RA 5AZ0A 3K13A 3NVZB 4YVXA 3BLFA 1OABA 3G1FA 3EMZA 1CEOA 1FHDA 4H6EA 3G1HA 3WQDA 1KCXA 2GOKA 3L4WA 1SR9A 3RLHA 2QUVA 3L12A 1A3XA 1YRRA 5FSDC 1M53A 3LG3A 3AROA 3URNA 3PBGA 3R0KA 4W7VA 3P8IA 4DBWA 3DKLA 2QDDA 1F76A 3AHVA 2C13A 2BCPA 2RDWA 4TVUA 2DFAA 3S1XA 1GYLA 1U2YA 5BWFA 3REQB 1MNSA 1XHGA 3CL8A 2NV2A 1EWEA 1JCTA 3XISA 1PCWA 2GK1B 3OZPA 4XZIA 3VKDA 8TIMA 3V3WA 1JFXA 3NXLA 4GO8A 4IMAA 1ZFJA 2E28A 3UCDA 2G97A 3G0UA 4OV4A 4LU0A 4JFTA 2BXVA 3KVKA 2P50A 2HS8A 2VGFA 2E68A 4KCTA 5DN1A 3KRZA 4GNVA 5HR6A 2FMNA 5E6YA 3V0TA 1NDYA 3WMCA 2RGLA 3LHWA 1VD6A 4HK5A 1K8YA 3PR2A 4XV0A 4O4WA 2ZZ1A 3KWSA 3GW0A 4H7CA 4H6KA 1CGXA 4MPQA 5TR3A 3GR8A 4CCDA 3USZA 5A94A 4D6GA 1R9XA 4ATLA 3RR4A 4A05A 4AY8A 3DZ1A 3LSCA 3UESA 4W4QA 5LNWA 1KRMA 1FWIC 2ISWA 4K37A 4JL1A 3WDJA 1A5KC 1R85A 4LANA 3VVGA 4AZCA 4I8YA 3W6YA 1UP0A 3TLQA 4Z2JA 2QJNA 4HHLA 2OT0A 2EO7A 3OLEA 1NQ6A 4J3TA 3F03K 4PFMA 3F4VA 3URHA 5BXSA 1GOKA 3KW3A 2B7NA 4WF7A 5LHFA 3P3BA 1EF3A 4FF7A 1QPQA 3SQPA 3IIVA 3EDFA 4P8VA 1A4MA 3OBEA 1K03A 4OBRA 2VEMA 2VFEA 3AHYA 1IE7C 5DLCA 2AL2A 2OQLA 5C2XA 1XSJA 3KDNA 1NY1A 3RCYA 3MO4A 2E3ZA 1GOIA 1EX1A 1XIIA 2PC8A 4LYKA 2D24A 4NVTA 1FWWA 4EANA 1XSIA 1LL6A 2DVTA 4JFUA 4QG9A 1P7TA 1EPXA 4YCOA 1M1BA 2CCRA 1BHGA 3OBAA 4B3LA 3NPXA 1E3ZA 2G4JA 4L80A 3UR2A 4IL2A 3WD2A 2Z1SA 4RZ6A 1OT1A 1E0TA 4DUVA 2CNCA 3ICJA 3BSGA 4A8RA 2XIBA 2ZX7A 3HPAA 5EBUA 1IXQA 2JGQA 5CJNA 1TWZA 4PBEA 1WDQA 4HA0A 3NO5A 4LYRA 3AIBA 4MWAA 2A5HA 2FVMA 1UWIA 2CHOA 2CKRA 1V3MA 2NQHA 4DJDD 4LBRA 2OWXA 3QTPA 3APTA 2FPYA 3DGBA 3CUJA 1E40A 3DGZA 3VINA 2I56A 3M64A 1EO5A 4XAYA 5JBEA 3HN3A 2WZEA 1KCZA 1EBHA 1FWTA 1RBOB 3GG1A 3O07A 3TYUA 5H1WA 4U5IA 1DORA 2P1FA 3E0LA 2NVKX 3CQKA 3S5SA 2VELA 1HX0A 2I9EA 3WQEA 1R2SA 3GLCA 1XIEA 3NDOA 5AECA 2AMXA 1ISVA 1J8VA 1F5ZA 1C90A 1J79A 4DWSA 1A0EA 3CMFA 1W1TA 3GM8A 1VEPA 4N6EA 1VIWA 4JN8A 4EXAA 3W73A 2AMGA 3CV2A 1H0IA 3R25A 3GW3A 3UGRA 1RK6A 4REQB 2XUCA 1W5MA 4H9UA 3UXIA 1W3TA 1R7AA 4O15A 1QPRA 2V5DA 4UNLA 3VIIA 3ZYZA 1PKMA 3GO2A 1VFOA 1IZJA 2Y7FA 3HTWA 3NPWA 4JR5A 4R85A 1HTIA 1QW7A 4PR4A 3HO8A 2PWFA 3TN4A 3W86A 3H4KA 1SQ7A 4UFJA 1WYIA 2OELA 2CEQA 3CC1A 4N4PA 1BF2A 5DBTA 2CBJA 5F4WA 3T08A 3NO3A 1TE6A 1E6PA 2YYUA 4JTFA 1NOWA 3NPVA 3MHUA 4XZNX 2HBVA 4QR6A 2BDQA 5FMHA 2WJEA 4GI4A 5EBKA 1W5OA 5I78A 4JTLA 2FIQA 4FMVA 3S1VA 1YPFA 1DXEA 5HWNA 3H12A 3GBDA 5A6SA 1Y5VA 3ARQA 1CPUA 5CZ0A 4MY1A 4NUWA 4JQ4A 4LFYA 2DV0A 3CZ8A 5FF2A 4CUCA 4UCFA 3S9IA 3ABQA 3LXCA 2IXVA 1P0NA 3LNPA 2ZDRA 3U9IA 4CN4A 4GVGA 1FEAA 1W5NA 1KBIA 1EJRC 4MF4A 3WLNA 4ATDA 1TYTA 1NHPA 1AD4A 3SY1A 3SUVA 3VNMA 4MWAD 1R86A 1WDPA 4R9XA 1CXEA 2VWTA 2C14A 3FHQA 1GVFA 1I4NA 4MZ8A 2X09A 1Q6FA 4AD1A 1QR7A 2BOFX 3ZJ7A 2HPMA 3NM1A 1TVLA 4TVWA 3S83A 3TONA 3MDUA 5B80A 2PDKA 2V9DA 3B40A 3Q45A 4CU6A 2WNZA 5ECVA 2YZRA 4CCEA 1VFSA 1W1PA 5AYZA 3CIXA 4QEEA 3SGGA 1H1ZA 1O68A 2WP5A 2WVVB 2I57A 4KRZA 3F4CA 1KBKA 2OLHA 4IP4A 1NDZA 2C8NA 3QQWA 2X2YA 4HSNA 4AEFA 1ZENA 3R89A 4ML9A 1RUSA 4F66A 1AMKA 4IJBA 4PGLA 1D9EA 4CVUA 3ERPA 4WDXA 3GK0A 4HPXA 1V0MA 1LWJA 1J2WA 5CCZA 5G1TA 4PULA 1XWYA 4H9TA 2XG9A 2VM8A 2JEQA 2VZUA 2BHUA 2DT2A 2OMAA 1IWAA 4QQUA 2VD8A 2YOCA 3PFRA 2PTYA 1PO9A 2V82A 1AK5A 4PUWA 5A1AA 3VIKA 2QPSA 3QYQA 4DO6A 4XD5A 5C0QA 6ENLA 3FYOA 2WOVA 3VOGA 4ZCWA 3PWAA 3N14A 3TJXA 7REQB 4HOXA 1TWDA 1X8FA 2YX0A 1LTDA 2XYLA 2GJXB 4S2CA 3CO8A 1MEIA 3F7JA 2XFYA 1OFDA 4LNYA 3ZSSA 4AF0B 1JNEA 1EGMA 1ZY9A 5CKSA 3WIJA 3VU2A 3BLEA 1M04A 3GC2A 4HNCA 1Z32X 3UR8A 1R3SA 4C6LA 1QNRA 4I9MA 3HGSA 1VQTA 1JF6A 3E74A 3G77A 4LUTA 2Z4GA 1VBGA 4XB3A 3NTYA 4DM2A 4HMCA 4E4PA 4FLQA 1KKOA 4UNKA 3H8AA 1VCVA 3V75A 4BCEA 3CV6A 2ZQ0A 3VNYA 1AOGA 2OTDA 4AD5A 3BJSA 1UWRA 1OSEA 4NQ1A 3MDWA 2OR2A 3HPSA 4DJDC 1HVQA 1O5KA 1G67A 4BV6A 1W8GA 3EWWA 1XANA 2VZOA 2ANUA 3HU7A 1CTNA 4NILA 3UWYA 3TYAA 1AL7A 2ATSA 4JIHA 1J2BA 4TIMA 5I07A 2ON3A 5JCNA 5A6LA 1H7XA 4O0ZA 1AQMA 4LY8A 4MY8A 4J35A 5DT7A 4GVHA 4NX5A 1L6WA 4ZTXA 1V03A 4LAKA 1ECQA 3WFAA 1P43A 4JPGA 3RPTA 2TMDA 1DQUA 2CLKA 2HVNA 3WLSA 4ERAA 4QITA 3H2CA 4C65A 1OC5A 1Q2RA 2B81A 2ZZ2A 2HVOA 1YADA 4GABA 3I6RA 4MOZA 2XINA 5I77A 2XH2A 3ITYA 1GNXA 2BB0A 3R11A 3EKLA 2VX4A 4ML4A 2CLMA 4QCFA 3CLWA 1JYXA 3WLJA 4JTJA 4ZEPA 1E71M 2XH0A 1F7BA 3WMBA 7CGTA 2IKJA 3DHUA 2DT1A 2PLJA 2VGIA 2X99A 1I1WA 3A47A 1U5HA 4IJCA 3AS0A 2GWGA 4IIGA 4PTNA 1EH9A 4GBUA 4DM1A 3NVTA 2R94A 4ZOBA 2HMCA 3HJZA 3TA9A 4US5D 2CHRA 1G7UA 4BFAA 3PZ9A 1VBJA 3VK5A 4FP1A 1W17A 2O92A 2WZTA 4PEKA 2W55A 3GDBA 1LL4A 1QASA 1EOMA 3THDA 1Y8BA 5HMDA 3B9OA 3LN3A 4QM1A 2XGIA 3SN1A 2P3EA 4LS0A 3MCNA 2GDQA 1LPFA 2VCBA 4DAIA 4H4QA 3O2LA 2R1MA 1G0CA 3P6LA 5F1UA 3SB0A 3CPGA 4CEXC 2GOUA 1X6NA 1XIDA 3CXBA 3C86A 1DOSA 1K1DA 1B30A 2E25A 3VMNA 4HMDA 1AA1B 3CEUA 1UB3A 3OIHA 4NJIA 3NQ6A 4IISA 1GVQA 4PTWA 5XINA 1VPXA 1AZ2A 3T0DA 3LMZA 4W8BA 4DJEA 4HNUA 1QOQA 1MQQA 5IOBA 4BF5A 3ITOA 4Q6XA 4Q6JA 3QHNA 3W88A 3T81A 1K8CA 4ZVJA 5KZMA 4RJEA 1F6YA 3ZS4A 2QVNA 4HGXA 3W02A 4R88A 3W1QA 2QAEA 3IJQA 2QLYA 3BLLA 2QJGA 2FGLA 3MO7A 1ZLPA 3D47A 2P0OA 2GLKA 4UMAA 4QE5A 4F2UA 3QOMA 2E1WA 1LCOA 4LQ1A 4PMVA 4OV9A 4TXEA 5FJRA 1HT6A 3IANA 3UCCA 3AYTA 3TW9A 2ZVIA 5EFFA 3E0WA 1UPMB 3POCA 4BKNA 3O0HA 2ZDSA 3WQCA 4GOAA 2Y5JA 2PAJA 3K4WA 1O5RA 4JFVA 4K2SA 1QWKA 2PS2A 3MMWA 1JZ6A 1XR2A 3EOOA 1Q2SA 4L56A 1DQXA 1IR1A 1OEPA 3UXAA 3T8QA 3BJTA 5HAOA 5AFDA 1PSCA 2GDUA 2HXTA 1XYAA 2B0MA 2Z2UA 3CM4A 2P5NA 2JQXA 1XX1A 1S5VA 4HIBA 4O52A 2FFIA 3LI1A 3CGDA 3CZEA 1KKRA 3O63A 1T5AA 4O1DA 5T8GA 3WH8A 2WSKA 1EZ2A 3CZKA 5D2XA 1E9IA 4BA0A 5JCKA 1TRDA 4C1NB 3WENA 4PC8A 3CUXA 3ITTA 1WKDA 3CQ0A 4DZHA 2ISDA 3OVRA 3AUJA 3HG2A 2QCMA 1IXPA 2NUYA 1W3IA 3PY2A 3VIGA 4CN1A 4RNFA 3KOYA 2WSRA 2E1DA 2ONEA 2VZVA 3PZQA 2ZUWA 3WDHA 3A9BA 1JRPA 1KQYA 3STCA 3AUOA 4R7JA 2QCFA 4UB9A 1R3YA 2ZRWA 4Q22A 1BRLB 3ELFA 3QMRA 2BODX 1V08A 1P6WA 3KL3A 3VD3A 1V3LA 1LWIA 2FFCA 3C61A 4KFPA 3RLGA 3DFTA 3G1RA 1L8NA 3D46A 4CQAA 3WFZA 3D9XA 1QO5A 1VPQA 4WDWA 4ZE5A 2INZA 4PRWA 3OYXA 3CQIA 3BH4A 2B7QA 2W67A 1R2RA 1FEBA 2QCHA 1XLAA 3QC0A 4Q4RA 1FQ0A 4ZE4A 5FF0A 3TW7A 1C7SA 1F05A 1WBJA 2J75A 1VDVA 1VGAA 5FD0A 4JS3A 4H7VA 3UZYA 1XLKA 5JUVA 3AWOA 1O12A 3PANA 7ODCA 3CK5A 2Q6ZA 1UMYA 1YPIA 4NZJA 3ZMRA 4US5A 2HQMA 4W88A 1WKFA 3O9NA 4JTEA 3W4RA 1FH7A 2YBVA 3C2FA 4O1AA 3O15A 4JIPA 4ACZB 1CBGA 1OBAA 1K70A 2D2HA 1NH6A 3UWZA 2Z0IA 5HUOA 4XZHA 3UJ2A 1VBRA 2YVGA 1XLMA 5AYBA 1AQFA 4GUFA 1YBQB 1OCNA 4ZB2A 3TE9A 2FB2A 3WJSA 1AMYA 2XFFA 4X2RA 5RUBA 1UR9A 4X63A 4G1KA 3H53A 4DWSC 4H01A 4CLMA 2QDEA 2C1IA 5K9XA 3IJDA 1K9EA 2WSQA 2PZ0A 3CWOX 1ECEA 3U5YA 1XUUA 1ZGDA 3GVWA 8A3HA 1XG3A 3GTNA 1MXGA 1VQZA 1GKPA 3MUAA 1Y65A 2PA6A 3NQ7A 1EQCA 4PMUA 3T9PA 1W6TA 1JULA 1LVLA 4M29A 4FO4A 1SVDA 2GJRA 2QAFA 3BAYA 3MP4A 1RY0A 4IF2A 2VUNA 2EPOA 3W2JA 4DZ5A 3W24A 5C54A 3PM6A 4URIA 4EQSA 2WC3A 1BYAA 2VRKA 4GQRA 3B0UX 1UJQA 3S5OA 2EPLX 4D6DA 4KEMA 3ECQA 1B90A 1CECA 2ZC1A 2YR1A 2NQLA 3K46A 4AB4A 3SUWA 1Z9AA 5FEZA 1K02A 3ARRA 3IGSA 2J7EA 3OGSA 4M81A 4FOKA 2QS8A 2PEVA 3PUDA 4LPCA 3W2KA 3RCMA 3CJPA 3REQA 5LNRA 4PTMA 2WC4A 1PEZA 4BEUA 4UC5A 4X9YA 1T8XA 1H63A 3W85A 4CU8A 2YW3A 1N55A 1VZWA 4X0NA 2DUXA 3GC5A 3EMQA 4EWJA 3R1ZA 5HWJA 4JHOA 4MHBA 2C1HA 4FPSA 2YB4A 3GG8A 3BLOA 4D6IA 3E5BA 2FQIA 4IUGA 2GQ8A 2O56A 2PF0A 4DJFD 2GR2A 3BGGA 4N9EA 2E5CA 2WCAA 1SFJA 4E2OA 2X7VA 3KUMA 4QAIA 1FCVA 3VOHA 1NWTA 2ZWZA 2C15A 1DWJM 3PBMA 3BLDA 4EPBC 5HUPA 5AN7A 1GYMA 3DYPA 5TQLA 3L4UA 3PUGA 3UT0A 1VYSX 3HBLA 2JBMA 1SJAA 3I3DA 3N6QA 4A6GA 3GU1A 1TX2A 1FRBA 4MMWA 3A5VA 2J8TA 3L4ZA 3GDTA 4H50A 2WBGA 1FH9A 3HZ3A 2WOQA 2W66A 4MB5A 1FDZA 1YE6A 1CZ1A 2VC6A 4M7TA 1RXOB 5GJPA 4B15A 2QIIA 3THUA 2I14A 2W63A 4JNYA 3G1SA 5JBDA 1TTIA 2IW0A 1W56A 2PP0A 1H7PA 1QUMA 1TRIA 5CBJA 1XCFA 3OOQA 2EPMX 3UVIA 4FNPA 1RJQA 3TCEA 2NLYA 3TYZA 3I6TA 4MNLA 1ZRQA 4Z08A 1ZBCA 3L5OA 1F74A 1X38A 3CHEA 4Z1BA 2A6LA 3GTIA 4UTJA 2ZCGA 1V5XA 1O95A 5LNVA 5AHIA 1JEZA 2Q09A 1XV8A 2W54A 3ZWTA 2ZTKA 5CJ5A 1GETA 1JUKA 5FI8A 4GUHA 3B0XA 2Y89A 2D20A 3U57A 2MUCA 1JRBA 1G5AA 3IJLA 2OOFA 1NTHA 2GR0A 3LTPA 5I02A 1J6OA 1TPFA 4KH2A 2WM0A 4RE4A 4OZOA 1JQXA 1VFLA 2CPUA 2GDVA 5JCMA 1XW8A 4HPGA 5CSSA 2CU0A 1QHZA 4ASTA 4ZFCA 1WAUA 3ITLA 1VRDA 2PGWA 1XBYA 4ALDA 3AIWA 1JCYA 4FHAA 3FAWA 2CZVA 6ALDA 4MLRA 2PF8A 1Q13A 3M5ZA 4BWLA 3VUPA 1ZPTA 2C3CA 4UTKA 1T6MA 1R8LA 2QUUA 3UETA 4XKYA 1HGWA 4ZQOA 3VOFA 1XLLA 2J7HA 4KRUA 5AHLA 4NI8A 4O54A 4F3HA 3TU9A 2C16A 5CLWA 2X41A 3BSMA 1BYDA 3P61A 2DZTA 1K6WA 1PYFA 4QLLA 4Q32A 5AHEA 4UTFA 3D0CA 1RSCA 2C19A 4LBUA 2E5DA 2YCIX 2VDIA 4J1OA 3KTSA 1EEPA 3H54A 4CEUC 3ZO9A 3IACA 1G1YA 1P0KA 3H2AA 2NQJA 3ATZA 4HCLA 1UD6A 4OQVA 4M8UA 4Q4QA 5FAGA 3PZVA 3POHA 2YDQA 1SPQA 3V0SA 4ENLA 4PEEA 4QLJA 4UTLA 1RY8A 1ZMDA 1JCNA 4NU7A 2X50A 3LTSA 2VTFA 3WNNA 1BLIA 5K4ZA 3DOPA 3SIMA 3LV5A 1N62C 4UFIA 2J25A 3K30A 1C8YA 4NASA 3CUZA 3ZQ9A 4Q8NA 1WV2A 4IZGA 3EWXA 4H6RA 2V2DA 4HHPA 1G6CA 1U22A 1BTCA 3OQ8A 2OWWA 2GGIA 1RJPA 3FSTA 2TPRA 1R5YA 3AS1A 2CFFA 4E3TA 4A2SA 1UKTA 2BXYA 3BPWA 4YTTA 1TVNA 5CSRA 2RJGA 5D05A 3TAOA 2UZ9A 3DH7A 3WNOA 4YNGA 1E9YB 3GUWA 1EJUC 3E02A 4UTHA 4U10A 1Q4NX 1W1B1 2F6UA 4LS1A 4DO5A 3O6DA 1UP3A 4LYQA 4GIEA 4F79A 1EBGA 4K6AA 2IPWA 1DXFA 4L7ZA 1R3RA 1E72M 4WDTA 3SN4A 1BZLA 2O9TA 2HQAA 3AJXA 1QW9A 2DGAA 1WDRA 2XWEA 2VT0A 5DFAA 3MW7A 2WHKA 5C9XA 1PYMA 3T55A 4WDUA 4EPEC 4IGMA 1DQWA 1QNPA 4LW7A 1EHNA 1FTXA 4BQ2A 3IK4A 3WQVA 4C90A 4H19A 1DJQA 3C0LA 1JD9A 4JYEA 3IGXA 4M6QA 4WJEA 1JCJA 5A6BD 4EQRA 1SZNA 3W1LA 1T8QA 3RLVA 3ABZA 3E0FA 4LEQA 1E0VA 4IIEA 2VCCA 2CFYA 3HFTA 1CIUA 2R1LA 2CIPA 3WFLA 2XSXA 2C0HA 3S6OA 1IT0A 4ERGA 4J3WA 3W7HA 1GREA 2WC7A 4N02A 3CAKA 4Z1YA 4KETA 3S1WA 1RA5A 5HMEA 4GZJA 4P5UA 3FYYA 4UUIA 4BWLC 3THQA 2G3MA 2VEIA 1Z44A 2GGGA 4RPQA 3NAVA 2VR5A 3W75A 1GV4A 2HPIA 3RF9A 3LRMA 2O7SA 3A22A 2OT1A 3NL3A 4UQCA 4BI7A 2ZZ7A 3O6YX 4D8AA 1JEHA 1L9WA 4I9TA 4JTSA 3LRKA 4JTAA 3UCQA 3M0XA 4G5DA 3WQ8A 2Z1VA 2YXXA 1B54A 3HV8A 4Z2IA 1ZSXA 2A85A 2BTMA 1RA0A 4IGHA 1REQB 1XLEA 5E0KA 2AKMA 1ISYA 1J11A 4XSLA 4WSHA 1OINA 4NIRA 2ZE3A 4JL2A 3RM8A 4JNZA 4F4RA 2ACRA 4O19A 4KIEA 2VC5A 1SU5A 1FXPA 1MQPA 2Z6JA 4DBDA 3MY9A 3B8IA 4AC1X 3IIZA 1Q5MA 1XLGA 3S5YA 3EOUA 1K7FA 2PDXA 5E93A 1KV5A 1AJZA 3TDFA 3APYA 4A29A 4L5ZA 4QJ4B 2Q01A 5IBXA 4E8DA 1NP0A 1GHSA 1JQVA 1M3UA 1UUQA 3CWHA 2CWNA 4K39A 3LSBA 3NZQA 3UNDA 1UZ1A 4QJ3B 4H8UA 3QV6A 4QS6A 1L6GA 4B2DD 3W7MA 2R24A 3GAKA 3GNNA 4IMDA 1N82A 2CITA 4LVGA 4IXHA 1FCBA 1MO0A 2Y7GA 2PI6A 2XVNA 4FF5A 1PE1A 3CGCA 5FEXA 4IT1A 1P6CA 2WLZA 1E70M 4HCDA 2YQUA 3H2MA 2C7FA 3LHTA 1SZFA 3KRUA 4LUTB 4B4FA 2YA1A 5CLTA 1V8EA 1NPXA 4Y2WA 1HP4A 4ORIA 1FWEC 4NZCA 1B5TA 4OIFA 3CGTA 1JDAA 5BOEA 3HQNA 4P8WA 1EJ7L 3PPHA 2NUXA 2X1IA 5FJOA 3ZT6A 3L23A 2VQTA 5DQPA 4JEQA 1HJSA 4ZSTA 1VBHA 4DNAA 3BW4A 4GACA 3E5PA 4GWEA 4HNNA 2PWGA 3Q37A 2DZPA 5D37A 1NDVA 4L9ZA 5H8PA 4TVDA 2J7GA 4FNSA 1NWUA 3AS3A 3RNMA 2ALDA 2WKLA 2CWXA 4TTUA 1NWSA 1DEDA 4IFOA 3A4AA 1S2CA 3H7RA 1XHCA 3TFCA 3SDOA 3P8JA 3NWRA 4XKMA 5BXTA 3GY1A 3L0GA 4MB1A 2GSHA 4FXSA 3C2VA 3WL0A 4D6EA 1B4KA 3M7WA 2EQ9A 5DY2A 4DJEC 1CLXA 1YPXA 3E2SA 3Q58A 4C5ZA 2DIKA 3LXAA 2OOGA 3UXDA 3FKKA 1UG6A 5H91A 4H4TA 1LF1A 2BWGA 2XFWA 3LCIA 1XD1A 5AVHA 5MHBA 4DF0A 1BQCA 4X0VA 4E8GA 1OFQA 1S2WA 3OIXA 4F0SA 4R7OA 3TROA 3ITVA 3ORWA 1L0PA 3RG6A 1RP8A 1R3VA 5GNYA 3HOJA 3UWUA 4LIIA 3W38A 1G94A 3CH0A 4AEOA 4GY7A 1HKMA 2HNEA 3QKZA 3GKFA 4HN4A 3WK2A 4BI5A 1H2JA 4A3HA 3UJEA 3LNMA 1W2PA 1HKJA 3VDAA 3BANA 3IK2A 3GXMA 2X8GA 3UXLA 1OCJA 3V7PA 1PS9A 3GXNA 5IFPA 4ATWA 2AAMA 2YCLB 4N42A 4EXBA 4TX8A 4OHQA 1UA7A 5ABHA 1WZLA 4NJHA 3PZIA 2XN2A 2C1GA 3H6OA 5HATA 3M46A 3QV7A 3SI9A 1LLWA 2E09A 3EA1A 2YGYA 1S2VA 5AZ1A 1RQBA 3NQDA 1WXJA 4AEEA 1XCWA 5C8BB 3WEZA 3H70A 3STFA 1JDEA 2L5HA 2PWUA 1X98A 4DLFA 4QHRA 2Z1XA 1E4MM 1H0GA 2BC1A 1AH4A 1EIXA 4AW7A 1W3NA 1SZGA 3B03A 4NP7A 4B5VA 3KBWA 4KIRA 3V36A 3M9YA 3VXGA 2QJIA 3G0XA 1NF0A 3TW6A 1PIGA 2QCGA 2WHMA 2J78A 5GPRA 1IIGA 1Q6CA 5ABGA 1AVAA 2I16A 2P10A 3FOKA 4MPKA 2YSWA 4G2DA 5HJXA 1OX6A 4DNMA 4XAFA 1X6LA 2AOSA 1UD5A 1MI3A 5LNUA 4QE1A 3W7NA 2E8YA 3W7JA 1T3QC 4GRSA 2W27A 3L0KA 4Q8MA 1MW3A 1VYPX 3NEHA 3ONCA 3GIPA 4BQ4A 1VHNA 3NQ8A 2PDMA 2Y7DA 4GNJA 4NNCA 2R9RA 5CPOA 3W7RA 4J9JA 3F5JA 4YVPA 4GKTA 3TR2A 5C71A 2VL4A 3WMLA 1SB3B 2V3FA 4LY4A 2PDCA 2PU0A 3P5YA 1IIHA 1VCGA 2WMJA 3GAYA 4GD0A 4EK7A 2GR3A 2DH3A 1JDFA 2V8ZA 1W5PA 3O3RA 4G1NA 4HSHA 1XPGA 4AD2A 1UWTA 4WXZA 3DG6A 4NNAA 3UR7A 5AYXA 3IIPA 2JIWA 4MJMA 3DHDA 2CZDA 2ACUA 3AQUA 5GNXA 4J3VA 3W1RA 3BLPX 2ZRXA 3NZ1A 3BCDA 4RZ4A 4ZXLA 2ZRZA 1C93A 4O1CA 3W25A 3DFSA 5XIAA 3I4KA 1A5CA 3TP4A 1OYCA 3VMOA 5H2ZA 1X8CA 1ME9A 2Q8XA 1WYGA 1RPKA 3VKAA 3N73A 5AHFA 3DK4A 4FX7A 1QNQA 3KBNA 3B8TA 2AAQA 3C0QA 3PUEA 1J10A 2F9RA 1QNOA 5L9FA 1THFD 5C55A 1LOSA 4D8ZA 1ODUA 3KBJA 3W81A 3ZSTA 1IF2A 1K8XA 1WNOA 3DGRA 7PTDA 1E4LA 2BASA 4XZMX 1V79A 4TMBA 2OO0A 3QKEA 4RKAA 1S3HA 1UD8A 5K4XA 1E51A 3GX9A 3BAKA 4H83A 1H5VA 4IQJA 3W27A 4W8LA 4LUJA 5CZJA 1GVOA 1CXFA 4FIRA 4CNUA 1WDDA 6REQA 4ICCX 2CYGA 5LA2A 4UWMA 3BW2A 4D1IA 2ZZCA 4GGBA 5A6JA 3SSJA 3DK9A 1XKJA 4RDYA 3KX6A 4GY1A 3FK4A 2IKHA 2YB1A 3GTFA 2WVVA 1KBJA 4W9TA 2OLSA 3L65A 3MMTA 4KT2A 3BSHA 1JR1A 2QYGA 3SUTA 3WBXA 4RXFA 4EAYA 3RJXA 2V5KA 5BRQA 1GZJA 3NQFA 1RBLA 4RV8A 1TWWA 1T0OA 3EWZA 5FSEC 1Q85A 3DX5A 3BV7A 4FOUA 4LCRA 3Q6JA 1GPWA 4PSRA 4C6IA 1MXDA 3KS6A 1ZBVA 3ALFA 2W6RA 1KO0A 1E1CA 3WD4A 3CHFA 6XIAA 2ATMA 4IH3A 4DI8A 3EDDA 1J0ZA 1GRTA 4TX6A 1SJDA 1ZALA 3URBA 2NX1A 3QRHA 3VABA 3BZJA 1KFWA 1MFVA 1TELA 1RR2A 3WF0A 4M24A 2J8GA 3W9ZA 1XQLA 1ZQ5A 4H4XA 3W2MA 5F2IA 2HBXA 3FLUA 4R27A 2XVGA 4PUNA 3LPOA 4PYSA 2DUAA 4YYFA 4ROQA 2VDHA 1ZJHA 3IRSA 4CNPA 4WHBA 1REQA 3T2QA 2NT1A 1TV8A 1U30A 3AZSA 3PC0A 1ZAJA 4S3CA 1Q1WA 2OJPA 1LLOA 3WDRA 3THCA 3N2CA 4I9AA 3EWCA 3UZWA 4Q4SA 2WMHA 3GNPA 5MF5A 3GBEA 5DCBA 1Q8JA 1VCFA 1HGYA 1HKVA 3S0CA 2PP3A 1PTAA 3NVDA 4H9YA 4GXMA 1F8MA 1VJSA 3WX7A 4C5YA 1E43A 3N34A 3PZGA 4LT9A 5JCIA 3SECA 2W61A 4O8AA 4F0LA 2G3NA 4LGXA 2GJPA 3U5UA 3TA6A 4IP5A 2FGBA 1LBLA 1CLVA 3AIQA 4AXNA 3H2OA 4TO8A 1D8CA 1B3XA 1TO3A 4GNKB 3TWAA 5KINA 4RDZA 1HJXA 4YHGA 1MYRA 5LIKX 4KGLA 2CZ5A 2W62A 3VGBA 2PRMA 4V28A 4DJDA 3TC6A 1XIHA 3DN5A 5LIXX 3II4A 3E2VA 3K1DA 1T7LA 3LGGA 3CEPA 3W1TA 3MUIA 3R0DA 2TPSA 2MANA 2QZRA 2E9MA 5AVNA 1UUOA 2X42A 2D0GA 3MWCA 3SR6B 1EYWA 1UOZA 2PP1A 4A35A 2JKPA 4C91A 1H4PA 3ETRB 2YW4A 3M41A 2IS7A 2NZLA 3IAPA 3AZTA 1J0JA 1DL3A 3W23A 5B7ZA 3VA8A 3OLIA 1FXQA 1V93A 1ZAIA 3M16A 1UW9A 4OWGA 3WJWA 3GXTA 1C3FA 1K9FA 1KD0A 3K8MA 1LRQA 1IV8A 4XIMA 4AVFA 1GG0A 1PUDA 3DI1A 2CKSA 1XYCA 4PODA 4K1GA 5FKYA 1ZX9A 1ICSA 2WKGA 3B06A 3EUB3 1S1RA 3GE7A 1EGVA 6XIMA 4LRTA 2H9AA 1KWGA 1OF8A 4GR1A 1HL2A 1MWOA 1KXHA 1E1EA 2BMBA 3RU6A 1W3HA 4LAOA 4QJ1A 4PN2A 4UQEA 2PGRA 5I00A 2GUYA 2QGYA 2WV8A 2X2GA 1OJTA 2FLIA 7A3HA 3UJSA 3JS3A 1FFRA 3NQGA 1EZWA 2TYSA 1QXLA 2OX4A 4TQTA 3S1GA 3DU0A 3WBWA 4WSKA 4JIRA 4M3PA 1ONWA 4AX6A 1EDGA 4IX2A 1DPMA 1CENA 1LZOA 1XYFA 4ZODA 1MUWA 1WKYA 2XN0A 3UY7A 2QV5A 3W72A 4WOZA 1OZQA 4K7VA 1QJWA 2G50A 4F9JA 4A3YA 5HJYA 3K2GA 3R8RA 1TPDA 2VOMA 4AH7A 2VC7A 4BR1A 1A5MC 4XVEA 3VZXA 4J2MA 5KSWA 4S3AA 3EWUA 3BAIA 4D6HA 1W1VA 4A3UA 1EHAA 1WE5A 1TYPA 3UU0A 1UR4A 4K36A 4ZOAA 3FDGA 4QP0A 2W91A 3N12A 2F8QA 5M1TA 3MI3A 3ZZ1A 4HMNA 1KQZA 2R82A 5HINA 3CHDA 4MKSA 2E67A 4ZSUA 4ECLA 4C7DA 4UOJA 4FX9A 3TVAA 1B57A 1QNVA 3CZJA 5T9CE 5D03A 2CLPA 1JPKA 1WX0A 4HPNA 2GUUA 2PMQA 3SCQA 3A7AA 4WZHA 2RAGA 1G7VA 4EMJA 2Z28A 2J7DA 2ZBTA 1W9DM 4B3KA 4P7NA 4S3KA 3OG2A 3VNIA 1KGXA 4C6QA 4A22A 5BXRA 3MSRA 3BJFA 3U8GA 3GG7A 4D8LA 3PK7A 3M47A 2J62A 1WPCA 2WXDM 3W01A 3MBFA 3A4JA 3CUIA 1ML1A 2BY0A 3NCOA 1F8WA 3ZLFA 4DEFA 2XTKA 3MMUA 4W89A 2NQ9A 3KTCA 3VIOA 4AHOA 4U33A 3I7SA 4UTUA 3MV11 4PCNA 1V02E 3N1AA 3NGJA 2EBNA 5T26A 3SQSA 4C6EA 3ITCA 5EL1A 1B3WA 5CPNA 3R8GA 2Z7KA 4KFOA 3GDLA 3LD5A 1N8WA 3KCJA 1UD4A 2ZUTA 1MXSA 4BF7A 1VP5A 4JTGA 4PCPA 3VZZA 4S3EA 1POKA 5DMLA 3S6TA 1OGBA 3G0SA 4MSSA 4UFLA 2NX3A 2WM1A 1UQZA 1UC5A 2FZNA 5J04A 1ENUA 4DVOA 4GZ7A 1MW0A 4PB5A 4QTGA 3IV8A 1S38A 1E9LA 2Z1WA 1UBSA 5DBUA 4X2PA 4H4YA 4C7GA 3BG9A 3GG0A 3Q67A 5HOSA 5KTLA 4NT0A 3UERA 4DO4A 5JH1A 1VC4A 3MJYA 1KRCC 4CD5A 3DFQA 4U28A 3VCNA 3RRXA 3E1F1 4REQA 4FXJA 1NQKA 3EXSA 3L8KA 3PZUA 2PBGA 3UWWA 5JIWA 1E4IA 1O5QA 3W00A 4E4FA 5CGTA 4HZ7A 3SCTA 2V30A 4PCFA 3L5MA 1AW1A 3JZUA 3QM3A 3CXOA 1BD0A 5JVLA 2MNRA 7ENLA 2DSVA 1GTHA 2CXEA 2HRWA 4LVDA 3B9NA 3WQFA 2XZ9A 1XLHA 3RLUA 4S1FA 3TTQA 1WOBA 3LERA 1B9ZA 4TUFA 5BOOA 3UBPC 1XH2A 3ZOAA 4Y9AA 4H4ZA 2Z24A 3TYCA 3ZT5A 3BGJA 2YCKX 5FL1A 2FH6A 3GH4A 3V5CA 1KTBA 3WSUA 3ABXA 1MDLA 1LLZA 3AIRA 4GJIA 4NZ3A 5A2AA 1JXJA 4R33A 4E4UA 1ICPA 1SMAA 5CPLA 2E6YA 4E6MA 2WMIB 1B0IA 1UKOA 1S5TA 1XH1A 2NSOA 2BGSA 2H90A 1K4GA 2EPHA 3T6CA 4GZEA 3VX1A 5BRPA 1L2UA 4ADUA 1H1NA 3UZZA 3GWQA 3NOEA 1ZTVA 1I45A 2RFGA 1C29A 3OO2A 2XFRA 2QVHA 3PPFA 1FECA 4DF1A 5FEPA 1EJXC 4AVNA 3ITGA 3A9IA 2VUYA 1A5UA 5HJLA 3S5NA 2BHZA 3MANA 1P6BA 2QCCA 4K8GA 1CB2A 3W0KA 3P67A 2DQWA 1DE5A 2Y88A 2DZSA 4TX9A 2JALA 4JHZA 1OK4A 2Y2WA 3ZR4A 2QXWA 4QG6A 2VEPA 3UD6A 3F1QA 1P1XA 3KFTA 4JTDA 1Q6LA 4CNNA 4POCA 4NNBA 3FXGA 3TOPA 3BAJA 2FJUB 3CIWA 1UKQA 4LB3A 4XO6A 3DHPA 4B5NA 4PMOA 2YL8A 1F61A 4IG2A 4MFDA 3AO0A 1AQ0A 5F2GA 3MZNA 1MEWA 2NWRA 1DWAM 2IQ0A 3W7KA 2KX9A 5ABEA 3AALA 4S39A 3PWIA 4KWUA 4TVCA 4EACA 2WNWA 4ROPA 2GSJA 1BVWA 2BV9A 3KOXA 2BX7A 4JDBA 4Z1AA 1WZKA 4YL2A 4H4RA 2NVDA 4KCUA 1K8ZA 2DZVA 2VFGA 3B9DA 1US2A 5CSYA 2EQ7A 2EF9A 2EQ8A 3LCHA 1R9ZA 1MW1A 3QSTA 1EBDA 3F2BA 2LLEA 1V0NA 2ZFAA 5A3HA 2WCSA 2INEA 4C1LA 1HVXA 4DXKA 1J6PA 1ELSA 2B31A 4NAEB 3TUUA 2QKFA 1MO9A 3CAQA 2OXNA 4GQ0A 2IPGA 4Z1DA 1QPKA 1FWCC 5FS6A 4B16A 3WMSA 1L6SA 5AC8A 1DE6A 2GL5A 1TMQA 3DGHA 4Z17A 4H8VA 1KWKA 1F3WA 3ZM8A 4AZGA 3W83A 1QPOA 4M7SA 1KBBA 3ZJKA 3W7EA 2FMOA 3MQTA 4G7EB 5HNUA 1CXHA 4KESA 2WVUA 1I9CB 1QI5A 2P53A 5EBAA 4JQ2A 3N2TA 1JZ3A 3MV01 1R47A 3VI2A 1Z8AA 1P0DA 4GVIA 3LBMA 5A6AA 2VVNA 4CU7A 4ZQPA 3TQ0A 3SRDA 3RFAA 4GJ1A 3QPZA 3W7OA 1DIKA 1I2RA 1QCWA 4R3UA 2WYSA 2J74A 1JAKA 1DIOA 2IXUA 3TXZA 3VOCA 3STPA 4F48A 4C6BA 1FCQA 1IGWA 4P8UA 1YYAA 4ICNA 3CUFA 3FEMA 3SFKA 3S1UA 1QI0A 3CMJA 3BL3A 3NRZB 4GZIA 1FHLA 1RVGA 5HXMA 4QEHA 2JKEA 2V3BA 4WK9A 4HHHA 3IJ8A 4W86A 4E2VA 3TJLA 3BMVA 4LALA 4BQ3A 1AODA 3ARPA 4QBXA 5I5RA 3P14A 1XP3A 4W85A 3TNBA 4F0MA 3KS5A 1X1NA 1KN0A 4XUGA 2R1PA 3GHSA 1KR1A 2HV5A 1B4EA 1UC4A 1OFOA 1QT1A 2PDIA 3TN5A 2Z26A 3BV4A 1F3TA 1EXBA 1VFFA 3DYMA 4GYPA 1NAL1 4UFKA 3QPEA 4L61A 1TFVA 4LBSA 4UXDA 4WR3A 4Q8WA 2OYLA 2X0HA 2FZBA 3TCSA 1BEUA 4H9ZA 4CQDA 2J9YA 2QUMA 1FWDC 3CH9A 2ISSA 3UVAA 4M0XA 3Q94A 1XLJA 4O18A 3IAQA 1QO2A 2HJPA 1EUNA 2WZHA 3MA8A 1BYCA 2FHFA 3AI0A 3TTYA 1JCXA 2WANA 3OZOA 4GG9A 1RLDA 2F2KA 3WLLA 1U1UA 3AMLA 4MNJA 4Q4OA 2OWCA 1TJPA 4JOMA 2WSYA 3JU2A 5AC6A 5L6UA 2ZRYA 1YNPA 5C9UA 1K7XA 5JH2A 2VHLA 3OQEA 5LHEA 2ESCA 5CBBA 1M03A 3EDKA 3I6EA 4KF1A 5U25A 4HVXA 3VKCA 4AF0A 3QC3A 3TC3A 1QI3A 4CQ8A 1SW0A 4GK8A 1GERA 4K1WA 2YA0A 4GH1A 1A5SA 4C7FA 3VILA 4I6KA 4HTBA 4IFRA 3DHFA 3WJZA 3R6IA 2W3ZA 4L6HA 1OQFA 3PG8A 1J18A 1TV2A 3H24A 3AIVA 3TTEA 3QV9A 1GKQA 1UHVA 3SCPA 4DRSA 1SM9A 4OTKA 4YN5A 6TIMA 4L9YA 4ZQMA 3LU2A 3EAUA 4MJZA 2PGFA 3DH9A 4X22A 1OB0A 4ERIA 4DO7A 3Q2DA 2PRHA 3SGUA 4LXFA 2ZUMA 3R2GA 3P60A 4KEVA 3IC9A 3NGFA 5I3JA 1K6AA 1A0CA 4X9SA 4LUIA 1A49A 3ZWSA 3SY5A 3W7GA 3EAOA 3N04A 3A5FA 5CPQA 2A7NA 2PDUA 3RPMA 2FJKA 1TYGA 3VD7A 3AXXA 1G9HA 1HJVA 3DKJA 5I24A 3AICA 4CGTA 4DYEA 1AFSA 1GVSA 4ICMA 4QSFA 4A2RA 1M01A 1ZNNA 1PDZA 4O28A 3K4DA 4X3ZA 4LTSA 3GVVA 3H4WA 3CHVA 4DJFA 1LRNA 2PDYA 4B2DA 5KEZA 4E8CA 3VGFA 1KRAC 5E1QA 4AD4A 2QDHA 3SCUA 4PMDA 2ZRVA 2CZFA 2YXGA 3GXDA 3S9ZA 1ZL1A 3BOXA 4J2PA 1GOXA 2BFGA 3D5HA 1GRHA 1XLBA 3IVUA 4K7ZA 1QVBA 1E6NA 3M0HA 3MZ2A 1FHUA 3GB6A 4NJGA 2ZTJA 4YS1A 3LCWA 3DJJA 1US3A 3KXQA 2PLKA 3WUEA 3G8RA 3SCWA 2QR6A 1TTPA 4GIAA 1UWSA 4PH6A 4WJ8A 1UH3A 4DN1A 1PPIA 2PTWA 2H3BA 2W3SA 3A7UA 3KZSA 1JCLA 1XLCA 3I65A 3MI2A 3N2OA 3DFYA 1VFMA 4ZQNA 3AM9A 4IUOA 1VFUA 1H50A 3PJUA 2EPNA 4AXKA 5LKYA 1H60A 2D0FA 5TD4A 5FS9A 2QUTA 2DIJA 4K38A 2C6QA 3MB9A 1OK6A 1Z48A 2V67A 4AYGA 2FPTA 2NPXA 1Q8AA 4KQNA 3VFLA 2QMKA 5DMNA 5D8WA 4DI9A 1DNCA 4AYSA 4C1KA 3P5ZA 1XFCA 3BQ5A 1CGUA 1CXLA 3CBWA 3LV6A 4EE9A 3ARTA 3VOIA 2E5AA 1BWVA 1UWAA 1R87A 4CQBA 1EDQA 3GIQA 4HN8A 4U3CA 3LHZA 5U4NA 1IEWA 4DBSA 3CWNA 2YVJA 3HGJA 3GDRA 3PS7A 1A5NC 1PL9A 1KFBA 2V38A 3LLXA 4JTHA 1E5JA 3DUGA 1KM4A 4Z0SA 5CC7A 3L4VA 1Q7MA 4EF9A 5DMMA 3QLLA 4M6VA 2VD9A 1IXNA 4Q7NA 2YKKA 4J3ZA 2FVLA 4HJWA 4C1NA 4HZ6A 1H2IA 1A50A 3H2FA 4GE8A 3EOSA 5G4EA 3TJ4A 2YFOA 1UD2A 1FWSA 2WCGA 2PDQA 1J96A 1OIMA 4J40A 1PXGA 4GMEA 5EMLA 5IM51 2GJNA 1TV5A 3CMGA 2WQDA 1CB7B 3KWXA 3LEPA 2X8HA 2I5IA 4CNTA 1E6XM 5FF4A 4JXCA 2IQDA 2AKZA 2HE8A 4ZB0A 2UY4A 2OYMA 3NSMA 3TH6A 1W9UA 4B9YA 5DF0A 1GUVA 3V4BA 5EKYA 4Y8EA 3BOLA 4ZO9A 4Y8FA 4EPKA 1W0MA 5FESA 3ZVHA 4QLKA 5AC7A 2VO5A 2QCDA 4ZQCA 3DESA 3OA5A 1YXYA 3FJ6A 3U2EA 1JGIA 3EMCA 3MUY1 1QHOA 4MWAB 1TTJA 2W92A 2G3IA 3ABOA 4FXFA 2QF8A 5EMKA 4FNRA 3IWPA 4RE0A 4PMJA 1IHIA 2ZUNA 1J9YA 3K8KA 4KERA 2FTPA 2QPUA 4EOUA 4DXVA 1LBMA 5K2ZA 3OB8A 2B4GA 2A0NA 1QNSA 1Y5XA 2GQ9A 1BXCA 2OZ3A 3NSXA 5FOOA 2DT3A 2ZZ4A 3R79A 1F6PA 3V0UA 4GX9A 4JQ3A 3EOEA 5HWMA 2E5BA 1VR6A 1CI1A 3E2RA 4DZAA 3GR4A 2Y24A 3WH9A 3TMQA 4IGSA 5KETA 5MKGB 3AXKA 2A79A 3IEBA 3KLLA 4JTIA 4I5UA 3SW6A 3QR1A 1N2VA 4HK7A 3C3UA 2DT0A 1F3PA 1XYMA 1XRVA 4IQEA 3ENLA 3VDGA 3OPSA 2FB3A 3AC0A 3E49A 3VKBA 3HB9A 3DC0A 1LUCA 3LUTA 5ABFA 1SW3A 4D1JA 3TSDA 3RHGA 2A4AA 3P93A 3RR1A 5GNZA 1EJVC 1XIJA 2OSXA 3UY8A 5SWUA 2OYKA 1KRBC 4G7EA 2BXZA 2E4TA 3AS2A 1UP2A 3N13A 4WUIA 4NY2A 2E6DA 1TB3A 3WELA 2WMFA 3T42A 4JHMA 3EXTA 2I7GA 2YYTA 4PFHA 5K7JA 3N29A 3NDYA 1EA0A 2ZZBA 1JIBA 3GHUA 2E3TA 3W1UA 1SMDA 3RK8A 2ADAA 2FKPA 4DUXA 5BYWA 1BWKA 3A3WA 3HURA 4S3JA 2PC4A 2CC0A 4XSMA 1TUFA 2I17A 2ISVA 4HZMA 1R38A 8RUCA 5CC3A 4IG2B 1QOXA 4N2YA 3PB0A 2E40A 3M43A 1JXKA 9XIAA 2O9PA 2HISA 3O05A 4PB4A 3WBYA 4B91A 2WPEA 1KM6A 4I3GA 2KZHA 3EPNA 4XAPA 3NQMA 1FWJC 3PTDA 1LM1A 3VD9A 5FJIA 3H4GA 3VM5A 1GOMA 3TQVA 4JQ1A 3IPWA 4FOJA 4UR7A 3KOFA 3U6WA 2VURA 3WNPA 1PHWA 3BURA 1E5NA 3LQGA 3WQ4A 2VYOA 4P7LA 4C6OA 3TXVA 1D2KA 4FSAA 3GH7A 2Y4SA 4P7QA 1U1HA 3KE0A 4NI3A 2QCNA 1LG2A 2WNQA 4Z2GA 3IGHX 1SYTA 3KOWA 1TE1A 4RX0A 4C6JA 4WQ6A 2RABA 3NOYA 1EJTC 1LRTA 4D6FA 4HOWA 3UNTA 1E9ZB 4IIBA 3CLMA 2A3AA 3B9AA 4W7UA 3R7MA 3CO4A 3M44A 3A3HA 3AJ7A 1ISWA 1UBPC 2QHAA 4QNWA 3HG4A 1KFKA 4ZO6A 1ITXA 3NSNA 2DVUA 3VMPA 2ZUUA 1F07A 2OO6A 2F2HA 2YZ5A 4ZL1A 2TODA 1JJKA 1TV4A 5AKQA 1JDDA 4IICA 1O1HA 2QJJA 5AY7A 2XJ7A 2CXGA 4M1RA 5U1OA 2UV8G 3GHRA 2X1TA 4IX0A 1XGZA 2WJFA 1PV8A 1JZ5A 4YWSA 1XRSA 2J4GA 3BXWA 1RCOB 4ES4A 3AYSA 3CNYA 1HQTA 2VFIA 1VB9A 3FA5A 2NXHA 3KBVA 3VIHA 3QMTA 3SCSA 4ZZ9A 2VRQA 2Q8ZA 3UXKA 3CPUA 3URAA 1TZ7A 2J13A 1JUEA 1TJ2A 4WX2A 3GQYA 1Z3NA 3GTHA 4EM4A 2X40A 1Z41A 2PTXA 3E2QA 1JZ4A 3NYDA 3DDMA 1L6YA 1DVJA 2WKJA 4OE7A 4X61A 2VDGA 3WK1A 4MYXA 3BAWA 3MP3A 3QFBA 4HP5A 1B3YA 4KPRA 1BXNA 2I5QA 3HA1A 4MB4A 1XISA 2DZAA 3R0UA 4GRTA 2VXNA 2HS6A 1MRQA 4FLRA 2OSYA 1YDVA 2DJXA 5CGMA 5D09A 1BPLB 4QSHA 1TV7A 2GVYA 2FYMA 4B5TA 3HPFA 3PB2A 3VDBA 1I2OA 3MKCA 1ITCA 5HPCA 1W3KA 2XSAA 1YBQA 3ISIX 2YPIA 1JZ8A 4QISA 3EX3A 2ZZ3A 4HMEA 1OF6A 3VE7A 3O8AA 4GKLA 3QFEA 4CN6A 4BJHA 5AC5A 1OX5A 1OHLA 1MVYA 1Q45A 2OQYA 4C6MA 1HFBA 5D4YA 3AYVA 2FZDA 1FA2A 3TNOA 3C4UA 1PTGA 2DJLA 2WZMA 4OFCA 3WBEA 3RPDA 2QGHA 3FA4A 1T40A 4XD3A 5LA0A 4H41A 2Q8LA 3GNRA 2P0IA 1CT5A 4OVXA 3EA3A 4C6DA 4XBJA 3FGCB 2BS9A 3TJIA 2X1RA 3EX2A 3WD1A 4JTRA 2Y61A 3LK6A 4AIUA 4Z2KA 1NP2A 4KEZA 5EYWA 3HV9A 4ZOHB 3U3HA 1IEVA 3WLOA 3U2CA 2E7FA 2D69A 3LXBA 4PCSA 5DX7A 1V6TA 2C3DA 4IJRA 5E9AA 3S2NA 4AY7A 1O5XA 3KHDA 2XPKA 2Z2BA 4YTUA 1DXIA 3N2MA 1M5WA 2QJMA 4YYCA 2AL1A 3FEQA 3R58A 1S2TA 5I0DA 4J5NA 3C2EA 3G1DA 3WLTA 4QCEA 3NQBA 4PA8A 5IHSA 1X39A 1S39A 2X05A 3G3MA 4M6UA 2PGEA 4RXGA 1B9BA 4LH8A 3FX4A 1VJIA 4MWAE 2C18A 3P0WA 3R43A 2VWSA 3RM4A 2PDWA 2VZSA 4C6FA 5BWAA 3LM3A 1KC7A 3W7LA 4DPPA 2GZXA 1RCXB 1HKKA 3INPA 4EQXA 8XIMA 2F6XA 1V6YA 1H3GA 3A4WA 4LAUA 1ZUAX 5DXYA 2PLCA 3G3DA 2JEPA 2C71A 3IJ7A 3LLFA 2R14A 3DERA 3MT1A 3YPIA 2Y8VA 3H22A 3DIPA 3VIMA 1NDAA 3W2UA 3PAOA 4WXYA 1GJUA 5A6TC 4GUJA 3SBFA 1QFEA 4FNQA 3KTXA 3L66A 3N25A 4FLSA 1RM6B 1Q6QA 4CD6A 4KWSA 3AHTA 1J93A 4O1BA 2BGQA 3EKGA 1R30A 4LUSB 4AHQA 4HYWA 1KTNA 4UQAA 1RBAA 1KXTA 2VQUA 3CT7A 4Q7IA 3H21A 3MVIA 3QQ0A 4G9PA 5G2HA 4V1XA 2GGHA 3LM7A 3C52A 4A8NA 1VFTA 1OFEA 3E6EA 2OQHA 4NAFA 3PF3A 1RD5A 3OC4A 3RXZA 3N3MA 4D71A 1UR8A 3J7HA 2WQPA 1P1MA 2J8FA 1V6WA 3BQ6A 3M1ZA 3WLQA 4V33A 2FHBA 3W74A 1QBBA 3UZXA 4DZIA 4UMCA 1JCMP 3ONBA 2GGJA 2YCEA 1JZ7A 2EG7A 2VFFA 1Q7QA 3E38A 2E0PA 2EGZA 2Z25A 2AGTA 2Q3OA 3HMCA 3F2CA 3WDQA 3OBKA 4UTTC 3GTXA 1Q1RA 1XD0A 1DYSA 4HNOA 5I7GA 1R3WA 2ZXQA 3H7VA 4XIAA 4XUYA 3UA3A 1Q65A 5XIMA 4XWUA 1UROA 1UIOA 3L2IA 5HR7A 5M3WA 1DTNA 3QPYA 4HHMA 5E0CA 3CIVA 3T1GA 1V4YA 3CL7A 2EXOA 1TMLA 2A8XA 1P7TB 2WMKA 3A13A 1FWGC 1E3XA 4Y96A 1KCLA 1RQEA 4UIOA 1CGYA 1UWUA 3CQHA 4GX8A 2XU2A 1PTDA 4D6JA 1GRFA 5G4HC 2DZUA 1ALDA 1QU4A 3RILA 3NZGA 4MUPA 4RPPA 3ZT7A 3MI6A 2V6OA 3V35A 1Q6DA 2Z7GA 4ACZA 2GQWA 1UZ4A 1MMFA 5M5DA 1YKWA 1X2HA 4JBRA 5F4XA 2NWSA 1WBHA 1IZCA 1WP6A 2X0SA 4PSPA 1A5LC 1RZMA 1GQIA 1FH8A 3STEA 3I3BA 4NYUA 5F4SA 3N3TA 4I8DA 5FS8A 3LX9A 4WOQA 1O1ZA 4BURA 1Z42A 3KBMA 2PDNA 5A69A 3AHZA 2PRLA 5KVHA 4I7VA 3T0BA 3U0HA 5REQA 4XAZA 4O10A 7REQA 1UR2A 3TWBA 4NXSA 1MQRA 1QAPA 4PZVA 2YXOA 2Z00A 5HMSA 5BMWA 3DC8A 3QH2A 2BY2A 3ZLGA 4B92A 1DJHA 3V1PA 1CXKA 1GPFA 3RNDA 2J77A 2GQ3A 3LOTA 4QGCA 4K7YA 1K3UA 4JX4A 2ZA2A 3PZTA 4YLWA 4NEWA 3IV3A 2J9ZA 3NDZA 1OYAA 3RGTA 1GCYA 3NYZA 4WIWA 1C8QA 5A8QA 4IFKB 2Y62A 3G18A 4DAFA 4F40A 4BHYA 3T8LA 4PE8A 1IWPA 1H61A 2DQXA 4UTWA 5KITA 5T91A 4U3AA 1M7XA 5AOUA 4RNHA 3GVRA 4GXPA 1OG0A 2XM2A 3ARSA 5HDRA 4EX4A 2G8ZA 2YDRA 4H4WA 4D9PA 3W7CA 4H9MA 5CPSA 1R2TA 2Y6ZA 1B3VA 1I2QA 3NQ2A 3TZNA 3M5VA 1BGAA 3P7YA 1GESA 3AMZA 4JKKA 2BY1A 4OT7A 2ZZ0A 3WUBA 4U2YA 3P74A 1LJYA 4IGNA 4A3RA 2J27A 3TC7A 3WDIA 2I5GA 4O11A 3EX4A 1IEIA 4TTGA 1UH2A 4N4QA 1MFUA 2Z6IA 1AJ2A 1XLFA 3HGRA 4J57A 1E6QM 3COTA 2GJXA 3GU9A 2VEFA 3PSWA 4AMCA 3F2DA 3N9KA 3W1XA 1D7KA 1PVNA 4GQBA 4HA3A 1I0BA 5D9MA 1G4EA 2ZX6A 1FHVA 1D3GA 4B5XA 1HZYA 2EEXA 4E3VA 3W1NA 2GVEA 4DUWA 3W71A 1GYNA 1KW1A 3EDEA 3N4FA 4XZ9A 3ATYA 4HT3A 5BOFA 5HQLA 2WJZA 1FWNA 3RO8A 1RLCL 5DANA 6A3HA 1OC6A 3GZAA 3W7IA 2TSYA 1BAGA 1ONXA 4HBKA 4YU1A 2HK0A 3PP7A 4M51A 1VF8A 2XN1A 2VEGA 2AL2B 1S5MA 3R12A 3RITA 2UWFA 3B05A 1KFCA 3QZAA 3GVGA 3M0JA 3BMXA 5CZTA 2G95A 1LQ2A 1PX3A 2ABBA 3EDJA 1XGEA 3WD0A 4CD8A 4V27A 3RAOA 5HMFA 3QFWA 4DJED 3NR0A 2FH8A 4H3DA 2CLOA 4JIQA 5IRPA 4N7QA 3G1YA 4DB7A 1VIZA 1SZEA 1LBFA 4A4AA 1DJYA 3VC5A 5DXXA 4AZHA 1U1JA 5H8MA 5A8NA 5AHNA 3OLGA 1GT8A 1UIPA 1CYGA 3S47A 1X7FA 1JYWA 3MWAA 1PKYA 1QDSA 1OFAA 3OW1A 2PODA 4MZYA 1S46A 4HQVA 1ZZMA 4GUIA 3USBA 3EPMA 3N6JA 1KLZA 5CJMA 2Z1BA 1NM9A 2G5WA 4JGDA 1JL8A 2WPGA 4Z2LA 4XK2A 3T2OA 1FOBA 3LYEA 3NVWB 4KPLA 4CVWA 2OZ0A 2HCVA 1O4UA 2HNHA 5D38A 2A3LA 2NV1A 2ALRA 1CGTA 4BI6A 4O13A 3L2LA 4Q33A 2V3EA 1ME7A 4GHRA 1KM0A 1T96A 1QI4A 3RDKA 3RX3A 2OPJA 4IOTA 2V68A 1VPYA 2V5CA 5F1VA 3VCCA 4RK8A 5J5RA 1RVKA 4JIIX 4WLCA 1Q6EA 3GR7A 4ONVA 1LQ0A 1JRCA 5C7HA 1GTEA 1J01A 3PPGA 3JZEA 2YCJA 2V5BA 4RE3A 4HK6A 3C3NA 4WKHA 4L6DA 3GS6A 3O0FA 4DELA 3UF9A 5F2LA 4TV5A 4PMZA 2HSAA 2VX5A 5CG7A 1PZ3A 1N5XA 3FG2P 2X1UA 1C9WA 1G4SA 2WBAA 3ES8A 3WQ6A 3TN6A 1DP0A 2P8BA 3AN1A 4AZ5A 3W28A 2V6AA 1M7PA 1FKWA 1U5VA 2DSWA 4LOCA 1XBZA 3NQCA 4M5PA 1OFRA 4HKPA 4CNSA 3WYZA 2XIMA 3N11A 4G8TA 1CNVA 5I03A 1MNZA 4LVFA 2JKAA 1J0IA 3PTMA 5TAOA 2HTMA 4J3UA 3Q4DA 2XH4A 3PUOA 4W5UA 3M0IA 3QZ6A 4AIEA 4AZBA 4FX6M 3G6LA 1HL9A 4BS0A 4L9XA 3E0IA 3NZRA 4ZB5A 1C8XA 1XKYA 2A7RA 2A3CA 2C0AA 3QY8A 5F2MA 4JD4A 3SN0A 1TX0A 1GQNA 3L21A 5G1MA 3BDKA 4AAJA 3M5YA 3W76A 4CCCA 1HF6A 2OKTA 1F3EA 3PBVA 4QDMA 5D02A 2OX1A 3NEVA 1HP5A 4QXIA 4RZ5A 3DFPA 3GUGA 1V6XA 2D2GA 5TNVA 3NUKA 5FS7A 1ZCOA 2X1SA 2G96A 3OVQA 4AX7A 4DBEA 4UTTA 1FVPA 3LENA 3NZPA 3CZGA 2W0UA 3CL6A 1NFPA 2O9RA 1E56A 1EP2A 2QNEA 1UH4A 2VX6A 3UR5A 4KGJA 3VM7A 5BXPA 2WOWA 1SFTA 4S38A 1Y0EA 1WXYA 5ECUA 4QRNA 2B7PA 3K4AA 1GORA 4AWSA 4JAWA 3II1A 1A5BA 1OG6A 4UNIA 2NVCA 1LYXA 3VGEA 2VFHA 3G2GA 1YHTA 3I7QA 3VGGA 1UCWA 1SUXA 5CQ1A 3RX4A 1EC7A 2UBPC 5AYIA 3QLDA 5REQB 5E6ZA 3A12A 4GQQA 3O16A 1EX5A 1YW1A 5C2GA 3TEVA 3T7VA 3F4WA 4H1ZA 3FGCA 2NXGA 4NAFB 1JYVA 4QG8A 4U2ZA 4UTIA 2NT0A 3UG3A 2VC9A 1N5WC 3G5EA 3LY0A 4XG1A 3WK0A 2Z2AA 4GYPC 4JKLA 4RNJA 2W0HA 4MJ2A 5BU6A 1BXBA 4GPNA 1GVYA 4A3QA 3E3HA 2XDFA 3O6AA 1S5NA 3DXIA 3AMCA 1WO2A 4FDCB 6TAAA 4O0KA 1OCQA 4J4KA 3DYOA 3U7BA 4HU3A 3QF0A 1XYLA 3FVDA 3UZJA 2Q3RA 3KRSA 5KZEA 3IARA 5BU9A 2Z27A 5C9WA 3RO6A 3T78A 1N63C 1RJRA 4GYFA 4MAZA 4UZUA 1EP1A 4XQ6A 1M6IA 1PWLA 1V7YA 1WOAA 2GVJA 2OGYA 4U4MA 3TSMA 2XIIA 4L4MA 1H51A 3PG6A 3N15A 5BMXA 5DCEA 3KEHA 4AWEA 4WRHA 1D3HA 4PTVA 4JYDA 2PSNA 1UZHA 5LA1A 3SJNA 1RHCA 1W2VA 3A7RA 2YL9A 2VFDA 4XKYB 1DV7A 4MZ1A 3FY1A 1W1A1 1MZRA 4I6VA 4UQ9A 2W79A 1I8JA 3QVQA 2PPGA 2O9OA 1JROA 3GHTA 3M07A 4GIYA 4ADSA 3L67A 1YE4A 4Y9PA 4M56A 2FDSA 4GYJA 3W2NA 2YJQA 3WLRA 3GU2A 3R5EA 4J28A 1PIIA 4Y9OA 2A21A 1JI2A 2HVMA 3T2PA 1UOKA 3SURA 4AWUA 1KXQA 2WSPA 3ARZA 1YLVA 1UYQA 3M0ZA 2Y70A 1GVRA 1F8IA 4MJ4A 5I09A 5EB8A 1ZAHA 3QW3A 4K3ZA 2VRJA 1UKSA 4S2BA 2ICSA 4B5WA 2XGBA 4FLOA 1ZDLA 3FYPA 1CWYA 3OGRA 1VYRA 4BZYA 3LA4A 4YVVA 2XH7A 1FY6A 4I90A 2Z1KA 1M68A 4ZQRA 3A21A 3UJRA 3KVJA 2ZUVA 2D23A 2XGZA 3VD4A 2C79A 3R10A 1V97A 1KFEA 2QIWA 4O53A 3MC5A 4TVYA 1EEXA 4H00A 2VMFA 1XSKA 2XVPA 5LIWX 1SGJA 1J12A 2WAGA 4GXWA 3CGEA 2VP8A 1ZKQA 1H7WA 3NIYA 1JPHA 1SJBA 3S5ZA 3VOJA 3WF2A 3WK3A 5G5GB 3HQOA 3NVVB 1RCQA 3VO0A 3P62A 2VENA 1U5JA 3BK0A 3KCLA 5G2WA 4Q3MA 3GIYA 1DJGA 4MY9A 3B4UA 3QFAA 4IQLA 3N19B 1TCDA 4PUJA 2JK6A 3K8LA 3C0JA 3FJ4A 3SQLA 3GYEA 4ZTYA 1BG4A 3DI0A 3T07A 5D04C 1H09A 3QQ1A 5BCAA 1FUYA 3WF3A 3N6HA 2DEPA 4HPHA 3FVMA 2H6RA 3FAXA 5M2FX 4QNEA 3IJ6A 1ZP3A 3W7PA 5AB3A 4HA4A 3S6DA 4Q7BA 3S2CA 4GFIA 4KBXA 1EJWC 2VZTA 1OADA 4UOZA 3CQJA 2JF6A 2AQOA 4MAVA 3PTQA 5CPMA 1XM3A 2DW6A 3G24A 2PURA 4NRSA 4AC7C 1GEQA 1H49A 4HZ8A 3WLIA 5CSUA 5FJPA 1B2YA 2Y63A 1WCGA 4HOZA 4QJ5B 1E73M 2DP3A 3UYIA 1YQZA 1ZS2A 3OP2A 3G8EA 2X0YA 1BVNP 3RRAA 4YPJA 4AU0A 2YA2A 1HG3A 3FNDA 1OM0A 2XSBA 3WNMA 2ZZ5A 4PL2A 3SEPA 5KMYA 2BLEA 4H4PA 1BTMA 1NOUA 4R53A 4V1YA 1OD0A 4M19A 3TR9A 1TJ1A 2XZ7A 1PJ9A 4YMZA 2A3HA 2GVGA 3LZ3A 1ADSA 2D22A 2DZWA 3TZFA 4CD4A 3W6LA 2G37A 3NXFA 2OVLA 4WGXA 1W9BM 3GDMA 1YIXA 3P2VA 3A6OA 1CDGA 3RU8X 3TFXA 3KZPA 1ADOA 1F73A 1QRQA 2HZGA 3L5AA 4AD3A 1WA3A 2J47A 1EQPA 3MMDA 2FHCA 5IHRA 5U7SA 4PBGA 1TZ9A 4ADTA 3QYSA 1RALA 3M7SA 4DWDA 5HNRA 1NOFA 2PDBA 2IQTA 5FJJA 5BZAA 3HGOA 5I23A 2P3ZA 1GHRA 2DSZA 1XIBA 1IXOA 4NG3A 1EFZA 4CD7A 1TWIA 3HG5A 2QULA 5JIPA 3O7UA 3AMDA 4YWIA 4PUDA 1UASA 4LSBA 4PUEA 4M80A 1GOOA 4B90A 3WBAA 4RR4A 3T0CA 5EMJA 1DWGM 1XDJA 3PZNA 4F8XA 4Q4MA 2D73A 2CLFA 3LCXA 3WEMA 4EKJA 1TKKA 1V3KA 2DVXA 1TMHA 1W5QA 5CEWA 1RQHA 1DJXA 1F4HA 1O60A 1XCXA 3L7RA 5IDZA 4IIDA 4W7WA 1KXVA 1FCUA 4TV6A 3DFOA 2AAAA 1S2AA 4WGHA 1IEQA 2YL6A 3A4XA 3IUDA 4FAMA 2BZNA 4N0RA 3BGAA 1LP6A 1XC6A 3V5FA 5LXEA 3C5QA 1Q63A 3NVYB 3PFMA 4J27A 4L64A 1WAWA 1SSDA 4DWSB 5MKGA 3A64A 4H04A 2X16A 4X60A 4AQLA 1J0YA 3W6MA 1J5TA 1S2UA 1X1ZA 5C9ZA 1QHPA 3EA2A 4AVOA 4TR9A 5AYYA 1IZKA 3WEOA 1NHRA 5BNKA 1XFBA 3KLKA 4OJYA 1GJPA 3UFYA 1HO1A 1HO4A 2YBUA 3AMGA 3APGA 2ZWYA 4TOQA 3HG3A 4B4HA 4DY1A 3OHIA 4HYRA 2AGKA 2EG8A 4GC4A 3EB4A 3LCGA 1V77A 3BG5A 4LJ3A 4AD0A 2ACQA 4G56A 4JZ5A 1JPMA 1V7AA 3EX1A 3G1XA 3CYVA 3OTRA 1VEMA 4WY0F 2W5FA 3ANUA 1V3HA 3W1PA 4XISA 1TCMA 1TREA 3TYDA 1KGWA 2EJ1A 4NX0A 3S4TA 4ZMGA 1ITUA 5LXXA 1ISZA 2B7OA 4PTXA 3WQPA 1H11A 3TX9A 5FJUA 4XTIA 1NF7A 1M65A 1R9YA 1XINA 5LGXA 3TMLA 1J0KA 1JG9A 2ZXAA 2X8RA 1YXCA 1STZA 4PB3A 4TMCA 2V3AA 3EOLA 2R1KA 3EX6A 1WUEA 4O50A 1EGZA 1R46A 5IXEA 2PBOA 4P61A 2VGGA 4GA8A 4M82A 1A53A 2OZTA 2X30A 3T09A 2QPXA 4LRSA 1TPVA 3WZ0E 4H9XA 4NXKA 1EUAA 2ZC8A 2NLIA 4DNHA 5H6HA 2VKZG 3Q65A 4LYPA 3VZYA 2Y85A 3VNZA 5A6BA 1NDWA 4RUBA 3OA3A 1N61C 1G01A 4HU4A 2RH9A 1H6VA 1KV8A 1TG7A 3IVTA 4ZO7A 3NNTA 2NW0A 3LGEA 3T0AA 3DECA 3SCNA 1T41A 1K4HA 1TV3A 2X8CA 5HK4A 1ZU8A 2G41A 3VIJA 3GFYA 4YTSA 4GFSA 1KGUA 1KLYA 4PUUA 2P76A 1VHCA 2BGNE 3NL5A 4JEJA 4LV9A 1NJJA 4DUOA 3GXFA 3VKKA 2F38A 4Q8VA 4O8RA 1MW2A 4GQGA 3U7VA 1UWQA 4H4IA 3PJXA 1HKWA 2RKXA 1Q3NA 5FL0A 2PTDA 1DHPA 4YIWA 1I2PA 1GWJA 1W9XA 4IQDA 1ZXIC 1WQ5A 2F5ZA 3W37A 4EPDC 4MNKA 1W54A 2EHHA 1YMYA 3M0YA 3CTTA 4O17A 2GPTA 1PKNA 1JI1A 1XJBA 3UPWA 1S5WA 1XLDA 4K8DA 4UFHA 2YIHA 1B3OA 4HNVA 1IT8A 1IGSA 4YTRA 3P81A 2RDXA 2G0WA 1EO7A 5EPDA 1HN1A 5G5HB 3M6DA 3TAKA 4PMYA 4UQBA 4US6A 2ZXBA 1DHKA 2WP6A 4D2JA 1GQKA 3TSBA 5A6MA 3NPUA 1W8SA 1P0EA 3FSUA 3P0XA 3BCJA 2INFA 1PIFA 3W7DA 2XVKA 4PMNA 3HQ1A 5A2CA 4L65A 3VKJA 1JF5A 4O16A 4K68A 1PZ0A 1P0BA 2VI0A 3T05A 3I10A 3JUGA 4FEZA 3SY8A 1SW7A 1M6JA 3ZLHA 3JRKA 5I3GA 1Q6GA 4H4VA 3BCFA 2EQ6A 2PD5A 1EJSC 4GYKA 1BWLA 1XQKA 1DKWA 2OEJA 1I60A 1PZ1A 3UWQA 4GISA 1E55A 3VCRA 5BRBA 1VAHA 3MJMA 3ARXA 1AW2A 3QY6A 1NWRA 4DHGA 3FXYA 3KCOA 1OYBA 3LS9A 5JQ9A 1ADDA 5I06A 1XBVA 4KW2A 9CGTA 5D8ZA 1XG4A 2PDHA 1J0HA 2VJXA 4ZXOA 3LLDA 3SADA 3I4EA 1A5OC 4HJFA 3IVSA 1SO5A 2ZOXA 1F2JA 1W9VA 4L4OA 1WZMA 3GKAA 1TZZA 2GFTA 4W93A 4HNLA 4N9CA 1QATA 2CLEA 5CXPA 2DU2A 2REQA 2EQDA 3AWNA 2BHYA 3TN3A 4J3SA 1HNYA 3B9JB 2A3EA 4N6FA 4LF2A 3C8NA 2NV9A 3PSVA 3QMSA 3H7UA 2ZRUA 4BY3A 1HJQA 5FIPA 2J79A 1MOKA 1KFJA 4FNUA 4MUZA 4EWND 3VDCA 2CBVA 3OVPA 1A47A 1OWQA 3MS8A 2NQZA 3PZOA 1FIQB 3EB3A 1EXPA 2WPCA 1C91A 1PKLA 3HF3A 3NFUA 1NHSA 5PTDA 1OT2A 1Z69A 3FA3A 3CGBA 3AU2A 1V3IA 4IPPA 1C7TA 1GRGA 5CG0A 2FZ9A 4JQAA 1FWRA 3LHYA 3PNUA 4L4LA 1X96A 1LORA 2HROA 3GNXA 3LMYA 4MKVA 3W87A 1DIEA 1XRTA 2JK2A 1TJ0A 3WH7A 4YXGA 3STGA 3BC9A 2XIQA 2EKGA 4JCLA 4LWWA 4GO9A 1E1CB 4UBPC 1GVEA 4HPJA 4OOZA 3A23A 4S3BA 4GINA 3QGKC 3UP8A 2Z29A 2V69A 4HA1A 2ZVRA 2OEMA 1LWHA 3L5LA 1A3WA 4IPNB 3U2ZA 5CC6A 4HNTA 1QI2A 1PBGA 1SR0A 3F4NA 3SAZA 2BVWA 3AFBA 3S46A 5IBXC 1XICA 4CQ9A 4CQCA 2V5JA 2WB5A 1ZJBA 1DWFM 4MYAA 4XX6A 1D7FA 1VLIA 3BICA 4LC8A 5G4WA 3MSYA 1FWAC 2D2OA 4MDPA 3UGVA 1X6UA 3PULA 4HU8A 1TA3A 3TV8A 2ZKMX 1NVMA 1OX4A 3O0KA 4RW5A 1XIGA 2CBUA 5CZSA 1K77A 1XI3A 3THAA 1VEOA 1PAMA 3M0LA 1A5AA 4MG4A 2J7BA 3H23A 3MSDA 2W9MA 2D1ZA 1JZ2A 3DEQA 4APNA 1H5YA 2DY3A 4KWVA 3SIZA 3RM9A 2ZIDA 2A1YA 1PX4A 4GCXA 2Y8UA 2BNJA 2BBFA 1D7YA 3SRFA 3KM8A 2FDMA 6REQB 4DQWA 1ZK7A 1TWSA 3ZVIA 1DJWA 5DY3A 5D9PA 1KM1A 4NZ5A 4BF9A 1KFLA 2OB3A 1OFPA 1AUSL 1N8FA 1AH0A 1XPYA 3N4AA 3QR0A 3MKKA 1WZAA 3L0NA 4ZR8A 4HU0A 4U5KA 1P4CA 4MM1A 2NVAA 2JF7A 2BVTA 2PWVA 4H9VA 2PWDA 3CS2A 5IFTA 1ME8A 4R5EA 4AZ7A 3FV9A 4A21A 1EL3A 4BQ5A 1YDYA 3S3GA 3L68A 1R6WA 2O4QA 4HCHA 1N8IA 3O6CA 3SSZA 2YL5A 3C2OA 2YDSA 1B3ZA 1Z89A 4JDRA 3GFZA 3HFYA 4E5TA 2HXUA 1VJZA 3LB0A 1CLKA 3LHUA 1RP9A 3ANYA 3DENA 3QR3A 5FF7A 2QDGA 3C2RA 3VX0A 1GOWA 3BG3A 4WKFA 3TYEA 3W7QA 5D9NA 2DIEA 4TU1A 1E15A 1G69A 4KWWA 3VYLA 3ANVA 3W53A 3CB3A 1UPPA 4I5RA 1GEHA 4B9ZA 2Y0FA 2BSLA 1ONEA 5T9BG 1UD3A 5HANA 1VLWA 2EPKX 2DW7A 4WCJA 5DRCA 4O1EA 1DXLA 3WH6A 3PVFA 3H2EA 4K8EA 3FN9A 3NQVA 3CAVA 1TQXA 1X2GA 2ZX8A 4C6KA 3MTWA 1EF2A 1SFSA 3TQPA 1NFBA 5DO8A 3URQA 4ORMA 1LOLA 2A6NA 2WZIA 3RUBL 5HQEA 1X97A 1ZB5A 1N60C 1UR3M 2ZX5A 4QIUA 1GQJA 3MUCA 1DIDA 2F61A 4FS9A 1XC4A 1XIFA 4I5XA 5LSMA 9RUBA 1RD6A 3N2BA 3WNKA 2HE5A 4RE2A 2E9LA 1AD1A 4XZBA 3G6MA 3ZVHB 2OCZA 1EA9C 2DORA 1K9DA 3NURA 2CBIA 2E6FA 4E0CA 3AZRA 3PNZA 7TIMA 2IKGA 3JW7A 3N17A 4P7OA 1GKRA 2I1OA 3C6CA 2J6XA 2H8XA 3QJAA 3MP5A 4OKDA 4FR1A 5HBFA 1I2NA 4R9OA 5EGRA 1GW9A 4UR8A 1ZBKA 3QGAC 4AFYA 3B8DA 3ZIZA 2D2JA 5I6SA 3UYCA 2VVSA 3U2OA 1SFLA 2WWCA 1EP3A 3VGHA 4B3ZA 1OC7A 2HDJA 2E9BA 2FVKA 1LG1A 4Q8PA 2DSUA 3QOKA 5C5YA 5AHMA 3XINA 1F6KA 3RYSA 3GXIA 3VC6A 4F2TA 3HRDC 1DWHM 5EU9A 3LGDA 4EAMA 4P8XA 1E1FA 1GVIA 3PJTA 1S3TC 2QEZA