3JWDC

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
184
structure length
184
Chain Sequence
MKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
total genus 36
structure length 184
sequence length 184
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdC02
4JQXA 2WIMA 4FQQA 3S98A 3HC0A 3ZO0A 1RK0A 1CE6A 1DANU 1J8HE 4JCMA 2IAMB 3MODH 5SWZD 1T2QH 3CC5A 5JTWA 5JQ6L 3PHOA 5GJTH 1ZVHA 4ONFH 4F2MB 5DRZA 1AGCA 2YPLA 1B2WL 1TZHB 4YQXL 4WHTB 4PGJA 1T5WB 2AEQL 5DC4B 4YFEA 3FFCD 1T7XA 4XP4L 3SGKA 2X9XA 2ZJSH 5E8EA 3NCMA 4XBEL 4PRPA 4G6ML 2O93L 3P4OB 1DP0A 2AXFA 1FSKB 4MVBC 1WZLA 3D85D 4HX1B 5TDPB 1UM5H 4OD3L 2W91A 1CFBA 1WISA 3CSGA 3HKFA 2A6JA 2DLEA 3Q5TA 1B90A 1NBYA 1BQLL 1JK8B 4OLVL 1J1XL 2WIIB 3RKDD 2AI0H 4LAQL 2ICWB 3WMSA 1WIPA 4PLJD 1QLEL 4Y2DA 4DCQA 1G7PA 5K59E 4UZGA 5FKPB 2AEWA 5D7SH 1K6QH 4GBXB 4G5ZL 3ARUA 4KJPC 4PRID 5C08A 5JR1L 4WI4A 2W9EL 3TBTA 3HNVH 2JE8A 5CD3A 4JG0H 3DECA 1LMKA 5I1LB 4NFDA 1LD9B 5FF6A 1P7HL 1E4KA 4G3YL 5DUPH 3TZVC 4BJLA 1KYOJ 1DSFL 1MRCL 4CMHC 3QISA 1MOEA 3S9DB 2XZCH 1SQ2N 5JUEL 2APBA 2NY0B 3HE7B 5HHVH 1CFTA 2JELL 3ULSB 4F58L 3QB7C 5D5ME 3CMGA 5BRZA 4Z7WF 1PBYA 1TXKA 3HE6D 1TETL 3T0AA 4PGZA 3OZ9L 4GAJL 2NX5E 4NQEA 5DMJB 4YWGH 1OP9A 2ITDA 2XA3A 4PRDA 1SM3H 1JHTB 4RIRA 4ETYA 1HH6B 5TQ2H 1KT2A 3VFUA 1PAMA 5KSAB 1HHJB 1NL0L 5C0AD 3U79A 4UDUA 4E0RB 4RGOL 5MEPA 3RA7H 4J1UB 3GJEA 3HUJF 3DVGB 5KVFH 4PTUA 3L3HB 2H9GB 2VAJA 2WUCL 4UOW0 3EJYC 4DFHA 1CLOL 3IVKA 3MUGB 3QUMA 4IOFD 4WWKB 1DVFA 3DMMC 2KZ1B 4OD2B 3IDGA 4PJ5B 2VQ1A 5ILTH 1U92A 2Y36H 4L4VD 1ZANL 2YD1A 4Y1AD 3AAZB 3FO2A 5JPNA 5IBLC 5FYJU 5DHYB 3MNZB 4P5MB 3RZCC 4MSWA 5BV7B 4TVPD 2YD7A 5DK0A 1MCLA 2W92A 1IAIM 3WIHA 4KXZI 4JCLA 4RFNC 1O7VA 1QLFB 1FGNL 3EOBB 1LK3H 4HS8H 4E42A 3TYGH 5I16A 1A02N 4O51B 5A3IC 2HA1A 2P5EA 4L4JA 1U41A 3MZTA 4CN4A 4FQXC 5EOTA 1A6AB 5BJTB 2DBLL 2VXQL 2X4NB 3O2DA 1T2JA 5HDQL 4MS8D 4X0KB 4J23A 5LG1A 4ZTPL 4J2XA 1CICC 1P1ZA 1DL7H 3EW3B 2XXCB 3DRQB 3OHXA 4HWBH 3QPXL 5GJTL 4NSKA 3MZGB 1T2QL 1FL5A 1T22A 3MODL 4RMTA 5IHZB 1PDKA 3RX7A 3HRZB 4WUUD 1XZ0B 3VWKC 4X9FA 2W38A 2Z35B 5DUBA 4HWNA 4U1GC 5EH1A 1ZT4B 4O02L 5DZNA 4XP9H 2GCYB 2DQJL 3GK8H 5K9QG 4N0UB 4XC1H 1CFNB 4U1JA 2Q3AA 2VZOA 4KJQC 3GBML 5GPRA 1AIFB 5INCB 4MMXC 3HUJE 4LVHC 2W9LA 4C56E 5I1CH 1INEH 3KGRA 3DGGA 1OCWL 3LEVH 2R0LH 5E8PA 3DWTA 5D1ZD 5I73C 4FXGB 1XGPB 1A1OB 5AUMA 1MCWW 1MFBH 3TLRA 1NMCB 1DR9A 2XT1B 2YD3A 1HSAA 2A6KA 4PRAB 1G0DA 3VDBA 5L8JB 4P3CL 1M6OA 5DK2B 4QHMA 2H3NA 5DJDB 4LAJH 3C6SB 1EAPB 3UTTA 3RY5A 3SGDI 4EI5D 3VE0B 4FMKA 4WUUA 2Z31D 3DROB 3MCLH 4LK4A 4MSWB 5IJVA 4WFGE 5GSVA 1N7MH 2VIRA 1OF2A 4LCIL 4ONGH 2RFXA 4HUKB 3P11H 3W5MA 3MLRH 3MUGA 3V5KA 2H9GA 4MJ6B 3FT3A 1TJHH 3DVGA 1B3JA 4NGHH 4K55A 2IANA 1HHHA 2VYRE 1T03L 3QG6B 3S5LA 3RUGE 3AXLB 1MHHB 4GG6B 2XTJB 4LSTL 4OCRL 5L2KB 5IVOA 5EU7E 3H42H 3TVMB 1I1YA 1AHWC 4APQD 3TBSB 3DXAA 3VXOB 2YKLL 2CXGA 5CD5C 3FHAA 2ITDB 1MFEL 4WEUD 1RZJH 3FZUC 5D7JA 1NGZA 1A14L 1GAFL 5IVXA 1FLRL 5C7XH 4ETQA 5D1QB 4OIIH 1CTOA 4YDVA 5DEZA 5E2VH 2VUYA 5C07B 3PV7A 4K7FB 1F3DH 1MHCB 2CGRH 2H6PB 3ULSA 3LKQB 1BOGB 4IRJD 1CFTB 1U2HA 3S88L 1FFPB 1FYHB 3LPGA 4LP4A 3FB7A 2H8PB 2GW5A 4LPWA 2QSCL 1DLFH 4WFFE 1QSFA 1YC8A 4DK3A 1SJEB 5B3JF 3FB8B 4PS4L 1DUYB 1UB5A 5GJSL 3V4UL 1D5XB 3V4UH 3VA2C 5GS2D 2OI9C 5FUCE 2OMNA 1I9RH 1AGDB 2YUZA 4Z0BL 5FYKU 4JZJA 1DLFL 2IADB 1S7QB 3ZKMC 5CBEA 4L3AA 3VG9B 4PBXA 2WWKT 3T2PA 4PIRF 4LVNB 4A2MA 3MV7B 2XTLA 4P2QD 4U0RC 3B8SA 5HGBA 1YN7A 1QBML 5IVXF 3O9WD 1VSCA 5E4IA 4QRRB 3C5ZB 4JHAL 3HLAA 4LKCA 4OIIL 1MI5B 1MRDL 1J8HA 1XGRA 1FLRH 3NFNA 4Y4FA 2Q76B 3RDTB 2ZPKH 1ZKAA 4AH2A 5GRVK 3HPJA 5CP7A 2AK4D 4NC1E 3N9GH 3HZVB 1AGFB 4LRNH 4M7ZC 3SKNB 2IAMC 1MCPH 2R4SL 4JPVH 1L0XA 1A7QL 3NZ8B 4NWTH 2VJXA 4XPTH 1JE6A 4OBSA 4PJAE 4R2GB 1N2RB 1DFBL 3OAUL 3C60A 2HJKB 2DQFA 3RFZC 3GMQA 1QFUH 5C0ND 1JHKL 1ZS8B 4OGAD 1NCWH 2HJLA 5F9DC 5F70A 5DRZB 2D4DA 1F02I 1QFWI 1QZ1A 3CC5B 4XXCA 4TSAH 1PFCA 2WWMD 1CT8B 1UZ6E 4MNQA 1HIML 2VO5A 3I50L 1X5ZA 5CJXC 3UTSE 2GQHA 3BH8A 4Q9RL 3PXJA 3QH3A 4DEPB 4HWEL 4AJ0A 4PJ7E 1INQA 2Z92B 4ZFFA 3FOLB 3VW3L 1B0WA 1DN0A 4YDIL 1N0XH 2V7HB 5D9SB 5K9JL 2QKIB 4H26B 5GS0H 2HTLD 3KPRB 3EO0A 1S8DB 5DI8B 1MLCA 4P3CH 4D0DA 1RD6A 5CLTA 4LU5L 5J12C 2FBOJ 3ARVA 2P7TB 4V1DB 3EYUH 5KVGH 1NLBH 2HRPL 4QRPD 5F9OL 5AZ2L 4G6AC 2LQRA 2H32A 2GK2A 3RWCB 3P30L 1DN2A 2ENSA 5MERB 3HA0A 1QQDA 1KC5H 4FA8A 3LEVL 4KKAD 4XZUB 4JFQA 2Y6SC 4KDTA 4PJBB 5I1CL 5DMIL 1PSKL 2VDOH 3JTTA 3SE3C 1PVHA 3AY4C 1BLNA 4K9EL 3BP5A 5BZDB 4PP2B 5D72H 2FO4B 4AT6A 2NY0C 3HE7C 3SDYH 4WWKC 3KLHD 3JV6A 3QWOB 1RUQL 5DTFB 2NW2A 1KJVB 3MOBH 4U2ZA 3T0BA 5B4MD 5D7JC 1DQML 4L4VE 1MWAB 2AJZB 1WC7A 4F7CA 5BO1H 1A7RH 2YPVH 2WBJB 4WFHD 4UIKL 3SKOB 4URTB 2OBGA 3S35X 2FD6H 5E8DH 3TESA 3U30B 2EEAA 4JRYB 5EBWA 5DMKA 5C09B 1Y0LA 1HSBA 1A1MB 4JG1L 4KVCL 4XMPH 1JHLH 3BSZH 5HYJA 1IGCL 4RAVA 4I0KA 5ETUA 2GJ6D 4MD4B 3ZZ1A 3DUUA 1R0AH 4OCWL 4XI5C 3V6FA 3IU4L 2DOCA 3N85H 2EYTA 5HPMB 3WSQH 4HLJA 2R29L 3DMMB 4O58L 3UYRH 3A67L 4HS6B 3L5JA 2ADIA 1MCOH 1MJ7H 3C87A 5HYQB 4LOUD 1S7TB 1V3MA 5C0CA 4S2SB 2GJJA 3FOMA 25C8L 1MFNA 5IT2L 3LSOA 2CKBA 4HHAA 3O41B 1L0QA 5IROA 3ROLB 5IEHA 4CW1B 1ZANH 3DX7B 2B20A 3MJ9L 4XMLH 6FABL 5E6IA 2CDGB 2FJGA 3DGCR 4X8JA 3AMLA 4RGND 5JHLH 4PTTA 5CMAB 3ILPB 5KVFL 3MOAL 5A2JH 4GKSA 4X98A 5GZNC 3Q6GH 4FFYH 4NM8H 1ODAA 3DV4A 4QHKI 3NCYP 1FNSH 2G5BA 9CGTA 2EIZB 1CFVL 3FT4A 1EUTA 2DYPA 3MRIB 3X12A 4BFGA 1NGYB 1IJ9A 5L6YL 3QHFL 1HN1A 1IAKB 4NC0B 5C0BE 2GAZB 4M6ML 2P5WA 4LPTA 1TETH 5JZ7D 3MLWH 3QNZB 2DTSA 4E5XA 1J1OL 5DJ8B 4ODUB 4X99A 15C8L 3QA3A 4JFYB 1OM3H 5CZVL 1GVIA 2EE6A 4GW4B 3U36A 2IFFH 1HXYA 1C8PA 1AI1L 1T7ZA 4ZFOL 4NKOB 2VKXA 2QR0B 2OR7A 3HG1B 3V0VA 3HB3C 5LKNA 1CICA 5IB3B 3RZWA 1N5YL 4JM2F 1LO5B 1S7XA 3GI9H 2J8HA 1CTNA 1GHFL 4JG0L 2BJML 1FG9C 5B8CB 1A9BB 1EO5A 4Q6YA 4MA7H 2H2SC 1QA9B 4BQ8A 1DBKH 5BXFB 4O2EB 2JF1A 4M1CC 1LE9B 2J88L 1HNFA 3UAJD 2HT4C 1JPGB 1QLEH 1M05B 2A9MH 4GRLC 4RA3A 3VGBA 3TO2B 3EOTH 4NBZB 4O5LH 4OZHF 3BE1H 5AAWA 3EJZC 4MCZA 4GRLA 5IEKB 2YEZA 3TWCH 3MLWL 3S37X 3MRPA 3OR7B 2DS4A 2MWCA 4NRYB 4JFEE 1CFQA 1A1NA 3TNNB 4Y89A 3MLUL 3OKLA 3K1DA 4GT7A 2FBJH 3VI4E 5BVJB 4S1QL 1PW3A 4JZNA 1S5HA 2DI9A 5DGQA 1IBGL 1MJJA 1AY1L 3SGDH 3EHBD 5GIRB 1RJCA 3QDGE 3FQTB 1CFVH 4N8VG 3MRQB 3EOYG 1PYWB 4P9HC 2A6DA 4LHUB 4HXAH 1B2WH 5KS9A 4DW2L 4X9IA 3IU3A 1CK0H 3MGOA 4M93B 4S0SD 4N0FA 4P59H 2NY7L 1A8JH 2EKJA 1JF5A 3WS3A 3T0EC 2NLJA 4E41E 1E4XH 2MCPH 1WIOA 1JZ2A 1JL8A 2HH0H 3MJ9H 4LVNC 4TUOA 4LNRB 5T5NF 1A47A 1JBJA 2PTUA 3H7BB 5C0BA 3EFFB 3AROA 1A4KB 2IG2H 1BZQK 5FB8A 1NKRA 2BC4B 2CLRB 5GS1B 2BMKB 1MQKH 1NPUA 2OXHA 3MJ8B 5DO2C 2B5IC 2F58H 3VH8G 1MJ7L 3QUZA 1KB9K 1T20A 1R3KA 2XZAH 4OLXH 3UJIH 3W9DB 4A6YL 4OSUH 3P77A 5D70L 2VQUA 5IMMA 1FVEB 4F8TA 3QDMB 1SYVB 1ZOXA 4BFEA 4KVCH 4XMPL 3VD5A 3GMNB 4X6CB 1BIHA 2J5LB 1FNLA 5D6DC 5EG6C 1S78C 1VEPA 4Q74A 3D0LA 2NNAA 4XNQB 3ARTA 3GSWB 4UDTA 2DQUH 3MO1B 1IC4H 4ZPTA 1N0LA 1BGXL 3LEYH 4HSQA 3S34L 3X13A 1NAMA 3C5SA 2GT9B 2NY6B 3TH3T 5GZOD 3MOBL 1RUQH 2HFGL 1WV7T 2WW8A 3G6DL 3GSWA 3K46A 3SDYL 1HHIA 4MXQC 4Z7UA 3AU1B 4XC3H 2OK0H 2VDOL 5DMIH 4O9HH 3VFVB 1X5XA 4I9WE 1FORH 1JZ4A 1KC5L 3EDEA 2BSRB 3ARXA 3VFOB 1QTYT 4L29A 4PJIA 1YMMD 3KS0H 5IV2A 2N1KA 1F5WA 4MHHI 5F72S 5J89A 4ISVB 5GS0C 1M71A 1P7QB 2HLAA 4QRQB 2OL3A 1YY8B 1DBBL 3QWRD 3ARGA 4O2FA 4TVSa 4RGNE 1ETZA 2OTUA 4NKQB 3IJHB 1BEYL 4YXKL 3RTQA 1U8PA 1I1FB 5JW5B 3IAGC 3SEPA 5D2LA 2PTTB 3DSFH 4CJ1A 2BSSA 1I8IB 1IQDA 4PB9L 1JGDB 3BEVA 3NAAH 2DWEA 3RGVC 3MGTA 4PJXE 4HWEH 5T3ZH 2ESVB 1TQCB 1CDBA 3MV7D 5H37H 4NN6B 4EVNA 2O26U 4HWUA 1MFAH 3IB4A 4JR9L 1HIMH 2VLRB 1S9VA 3PJSB 4R96B 3IU3B 1YMME 4P46C 4DVRL 2JCCB 3QIWD 2IH1A 1AGBB 3QNYB 3WNPA 3MV9E 4KHTH 1TPXB 3B2UD 3TNMB 1FIGH 5F93C 5HHQA 3ALXA 1FYTA 1EFXA 2WV3A 5ANMA 2EDEA 3OAYK 5F7WC 4QXUH 4ZYKA 4NQXA 2HVKA 5F7DB 1JJUA 2HG5A 5F9JB 2A38A 1CFQB 4L4VB 4X9GA 3QEGL 4K9EC 2K1MA 5FO7B 3BKML 2DM3A 3S36X 5I1AA 4I3SL 5IR1B 1MRDH 1KTKE 4LCUB 3VRLF 4NO0B 3IFNL 4F15C 5AG8A 4MXVF 5BV7C 4XCYA 3BEWB 3VXQB 4J8RB 1YQ2A 4LVEA 4R7NB 4MQ7B 1UJTA 1JGLH 4HAGA 3MXVL 5EO1B 5ESAB 4NJ9L 4Z0BH 3VJ6A 1FIGL 3TYFB 3PQYB 5E00A 3CGTA 5GJSH 1CWVA 3EFDH 3MUHL 4QRTB 3V6OC 3K8MA 2XI9A 3VFMA 2VLLA 3FB5A 3DOSA 4ZOAA 3TO4C 5I15H 3ARQA 4UB0L 1YMHB 3AFLA 1QO3A 4XX1G 5AD0B 4NN5B 1I8MA 3CAFA 3X14B 5KG9A 4P2QE 2ZUYA 5KW9L 1CFSB 2R69H 2NY5H 5C7XL 4X6DE 1GAFH 1A14H 1QBBA 5GSRB 4BSWA 1RZJL 3KPSE 4N1CA 1XIWD 5T1DL 3JV4B 1VADA 3LKRA 2CLZA 4W6YB 1ZHKB 4H1LG 2ZUQB 4ODBD 3WIHL 3H42L 2NY2D 2P5WD 3CZFA 1FVDA 3ILQC 4HZLB 3UZEA 4LSTH 4OCRH 2OP4H 1I1RA 4NQUA 1EHXA 4YJZL 4F80A 4HPYL 5C0FA 3ULVD 4PV9A 1QHPA 1ZVYA 5GGSA 5D7KE 4Y16D 2C3VA 4PTTB 2OK0L 1ORSB 3QCUL 1NQBA 1T2XA 3MV11 3HAEG 4WVRA 5EWIL 2E6QA 1VA9A 1QSVA 4FTVD 4LCIH 4ONGL 3L95B 4U6HB 4UMGA 2EXYD 2R1XB 1G7MA 4R3SB 5JHDB 4OZFB 4E41D 1I1AB 4GXUN 1L4IA 2O5ZH 5IB4B 5AZEH 1IC4L 3BQUD 4S2SA 5C0CB 4P4KA 3D39D 3G08B 1JUFA 4YK4C 4YHIA 3G6JE 5DJXA 4GBXD 3MR9B 5FO8A 1F2XK 5DD5H 4GXUM 4PRHD 1KIRB 1KLFA 3C8HA 5DFVC 4WW1B 1OP3K 3C8KB 4IRZL 4EDXB 3NACL 2IANE 2MQ3A 3GBLA 4LLDB 3UZVB 4IMLB 1JNHA 5CZKA 1T4KA 4PRPD 3ARBC 4M1DL 2F8VA 3OSKA 4ZMAT 1H3PH 1P6FA 2PKDA 1JCKA 2JJWA 2DIAA 4CL7A 1EGJL 3RVVC 2D7TL 3UJJL 5HHME 2FDBP 3ZKND 4OFPA 3RI5K 2VDQH 1YY9C 1KG0A 1OPGL 1F2QA 3EIFA 1S7VA 4WU7B 4TULH 3ARDC 2F58L 1CL7L 4MGXA 3HAEA 4UQ2B 5EOCL 1KXVC 1LDPH 1RUAH 2IG2L 4P49A 5B39B 5JDJA 5J06A 4GO6B 4NQDA 4O02H 4HULB 5AAMA 5TDNA 3BI9X 3JV6B 4HWZB 1FC1A 5C9JA 5I1IL 1IL1B 2B1HL 3R4DA 4P5KA 4PJCE 4U1KB 5C0FB 2F8OA 1EERB 2I5YH 2ARJQ 3QXTA 4XVTH 5F1NA 4DW2H 1RU9L 4KV5E 3PDGA 4K7PX 4RFOH 1DL7L 3GHBH 5DD3H 3BPOC 2Z31C 3PWPB 4ZTPH 4PJXA 1T04B 2PW2A 3ET9F 5IVZA 3U4EB 5HDQH 1AY1H 3PV6A 3NPSB 3OXSA 4NNPH 4UV4H 4S1QH 2FBJL 2OLDA 1QUNA 1T21A 4U3HA 3TYGL 1AR1D 3BQUA 1FGNH 1G7QA 5HPOA 2HKHH 4JFOA 1RY7B 3D2UB 1VCAA 4XNUL 3HRPA 4WGVB 4I4WA 3VFRA 1INQB 2YRZA 2Z92A 5F8RC 2JB6B 1G7LA 3BE1L 1IKNA 3L5XL 5EZJA 3VFNA 3NA9H 1Q0XL 2Y5TB 2G2RB 5EUOE 4DGYL 5FYKH 3QWRA 2A9ML 3REVA 5A43C 2Y7QA 3RX8A 1LEIB 2K9UA 3ARGC 2F15A 1RUML 3F7VB 3VFMB 1R24A 5IFJB 5DWUL 5E4EB 5IMLA 5JIPA 2XACC 4UUJA 3E3QE 3IDYB 1N4XL 5JPMA 4MA7L 4S11A 1RIVH 3RWHA 3GMQB 1K8DA 4C83A 5F96L 4RGOH 4MQXC 4WW2A 3T3ME 5A1AA 4UOW1 5ACZA 1MCFA 3MJ7B 3P40A 4P0DA 4B41A 2X4SB 4LGRB 2IPKA 3DRTB 3NCFB 1Z5LA 3BUYA 3N1PC 1SEBB 4PJ5D 2O61A 5F97E 1AI1H 4M6OL 2EDYA 4RMQA 4GAGH 3N06B 1OM3L 3MRHA 5GHWH 5EIIB 2XN9B 4UT6L 3O6FC 5LJYH 1J12A 4KV5F 2HJFA 4X5WA 1WZMA 4PREB 4WI2A 4ZXBD 3IDJA 4IM8A 1YEJH 5EDXA 4CNIA 4DKFL 1TQCC 2AJVH 2NCMA 5IM7B 1QLRB 3O2DH 2RBLA 2C1OA 1X5HA 5CIPB 5DD1H 1A7BA 2A0LC 3CFIC 3I9GL 3UTZA 2UY7A 2WAHA 4O4YH 3MRCA 1FNSL 2YPKB 5EU5A 4KGJA 4JRXE 3TN0C 1FP5A 4LPVA 3IDIA 3QEHB 4K8RH 5FM8A 2F19L 3CK0L 5JHLL 1WBXA 1A4JB 3TPUB 5D7SL 4JQXC 3BDYL 3R1GL 4HK3N 4YHPA 5IKCA 3DXAD 1U6AL 4MQTB 3GKWL 3SDXE 5HVWA 5DEGA 1MHCA 4K7FA 1LHZA 1VACA 3OG6B 5HHPB 5F3BA 5IT2H 25C8H 1S9WA 3AY4A 3B3IA 3PWVB 5C1MB 1N3NB 3OJMB 4PJHF 2WBJD 4FFWD 2Z8WC 5T1MA 2ZSWA 1IFHL 2X42A 3L3JA 2J8UB 5CJOL 4PJ8A 4YHMH 1S7RA 1V8HA 2UZIH 3HNSL 4OD3H 2OL3B 2WWMC 2CIKA 5DK3A 4X4XA 3VXOA 4OGXH 3N85L 1N5AA 4M8QA 3IU4H 1FAKT 5L2KD 3T4AB 3ZYOA 2QTEA 1FJ1A 1MF2H 3TN0A 4XBEH 3GB7A 5L2KA 2X7LA 1CLYH 4XP4H 4NUGH 1F6AA 2AEQH 3VFVA 5FYLD 5HHOE 5KANI 1AP2A 4YQXH 2WQRA 3TJEL 4PJAF 3SKMA 3AU1A 3DYOA 3E1F1 2EE2A 3S6CA 3IAPA 1AXIB 3O11A 5E1AA 5BMFH 3ZKQD 2CQVA 4KAQL 5C2BL 3DETC 5EFIA 5BO1L 1YMMB 2GSGA 5E08L 4X6EB 2YMXL 3W0WE 2BCKB 2YK1H 2DLFL 1A3RL 5TQ0H 5TF0A 2VXVH 2DQDH 4I8DA 3IDMA 3BP6A 4X6BA 1IAIL 4JO1L 4ZAKB 4FP8L 3MPCA 1SY6L 3S35H 1A3LH 5GGQL 1PSKH 4BSVB 5E99H 4X80L 4Q2ZB 4OD1L 3R06A 1GC1L 1EK3A 1FZMB 4FN0A 1RUKH 3NA4A 3OAYH 4H8WC 1IC7L 1NGWA 4JAMB 3UTSB 1MCCA 3PWPE 3W9DA 5IB5A 3CFBB 5AZ2H 3M8OL 3Q2CA 4PY8J 1NFDA 5FHAH 1WTGT 4BSVA 4MNGA 2M2DA 1U3HB 5DD0L 3DX9B 2EICA 1T5XA 2PW1B 4GG8A 4X6BB 5I74C 1ZTXL 5SWZE 3V9FA 1DDHA 5K9JH 3NVQA 1CFNA 1WGOA 4NJAL 4PJGB 3TV3H 1A64A 3VW3H 3GSNA 2P24B 2LFGA 3QDAA 2BCKA 2YSSA 3KXFD 1KJ3H 3D5OF 1IGML 1WFTA 4GKNA 2AJSH 3DX9A 1FHGA 1MY7A 3VFGH 4H0HB 2VN4A 4RWHA 5TF1L 1LO2L 1YEIH 1MUJA 3AREA 4DUWA 3D3VB 4TUKH 4XHJD 3OHXB 3QO1B 4I3RL 1NCTA 4J3OC 7FABL 4HIIA 4XCNB 5E6ZA 3R06B 3PP3H 5DQDL 2XRAH 2ZOLA 2Q86A 4IDJH 5LQBL 5ID0B 1MIEH 3X3FH 4JO4L 3H9ZA 1A6AA 2QQQA 2X05A 3BMWA 3MV8D 3N9GL 1K2DB 3N1QC 1FN4A 3T0EB 4RMSA 1EH9A 3FO9B 1GGBH 2J8UA 4Z7UF 1J9CT 2GSGB 3SPVA 1OTTC 4GRLB 3WXWL 5C0BD 1MREL 3BOVA 4NKDB 4WO4D 4XXDB 1KYOK 5FOJA 3AAZA 1CN4A 1KN2H 4TNWK 1QBMH 3MRNA 4I13B 3QJHA 4OZIF 3CFJA 3QWQB 4WHDA 1J8KA 1FE8H 5E2UL 2VWEE 3OKMA 1FNGB 3PWNA 1BOYA 4NT6B 3VMNA 1LE9A 3K8KA 5I2IB 3B83A 1YYMH 3GUTA 1NDMA 3KXFB 5MHSD 4JLRA 3WS6A 3RKPA 3WLWD 2Y07L 1HHKA 4G42B 1BFOA 4G43B 5TE7L 1PKQB 3C09B 3QQ4B 4H0IA 2FX8L 4HS3A 3GSOB 2QHRH 4UDUB 5EU5B 4E0RA 3QR2A 3O8XD 4XPBH 2VZVA 3AS3A 3V79C 1EZVY 2EDNA 4GKOA 1A2YB 2OR9L 3VG0H 1A6UL 4CNIB 4NQDE 1Q72H 1BJMA 1NSNL 1MFCL 3O2WH 1B0GB 5DXWA 2Q7NA 3PHQB 4POYA 4YBHA 4PLKD 4KI5E 1S9KC 1ORQA 1C12B 4K71B 3MLSH 1KENH 2GY7B 3PL6A 2QQLL 1EO7A 5IKCB 4NC1C 4I0PC 3X11A 1QFWM 1N64H 4Z7OE 1P5VA 1UACL 1FFOA 4GRLD 4W81A 3ZDXF 2H32H 4JJ5A 3DV6B 4UBDD 3MJ7A 2OTWA 4S1SL 4V1DD 2YPKA 3NFSL 3OXRB 3CLFL 2VH5H 1Q94A 5CSZA 3PABA 5CILH 4OI8A 2BOBA 1T0PB 4GBXA 4QHKJ 4P46A 1KTLB 3MLRL 2FJGB 5J56B 2BNQB 4ODHL 1P7KB 1YPZA 1VPOL 3Q1SL 3E2HB 4IIQA 4TPRH 3REVB 3V4VH 4R97C 2XN9A 3UEZA 1T1YA 4ZG1A 3EHBC 4CW1A 5L2KE 3MBED 1U58B 5ELIA 5EUOA 5CZXD 1EEZA 4XCFH 4CBPA 1EEYB 2J8UE 1U9KA 3QFJD 2V17H 5I1GL 2OSLB 5E9DE 3MRKB 4BH7B 3MRMA 5HGHB 3RTQC 2X4SA 1G7QB 4Y19B 4BZYA 4UTBH 4NN6C 1AKJA 2AS5M 3HZYA 3GMOA 2AXFB 4JFFB 4R2GD 5DJ0B 4WUKH 3PWJB 4NCDA 4RAVB 1E28A 3MLTB 1HILA 4FQXA 1FFNA 3BN9C 3PWPA 1F58H 4FQIH 5JOFB 3VDAA 1HYSC 4KI5F 1QVOB 1W72H 4DVBA 2NXZD 3DIFA 3N1GC 1INEL 4S0TD 4P5KB 5CINH 2IAMA 4X7SH 1ACZA 2CRMA 3SQOH 1JTOA 3GBMH 3HC0B 4N8VA 2CKBH 4KRPD 1KNOB 4XC1L 3AS1A 5GGRB 4KJWC 1GZQA 2A9NH 2E7LC 4UNUA 3I84A 3RZCB 4QWWC 4D9LH 1G7IB 1KJ2H 5FUCC 3RGVB 2EEDA 3I3BA 4ZQKB 3O6LL 4KROC 4WI6A 3EO1B 4QRPE 1YYLL 5HHXH 2Z8VC 1KG0B 3BGMA 4KZEL 5F9AC 1KBGH 2KQMA 5GRJH 5J3HC 1MY5A 5DEFB 2EE9A 2HN7B 5CEYB 3CD4A 3LS5H 2D0HA 2UUDK 3VGGA 2J3SA 3WD5H 3B9KA 4LLDA 5IFHL 3VXSE 3LQAH 5C6TH 4ZO9A 3EO0B 2VXUH 4YHLL 2KPNA 4OV5B 2HRLA 2PO6B 4UIMB 1OARH 5F7NC 2VC2H 2HTKC 5HGHA 3ZYIA 1UXWA 4FQ1L 2BZDA 3B4NA 5I17B 4P5TA 3T08A 2AV1B 3MX0A 2FNBA 4LPCA 1CQKA 4ZAKC 5BVPL 5I1EH 1IT9H 4OZFA 4YO0A 3DIFB 3B2VH 1LO0H 5SWSE 3SGEH 1TJIH 4HQQL 2FGWL 1VFBA 2AGJH 3MV8E 1UEYA 4LLMA 5IFAL 2BSED 5LBSH 3BRDA 2HVJB 5KSBB 1G7JA 3PWJA 3T1FB 5I66A 5FOBA 3GMOB 4QXTB 5CJ5A 1VGKA 2OTWB 3MYJB 1MVUB 2L7UA 3G5YA 5HHNB 2B4CC 5TQ2L 5AYUH 3ZT5A 1WZKA 1OSPH 2VISB 4L5FH 3WNKA 1CR9H 1KEGH 3IDNA 4YEFA 2Q76A 3QIBC 3V6BR 1RI8A 1UQSB 3IDUA 1G7MB 3O6FA 3L7FA 4XTRC 2O5YH 1H5BC 3L95A 3S8WA 4QNPF 4IIQB 2F5BH 2G60L 2XPGA 1EVUA 3MQIA 4F58H 3I6LE 3QO0B 2JELH 3T8XB 1KTLA 1MRCH 3W39B 1DSFH 4PV9B 1TJGL 1W72B 4KPHL 5KZCB 1MJ8L 4AL8L 4ZUWB 5JDSB 4WFFD 5TE4H 4HJGB 2JTDA 4J7RA 5IF0B 4OKVB 1PX3A 4UILH 3CZJA 4KK6D 3HNVL 3VGAB 5JORA 4GKZA 4G42A 1BFOB 3QDGD 1SJXA 3GIZL 1BF2A 1B88A 1KTRL 4OLUH 4LHUD 4TRPL 2NYYC 1HQ4B 5KSVB 1NDMB 1FG2B 4W4OC 4L9LC 4MQ7A 4NCC1 1JYWA 3MLZL 2NQCA 3ZHDA 2DMKA 4OJFH 3MJ9A 3C60D 4JPKL 1ZEAL 1MIMH 3P0GB 1CXEA 2XWTA 4JKPH 4KJYB 4U1SA 2AI0L 2NY3C 3RWIA 3CVIL 1WUNT 2ZUVA 4LIQL 4EUPG 2VE6A 3ZDYE 4PRBA 3S96B 4ODXA 1RJLA 4KUZL 4ETQB 4PV8B 3G5ZB 3VXRA 1KLGA 2DQEL 4GRWF 4PFEA 3T0EA 1PLGH 4WNQB 3WBDA 4NZUL 3N50A 4UQ3A 4XVJH 1WT5C 3MNVA 5EBMB 4D0CA 4HS3B 2B0SH 4TVPL 4YK4B 5D71L 4G6MH 4HUMB 5GGTA 2Q86B 2A6IA 4PRPE 2RIKA 3KJ6L 1WBYB 2GJ6A 2YBRA 1WK0A 4NP4L 4C56D 1AFVL 3BGFC 4DQOH 2WWKO 3EYQC 3OKMB 5HHMD 4R7NA 3CDGB 1JZ8A 3OJDB 5I71C 3G5VB 3O3UN 3CCHA 3BAEL 3FQWB 3MA7A 3KPMB 4JEGB 2RFXB 2IJ0C 2P1YA 3GSVB 4NQCE 1G1CA 1OF2B 4NO0A 4P23A 1MCSA 2MMXA 4YDJA 2DQHL 4LCUA 4LCCC 5GSVB 1BVKB 3QDJD 3IXTB 2CRZA 5DA0B 3DROA 5FO7A 3LH2L 2D7NA 4U0RB 4F57L 4TUJB 2IPTH 1CF8L 2VXTL 2E6PA 3P4NB 4GQ9L 1DDHB 1QD0A 2DQIH 3U4AA 1CIUA 5JW5A 1UKQA 3TA3A 1HI6B 1XF3A 1A7OH 1U8OB 2EDXA 5ANMB 1ETZB 2C3HA 1NFKA 1U8KA 4PRAA 3LV3B 4KQ3H 43CAB 2ED9A 4NBYB 4Z76A 5J13B 3TNMA 2ZNXA 2Z4QB 3OJVC 5M7QA 3KPRE 1AJ7H 1NDGB 1T89A 1JP5A 1QRKA 5DVLA 3UTSA 1XGPA 4R4FH 5D7LD 2OL3H 2G75A 3X17A 4LMQE 2D7OA 1KELH 3DGGB 1VERA 4EVNB 4PJDE 2R23A 3THML 1XFPA 1WVZA 1WWBX 3A6CL 4ZAKA 3QCTH 4M5ZH 1WWAX 3LKPB 5TPWH 1ZLSH 5KJRL 5FCUL 1SBSL 3PP4H 4Z7WA 2MTPA 4JFHD 3ARBD 4MDJB 2FB4L 4RMRA 2IBZY 1KIQA 4I5BA 4K71C 4KK8D 2GT9A 4IBLT 1OAXH 5MENA 1KSRA 2UWEA 3ZKNC 3NCJH 2Q8AH 2B39A 2RHEA 1XH3B 2YOCA 2APTA 5C70A 4WUUE 3U0WH 2BSRA 4MXWH 3FTGB 4XHQA 3O3EA 1F6AB 4MD5A 5EIQA 3P0YL 2QL1A 3T4AA 1WSST 5EZOH 3VXMB 3MA9L 1IGJA 4PPTA 2BY3A 4K2UL 2CUMA 4K3EH 2A2QT 1QSZA 2CIKB 4OGAC 3KYKH 3FFDB 3EOBA 2R8SH 3K4AA 4PJFB 1T20B 3QPQD 2UWEB 1S7UB 5J6HA 2OJZL 2BFVH 3Q6FB 5GS1A 1G7HB 4HIJB 4KHXH 4Z7WB 1JVKA 1ZLWH 4M43H 3PDDA 5SWSB 3EFFA 2F53E 1UM6L 3KHQA 4R26L 3LN4A 4QXGH 4RFNB 4KTDH 3O0RL 4MVBD 4X6CA 3VRLE 5EA0L 5KVMC 1QPXA 3QDMA 4JPWL 2MPAL 2NZIA 3W11C 2HFTA 2ORBL 5LAXB 4EKXA 5KS9B 1QHOA 4RNRA 1T7YA 3F7YB 4HUVB 4X6FB 4IOSD 3VFUB 1Q0YL 1R3KB 1OP5K 3U4BH 1R5IB 5DDHB 4L3CA 3QXAA 2R2EA 1N3NA 2GSIB 4D0BB 4FZ8L 4U1LB 4GLRH 3GEWB 5EOQH 4K7PL 3FO0L 2B7DT 4UAOB 3VXMD 3WIFB 2FL5A 12E8H 1BZ9B 1SMOA 2DQTH 4XP5L 3EJYD 3NH7L 3HE7A 5EZIH 2VERN 2X44D 2BSTB 1SEBA 1RIUL 3TC9A 3U46A 3EGSA 4DN4H 1SBBA 3IDIB 3QEHA 3HG1E 5EN2B 2VOTA 4G6KL 1QSEB 5EBLA 4P3DB 1CGTA 2DJSA 2VTFA 2A6DB 2X70B 4LHUA 1U8IA 2Z9TA 3BD5A 1EGJA 3MRQA 4K8RD 2W0PA 3WKMH 4K07A 2YA1A 5CIPA 2C5DC 3QDJA 3HR5B 1NBQA 4JVPA 2E9JA 4Y4KD 1NCCL 5EBMA 3HMXL 5ESQB 1P4IL 4PREA 3MNVB 1A1NB 3TNNA 2PR4H 3FN0L 4I0PA 2A1WL 1QBLL 2JJSA 1QOKA 5C0AE 4DCQB 1CICB 2PO6C 5IB3A 1LEGA 2V5RA 3VFTB 3KAAA 1Q1JL 1AQKH 2G2RA 1V7ML 2C4FU 3GJFA 1NCAL 4RAUA 4PRBB 3NTCL 2IPUK 3ZKXC 2O61B 3INUH 2IH3B 3RY6A 4MAYB 5E03A 2IPKB 1GGUA 1UZ8B 2RJMA 2X40A 2Y4SA 1IQWL 1QBLH 4TNVF 5TDPA 4P2OD 1MSPA 2E7HA 4J4PD 2DN7A 4C55A 4AEIL 1LP9A 5HSFA 4LQFL 2JIXB 1YECL 4ZSOB 5ICZA 1KCLA 5JPMB 3TPKA 3RWGB 1L7TL 3QSKB 4PJXB 1RZKH 1OTUD 3JWOL 2PTVA 2BVPB 2X89A 1LO5A 1S7XB 1T1WB 1PGRB 1TZHA 3OB8A 4F2MA 4X5XB 4U1KA 1TZGH 3QCVL 4M7KH 1NCDL 1IILE 4FXKA 2JB6A 3T0DA 5D1XD 3SOBH 1RK0B 5EZIL 3VFSA 3VWJA 3L3DA 4I4WB 4LDLB 3UJTL 4F37F 4AMKL 1NFDE 5EOQL 1CYGA 1L7IH 3TFKD 1YJDH 3Q5OA 1MPAH 4UQ2A 1AGEB 1M7DB 1WJ3A 1OAYH 5CSGA 3JWDL 3UTPE 3GSRA 2W07A 4HJJL 2YA0A 2VLJE 2BVTA 2YWYA 1Q0YH 1BF8A 3ULVH 3W5NA 2G5BB 1DBAL 1S9XB 3WUWG 2HMIC 3DETD 5D2NB 1XGTB 2ZCHH 5HDBE 3WIIH 3FRUA 3O2VH 2Q87A 3RVUC 1KCKA 5DHVH 4R90L 4YE4H 5I6XC 5HYJB 1NLDH 2CH8A 4IMLA 1FO0A 3BPCA 2OR8A 3SJVB 2R2BB 4PP1D 4WU5B 4QXGL 3HR6A 3WO3B 3RWDA 5JLZA 3MR9A 5FO8B 3ALPA 4NYLB 1BVLA 3ECBA 2AXHA 2D7MA 4BZ2H 1P6AB 4X7TA 3V7AE 3QQ9D 3NN8B 4KXZH 3QUYD 1V3KA 1UKSA 4Y5XB 1GOFA 5IIEB 3ECBB 2OJZH 2R1XA 3GMPA 3PGFL 1EHAA 4JFDA 1KJVA 3QWOA 2DDQH 1WFOA 4UNVA 2Q20A 4WU5A 1GGCH 5JW3L 1I3GL 2BK8A 4K2UH 2E7MA 3S4SA 3V7AG 4CU8A 3ZTNH 2VLKB 4HCRA 3LMJL 4XNYH 1BM3H 1YA5A 1N6QL 1JWUB 2HN7A 4JRWA 1A1MA 4PGCB 3V6ZB 4K94H 3C9NA 3E0GA 1Z0NA 4POZD 1T7VA 3SE8L 1VADB 3L3OB 3JV4A 3CSYB 1A5FH 1TNNA 4HBQA 4P4KB 3NCJL 1EJOL 1MWAL 4N8PA 3O6KL 4M1GL 4FQHB 1HDMB 1OAXL 4JM2D 2VDKH 1BP3B 5CKAA 3KYOB 3B9VA 1LK2B 3PP4L 1R5WA 5GGRA 2FJFA 3MTRA 4N8VB 1RZKC 1QACA 3ALWA 2Q8BH 3PNWB 1JNLL 1S7SB 4I3GA 5T1LB 1JI2A 1OAZH 2PXYD 3QH3B 2APXA 2MOVA 4OCXH 1FRGL 3FJTA 4Z7QE 1OB1A 1P53A 1KELL 4JFQB 4MJ2A 2AVGA 3LKSA 5CD5D 5JHDE 3UXFA 4Q58C 5HI3C 3U9PH 4F7MB 4M7LT 3CZFB 3CPLA 4NC2B 1HILB 1L6ZA 3H7LA 4GS7C 4LSQL 2ZWLT 3EZ8A 4JANA 4MMZC 3TT3L 4ELKB 3MV9B 1KCVL 5DJ0A 3VXPA 2OTPA 5E2TH 4IRJC 1K8IA 5JW4N 1A7OL 3HG1D 3QP3A 1T0NA 3BP4A 3E8UH 3OKEA 2R0WH 1G9MH 2V7HA 4DAGH 4TNVK 1QO3B 2IPTL 5AD0A 3FFCB 3HI1B 1UJ3C 1XGRB 3SY0B 1VKXB 4H8WL 1MI5A 2XZQL 3GJFB 4RAUB 1YEGL 3G6JA 3QDJE 4R97B 3BN3B 3HLAB 2EE3A 3LEXA 2RR3A 3ME0A 5F1SA 3S3PA 3UZQA 4MNQB 4CVWA 1UM4L 2J6EH 3BMVA 1MHPL 5HYSG 4PUBH 5TDOA 5F9JA 5CLWA 5KTEH 2HVKB 4P46B 4HK0A 3UO1L 5DLML 2Z8SA 3P9LB 1ZS8A 1AE6L 2VDPL 3STLB 1ADQA 4Z8FL 4PJAB 5C9KA 4Y4KA 1UFUA 4JZJB 5AWNH 2FR4B 4LEOB 5AWNL 1I7RA 3KJ6H 3DARA 4FABH 2HT3C 4OQTH 3B6SB 4P3DA 5CEXA 3DV6A 5ICXA 2VSCA 5KTEL 5I8KL 3T65A 3TA3D 5KVDL 3OMZA 2VDLL 4GG6F 1F4WL 1UM4H 5GGRY 3ARSA 2VLMD 3VRIA 1IGIH 3MLXH 3NCCB 4Z7QF 2ESVA 4ZOBA 3HNTH 5JXEA 1XF4B 5ICYB 1I8IA 3PHQA 3W2DL 4DAGL 5D2LB 5HGBB 3L5WA 2R2EB 3MLZH 7CGTA 2QSTA 4ALAL 4NRZA 3H2WA 1YDPB 2EDLA 1LQSR 1XF1A 2XTJE 3QFJE 4F15B 4GUPB 4ORGB 3BIBX 3RQ3A 3CDYA 2AAVA 4OLZH 4IRSA 1HHGB 3K4DA 4UILL 2FLRT 2CD0A 2HFEA 4FZEL 4DFIA 3U7YL 4PJIB 1HWGB 3FB8A 5TE4L 5C0EA 2AERT 3VI3E 1MVFA 2EC8A 4QTHA 4JHBA 4JRXA 4PGEB 5BW7C 1A7PL 3QRGL 4FQLH 5KBNC 4KPHH 1FZKB 1TJGH 4KMTH 4KKLD 4NUJA 4MJ6A 2GTZA 4WGWB 3T77A 1OAZL 5CUSL 3QNXB 1JNLH 1IKNC 3H9SE 1OLLA 1TMCB 1SVCP 1KCUH 3E6FB 3M1BA 3RAJH 3CU1A 1FCGA 4WJ5A 3GSNH 1QBAA 3HTLX 2P8PB 2CO7B 3QUXC 3NIFF 4HXBL 4DOHE 1K4DB 4ZPTB 3FO9A 4PJFA 3MO1A 1K2DA 4XNQA 4XGZB 4G6JL 2ARJB 4MAYC 3D0LB 3R0NA 5B22A 2Y6SD 1F3JA 1DE4A 2RCSH 4ZO6A 1A22B 5ADPH 5J1AB 5DZOA 2VMFA 1M6OB 5I1KH 2PYEB 3AXLA 4XH2A 3BISA 5HGGS 4HEME 2R0KH 5H2BA 4MB5A 4OCSL 4EUPA 2N56A 4XNYL 1UWGH 1WZ1L 5B8CC 1MUJB 3OF6D 2EC9U 2ZUQC 3KLAB 4L8BA 1UT9A 1WBZA 2D31B 3PGCA 5EU6A 4EOWL 4HQQH 5LGHL 1R6VA 3SDAB 4UT7H 2IGFH 2EH7H 1YNLL 4CMMB 4X7FC 5BVPH 1P4BH 3IS1X 4TSCH 4YHOH 5EUOF 3VXUB 2P24A 3GSNB 1YEHH 4UDTB 4PJGA 3GSXB 1WWCA 1ZT4A 2R15A 1QRNA 1OARL 2BOCB 1VEOA 5A2FA 5MEQA 5DSCB 1TCRA 4F9PC 4LLQB 4G9FE 1FVEA 3IJYB 5IB5B 4JPIA 4NHUB 2WBWB 3LS5L 4OZIE 1JFQL 4M6AA 3P77B 1T0MA 1IEBA 1C5CH 4XCCL 1NGWB 2ZCHL 4K3DH 4Z7NE 1VHPA 4FXGA 4KZEH 4RBPK 5T33L 1TVDA 4Z76B 1KLUA 2HWZL 3CMOL 3V95A 43CAA 5E7BA 5GIRA 4PRHE 1U8KB 4G80B 3BDBA 1TZIA 1XF3B 1OAYL 3H3PH 1NAML 3MJ8A 2BMKA 2W0FB 4YC2C 3AGVA 3RI5F 4CADA 3ULVC 4HUWB 2LVEA 3FB6A 4YFDB 3VFPA 1EEUA 2DBJA 4L9LB 4HD9A 3B9DA 1KACB 4OGYL 5I0ZA 2H2SD 3IXTA 2F54A 1BVKA 1BAFL 5EO9B 3RNQB 3MC0A 4MCZB 4C56A 4TTGA 4P23B 4QEGA 4Y19D 3CSPA 5F1IB 1EDQA 1IEAB 3KPMA 2XV6B 3P4LA 1NCDH 1TZGL 3MGOB 4PGDB 1A6PA 3CH8A 2EDHA 1QEWA 1M05A 3KR3L 3IDGB 4U49A 3U82B 4JHWL 4O2EA 3FT2A 3VFWB 2Z31B 1XGYL 5F7UA 1FJ1B 4WEMB 1QP1A 2ZCKH 1FCCA 1A6WL 1HOCB 3ABZA 4LLUB 5EOTB 4LEXH 4UV7H 3DI2B 4N9OB 2O5XL 5GRXG 5KSAA 3BPOB 4BKLB 4WNQA 4UTBL 3IDXH 1R3JA 1KLGB 2PUQT 4XVUD 1MAML 1VENA 4PV8A 2YEZB 3D48R 1IGFH 4U3XA 1MCRA 2V2TA 1M7IB 1U8NB 4RGMC 3WJLA 2E27H 3PWVA 1S9WB 3B3IB 5L8KB 3H9YA 5L0QB 1VACB 3MNZA 4P5MA 4RSVA 2QQNL 1REIA 3BXNB 4EQ2A 2ITCA 1E27B 1W0YT 4EI5A 3V4VL 1EMTH 3UTTE 3ZMRA 1BQHB 3D9AH 5HI5D 5E6YA 4OZGE 3L3IB 3IVKB 1P4IH 1QR1A 4HF5H 5GGVH 1HINL 5FXCH 4GS7B 1ZT7B 5CILL 1NFDF 2CDFA 2VH5L 1GZPA 4Y5VC 4AY0A 3ZE0E 1MCBA 1F90H 4HJGA 2I9TB 3DX8A 4DN3L 4ZUWA 3OKKB 3F8UB 1W72A 1A9EA 4GKSB 1JHTA 1D6EA 1UACH 4X98B 3V4PH 3ILPA 2NMSA 4KFZC 5GGVL 1ZLWK 1UWEL 3QFDA 5FKPA 4GW4A 4F7PA 2A83A 4JN1H 1CGSL 1VFMA 3MLSL 4MJIB 3DXAE 3L7FB 5BRZB 1NGPL 3MRHB 5TJWK 5DT1L 2P5WB 1JGEB 3FO0H 4CMHB 4N1HB 1KJ2A 1Z5LB 4IRSD 2QBWA 4S10A 1MAMH 4M00A 1WCQA 3BPNC 3WFDH 5EPMA 1X9QA 4XMKH 4LRIC 1HYRC 4TQEL 3ZDYF 1TVHA 2ZCKL 5I1JL 3T1FA 4XP1L 3FN9A 3DUUB 1K8DB 3QIUB 3RWHB 3MGAA 3MUZ1 4MD4A 1P9MC 5MEOA 3UBXA 1V7NH 4NWUH 1FE8L 5DO2D 5E2UH 1DQTA 1G7PB 2Y7QB 4R26H 1GRWA 2KL6A 3C08H 3GMRB 4RX4D 4YXHL 2X4UB 3OQ3B 3SKOA 4M43L 3LQAC 1XR8A 3JWDC 4ZFGH 2Y5EA 3BIKA 1MWAA 2AJZA 5FUOL 5C8JB 5I17A 1BAFH 1GSMA 3P4MB 4OZFH 4P57B 2G9HB 1XIWB 1Q9KB 2CUIA 4ODWB 3P73B 4HDIA 4YGVA 4JY6A 1I7UB 3GHEH 4AQ1B 2DJ4A 3MA9H 3V6FB 2VL5B 1ZHNB 4JO4H 2UY6A 4LLVB 1F3DJ 4KZDH 5DQJB 4IDJL 4JE4B 2XRAL 1C7TA 3O3AB 5ETUB 5DQDH 1F4YH 1G6RB 3NCBB 2R2HA 5EC2A 3O81A 5T1KA 3ZHLA 3U0TB 1OQXA 4PJCB 3VD7A 7FABH 3F5WA 4TUKL 1A6VH 5HDLA 3RWCA 2DLIA 1JFQH 3MCKB 2YXMA 2QSVA 1YEIL 2LABA 1IE5A 4JVUA 3L1OL 3WS6C 5CSBA 4PJ7F 3BKJH 3V6OE 3RVTD 5BS0B 1RVFH 3GIVA 4LSPL 1ZA3B 2AJSL 3TO4B 1A6TB 3S36L 2FIKB 3WLBB 4IOFC 3WFHB 2AV7A 2XNAB 3BYYA 4Y4HD 5C09E 5FCUH 3G6JF 1KNOA 1ZLSL 4F37K 5KJRH 4P9ML 4XBPB 3UP1A 5AYQA 3QCTL 3SDCD 1U3JA 3FONB 4WI5A 1F00I 3T2NL 4DVBB 1KCRL 1JRHL 3LIZL 1WZ1H 4N90D 5EU3B 2ID5A 1GGTA 4YR6A 1B9ZA 2DQFB 3MBXL 3SE4C 2R2HB 3ISWA 3HZYB 4C57C 5D2LE 3V0WH 4QCIA 1P84J 4XPFL 3I6GB 4P5TD 5EC1B 1NFIA 3AM8A 1ZHNA 4LLVA 3CSBA 1FL6B 1WFNA 4WTZG 4GRMB 4OLYL 4U4BA 2BVQA 4BH7A 2QKIA 4U31A 4PRIE 1DN0B 4N68A 1WIUA 4UINH 4MZ3A 1MCWM 4D8PB 4UU9B 2G9HA 3LDBB 4P57A 4LKCB 4FS0A 1UB6B 3HPLB 3GSNL 4QRRA 1MQ8A 4BA8A 1GPOH 1AR2A 3KWWA 3TO4D 1KUMA 4L4TB 2XN9E 2YUWA 3MV7A 4GOSA 1D6VH 3PABB 4NIKB 1PY4A 1E4KC 5ITFB 4AEHH 1RIHH 4UOJA 1UKTA 5CGYC 1Z3GL 4MB3A 3H3BC 4ERSH 4WO4A 1E4XI 4HG4K 2CDEB 3GGWB 3MRJA 1RZGB 5I6XB 1CDGA 2HLFD 4NZUH 3ULUC 1QSFB 3DYPA 2ICEB 5T3XH 3UMTA 1QFWH 4LQ1A 3RPKA 4ZUSA 2AJUL 3ARDB 3CVIH 3LKQA 2ARWA 3QZWA 5C07A 4RMVA 2FEDD 3OBAA 4OJFL 4YDVB 3DHJA 4HKJA 3AB0C 4TOYL 2A83B 4Y16C 4F7TA 2J7LA 3ELAT 4PG2C 3EDDA 4PJIF 4M5YL 3WL9B 1K4CA 4QHLB 1C7SA 5F7YC 2EXYC 1D5XA 1B6DA 1Z9MA 4G8IB 1HHKB 4OQTL 4M62L 4ZS7H 2I9TA 4FABL 4O4YL 1NGXA 4DKEH 3BD4A 2X41A 3OJ2C 3K2UL 5DD1L 4AEHL 3GUTB 4S1RL 4B50A 1TVBA 2F54D 1ZT7A 4Y0GA 4DKFH 3H0TB 2GTWA 1FFPA 1Q9WB 4NN7B 3FL7A 4PUBL 2DD8H 1JZ3A 5C0RH 4APQC 4UT6H 4PJDF 1BD2E 4H8WH 1UYWL 5HI4D 2CLVA 5C0IA 4GAGL 4HK3J 2NY2C 3VXSA 4OZ4B 1CR9L 5F6HI 4C4KT 1Z0MA 5F7HA 4L4VA 1OSPL 3MV8A 1G9ML 2R0WL 3QAZB 1ITCA 3E8UL 1OAKL 5DJDA 5TE6H 5HGDB 5DJCB 4WY7H 2P4AB 3C5JB 1CGVA 3I85A 3V0WL 4RMUA 5I19L 1IZKA 4CVZB 4YFLI 2XQYK 3S5LB 3CXHJ 1PG7H 4KK5C 3MBXH 4OT1H 2LAGB 1G84A 2V5MA 3TT3H 2XKNB 3T2QA 5LBSL 1F6LL 2OMBA 5CJBA 4Y5VB 3NIGE 2AGJL 5HHMB 4OCLC 1FL3B 5ALBL 4HUUA 1NCBH 5EZLB 1QEWB 4TSBL 2OZ4L 3T2NH 1FRGH 2FEEI 4JFHE 3K0WA 4EN3B 5A40E 5I1EL 2ATKA 4BH8B 3F7QA 2Q8BL 5BOZG 4HEPG 3NPSC 4J6RH 1B0RB 1IQDB 4U1JB 5JO5B 2F54B 5EO9A 3RNQA 1DQJA 2E7CA 3W0WD 2ESVE 3RVUD 5D96C 4IHOA 4QOKE 3NFPB 1J5OH 1RVFL 4MNGB 3QG7L 4BK4A 1H3WM 4MA8H 5DS8B 1OGTA 5H35B 4L3EA 4PP1C 4UV4L 1ZLVK 3V6OA 3MRRA 1KV3A 5D1ZB 3JV0A 2VQTA 3ARFA 1M71B 4G7YH 1F4XL 5F89B 4KROB 1CD8A 3WFCH 1A6VL 1T6VN 3WXVL 4EDWL 2EDJA 1ES0A 3M17B 4JFPB 4NRXA 1IEBB 2YN5A 2LV4A 1F4YL 1LNUA 1I3RB 5D7LB 5DF0A 5D1ZA 4AM0B 2CMRH 1EHNA 4QHNA 1SJVA 2KUTA 3TBVB 3WUZA 2CIIA 1ZLVH 1YQVH 1GGCL 3GHEL 4HIEB 4IHOB 4M61A 4ZUTB 1UVQA 5C3LD 4ZDHA 5I30L 2NY0D 3HE7D 4YZFF 5DJCA 3KLHC 1MFDH 2DMCA 4N0YL 1B0RA 1HEZA 5IESL 2CKBL 5FGSA 5DK0B 3SBWA 5DHYA 1CL7H 2F53D 4POZC 1NBZA 3G6AA 4NQEE 3SDAA 1ZMYA 1KXQE 3EDJA 3SKMB 5KAQF 3SCMD 4U6YB 4KC3B 1AP2B 3ZE1F 4JDTH 4JM4H 3FCTA 3QXUA 4A6YA 4YGAB 1EGJH 3MSPA 1U8LA 1NLDL 5J8OA 4JKKA 2OM5A 5IMMB 4KI1A 2EIBA 5BZWB 1ONQA 4F7EA 4XRCB 1DBAH 4ZOEA 3QIWB 4X4XB 1WFUA 4XMKL 4D9QD 1RHFA 3IKCA 2GUOA 2WUBL 5DD5L 4PJ8B 1H3XA 4R6UA 4G8FB 5I1GH 2V17L 1PG7W 4NKMA 4HPOH 3K1KC 4CGTA 1MPAL 1K4CB 4KI5C 5C0JA 5DT1H 3IXAA 5C0DA 3I02A 1NGPH 4AMKH 4H1LA 4OAWB 4TPRL 5T5FL 1BZ7A 4JFZL 4JN1L 4N8CH 3PIQA 3F65A 1CD0A 3TM6A 3WS3B 2E9WA 2JJTC 4N0FB 4MJID 1TVBB 4HPYH 5DVOA 1CGUA 3GJEB 5KOMC 4AEFA 5IQ7H 2DKMA 4RGNC 5FYLH 1UA6H 3ETBF 5IJKC 2OP4L 1QYGH 1F90L 1E6OL 1RZKL 1R3IH 3LAFA 4L1HA 3SGJA 4MQSB 3SJVD 1L7TH 4FFWC 1EEQA 4QHLA 1RUPL 1RZGA 1YECH 1HH6A 3CFDB 5FECB 1S5HB 4PRDB 2MSPA 2HFFB 1ACYL 4K23H 2HJFB 3D9AL 1FFRA 4GMTL 2R69L 5TH2B 3SDAC 1EMTL 5CEZH 1KPVB 4P9HH 2ICWA 5FIEA 5JOEA 4NHCH 1NBYB 3NTCH 3UROR 5IW6B 2IWGA 3TO2A 1AC0A 2VDRH 5CCKH 1INDL 5LGJB 3KYMB 3UC0L 1RPQA 1KOAA 4HT1H 1QR4A 3GM8A 2AEPL 1NCCH 2JKXA 4G9DA 3VGAC 4CVXA 4IOIA 2Y07H 1TDQA 2BVQB 1WCBA 2QV2A 1NC4B 1A7NL 4UUJB 3W9EB 1JV5B 2EYRA 3HC3H 3ULUL 1JGLL 4LHJB 1EUUA 4K3JH 3KPPA 2XTJC 2YPLB 3KR3H 4G6KH 2IQAA 4HMCA 1KN2L 5EU3A 2Y5TA 1D5ZB 4W70A 3OPZH 3O6MH 4WEBL 2YD8A 3N0PB 2DQTL 2OX5A 3TF7C 3V5DB 2QQKL 2VABB 4NPYA 4UNTA 4OGYH 3SY0A 1BFSA 3KDMB 4L8SA 1NUDA 2R4RL 4KK9D 3DBXB 4ODTL 5DRWA 3EYFA 4FTVB 4WV1B 4BYHA 1FC2D 4HX1A 3REWA 4FZ8H 4D3CL 3D69A 4GJTB 1I8LC 3MUJA 2CPCA 1K8IB 4BZ1L 4NDMA 4WI9A 4Y4HB 3KJ4B 1A6ZA 4Z18A 2VR5A 3TIEA 2JCCF 5JMRA 5IBTL 3RUGF 3QUMH 3HB3D 1N8ZB 3BGFB 3EDFA 5F1NB 1RJYB 2ORBH 1LO2H 2VRAA 2XA8H 4ODVH 2MPAH 3BWAA 1QSEE 3F5WB 1OB1B 4F9PA 3BZEB 5C0GB 2FO1A 5D1XB 3QYCA 3I75B 2F5AH 1X7QA 1C5BH 2VL5A 1TCMA 1Q9OB 2F74A 4HHAB 3LSOB 2YPLD 1TFHA 4AQOA 4TSCL 1A6TA 5E0QA 4YXKH 3RBSA 4MJ4A 2NY3D 2ADIB 3H9SB 1YNLH 1IC1A 1DBBH 3K74B 3P4MA 4M48H 1DVFC 5F7FA 4EOWH 4P23C 5EO0B 3BIKB 5J13C 2Q3ZA 3LHPL 1UWGL 1RK1A 1ZT1A 3DTXA 4Y2DD 3FKUS 1RUKL 4PGCA 4Z0XB 3RNKB 1J05B 1Q9LA 1KF9B 5BW7A 4WO4C 2EDFA 2R0KL 5IB1B 3KPSA 2VDMH 3GMMB 1LDSA 3KPPB 1JNNH 3UBXB 4O9HL 5EBWB 4U6VL 4XC3L 4FP8H 3BRGC 1IAIH 4JO1H 3C09C 4G6JH 4P2OA 4PBWD 5CWSB 2Q8AL 4YGVB 1A3RH 3G6DH 3PWLB 4Y16A 4PJFE 3JTSB 5IIEA 43C9A 5L7XL 32C2B 3QQ3A 1G6RH 3LEYL 2NW2B 4KAQH 1IM9A 1D9KB 1FAIH 1SBSH 4LSSL 5LVEA 5TPWL 1S5IL 3SBWC 3SE9H 3RWDB 5JLZB 1V05A 1JWMA 1DJSA 4LGPB 2NY6C 3CH1A 3D39A 1MCQA 4KMTL 4KRMB 3QRGH 3OB0K 1A7PH 4FQLL 4LCYB 3RJQB 1T1XB 1XAUA 1QQDB 2JLLA 1GGIL 2GJZA 5MI0C 3QFDB 3QIUA 1ND0A 1VGEH 1OTTD 1XGTA 3DI3B 1WLHA 4OLXL 4V1DA 4NBXB 4EEEA 3HNSH 2VXSH 2HYMA 3RVWC 3IJSB 3WFBL 5DJ6A 1HNGA 4Z95L 2PYFA 3C6LA 2E3VA 4H88L 1SY6A 3IYLW 2NX5D 2WP3T 1MQKL 2K3TA 4Z7NF 3T3PF 2EKSA 4GQ9H 2QJDA 1KGCE 4F57H 2X4OB 1JZ7A 2XKSA 1C1EL 2HH0L 4WI8A 5ERWB 5C0NC 1UADC 1NUNB 1UJ3A 2FYYB 3MRBA 1JYNA 4LCCA 2H41A 1L6XA 4M8VA 1E27A 3DVNB 5DUML 3WNOA 5A2KH 3CFCH 2CSPA 4QRPA 2VLLB 3FB5B 4R4NC 3JWOC 5GZOC 3BAEH 1D6EB 4XAWL 1KEMH 2EZ0C 5J1SC 4K8RL 3LQZA 2HJLB 3MLPA 1DBML 3EZJB 2WP3O 5E00B 1CXIA 3I6KA 3SE4A 3QIWC 3IKCB 2EDQA 3KPNA 3WO4B 1CVSC 2FH6A 1PZ5B 3C2AH 1YNTB 4CVXB 2AJVL 4XPGH 4OCNC 2B0SL 1YEJL 3UDWC 1F6FB 4KTYA 3UO1H 1QR1B 3HZVA 4JQIH 1G9NH 1BBDH 1PLGL 2AQ3A 2DQEH 5SWZB 5J57B 4TNWF 4A6YB 4NOBA 3F6LA 1X5KA 3TWCL 5J1TC 4M6NL 2ADGA 5IR1A 1EFXD 3EYOA 5K33A 4OFYA 1G0YR 3PQYE 4M6OH 3C5ZA 4RISL 5KZCD 4H0GA 1IEAA 1BD2D 3CU7A 5T5NG 1MIML 4JKPL 3OGCB 5BOPA 4D2NA 5E9DB 4PGBA 2ADJB 2Q1EA 1LEKA 2FWOB 5I76A 1FYTB 5E2TL 4NO5A 1I1CA 3FB6B 5F96H 1ROWA 2FX7H 2EDDA 4KJWD 3N1FC 4OLUL 4ZS6D 1AO7B 4CADB 4EUPH 1RIVL 3CFDA 4LVOB 3HFMH 3GIZH 4XP6L 2DIJA 5IK3A 2WZPD 1U8JA 5C0AA 5SWQA 4HKXB 3T3PE 1TZIB 3BT2H 5D7IF 1I3RA 1DUYA 1GHFH 4R96A 3GI9L 5HXMA 1E6JH 2VLRA 1QSEA 5F88B 1CVRA 1N5YH 3H9HB 3IF1A 2DB8A 1P69B 3QI9D 2P47B 3ES6A 1UXSA 4V1DE 4OIBA 1CDIA 2XFXB 2VAAB 3BW9B 4JPIB 2IFFL 2VZUA 1MLBB 1U93A 1BOGA 1CXFA 3O3BB 4ZUUB 5CZVH 15C8H 2V2WA 4OCYL 1OGTB 5H35A 1I85C 1TCRB 3E3QC 1J1OH 3I02B 3NFPA 3DVFA 1LP9E 3ARYA 1I1AC 5C07E 3LVEA 4O2FB 1KEGL 3QHFH 4NNPL 1HYSD 1JPSL 4G80A 3DXAB 2R56L 1I1YB 3MREB 4YFLF 4QRSB 1G9NC 4MNHB 4P3WA 1RU9H 5D2LF 4RNRB 3DPBA 1WBZB 3PGCB 1UH4A 4FFYL 1PKOA 4FG6C 3IT8D 4Z6AT 2IAND 2Z0BA 5MEQB 2X9YA 3LPWA 3SDXF 5AEAA 4BQCA 4QWWD 3FQNA 3CX5K 2DDQL 5GGUA 6FABH 3IS0X 4XMLL 4CVZA 1KCSL 4X6DB 3QEQB 5DMGC 3CXDH 1J0YA 5HGDA 3FAXA 4ODSL 3MXWL 1MI5D 1XGUB 3VE0A 4XGZA 5E2WH 1LVEA 1S7UA 3WJLC 1W0WB 2Y23A 3LDBC 3QIBB 1OD9A 4WFGD 3UYRL 4O58H 2R1YA 4HZAA 1A0QL 4OV6F 3LQAL 4L8BB 3UJJH 1JN6B 3B8YA 3WD5L 3OTTA 5D2NC 4AM0A 5HJ3A 3HE6A 2IBGA 4Y1AB 4HLZH 2PF6A 4LFHG 4XH2B 3BSZL 1TTFA 3NGBC 3QXDB 3O4OC 4JG1H 4U3CA 3H9HA 4PJ9C 3KNBA 3ULVL 1YYLH 5J6GB 4QTHB 3BDXA 4XT1C 3ZL4L 5DMYA 3MRRB 5K9QI 3LQMA 1HZHL 1KJ2L 4NN7C 5DS8A 3FQXB 4OZHE 4D9LL 2VKWA 3TT1H 1I9IH 5FB8B 5MENB 5FUZH 1X5AA 4OZIA 1O0VA 3ARDD 2LU3A 3C8DA 3W82A 1FNEA 5I8EA 4Y5XC 1GH7A 4YHYC 4MDJA 4TUOB 2ICCA 3ZDZE 4F7TB 2BP3A 5JO5A 4PGBB 3LB6C 3B9EA 4BELD 5DQ9B 2VZ3A 4HUNB 4OF0A 3QCVH 4M7KL 4NSKB 4YXLL 5F88A 2RGSA 1RURL 5KSAC 4ZO8A 1WICA 2W60A 5FGBA 4ZFOA 3R0MA 3JWOH 4GBXC 3EJZD 4LPUA 2HFEB 3QDGA 5EU4B 1QNZH 1HHGA 3P9WB 4X0KA 3T65B 4XTRD 2QADD 2X4NA 2E8YA 2EIEA 1J1PL 1OGAE 2W9DH 4BFIA 5IGXH 3IFPB 1J87A 2JJVA 5K93A 5AG9A 4DWHA 5I76B 4HKBA 4X4YA 5DR5H 1HI6A 5F6HJ 2UV3A 5KW9H 2APFA 4XVSL 4JKLA 2XXMB 5ITFA 5KS9F 2WBKA 2ILLA 3OGCA 4YDLC 4WFEE 3P9LA 5IEKA 4KTEL 1MCIA 4OZ4A 1SYSB 2R2CA 1WF5A 1SMAA 3EKCA 1V7MH 1TITA 4ENED 3GSQB 1KGCD 5SWZA 3KYNB 3MRBB 2JJSC 5ERWA 1CG9B 4KGLA 2E7BA 4D8PA 3QT2A 2BHZA 2GTWB 2P5ED 3BZDA 4MB4A 4YNYB 3SN6N 1CXHA 4Z5RB 3U6RB 4PD4J 1YNTA 2AABH 5FYJD 4JRYE 4XVSH 5LCVH 1G1YA 1TIUA 2GJ6B 1NFIB 2COQA 4J3UA 4KKCD 4QCIB 5EC1A 1DFBH 2A6IB 4KJPD 4GXVH 1X5GA 2BVOA 3FQUB 4XCEB 4G8IA 5DZLA 5K59F 3UTQB 3G5XB 4N0CC 4QT5A 2IMMA 4HK0B 3MV9A 4P4RA 4XX1E 5TDOB 4OUUA 5H94B 3ZSTA 2FRGP 1RIUH 4X5LA 3JBG7 1M4KA 4QYOB 5C3TA 2DWDB 4XP5H 5F1OB 1J7VR 3L5IA 1UJ3B 4LCYA 4U6XB 3PL6C 1CGXA 1EBAA 3F62A 3QEGH 2CKNA 1DQDL 4Q9CA 1Q72L 5L2JB 2LU4A 1A6UH 2NY4C 4XB7A 2PYFB 3C6LB 5IBUG 4X7DC 3IJSA 4FFVD 4N5EC 2DI8A 4J12A 5KSVA 3TO4A 1IMHC 3ZE0F 2EDKA 3JTSA 5BS0A 3Q5YA 3TT1L 4JM2B 1DTUA 2BNUA 2FX8H 2YWZA 5TE7H 1VESA 3CPLB 5IW1A 3UTOA 1OQOA 4F7MA 1MCJA 1CD1A 5EA0H 2I25N 4Q6IA 3WO4C 4PJCA 3IRPX 3W39A 1JMZA 2BDNH 3DVIA 3PNWA 4Y2DB 5T1LA 5IJKA 3S88H 1I7TA 1D5MA 3KPRD 4QF1A 5GRZA 4PB9H 3DTXB 3RNKA 3U9UB 4EJ1C 5JA9A 3S4SB 1Z9LA 5SX4H 1B4JL 5EO0A 4Z7OF 4L9DA 1GL4B 1TTUA 1A0QH 2I60H 2BFVL 2CRIA 3ZE1E 3B5TA 5HYJD 4PG9B 5FA3B 1MFEH 4U1GB 4Y5XA 5E2WL 4ZFZB 4J4PA 2BNRA 1TTGA 3CSYA 4X7TB 4ODSH 1FL6A 3G5YB 5HHNA 2MNUA 3CXDL 4JB9H 4R8WL 4GFTB 1VGKB 3GMRA 5E8EB 4QXTA 4LL9A 3HMWH 4OB5L 3VRJA 5M94B 1T03H 1JWSA 3KS0J 3MLYH 1Q9LB 1U42A 4NGHL 4PJ9A 3SJVA 3K81A 3QXWA 1AHWB 3BP7A 4JRYA 4OLWL 1C16B 5TF1H 5IW1B 2HT3D 3OAZK 1KULA 3VWJD 1OD7A 1H0DA 5FO9B 5I8CA 2P8LB 3K2MC 1MNUH 4FQQB 1N7ML 4P46D 1NCNA 4M3JA 2I27N 1UCBL 4PJ8C 5EPMB 3MCLL 2FB4H 1KJ3L 4YPGB 4Q9BA 4AK1A 1YNKL 5DJZA 4JJHA 2DQUL 5I75C 3OX8A 4PB0H 1M7DA 1PJ9A 5L2JA 2XQBH 1ZTXH 4LSUH 5D1XA 1IGTB 4RDQG 3SDDC 4ZTOH 3GMLA 1FO0B 3VA6A 5J7CC 1J0HA 4HC1H 1S9YA 3L3DB 2DWDA 3MCKA 4LVOC 3PWPD 3RX5A 5CBAB 3RWJA 3EDKA 1IC7H 3TIDA 1MFBL 1HQRB 1QG3A 2X5PA 1JGUL 4X5XA 4MWFB 3U0TA 3BGMB 3OKKA 1A6ZB 2R0LL 4KQ3L 4Y4HA 4O2CA 1J0KA 3DX8B 2L4OA 3ROOA 3A6BH 1AGEA 4X6CF 3RWGA 1WCBB 4JQVA 4XP6H 5ICZB 1R3HA 1BWMA 3U6RA 2J8OA 3U83A 1LP9B 1J86A 1FIEA 3GK8L 2DLFH 3FOLA 3P73A 4HDIB 4R4BA 2BNRD 3KDMA 4L8SB 3T0VA 1MCDA 1BQHA 4Z77B 4PRIB 1FVCA 2EECA 2DQHH 5CP3A 3VWJB 4E41A 1XR8B 4B7IA 3KLDA 4MA3A 2V2XB 1CK0L 2PO6D 3GFUA 4YZFE 3D85A 2DKUA 3TJEH 3IFLL 1M7IA 4HWBL 4PRHA 5JOFA 4DQOL 3SO3C 1AD0B 4QKXB 5MEOB 1CZ8L 1W0VA 1H8OA 1H3UA 1UENA 1N2RA 1MF2L 2KQNA 3OR6A 3IFPA 2P8MB 1D5BB 1G0XA 3MLUH 4OGXL 4EN3D 2ZUXA 2VN7A 1D7FA 4HS8L 3HPJB 1LK3L 3QDGB 4IJ3B 5T3ZD 4OIAA 3MRMB 3ARFC 5EBLB 1KJ2B 3RIAF 5IW6A 4HIHA 2IH3A 5EN2A 4DK6A 3UPRB 4NOFA 4XAWH 3ILQD 5BCAA 5HYEA 3HZKA 3EOTL 4B5EA 3WE6B 3O9WA 3GKWH 3JSSA 1KPVA 1ZEAH 4ZXBB 1P7KA 1YPZB 2XKUA 4BQBA 4ELMF 2X9WA 2C1PB 3QUXA 1EAJA 1B6UA 1DBKL 3IXAB 5C0DB 3CK0H 3SDAD 2F19H 4JFDE 2KDGA 4D0BA 3FQXA 3A6BL 4H88H 1EJ6A 4FXLA 3OXRA 1MCEA 1NL0H 3TFKC 4NNXA 3AVEA 1WAAF 1P4LB 1SJEA 1MJ8H 2CDFB 3O8XC 4GW5A 1VGEL 2DIBA 1TNMA 5LAXA 1XCTA 1ZHBA 2AEIT 1ULVA 2ATPB 1GGIH 2H6PA 3T4YA 4RWYH 5K9KB 4HW6A 4OAWA 4H1LB 5D93B 2ITCB 3O9WC 3VG9C 1B0GA 4LSDA 4QTIL 3RVVD 4LSUL 3SE9L 2NW3B 2ESVD 3WN5B 1D9KC 4FOMA 1NGZB 4OF5A 1BJ1J 2PN5A 3QXAB 2V2TB 1YNKH 2XTJD 2L0DA 1XGUA 4XNMB 5AYUL 3IFOA 5DUPL 1UCBH 4MZ2A 2NXYD 5JXAL 4QGYA 1UVQB 1MNUL 1RZ8A 1VFAB 3RIFF 4HJ0C 5GRVL 2GYSA 3F7YA 4M61B 1BX2B 3FFDA 1JYVA 3H3KA 1VDGA 4DZBA 1JGVH 1ONQB 1P9MA 1HHHB 3LN9A 3KLAA 4C4KO 3I2CH 1KPUA 1IGJB 5E56A 4G5ZH 4JLRB 1U8LB 4X6DF 4JY4B 1LNUB 3V0AC 2UZYB 1FNGA 2FGWH 4U6YA 1TJIL 4I2XB 4IRJB 3L6FA 3F12B 4DZ8B 3AC0A 4YDLB 3NA9L 1ZE3C 3A0OA 2AXGA 1J1XH 1IM3B 1LILA 4OLVH 2Y1VA 4QOKD 5CFHA 4XNUH 4C56B 3BRFA 2YUXA 1MCOL 2NY4B 3C6SA 4NQVA 4GRWH 2I60L 2R29H 4I5BB 1UM5L 2YRPA 2P8PA 2PCPA 2CIIB 3MBEA 4RAHA 5IFHH 3PP3K 2W0FA 2HTLC 4JM2C 1OAQL 2AKRB 3O3BA 5DJYA 4ZUUA 5D7LA 5F3HB 2F5AL 5HYSA 3KPLA 2VAAA 2ZG3A 3BW9A 4MJ5A 1KLUB 3ES6B 4NRXB 1ES0B 3M17A 1KBGL 4P2RA 5F7LB 5HVHB 1L0YA 3BO8A 5HHXL 1T0MB 3E6HA 4NHUA 4ODVL 3RPIA 3IJYA 3MROB 4HKXA 5C0AB 5SWQB 1NDGA 2YPVL 5I1IH 1KB5B 3KPTA 3SDDA 5FK9B 1YDPA 4Z9KB 5SV4A 5JZ7C 4KRLB 2MFNA 3LKPA 3HRZA 1F8TL 2PYED 1DQDH 2IALB 1YEFH 2YC1B 3ARED 2E9BA 3TVMD 1W72L 2CK0H 3FQRA 5GS2H 1XGQB 2MHAB 1P7QD 3P9MB 1ZXQA 4CN6A 3U0PB 2VDQL 4GMSH 4X4MA 1F58L 3OPZL 5LWYH 4DGVH 3RWEB 5CGMA 4LARL 4WCYH 3T0XA 2YUVA 3SGEI 3CCHB 2YHGA 1M7XA 5BRZD 3EYUL 4ZPVB 3UX9B 4BSJA 2AK4E 2K7PA 4GXVL 2P5EB 3TP4A 5LCVL 2FR4A 3KXFE 1EPFA 3Q0HA 3KG5A 5D5MF 4FQCH 2V7NA 2NZ9D 2ARJA 3L9RA 3STLA 3KPOB 2DM2A 5FYKD 5IHUH 2EH8H 2HTKD 4DKDC 4JFED 4X6EA 4HT1L 1FNAA 1OT2A 2ICES 1H5BB 4QRPB 4Y19E 1YMMA 1U92B 5C0CD 4J3TA 3I50H 1RJLB 1J88A 1VPOH 4ODHH 4Q9QL 4NHCL 4LLWA 1RHHA 3QNXA 2HKFH 1P2CA 1NCWL 3NIDF 4NUJB 2ZOKA 4P9HL 3ZYJA 1QFUL 2A73B 3WDIA 4J1UA 1LO3L 1U3ZA 1T0NB 3PGDB 3CLFH 4IS6A 4P2QB 2BY1A 4K23L 4X8XA 4U7KA 2SEBA 4G8GE 4LBEB 2FX9H 3WIHH 2YD6A 2E9IA 4RQQA 5IQ9B 1A7QH 5F21B 1RUPH 1I7ZA 4LRNL 3LD8C 4P2RE 4U1NB 4GKZB 4ORGA 1RULL 5FCSH 1QNZL 3RDTD 1R3IL 1ND0B 4RZCA 1ZLUK 2KZWA 2ICWI 3VXRE 2YXFA 2CJUH 4H20H 5JDSA 5IP4A 4AIZB 2ERJC 2ZSWB 3QEUB 4WI7A 2QQLH 4HKJB 1MHEB 1KENL 4KH2A 4LCWA 4WTXA 2VE6B 1CDCA 5HHPA 4JHAH 1RJZA 4HUXB 1AXSA 3RWIB 1AD9A 3LCYA 2Q7YB 4U1SB 4KRNA 1G9EA 1NJ9A 4N0RA 3TBWA 3BZFB 4GQPH 1I9EA 3PQYD 1EZVX 3MFFB 4D9QE 5KSUB 3KYOA 1WBXB 1HQ4A 1HDMA 3PWLA 3BH9B 3EOAB 2EH8L 3IDNB 4HPOL 4RA0C 4P2OB 4NQCA 3LKNA 5CEZD 3SDCA 3JXAA 4NQDD 1HCFX 2X1QA 3ARWA 1YYML 1KTDB 2F8XC 2BRQA 3FRPG 5FOBB 2NYYD 2VLJD 3KPSB 5IVXE 5KSBA 4M1CD 1I4FA 4JKWA 4WDIB 4ZS6C 2JJTA 1UB6A 3HPLA 4NKIH 3QFJA 4JDZB 5EIIA 4GMSL 1MREH 3LPFA 3AB0B 2CK0L 1GGBL 2FIRT 2EEBA 3FFCA 3QIBD 3FONA 4K94C 4EI6A 2YKLH 2DL2A 2NY3B 1NAKL 4PJEE 2GIYA 3ZSSA 5EUKA 4GRMA 4P5TB 2W0LA 1MVUA 2JB5L 4NQSA 3WFHA 4GRWB 1YEEH 1C5DA 4P48A 4WW2B 1ZHLB 3GIVB 1NMBL 4PLOB 5HY9A 3BZEA 4YR6B 3D3VD 1G7JB 1OHQA 3BPCB 3BWAB 4V2CB 1FYTE 3VI4F 2DQCL 1VFBB 4AZ8A 5FGBC 5JW4M 5CHNA 3VXTA 1DCLA 3VFGL 4XAKD 3ZDZF 2FCBA 1ZA6B 1G6RA 1F4XH 4XBPA 2AV1A 5KANG 2FJFB 1T1ZB 4M93C 1D5IH 2X89D 3DSFL 1BBJA 4HFUL 1KFAL 4ORZC 2A74A 4X7EC 3RHWK 4JY6B 3RRQA 2WLZA 3VH8B 1T21B 3RGVD 4LKXA 5FHAL 1GZQB 4ACPA 2L7JA 3V5DA 1T1ZA 3A6OA 4Z7VE 3L3OA 4AYFA 3J7HA 5DURD 2PW2B 1D5ZA 2X4TA 3O8XA 3C9NB 4YBQD 3DUSB 2PNDA 4QY8B 2IQAB 1I8KB 3G04A 1GC1H 1RZIB 4OD1H 1E6JL 1OCWH 4MHHG 5E99L 2DM7A 2VLKA 3BT2L 3B43A 1CS6A 1SY6H 1G7IA 1IL1A 4IOIB 1SHMA 2DQDL 2FX7L 3VD3A 4HWZA 2DQJH 1BMGA 4PJEF 2YK1L 3T3MF 2GK0B 2YMXH 5E08H 5JXAH 3B9KD 4YDKH 4Y19A 5B39A 5D6CB 5C2BH 4CU6A 4XNZC 3NZHL 3WN5C 4W68A 3T09A 2X4UA 1PEZA 4QHUB 4WU7A 5HDBF 2HT2C 1JGEA 3L7EB 4W4OA 4JREC 4M6NH 1LE5A 4U1MB 3CFEB 4J3XA 4TVPE 4RWYL 4NUGL 1E28B 2FLBT 4JQIL 2DD8L 4LSRH 3UPCA 1XCQA 4JFDD 5D70H 3FRUB 5F1KC 4I2XE 2W1NA 4POUB 4OSUL 3M07A 5INDB 5HI5C 5FECA 1S9XA 3R8BB 3UJIL 3OGOE 3MACH 3LKOB 1X6LA 2FGZA 4PY7A 2UZIL 1KIRA 4YHML 5CJOH 1JPFB 1U8IB 1X3DA 5DD6B 3TCLA 1IFHH 3PWUB 1DBMH 3D18B 2LE9A 4UBDC 3BH9A 3EOAA 3HI6L 3QPQC 4ELMB 1FFOB 1I1AA 2J8UF 1T3FA 4QRUA 1R3LA 3CFCL 3QJFB 5DUMH 2Y36L 3X11B 1IGYA 5B39G 1U6AH 5ILTL 4AG4H 3PIQB 1I85A 3TBYB 1FH5H 2BX5A 2YD5A 1O7SA 4UT9H 3TBWB 3BDYH 1CDJA 1XEDA 1C1EH 1ORQB 1AD9B 5D7IB 4KK8C 3VXNB 3DLQR 2BOBB 4P59L 1GXEA 3EAKA 1PG7X 2AJUH 3HI6H 4JDVA 1A21A 1T83A 4MNQD 3CVHB 5C2UB 4NKMB 1GOGA 5CZXC 5T3XL 5J4MA 4JFFD 1FVDB 1F3RB 4G8FA 2P46B 4HZLA 5DDHA 3TZVA 3UTSD 4D94A 2VXSL 3I9GH 4PJ5E 2CLZB 2CUHA 3MNWA 3CFKA 4JRYD 1SM3L 1FLTX 5I1HH 1YC7A 3QIUC 1T89C 2I07B 4BQ6A 3QI9B 1CFSA 1CZ8H 4Y5YC 3T1WA 3K4ZA 4Y88A 5DJAB 3GJFK 4X9HA 5GHWL 3ARPA 1SJHB 3QULA 4MAYA 3IFLH 3MV9D 3BXNA 4NZJA 1PEWA 1NBZB 3G6AB 4LLWB 4B7LA 1Q38A 1GPOL 3WV0A 4LHUG 5ID1A 5KS9E 4PJEA 1MCKA 1II4E 3MMEA 3BQUC 2NXZC 1HEZB 1R3JB 4NQCD 5L7XH 5DRNA 1IKFL 2VR4A 3CDCA 4H25B 3V52L 3L3KA 4KRPC 3GSOA 3U2SA 1FN4B 1PKQA 2W9EH 3QQ4A 4G43A 4HIEA 5JR1H 3TBVA 2A77H 3KXFA 2Z31A 1K6QL 2ZSVB 2H1PH 4I1NB 2XYCA 3W11D 5DRXB 1AO7E 4U1HA 3D1MC 1JNNL 3WUWA 4G6FB 1U8QA 1YEDB 3BWUC 1RUMH 3FTGA 3HZMB 3RL2B 3CFJB 2MJWA 5FYKL 3NOIA 4OF6A 1Q0XH 4LCWD 4LAQH 3LD8B 3U46B 3LIZH 3RWEA 4XXDA 4U1IB 4WHYG 2KKQA 5HBBA 2EXWD 4PJHA 3KHOA 1J0IA 1FQ9C 5DSCA 4ZTOL 3RGHA 5ADOL 4GKNB 4M6MH 1Y18B 1MRFL 4WI3A 4HFUH 2XQBL 4R7DA 1D5IL 4MLIA 5KN5A 5L6YH 4HIXL 4G8GB 4JVWA 4P2OC 1R5IA 2IFGA 3VXUA 2ATKB 4BH8A 4CJ0A 5HHQB 4FTVE 4Y4HC 4K7PY 1AO7D 4CRPA 2DM4A 4HMEA 2F53A 5DD3L 4RFOL 2NTFB 3BKJL 3AREB 3SDCC 1AQDA 4ONFL 2DL9A 2DQCH 3Q6GL 5JQ6H 3RPIB 5HYFA 2OI9B 4OLWH 1GGYA 1RAMA 5ECJE 3QUML 5HHOA 3MLYL 5IBTH 3D25A 1NMBH 2BXZA 5FGRA 4OB5H 5ISZD 1QPPA 3HMWL 2B1AL 5D1XC 1YEEL 3SKUD 8FABB 1J10A 2AKRA 5MEND 4JB9L 4R8WH 2JB5H 2X1WL 2AP2A 1LDPL 1G7HA 1RUAL 2VZTA 4GG8B 3UTPD 5EOCH 1NAKH 2Z91A 3Q6FA 3OKOA 3AUVA