3JWDH

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
total genus 29
structure length 220
sequence length 220
chains with identical sequence P
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdH01
3CVHH 4U4BA 4S11A 4YC2B 15C8H 3CDGA 1BMGA 1FCGA 1OP5H 2ITDA 3ZE1E 3U7YL 4OSUH 3QR2A 5IW1A 4QYOB 3O6KL 1WAAE 2DLTA 1UM4L 2DD8L 4O2CA 2YK1L 4CU7A 1T5WB 1N3NA 3B8SA 3CH1B 5FGCB 4Q0XL 2W07A 4M61B 3QDJB 2M1KA 2IANB 4KU1A 1WBZB 5F9WB 4R4NC 3WDJA 1J05B 4MSWB 1RZGB 4KKNA 1QHPA 4FZEH 5FM5O 1T21B 2Y1VA 4FQJL 5HGAB 2WWMD 3E6FB 4GKZB 4HV8B 4J23A 1CK0L 1QACA 4JN1H 4L8DA 3S5LG 2JIXB 1FFQA 3UDWA 3IXAB 1ZHKB 3NAAL 3WSQH 4G6AD 2L0DA 2VKXA 3BOVA 4I2XB 1AIFA 5JDSA 3FRUA 4HXBH 2YD9A 3QDHA 3C09B 5HHXH 1UG9A 2HLAA 5C0AE 5HPMB 4C56D 4IRZL 3DWTA 1BD2B 1WCBA 2X1XR 3MYJA 3BP4A 4PJ7F 1A3LH 3IFNL 3OB8A 2PW1B 3JWNC 1J8KA 5DR5H 4P5TC 3MCLL 3ULVE 3NBNA 4GKNB 1CVRA 1X9QA 2RHEA 1AC0A 1LO0L 1VFAB 3HI6L 4BFBD 2H45A 4M5ZH 2JB5L 1I3RA 4WHTA 3TO2B 5IB2A 1KIQA 1I7UB 5CP3H 1AD9B 3LOWA 4ZDHA 4OSUL 3N1FC 3HG1A 3SDXB 3QFJA 3FOMB 4UDTA 3J7HA 5CBEA 5FB8B 1H3GA 3H8NA 3G9AB 1JBJA 3KPQB 2HYMA 3OJVC 4N0CC 3TBTA 1W0VB 3GMOB 3BXNB 4PV8B 1KT2A 2JJTA 3NH7H 2DKMA 1KN4L 5JOPD 4TNWF 1IEBB 4Y4FC 4HIEA 2ID5A 3GMNA 2PNDA 3EZ8A 3BPOC 4L4TB 4FZEL 1H15A 4P5MA 3MLZH 3ULUL 1BP3B 3CMOL 4HK3J 3SY0B 1RAMA 1ZS8A 3MV9A 3RDTC 3KS0H 3GMOA 1NGXB 3FQXB 4JVWA 1CIDA 4LIQH 3UO1L 5F9DC 3MRCB 3KG5A 3QIBA 3H9SA 4JFOA 1SBSH 1IKFL 5F1OB 1G9EA 3G6JE 3DETD 4XMLL 1VCAA 3CXDH 3MQIA 4P2QA 1Z9MA 3CVIL 2W9EH 2XQYK 4JFDA 4MXVF 2R4SH 4FNLH 3BFOA 4B0MM 3C09C 3FAXA 4QXGH 5EWIL 1A7QH 3IAPA 4RGMB 3VXME 3RIFK 4OCSH 3DETC 4DK6A 3EJYD 2X5PA 4L3CA 2PO6C 3DSNA 3KPOB 2C1PA 3SGDI 4G9FE 3KPRB 1OP3K 1HN1A 5CZXC 4F57L 5JMOC 1MI5A 1YEKH 4J4PC 3KS0J 2OJEB 4OKVB 4R0LB 4FQ1H 3A67L 4JKPH 3ZE0E 2HRLA 5HPMA 1N0XL 4DZ8B 4NWTL 3BSZH 5GXBB 3JUZA 3VJ6B 4L5FL 2Q8AL 4XGZA 3DUUB 1YN7B 4U1LA 2ZG3A 5DC0A 1QRNB 4TPRL 5FA3B 1VEOA 2JIXA 3LH2H 3NCCB 5JW3H 2HRPH 3IDIA 4U7SA 3O3UN 1C08B 3LKQA 1IAKA 4DVBA 4Y19A 4LARL 5E94A 1D5BB 4YNYA 1JPGB 1LK3H 3LPFA 3CMOH 4HWZB 5ENWB 1RZIB 4IRJC 1EZVX 3VGHA 4XCFH 4DCQA 4A6YB 5I1HL 5GIRB 1YY8B 3I75A 5KANI 1U8JB 2YEZB 2PW1A 1LQSR 1CGTA 1KLGB 3PGFL 4DZBB 2RB8A 3HN3A 4ODVL 4N0UA 5L9DL 4FQXC 1JHKL 1FVEB 2W9LA 2ADGB 1D5ZB 4EDWH 4JO2H 4UOW1 1JRHH 1E4XL 3RQ3A 2C3XA 3F65A 3BPNB 5DQDL 1JE6A 3VRLF 2CMRL 3I6GA 3S36H 1J8HE 2NY4C 3WIHH 5C07A 4K3DH 2CIKB 2DAVA 4PRHB 4Z7QF 3PWLB 5KVEH 4D9LH 2A6DB 1BEYL 2D0GA 4P2QD 1CGWA 1T0NB 4KI5D 1K4CA 2AEPL 2Y36L 4APQC 5GRWA 1YDPB 5IMOA 5EULV 4AEIL 2NXYD 1HDMA 2NW3B 5LGJA 1YY9D 4WU7B 1NGWB 1P4BL 2VUYA 5I8KH 5JNYB 4HFUL 5LKNA 1KCSL 3B6SB 2WLYA 2VN4A 2V9QA 1ZTXL 2FEEI 4HQQL 3LH2L 3P77A 1IKNC 1FORH 2XY2A 3BP5A 4NGHL 4OIAA 1JHTB 1I9JL 2VDML 2VE6A 5D1XB 1BF8A 1D5ZA 4LSUH 4UIKH 3MV8B 4NIKB 5IG7A 1V5JA 3I50H 4HXAH 5J89A 1INQB 4I0PC 2OZ4H 5DYOA 4G8IB 4X7CC 2F19H 2R2EA 5ETUB 3BMWA 2NY5H 4PD4K 3STZA 3WE6B 2ZUXA 3C6LC 1CU4L 3IVKA 1WEJL 3O2VH 4PGBA 1R24B 3I2CH 4YNYB 2E7MA 5IOPA 2OYPA 4PJGA 3KPSE 3X13A 1BHGA 3QQ9C 1FV1A 4LDLB 3LEXA 4WRLA 4MD4A 3K8KA 5CD3B 2DQCH 4OKDA 1CT8B 5IB1A 2OJEA 1FE8H 4H8WH 4R7NA 2F58L 3FCTB 3FT4B 3MJ8B 3WNMA 2WIMA 1PX4A 4IS6B 4GBXD 4RFNB 4JO3H 3D85B 4GQ9H 1J5OL 2ED7A 1QBLL 1LO3L 2NY7L 4OKVA 2CQVA 2OK0H 1ZVSA 1YEEL 2XA3A 5JTWA 3EFDL 2HT3D 3LMJH 1UZ6E 1FNGB 4I0CC 5BV7C 2ADJA 3U82B 3KPRD 4OCXL 4NJ9L 3LKSA 2NXZB 2DJSA 1FFNB 4I77L 3CFJA 4PRHD 1FORL 5T1LB 2WV3A 4XP9H 3HPJB 4HC1A 2YBRA 3T0EE 4P2CG 4TNVK 1T4KB 3K2MC 4OQTH 5L88H 1URLA 3RVUC 4C83B 4JB9H 3I50L 2W0KA 3QIBB 4LU5L 4XH2A 1K3IA 4E0RA 4XVSH 1S7WB 1FAIH 1LDSA 4IRSD 3I6KA 2X1QA 4PJ7A 4XXCA 4KPHL 1F4XH 4Y2DC 3VRJB 4QLRA 4XP5L 4G6ML 4NP4H 3QUYB 3TNMB 4X6FA 5E9DA 2P24B 3SDAA 1PG7L 4JHAH 3E6HA 1XGTB 4YR6B 4OD2A 1G7PA 1ROWA 3PQYD 4MXVE 4HIEB 2NY2D 3OKLB 3VFOB 3SKNB 4QRPA 2W1NA 1QPPA 3GJEA 4XBPB 5SWZA 1SM3H 1AD9A 5JOFB 3WFBH 2R0KL 2FSEA 4PGDB 2ORBL 2JCCA 4XWGH 4ZXBD 1A9EA 5CSGA 4JQXC 3KLSA 3QI9D 3KYKH 4IJ3B 3U4EB 3GSVB 3GNMH 1CE1L 1WZMA 3T3PE 1NLBH 1AHWB 3QDGB 3MGOB 4MA8H 3PG2A 3DV4B 3IF1A 3B5TA 4RFNC 3E2HB 3UTOA 4XX1E 4G9DA 5I1CL 1JHLH 5IFJA 5TDNA 1U58B 3RWDA 4OCWH 3AREC 4JHWL 4QXTA 5B8CC 5GJTH 2X1PA 3BIBX 5J4MA 3IXAA 3NFNA 2NY0D 3N1PC 2RJMA 5EG6C 3JZ7A 3WMSA 4QRPE 5BRZD 1F58L 2X4TB 4LF3B 4PRPA 4JRYD 1JTPA 2CUIA 4RZCB 1QBBA 2XN9E 4Y7MA 2HJKA 2AGJL 5AD0B 4X6DE 1WFOA 4GRMB 3ORJA 5JDSB 4JY4A 1HZHH 2X40A 4LLVB 2A6JA 5HHNB 5HI4C 1KXQE 4G6KL 4L4VE 4WO4A 1IGYA 4ODSH 1UJ3B 1PG7H 4XPAL 2HFTA 3QFJE 2YUWA 3N1GC 1DUZA 2A9NL 5H37G 1N59B 3TPUA 5INDB 5CP7A 4XAKE 3VFPB 3ZO0A 1WBZA 3P73B 3EDJA 3QUYC 4ODUA 4PRID 4XPFH 2XNAB 4P59H 4XWGL 1HINL 2IPTL 3MRGB 1FLRH 2UZXB 4U2YA 5J13B 2X42A 4L8BB 1YC8A 3TLRA 4QYOA 5IMMB 1CLYH 4FOMA 4IIQB 3QDGE 4R2GD 4MNGE 2PCPB 4LSVL 1BVLB 4YHZL 5GSVA 1ZA6A 4PY8J 4U3HA 2MPAL 3BKCL 1JHLL 4G8EB 4J6RL 3CNKA 2QR0B 4HIXH 1BQLH 1AHWC 4XRCB 4OD3L 3DO7A 4AK1A 2RFXA 2OMNA 3LRGA 1G1CA 1CLZH 5JHLL 2FB4H 1RI8A 1CN4A 5IROC 3TBSB 5C0CB 1A3RH 5D7LA 4PJEA 3T04D 1QYGL 3JXAA 5DMKB 5E8NA 1FGNL 1BIIB 2X70A 5KSAC 5B8CA 1K6QL 1F42A 3M17B 4G6KH 4RFEB 4U33A 2IPKB 4WEUD 1LMKA 4X98B 5HI5C 2P5WB 5I71B 1J1PH 4IRSB 1AY1H 3KXFB 2A9NH 3PABA 1MPAL 3G08A 4CVXA 2JB6A 1KN2L 4MS8C 5EU6B 4PJCE 3NCEB 1EEYA 4R8WL 4Z7UA 3SDCD 4P5TA 1YNKL 3HRZB 2NNAA 3MREB 1WBXB 1MHHB 2PF6A 4ZTOH 3RA7H 1INEL 4GKSA 4I18A 2YXMA 4KKBC 5BVPL 2DQTL 5D2LB 2ED8A 2BHZA 2AEIT 2EDLA 3BQUC 3X14B 4GRLB 1A6VH 5JZ7C 2GJ6D 3FO1A 2H32B 3CFIC 2DYPB 2P8MA 5D7IB 3TFKC 3K80A 3KGRA 4RWHA 3O4LE 2WUBH 5HHOB 3RBGA 2P44B 3PWJA 2X6MA 4OCNC 3V4VL 3MNVA 1MHPL 5EH1A 3U0TB 3V8CA 4HT1L 5EN2B 4MZ2A 4PJ9A 4L8CB 3FQUB 3TIDB 2AK1L 1DBKH 5AYQA 5TF0A 4WEBL 1XIWD 5D93B 15C8L 1JNNH 4PJXF 3WFHA 5IVNA 4FQLH 1FL5A 5L7XH 4Y4HD 1NUGA 2J6EA 1FBIL 3FT2A 1KIRB 1GZQA 2B4CH 4PJBA 2OP4L 5EO0B 2P48B 1M05B 2RFXB 5KSAB 3TEUA 1T1XA 1A1NB 3PF2A 4R7DA 1KN2H 4XX1G 1DJSA 4AENA 1GPOL 5HYJD 1DQDL 4OZGB 1N6UA 2NY3B 5I73C 1GIGH 1VFMA 4TSBH 1PBYA 4FQJH 1QSED 4E42A 4RWYL 1VDGA 1NGPH 5E56A 1CK0H 3OKOA 5T1MA 5CZVH 4U1NB 4RBPH 4L8BA 3TO4A 4RMRA 1K5NB 1MJUH 2GY5A 4G8GD 1T66C 3NA4A 5ISZB 4GXVL 1P9MA 1A7RL 1R5WB 1F3JB 4KRPB 2DWEB 1CLOH 3VFWB 2JF1A 4UBDD 25C8H 2RCSH 5TFSL 3JV6B 2WNGA 3PWUA 1RJYB 2P1YA 4HWBH 3L5WA 4H0HB 5BXFA 2XWBA 2MQ3A 4MS8D 4HUUA 1C12A 3TJEL 2X89A 1A2YA 3A6BL 2XWJA 1HXYA 4J3SA 3HZMB 7CGTA 1IM9A 2FX7H 4ZYKA 1NMBH 2HJKB 4NKMB 1QQDA 4OQTA 4L3ED 2A77H 1UCBL 3KPPB 1DBAH 4QWWD 1FGVL 2Z8RA 2ZPKL 4BKLB 4YBQC 1UVQB 4QXTB 4IDJH 3KPPA 3MZTA 4RFOH 5E8EA 1I7TB 2IC2A 3IS1X 1XF3A 4LRNL 5EBGA 4NKMA 2DLFL 4N0YH 5I66B 2K9UA 3LIZH 2AJUH 1I1AB 1JYNA 5D1ZA 4LMQE 1NC4D 5DQ9A 4FQPA 4C59B 5DJYB 2PW2B 4TSBL 3ULUH 5TGBB 4BZ1H 4RWYH 1PFCA 3U36A 3L5WB 2DM7A 4GXUM 4CDGC 3FFDB 2VH5L 4U1NA 1LGVA 2NY3C 3KNBB 5E6IC 5F7WC 4MAUL 2GTWB 3W2DL 2YD8A 5D7IF 3WNKA 3LKRA 3L3DA 3SKNA 5ESAA 1R3KB 2APXA 2RCSL 3PDOA 5FXCH 3U7WH 3MLVL 4L3EA 3D0LB 5E70A 4P4RB 4HKJA 3S5LA 3SE4C 3VI3E 5EORL 4UV7L 2PO6A 1L4IA 2X89D 4XBEL 3GM0A 4F58L 4WFGE 3QIWD 3VFTB 2ZOLA 1JI2A 2QQLL 1K4DA 4OZFA 4P9HL 1BX2B 1KJVB 1UACL 2OTUB 4WUUB 1T5XA 4XH2B 1T1XB 4PJAB 3H9HB 4EI5B 3AUVA 3RNQB 5E2WH 3IJHA 3VFGH 2CSPA 3DURA 4QHMA 4LHUG 3DMMD 4XB8A 5B3JF 1FL5B 5IVXF 1LDPH 4HG4J 3GIZL 4PJGF 5CEXA 5LWYL 43C9B 3QWOB 1A7NL 3WEXA 4XP6H 2Y25A 4PJ8A 1P7HL 4ZFOB 4POYA 5J8OA 1M71A 2BVOA 1S8DB 2ENSA 4U2ZA 5BQ7A 5E1AB 1A7PH 2ZUVA 2NY2B 1QOKA 5I76B 3MJ8A 4G8FA 1ED3B 4ZSOB 2FNBA 3LS4L 3FCTA 5SWSA 1J12A 2CUMA 5I1DA 2R9HC 5JA9A 3QWOA 2NY4B 1Q9WB 5FAAA 4Z7UB 4DQOL 1MRFL 4NKOA 4ZFZA 5I1GL 4KV5E 1OARL 5I1DB 4EKXA 4J3XA 4CVXB 2VXQH 2BNQB 3O2WH 1LNUA 4TVSa 4ERSL 3TESA 5HYEA 4OFYA 3ZLQC 4P4KA 1S9XB 5HTSA 2V2XA 1PKQB 5GRUL 3SE3A 5DRZA 1MCJA 5FUZH 3SGJA 3UCRA 3X17A 3PV6A 3N0PB 3SKJL 3ZDXF 2VC2L 5DMKA 1IC5L 1GSMA 3WS3A 3VH8A 3L3GA 5J9PA 1WTGT 1S5HA 4KMTH 4ODBD 5ANMB 4GUPA 2BXYA 2D3VA 2J88H 4U0RB 3WFEH 4U1IA 4LPXA 4XVUD 4U7KA 3HR6A 4MNGB 4HFUH 4XC1L 2APVA 3E8UL 1L9MA 1PAMA 4Q6IA 2L7UA 3QIWB 1T89A 1CFSA 1CFTB 5I75B 1CCZA 4MX7A 3U30C 5D5MF 3ZDZF 4ZO7A 3PWNB 2YRPA 3ZDYE 2O61A 2H1PL 1UFUA 1ZA6B 2WBJC 1WVZA 1LK2B 4JQXA 1ZE3C 3VXQA 5GSVB 4LCWB 2QEJA 2YSSA 1MCEA 3LS4H 2VITA 2XXMB 5EPMB 5D72H 1DQQB 1UZ8A 1WUNT 5CINH 2O5ZL 4LRIA 3AROA 5I1GH 3QI9C 2B1HH 5GGTL 2CLZB 3HNSH 2BY1A 3CX5J 1LEKA 5DUBB 5I15L 1CFNB 3BJ91 4RA3A 1NC2B 4G5ZH 3SKMA 2R56H 4U1GB 5CGMA 4D94A 4X4MA 3KWWB 3WO4C 3QUMB 1AGDA 4EDXA 3D18A 4H26B 1A2YB 4H26A 2CRZA 2DWEA 3HLAA 3RX7A 1F8TH 1JZ3A 3C2AH 5C09E 1UVQA 3BT2H 3BW9B 4EI5D 4Z0BL 5HPOA 3ULVH 4GT7A 2X10A 3TH4T 5DD3L 1JN6A 3V5DB 3D2UD 3CLEL 4LCIH 1U8QA 4PD4J 4AENB 3OG6B 4YO0B 3H7LA 1UM6L 3BISA 5GISH 1RJLA 2IAMA 4Y5YC 4WENB 3AAZA 4KPHH 4LEOB 3EBAA 1B2WL 1FNHA 3CFBA 2GJ6A 4POZD 3QQ4B 1A8JH 2VKWA 5F3HA 5CINL 1GC1C 3QG7H 2WBJA 4P2RB 5H94B 3VWKD 4ZFGH 1AHWA 4IJ3C 4ODXB 1FJ1B 2ED9A 4XMKH 1F11A 1OSPH 4GRWE 5ERWA 1TVHB 1QG3A 4I48B 2XA8L 1NCAH 3V0WH 4HIJA 5BRZA 3VW3L 2YS4A 2IBGA 2LAAA 1S5HB 4X6FB 5E9DB 4BQ8A 1JNLH 4RAUA 2FO4A 1EO5A 3ARGB 1DEDA 4WU5A 3GNML 3CDFA 1CICA 5HYQA 3UBXB 1OPGL 1WZLA 3STLA 4AEHL 3TV3H 1UENA 3MNVB 3BH8B 3H3BC 4NKQB 2P5EE 2VLJA 4Y4KB 1CTOA 2FATL 2PETA 3CFDB 1ZWIB 4CMMA 5I1JL 1YN6A 4LGRB 2R0LL 5DD3H 3IRPX 1PKQE 1Z0NA 1A4JB 5ALBL 1GAFH 1VA9A 2Z8VC 4YAQA 1NANH 3UTTB 4GAJH 5KW9L 5ACMA 1FYTE 4LLAA 3UJTL 5I1IL 3MBEC 3G08B 2AGJH 2BCKA 4HWEH 3RWGA 5A16A 2EE2A 1NCWH 4NBYB 4L1DA 1YMHA 3MREA 1B2WH 3MLXL 5HD8D 3RL1A 1RZ7H 1JF5A 1UM5L 4G6JH 2VXSL 2ICWA 2LE9A 4KROB 4XPAH 4O02L 2ARJB 3W9DA 1CD0A 1ZHLB 4DN3H 1NLDL 2NYYC 5E2TH 4Y1AE 3D85A 2O26U 3JWOC 4JG1H 2BOCA 2D0FA 1G6RA 5FHBH 4M48L 5HGDA 3NPSC 1VERA 1Y6NR 2J5LB 3BAEL 3FT4A 5I6XB 2NY6B 4KRPD 3O4LA 3BO8B 2RGSA 5DHVB 3L7FB 3LEXB 1HHKB 4P2RD 4PJFF 2C1OB 4FP8L 3CZFA 1K4DB 1M6OA 2A0LC 4HLJA 4LGSB 1MCQA 2Y07H 4J6RH 2Q8BH 3P4OB 4BYHA 3JTTB 3C5ZA 2FHCA 1UYWL 4MLSA 4PRAB 4RDQF 4Z78B 3OKMA 4MDIA 4X6DF 5IMMA 4G80A 1IGTB 1RUQL 1JPFB 1U41A 3SJVB 5M95B 1F2XK 5IW1B 2ATPA 3ESUF 3VXTB 5D1QB 3QCTL 3LRHA 4XP4L 1JGUH 4D3CL 3SDDA 1F2QA 3BP5B 1BAFH 4XPGH 4NCC2 2F54E 2I27N 4G7VL 4BELD 1CD9B 1BGXL 3CVHL 5BZDB 4Y4KD 2Q76B 2XKSA 3LDBB 4IOFD 4ENED 3NACL 1J10A 1GGBL 2C3HA 2OBGA 1IGYB 1NGWA 2IGFL 2QR0A 5FUCE 2NY0B 3S4SG 4XC3H 2GJZB 3LEYL 1HHJA 3C6SA 3MJ7A 2B4CC 4HUNB 3MGTB 4UDUB 1T0NA 3PHQA 1U8LA 2AP2A 3B2VL 4HIIA 3HC4H 4LF3A 4IRJB 4LLDB 5F89B 3RGHA 4WFFE 5ILTL 2BC4B 3EHBD 1U92B 3S37X 5DXWA 3DROA 5GRJL 4HH8A 4QRPD 5EUOA 2Q87A 4UBDC 5F1NB 2VAAA 4DCQB 3NPSB 4V1DB 2HKHL 5K9JH 5LXGH 2V2WB 5E9DD 4P48A 1Q94A 4UT6H 3V6OC 2R8SH 2JK5A 2VLKA 1IAKB 2NX5D 1X5GA 4KTDH 5D7IE 2QADD 4HEME 4HUUB 5D2NC 3GMLA 4ZUSB 3AS0A 2X2YA 4LLVA 1PVHA 2YD4A 1HCFX 1KGCE 1OAXH 2D7OA 5IQ7H 1PQZB 1A3LL 3ETBF 1RJZB 4NC1E 2B1AL 1D9KA 1OM3H 4XGZB 2FSEB 1X6NA 1T2QH 1I85C 4H1LH 3RIAF 1B6DA 4NQDE 3LKQB 1OGTB 2X4TA 2G2RA 4NN6B 1A6UH 1UT9A 1KACB 5D1QC 5HDBF 3ZKXC 4KK8C 3T0XA 3NABL 5DF0A 4YBQD 4QTIL 5DZOA 3EFFA 5D7KD 1ITBB 1IC4L 3D25A 1XIWC 3KPRE 4XC3L 3VGBA 3MBED 1FNFA 5I73B 4WTWA 5C0CD 4CGTA 3JWOH 2J8UF 2C3WA 3X11B 3P0VL 3MA7A 1AFVL 5DJ0A 1D5MB 2JELH 1MJ8H 1XGTA 3OHXB 3H3PL 1KN4H 4WW2C 5HDOA 1A1MB 2NCMA 1KG0B 5F6IB 1Y0LB 1F3DJ 3JWDH 3W82A 3RZCA 4KUZL 5DK2B 3U46A 1IFHL 1ZT7B 2VLRB 3S37L 4OLYH 4KRPC 3MLZL 1MCLA 4YBLB 4OZGF 3U1SH 3MRJB 4OLWH 1OL0A 1KB5L 2VDLH 3G5YA 4WY7H 1U8IA 1T4KA 5E00B 3B9KD 2QADC 5DK0A 1TTGA 5T1LA 3SDCB 2N7BA 5FGRA 1MCWW 3GMNB 2I07B 1IC7H 1SBSL 3F58H 4JREC 2VQ1A 1G7HB 2K7PA 3VRJA 1T03H 3MV11 1PX3A 3RVXC 2ZG2A 4P5MB 5KVGL 1FL3A 1DDHB 2DQHL 2NXZD 4E0RB 4U1SB 3MUGA 4OIBA 3EJZD 1OGTA 5DQJB 5SWSE 2X9YA 4P3CH 4HPYH 5T3ZD 4FXKA 1KSRA 1G7LA 4X7SH 1V3MA 4QTIH 1XGRB 5MENB 2NR6C 4P99A 1ZANL 4RMWA 3CU7A 1H5BC 3BKMH 3QWQB 4ESKA 3VXSB 1U2HA 4U6HA 2B7DT 4TPRH 4YWGH 1AO7B 2UZIL 5D2LF 4EEEA 3N1MC 4H20H 4LFHD 4K55A 2IG2H 3BZEB 2VZSA 3C08H 3QIUA 1HOCB 4OM1L 1BIIA 4M7ZC 5D7JB 3DBXA 4LOUD 4EOWH 4JY6A 4I8DA 4HKZB 3MRRB 1NC2D 3CFEB 4I2XA 1MFAL 1K4CB 1ZHKA 5DWUL 1QPXA 5JORB 1JRHL 5F7DB 4UU9A 2R2EB 5D6CB 3FB8A 2FD6H 3IJYA 4JDZA 2CMRH 5DYOB 3VE0B 3WIHL 1LEIB 5D96B 1LEGA 4O4YH 2Y6SC 4M3JA 1S7QA 1DQJA 3VXTA 1WLHA 2Y36H 5CJOH 3GSOB 3ZMRA 1UWXK 1JV5B 1S7VB 4PTUA 1HWHB 5HYFA 4BM7A 4MDIB 3MRGA 1KV3A 5C0FA 3JTTA 4I1NB 5CGYD 1OTSD 2YA0A 1JK8A 2GUOB 4X5LA 1FIGH 5J6GA 5MEPB 4ALAL 4KVNH 3RWHA 4K94L 3ARBB 4N0UB 5CKGA 2H8PB 1M6OB 1N59A 3TPUB 4DZBA 4HHAB 1MJ7H 4MJIA 1XR9B 3Q1SH 4ZNCD 2I9LA 1U8JA 6FABH 4L8SB 2ITCA 5CCKL 3TCLA 1UXSA 4WWID 4X9HA 1RULH 4HXAL 2V9TA 5ENWA 5MP6H 3VFRA 3MLSH 1OAUH 4TSCL 3O3DB 3ZYIA 3VJ6A 4IHOB 3VI3F 1DLHB 4PJ5D 3P9MA 4JM2D 3QPXL 2DIJA 1NL0H 3RZWA 4FQHA 2N56A 4MVBD 2FLRT 3MSPA 4PJIF 4U1MB 4XCEB 5D7JC 5AYUL 5KS9A 1OARH 1H8SA 3DVGA 5KN5B 4U7MA 3GSNL 3MRKA 4GMSL 4RAVB 1U3HB 2NLJB 4LPYA 1YQVL 4KY1H 2YR3A 3OR6A 2EYRB 3U9PL 2FX8L 5F6HI 5IGXL 4ZNEA 5FECB 3DV4A 2ZKHL 2MCG1 2C1PB 4S1DD 4GQ9L 3EOYG 4Y5YA 4LLUA 4ORZC 4GS7C 1G6RL 4KK5C 3UPRB 1A4JA 5I30H 4KQ3L 1U91B 3CD4A 1EHXA 2H32H 1A0QH 2OJZH 2D9CA 1EHAA 1BBJB 2VWEE 3TNNA 2BSSA 4I0PD 4P2QB 4APQA 5C6PB 2IALB 3SY0A 5EOCH 4K94H 5BS0B 4X8JA 1D5XB 1FC1A 3HZYB 1CDYA 3T08A 3ROLA 1H0DA 3N06B 4HJJH 3VFVA 4YGVA 1TFHA 1U95B 3B4NA 1GHFH 5FO8A 5IBLD 3T0VA 1P5VA 3RWCA 4XVSL 3MLSL 3MTRA 4P23B 4IRSC 1IZKA 1YC7A 1H3TA 2DQDL 4XNMA 4YUEH 3TYGH 1DBBL 2R1XB 1NGQH 5I1KL 4ODXA 1FYHB 2XKNA 1U8IB 1DBML 3IU3B 2ZSVA 1W0VA 1I3RB 1NMAL 4KK9C 1XZ0A 4WHTB 1MSPA 4P2RA 2H2PC 4WTZG 4YXHL 4AIZA 5GS2H 2LABA 4RRPG 3GSNH 2VZ3A 1VFAA 4K8RL 4PP1C 3WIIL 3QFJB 1SVZA 4BSWB 4KY1L 4F9LC 1IGIH 4JQIL 3L3OA 4OZIA 4G5ZL 4TUOA 4PJAF 1W72H 3OJDB 2ZZUT 4KKAD 4X4XA 3BP4B 4CU8A 2Z93A 3I02B 3LKNB 2EIZA 4OZHE 5C0DA 3ZSTA 1CE6A 3QJFB 5DS8A 2GSGB 3SJVD 1LE5B 3DXAA 3BXNA 3GSRB 4CRPA 2BNQD 3ZZ1A 1LO4L 2V9RA 3CXHK 5JQ6H 4M03A 1S9WA 4QHNA 5I18L 3D5OF 5DUML 4NRZB 1B0GA 4Z0BH 1R0AH 4LKXA 5MI0C 1XF2A 4XCCH 3MODL 2KDGA 1M4KA 4PYGA 4MZ3A 3T0BA 5A2LH 4Q58C 3V52L 4QKXB 3CK0L 3VH8G 1Q0XH 5A1AA 3RI5K 2W0LA 3O45B 3MJ6A 3QDME 3CH1A 1T5WA 3T4YB 3SKMB 2VLKB 1EH9A 4TQEL 4JHZA 5C0CE 1HZHL 2R29L 5GZOC 3FFCB 4GG6E 1K8DB 5HI4D 1WCBB 3D0VB 4BQ9A 3T2OA 3I3DA 4MXQD 1YEJH 5E8OA 4I4WB 3MUHL 3PHOA 4X0KB 3O3BB 3RUGF 1H8OA 1N5AA 2NQCA 3SGKA 5C6WH 1S7SA 4H25A 5E6ID 3REWA 3WFDL 1T80A 1EFQA 3H7BA 5HHME 5LGKA 4QXWA 3QNXB 4DAGL 3IDMB 1MHCB 1H3PL 2P49B 3LS5H 4UMGA 3MRMA 4R3SA 5HGAA 5KVMC 2EYSB 3A6CH 4KAQL 2ZCHH 4OZHB 1T3FB 4RISL 4X6DB 5E99L 4HZLA 4OLUL 5DUPL 4M61A 2HT4D 1CFTA 4LLWB 2FZ3B 1G9MC 3HI1A 1AP2B 3IKCA 3PXJA 2DLEA 4KI5E 5GS1B 4ONHB 1ZEAL 4GQPH 2QL1A 4HFWA 5MEOA 3HE7C 1VGEH 1CGSL 3VG0L 4BFEA 2AQ1A 4LVHB 4S1QH 3V0VB 3RAJH 2DI7A 3S88H 4PY7A 3C8DA 4IDLA 5D1QA 3MZGB 4M4RA 5TJWK 1ACZA 4JFED 3MBEA 5T3XH 4OZFH 3VCLA 3TZVC 1KXVC 4S1RL 4P2OB 4JRXB 4NSKB 1WSST 4I5BB 4P57A 1FGNH 4GLRH 1ZSDA 4HWZA 1FNEA 3FB7B 2X4OA 4BQBA 5I17A 4F7TB 5K59F 1XAUA 2V7NA 4G6JL 4K8RC 3BPCA 1U9KA 4QRQA 1D9KD 3HZKA 3BVNA 4ELMA 1DFBL 1I4FB 3IJSA 5DRWB 3MBXH 3TO2A 3BIKB 1A6TA 4LSRL 4N0FA 4W6WB 5DD5L 4UTAL 43CAA 2P8LB 4NQXB 5I16B 4ZSOE 4DW2L 1FPTL 4K3HA 3FOLB 4PRNB 3MUZ1 1QHOA 4OCLC 1BQUA 1KGCD 1ZT1A 4HJGA 4MNQA 2Y07L 4GG6A 3F7VB 3ELAT 4YE4L 3SO3B 2AJZA 4NO5A 1BZ7B 1D6EB 1VGEL 3S96A 1A5FH 3H7BB 5DVOA 3TVMB 3PUCA 2X9WA 3VI4E 3R1GL 4M43H 3RY6C 3CSGA 3OX8A 4U6YB 4HUMB 5GS1C 4BZYA 4LQFL 4ODHL 2XN9A 2QQKH 1MNUL 4K07A 4M7LL 5E8OB 3ZKMC 4LVHC 3ARYA 3V4PL 5DT1L 5DZLA 2VLRA 4APQD 4LP5A 3MGAA 5ANME 1FO0H 4PG9B 3KLAA 3O9WC 5GPRA 5TPWL 2JB5H 5BMFL 4JPWL 2CUHA 3CUPB 1LP9B 3M1BB 3ABZA 1DUYA 1F90H 3C8KB 4IOFC 1YYLL 2ARJQ 2OTWA 4PY8I 4N68A 1WT5A 4N9GB 4P5KA 1CL7H 1D6VL 1FSKB 4OBSA 4RAUB 1RVFH 1RHHA 3KPLA 2GTWA 3KPQA 2V5TA 4M7KH 3MRLA 4LSRH 4WFEE 3VWJC 3HC3H 5K33A 3OKNB 2YUXA 1NCDH 1PLGL 4NWUL 5KVFH 3KPNA 3FQTB 4JZNB 1VADB 4M6OL 3C5JA 3G6JB 5TE4H 1PY9A 4DGVL 2DLGA 1IJ9A 2DQUH 1NGPL 2ZCLL 1A1OB 3NOIA 5C0DB 2FLBT 4LLMB 1X6LA 3O8XD 5CAYB 4JM2A 3SGEI 4CVWA 2DTSA 3CFCL 5SX5K 2HFEA 3LKPA 2IFFH 4OF3A 4F37F 4MMZC 1DANU 3ARQA 3WV0A 2YRZA 3S34H 4O2EA 1E4JA 3ET9F 2CR3A 4GRLD 1OAXL 5IQ7L 2W9EL 4JO4L 4ODHH 3TJEH 3KYNA 4NDMB 3RGVD 2FWOA 3TH2T 1A7QL 4W68A 1JGVL 1T0MA 3V4UH 4EXKA 5C0GB 3TVMC 1SHMA 2ESVB 1OF2B 1NMBL 2CDFA 1FO0L 5HXMA 5DMYA 4C56B 3MV8D 2FIKB 3U4BL 5FO8B 1R3LB 2G5BA 5BXFB 4LPWA 4JKPL 4PLKD 2OSLB 4LSTL 4WUUE 4P2OD 3JV6A 4M3KB 3VFSA 2ZPKH 4K3JH 4MSWA 2EDTA 4NO0B 1HHJB 4H88L 1AGDB 2R2BB 1JI1A 4NQED 4OLXH 1RVFL 4CN6A 1N3NB 2AKRB 1T22B 1CS6A 4N0RA 4JLRA 5IEKA 1JPTL 3ESVF 2VLLA 3FB5A 2HRPL 3DHJA 4OCRL 3ZT6A 5DVNA 4PS4H 5EC2A 1LEKB 3TT3L 1NBYA 4M5YL 1X5ZA 3QCVL 4OLYL 4P4KC 4DGVH 3U4AA 3UTZA 4W4NA 1JWSA 3U46B 4XHJD 2CDGA 4FQXB 3SE3C 2OI9B 1DEEA 1KELH 4ELKA 4JREB 1JZ2A 4AM0B 1S7UA 4GBXB 4MXWL 3FB6B 4R90L 2ZUQC 3R0NA 1LVEA 3EUUA 5T3XE 1ORQA 2EE9A 1RZ8A 5F1KC 4CVZA 3QH3A 3T4AA 3KYAA 4L4TD 1PYWB 4G6AC 3WUWG 4JO2L 4MGXA 2OZ4A 5I74B 3QHTC 2F5BL 3HZVB 1X7QA 4R4FH 1I1FA 3WIFA 4MJ5A 4S2SB 3T0DA 2WINA 4JZJC 3ARRA 3GSWA 5JUEL 2QQLH 1MRCL 4NYLB 1UH3A 2M2DA 1QEWB 3Q6FA 4GUPB 3SE8H 4KJQD 1MWAL 1L0XA 5E2WL 1A21A 5KAQF 3AXLA 2P5ED 4LCYB 3VFNA 3WJJA 4QOKD 3BPCB 32C2B 4C4KO 1MHEA 4NC2B 1EV2E 1LDPL 1DBJL 1ZSDB 2NX5E 3T8XB 5JO5B 4D2NA 2IQ9H 3PQYB 4PJDB 4POUB 4V1DA 4JFQB 4I5BA 4P57B 2H26A 5IHZB 1HKLL 4Z9KB 2PKDA 1AJ7L 4MA3A 1BQHG 4AQOA 3VXMA 5KTEH 5C09A 1YEFL 1JV5A 1L7IH 5F9OH 3CVHB 3PIQB 3L3KA 4OI7A 1HNFA 1EGJL 4LLDA 4RAHA 4PY7B 4MXWH 4JFFD 3QQ9D 4UT9L 4WFED 4ZUTA 3DLQR 4UDUA 1YN6B 2IADB 2JB6B 1HILB 3CLFH 4R4ND 1MIML 1E27A 4DGYL 2EDRA 4GBXC 1N4XL 4DQOH 5JZ7D 4PTTA 3VXNA 5DFVC 5HVGB 4MAYB 5JORA 4M62H 4F2MB 3IDUA 4ZAKA 5CEYB 1KJ2A 4OQ1A 3QNYA 3C87A 5IJKC 4KTEL 1MH5B 4PJCA 4YHLH 3NPZB 2FO4B 5SWQB 3GMMA 1CDUA 3HE6C 4JFZH 3WXVL 1XR8B 5DURB 1A7OH 1LO3H 3CX2A 3BZEA 2UWEE 4L1HA 1AR1D 1YYML 4WUUD 3MLTA 4KMQA 5GGVY 3VXUE 2Z92A 4WI9A 2NR6D 2YUVA 2R4RL 2ENYA 2C1OA 1GGCL 3CFBB 4I0PA 1Z5LA 4PLKC 4WIQA 1Q9OB 4KROD 4M1GH 3VXRB 3TN0A 4EQ3A 3FFCD 1F45A 1TITA 1XF4B 3L7FA 5E5MA 6FABL 2N4IA 1UWEH 1EERB 4BSVB 3B5GA 5KJRL 3QEUB 5FM8A 4QF1A 4QOKB 3GM8A 3VXPB 1QR1A 5DSCB 2XNAA 4LBEB 4UT9H 1CD8A 3MROB 4MCYA 1OP5K 4LKXB 1ZHNA 1YPZB 3WIHA 1VKXA 4KTYA 4YXKH 4FQXD 1CDIA 1NL0L 1CXEA 1FVCA 3QZWB 4X9GA 2A74A 5GGTH 4JM2F 1PZ5A 1VENA 4KWUA 5IVXA 5HYIA 4G3YH 4WFGD 3DV6A 4KHTL 3RWGB 4DN4L 4R26L 1CFVH 2I07A 1A6AA 4LHJB 4P5TD 4PJ5A 2ORBH 4X4XB 1U6AL 4GRWB 1EZVY 2FIRT 3TWCL 3UTTA 4LSPH 5IR1A 3QHFL 4NQSA 2ZKHH 3UAJC 3AREB 1Z6JT 1N5YL 4M8QA 1NGZA 4WVRA 4ELMF 1KTDA 1OW0C 2ZG1A 3QDMB 3HB3D 5BV7L 5L2KD 4G6FD 1TJIL 5AWNH 3P40A 3C2AL 3P9LA 2JKXA 1U58A 2CDEB 3OL2A 3GI9L 1I9EA 2XWJB 4JFHE 2J3SA 5EUOF 5F8RC 4WU5B 3LDBC 1T7XA 3DHMA 1H0DB 4NQCE 1T89C 2AW2A 2HMIC 1G9NH 3QAZC 3GUTA 2NY0C 4JPIA 5KSVB 3QDJD 2BSED 1U3JA 2WK2A 1LHZA 4YHML 3TN0C 4JQVC 4WCYH 4WDIB 5EBWB 3GJEB 5SWZB 1CDHA 2XKUA 3BMVA 1P84J 5H94A 4GMTL 5HSFA 3FO0H 3HA0A 3MX0A 4OD2B 1JVKA 5EOTB 5JW5B 2AABL 3KYOA 1QSEB 2ADIA 4UQ3A 3HPLA 2DN7A 1I9RL 1ZLVK 3C60B 4R26H 2XA8H 1BVZA 4OM0H 3MXVL 3ULUF 1JWUB 1F97A 2E6QA 1K8IB 2VXUH 2Z91B 4TULL 5L0QC 4PJGE 2V2XB 1GGIH 5DFVD 5E7FA 3N9GL 3FQWA 4KVCL 5D2NB 4YQXH 3TV3L 3QDMA 1LO4H 3QXDA 3ARVA 1FFNA 5JQ6L 2ILLA 5TE6H 2FATH 5I18H 4MD5A 4N0UE 1QSFB 3OTTA 4ORGA 5CWSA 3OGCA 1YJDL 1CLZL 1ED3A 3O3DA 5KSAD 5JHLH 3U0TA 2VZ1A 4UTBL 3FQNA 4NQEE 4EDXB 1ZHBA 2PYEE 4H0GA 3K0WA 3BD4A 3SKOA 4XNXL 2BK8A 3V6BR 2EIDA 1T1WA 1SBBA 3FZUD 2YWYA 1IAOA 4UNTA 1MWAB 1H3WM 1EA9C 2C7UA 2VWEC 4PGEA 1CTNA 5JMRA 4JJHA 1ZHNB 5MEPA 1N64H 5EUKB 4HZAA 4GMTH 1TQCC 3GGWA 5EA0H 1N6QH 2ATPB 5FO9A 3PNWB 3CIQA 1X44A 4GAYB 3RNKB 5C0ND 4NZDA 3QUKA 4LVNC 3GSOA 4P23D 2OXGA 4URTB 1EEYB 3FJTA 2WWMC 4PJAA 2ZUUA 5CHNB 3ZE1F 5KG9B 2VDNH 2EKSA 4YPJA 4DGIL 1F3RB 4RMVA 5C0EB 4BH7A 2O61B 1DL7H 2H6PA 1X5JA 3BP6A 3SDCC 4P3DB 5KG9A 2DQTH 3CXHJ 5IT2H 3O9WA 2VISB 5F71A 4RRPA 3V5HB 4RGNB 4K23L 4BH8A 3RZCD 3ZHLA 3IT8D 3OV6A 2VLRE 4UNUA 1RZJC 3VH8B 5I8OH 1S9VA 4P2OC 5CD5D 5F88A 5DMIH 4G6FB 3S3SA 3DBXB 3BX7C 2ARJA 1JYVA 4KXZH 2F53E 3RVVD 1AGEB 4XNXH 1QNZL 1XGUB 4PRHA 2FEDC 4E41B 2AS5M 1U8KB 5A16B 4NJAL 3HMWL 2OXHA 1I1YB 4YPGB 5CJBA 5IV2B 1CDCA 2QSQA 5CSZA 2VXTL 1ADQH 1A4KB 1ODAA 3ULVF 1MCKA 1N6QL 1BQHB 2B4CL 1GXEA 4QRRE 4NZUL 5SWSB 3T65A 4F9PC 1DQMH 3H9YA 4HUKB 4I18C 4OT1L 1H8NA 5IESL 5CEZL 4K9EH 4KMLB 5EUKA 4UTAH 5FCSH 1AD0A 2VOTA 3P73A 1V3KA 2DM2A 2P43B 2Z91A 3QUXD 4PGEB 2LQRA 5CP7B 4DW2H 4Z8FH 2NY4D 5K9QG 2D31A 4U6XB 2QQNL 5GGVL 32C2A 1VEPA 1NCCL 5CZVL 1QSFA 4OBRA 3UTSB 1W0WA 2FHBA 5LXGL 5TQ2L 2D7TH 5EZIL 3WN5C 4ETQB 1OP9A 4QHUB 5D9SB 1CF8H 4LP4A 3V9FA 1REIA 3SDCA 1C5CH 3VFWA 4KRMB 5ERWB 5I8OL 1FNAA 1R5WA 2NW2B 3C2SA 3D3VA 4J3UA 1P7QA 1G1YA 5AZEL 1FJ1A 3T1WA 3MLYL 5EU3B 4NZTH 1FG2A 1AGFA 1K8IA 4D9RE 5D7LE 4CDHA 1OD7A 2HVKA 1KB9K 4HCRL 1IGCL 1OAZH 1R5IA 4L3CB 1C16B 4NQVB 4OB5H 1EAPA 4F33A 5FF6A 5KSBE 5BV7B 4KV5F 3HMWH 3WKML 4LCCA 5IKCA 4JPWH 2DQJH 2JJTC 1EMTL 2Y5TB 3WHXB 3NCYP 1U2CA 5GSRA 1R5IB 3KNBA 1F4WH 5F9JB 1BJMA 2JELL 3ULUE 1I8KA 1P69B 2VDRH 2WLZA 4KJQC 4F37K 4ETQA 4N0YL 4Y5XB 2I5YH 1KLFA 4M8VA 2G2RB 3C9NA 3DVIA 3DI2B 4PV9B 4WDIA 5F96H 1XMWA 5LCVL 5IHBA 4JM2C 1H15B 5JHDB 5C0JA 1D9KB 2O5XL 1CDJA 1G9ML 2VDLL 3I85A 4DTGH 4OIIH 1J8HD 3GZKA 4PJIA 5GGRA 2KZWA 1W0WB 1QO3B 1Z3GL 4WEMB 3RWIA 2GJ6E 5D5ME 3ZDZE 5DJAB 1RK0B 4WJ5B 3MV7E 2X4SA 2WUCH 1BZQK 5AZEH 4ZXBC 2PXYD 1YPZE 2Z8WC 1T03L 2XG5A 1ZVYA 5HY9A 1JL8A 3PE9A 3LD8C 1MLCA 4KZEH 3GKZA 5IBUB 4I9WD 5IM7B 4Z77B 5J11B 1NCTA 4GKNA 1U3YA 5E5MB 4P9HH 1FVDA 2DMCA 3WKMH 3LKPB 2AV1A 4X7TA 2FECI 3WD5L 4YXLL 5CSZB 4XMPL 4JRYA 4LCWD 4JFHD 3FRPA 4UUJB 3FQRB 1P7KB 3MLTB 3L5JA 1ZANH 2ZNXA 1XH3A 3BIAX 4PUBH 4XP1H 5FDYA 4R96A 4X8XA 3VG9C 2IWGA 1G7JA 5E8DH 3L5XH 3ZDYF 1RUML 4J12A 3VGDA 1T20B 3BZ4B 4HWUA 2ZCKH 3RY5A 3L3GB 3D1MC 1OGAE 4R6UA 2R9HD 3UBXG 4FQ2L 2OMBA 1KELL 1C5DB 3G6AB 5C6TH 3EYVB 1A7PL 3RVXD 3ARPA 5CEYA 1F3DH 1HHGA 2BSTB 3D6GA 5D1ZC 3D9AL 5IK3B 4EOWL 2EDDA 1P84K 3WE6A 3BUYA 4U1JB 1JGDA 3OKEA 3SE4A 3Q5YA 4ZXBA 1P4IL 3VXRA 4UOW0 1DSFL 1XFPA 4JZJB 1HE7A 1NGYB 4W70A 4NN5C 1H3XA 2VTFA 3QEHB 12E8L 2VE6B 5BRZE 2HJFB 4E5XB 1PDKA 2LFGA 1UC6A 1UXWA 3DYMA 5IFAL 2DLHA 2DBLH 5HGDB 3NN8B 1HYRC 4L9DA 4MA7H 3WD5H 1I7RB 1BF2A 3S35H 5MI0B 1MFCH 4MNQB 1IC5H 1JWMA 1M71B 2EDFA 3ROOA 2AJVL 2C7UB 3D2UA 4JRYB 3TN0D 2DYPA 1QD0A 2QTEA 5IBTL 1MCWM 5B39B 1X5LA 1CD1B 3MXWH 5K9QI 4QWWC 4FQCH 3ULSB 4B7IA 3HB3C 2A73B 4RBPK 3UPCA 1JGEA 1MELA 1KTRL 3H3KA 2ZCKL 3DXAE 2FCBA 4LAQH 3UYRL 5AD0A 1QSFE 4JKKA 4D9QD 5F9OL 5HHVH 1FCCA 4MJ5B 2J12B 3QRGL 4S2SA 2UYLA 1EGJH 3FO2A 3MOBH 3GMQB 2FHFA 3TA3D 2X4OB 5D6DA 4IEFB 5HGGS 3KJ4B 1DVFD 3TCXA 3I75B 3L95A 5KZCB 2PR4L 3PP3K 4MA1B 1MFEH 2KQMA 3B9DA 3QIUC 1JIBA 4JRXA 5DMJB 1QEWA 3SDYL 2AAVA 4ONFH 3WO4B 4GAGH 4M62L 4Y19B 12E8H 3MR9B 5A2IH 3WDIA 4B53A 3PL6D 1F00I 2V2TB 3VA2C 2VR5A 5DJ2B 3DX6A 2V7HB 4NBXB 1GVIA 3BKYH 4U6VL 9CGTA 1F11B 4MJ2A 1TETH 5T1DH 5AUMA 1PKOA 4YHKL 3LB6D 4QEGA 5IBTH 3EO9L 1FFOB 1BD2E 35C8H 3VI4F 4AM0A 1Z9OA 4L4VA 3ULVL 3QUYA 4PBVC 3OZ9L 1IQWL 1C16A 4XZUA 2D03L 1S3KL 5GGSB 5BVJA 1OF2A 4FTVB 2W91A 2MQCA 3TIEA 3OBAA 2O5YH 4MYWB 4KK6D 1FO0B 1N5AB 5D6DC 1GHFL 1WC7A 2JCCE 2WP3T 5JPNA 4G7YH 4KKBD 2IH3B 2XI9A 5ALCH 1R3JA 4FN0A 4NUGH 3K4AA 4OFYD 4WI6A 4WFFD 1NGQL 3AM8C 4YXKL 2E7CA 5SX5H 4RQQA 3CPLB 1ZS8B 1T22A 2MKWA 1FVCB 4XMKL 3KJ4C 4LRIC 5HI5D 2CIIA 2CLRA 4DKFH 1U6AH 2ZSWB 3DX8B 5DSCA 5FYKE 4LSPL 1IE5A 3MV9E 5CBEB 5FB8A 1N26A 4BSVA 3MO1B 3GSRA 4OV5B 4PP2B 1B88A 1HIML 1SJVA 4BA8A 4XXCC 1KIQB 4PJHB 1TPXC 4XT1C 1GC1H 1U3ZA 3RTQA 5DUMH 5ITFA 1B9ZA 1NEUA 1FQ9C 4UIMA 4AJ0A 1XGPB 4LGPB 3TN0B 2EEDA 5GS0D 1HI6A 4HPOL 3VDCA 1MEXL 4S10A 3MACH 3LCYA 4Z7UF 1ZGLM 1Q0XL 3PWNA 1A7BA 2B20A 4MNQE 3GHBL 2ZSVB 3IU3A 4XAWL 3KLHD 4GOSA 4MX7B 4DJMA 1R6VA 4PB9L 3G6JA 2HWZL 1JF6A 2FEEL 2YA1A 1MH5A 3C60C 3O41A 3DXAD 3C8KA 4MNGA 1QTYT 5E5RB 1RZFL 1INDH 4FHBD 4XBGB 3AMKA 5DI8A 3E0GA 4O02H 3IS0X 4NKIL 1RHHB 1ZT4A 2JTDA 2A6KA 4PJFA 3IU4H 4HJGB 4UAOB 3RY6A 2K7QA 4Z7WF 4J1UB 2EKSB 2XWTA 3HUJA 2GTZB 3B8YA 4HX1A 2EE6A 4Z0XB 3N9GH 1WWCA 1NMCC 4KVCH 5DEGB 1QLEL 4TYUA 5DUPH 4MB3A 2YZ8A 1NC4A 1VACA 3IDYC 3QQNA 4P5TB 4ACPA 4M6MH 3INUH 5EU6A 4DVRH 3EYUL 4MCZA 3DIFA 3ZL4H 2R39A 3ARED 2JJSC 3REVA 2NLJA 2P5WA 2D7QA 3FQNB 2CR6A 4GG8B 1N8ZB 2BNUA 3F7YA 3THMH 3VCLB 2J8OA 5E94B 2FBJH 4Y5VA 4L29B 1CT8A 5IB1B 3ULVC 1IM9D 2HJLA 1QFPA 2EKJA 2FX9L 3IDIB 3NGBC 4NO2B 1P9MC 4RMTA 3X13B 1I1FB 3NACH 4F7TA 1INDL 1FFRA 2VB5A 4K2UL 3IVKB 3GSWB 5I8CA 1DFBH 5IW6B 1RIHH 4CVZB 2FZ3A 5A40E 3W81A 4PBWD 2OI9C 3HC4L 5D7JD 5F3BA 4OF8A 4HZLB 1VFUA 1FZMA 5SWZD 4ODTL 4YH6A 3UTQA 2ZUQB 3HUJF 4G8GA 3RWJB 3HNTH 4RGOL 1UB6A 1OB1B 4LLQA 4Z7WA 4KKAC 5C0FB 3KLHC 5IT2L 1U93B 4LPTA 2ERJC 5I74C 3OB0K 1MQKL 2HLFC 1D3CA 1DQJB 2AJYL 2R8SL 1EEQA 2VDPL 3KPSB 4RGMC 4UT7L 5D71L 4Y16C 5ELIA 5MEND 2P8PB 3QEGH 1ZK9A 4AL8L 5H35A 5CBAA 2YPVL 4JPIB 3FQXA 3FFDA 1TZHB 3VXSD 4NQTA 5FKPB 2JCCF 5IHUL 3QUML 4Z0XA 2NY1C 1HQRA 1TTUA 3ES6B 3S7GA 3REWB 3MRQB 2BXZA 3LQAC 1UKTA 5F21B 4M6NL 1A6WL 4IRZH 4LCUA 2DI8A 3OAZK 2VABB 4NQDB 1T83A 5DEFA 5D1QD 3ARFA 5GHWL 1L9NA 3T0ED 5FUOL 2NYYD 1D6VH 1FH5L 1QBAA 3OR7B 5FCUL 4C54A 2FWOB 3BN3B 5E2UL 4KK6C 5DS8B 1LE5A 4OT1H 4YZFF 3OF6D 5CEZH 3NZ8A 1XT5A 4ZYKB 5DJDA 1PLGH 3IFLH 4N1HB 3GJFK 3O6FD 4NWUH 3C6LD 1HXYB 4DUVA 1D5BA 3K4ZA 2W65A 4WTZA 3SDXE 3OSKA 1EAJA 4S1SH 4OZIB 5ESQB 3V6FA 4YHYC 5CJXC 1RUKH 3MYJB 2OR9H 5EZIH 4W81A 4AIZB 4I9WE 5B22A 3UJIL 3RDTD 3GKWL 4XNQB 4GW4A 3WBDA 5GRVL 3MO1A 1V05A 2R1XA 4HMCA 2D4FA 4QF1B 4R97C 3MRPB 3QULA 2HFGL 1GJIA 1KYOK 4RX4D 1LP9A 3HFMH 5IUSA 4LFHG 4O9HL 1WGOA 1MCRA 4JDTL 4PJXB 4Q74A 3UO1H 3WSQL 5D5MA 3TZVD 4N9GA 4Y19E 3MLPA 5GJSL 1OCWL 1T83C 4OLVL 5HDBE 2DQIL 4NM4L 5FV2A 3U4BH 1A6WH 1QUNA 5FYKH 2CO6B 5HHXL 3RJDA 5F72S 4PFEA 5I2IA 1N2RB 1EMTH 1M05A 2H41A 5EC1A 5GZOD 1CBVL 3FN9A 3EYFA 2GSIA 4H88H 1E4WH 2VLJE 2FJGB 4JANB 4CNIB 5HGBA 1F4WL 3D3VE 4HAGA 1L6XA 3MV9B 3TA3B 4OCRH 1A1MA 4Y5YB 3SBWC 1CZ8H 1P1ZA 3WS6C 2UZIH 1FO0A 4F57H 1Z9LA 2HT2D 4M5YH 4NQDD 2DBJA 3DRQA 1DN0B 4HW6A 1S7TB 5C07E 3LZFH 4H5SA 2VIRA 1J88A 2P8LA 1SEQL 4L4VB 1D5IL 4OGAC 4H1LA 4EN3D 1WV7T 1Z3GH 4XPHH 5KS9B 2V2TA 5DO2C 5DRWA 2LVCA 2F74B 4JN2A 3PL6B 5AUMB 5KAQG 4K7PL 4JRYE 3RTQD 4LAJH 4NQXA 3L3KB 1J1XH 1IBGH 43CAB 4PJGB 5IEHA 4Y0GA 4ZUUB 4KQ4L 2EYRA 1NBZA 4PB0L 1FNEB 1PQZA 2F5AL 3QG6B 4WO4D 5DD1L 4KKLC 4O9HH 4PJCF 1JGLH 3STZB 1AQDA 1NAMB 3RL2B 1NFKA 4HWNA 4BUGA 4X5WB 3VMNA 3FO2B 3VG9B 5C0IB 4X9BA 5F3BB 4CJ0A 1KJMA 3GHEL 5MEQB 5JOPE 2X4RB 5E6IA 1U3HA 3CVIH 4PUBL 3V0VA 2UWEB 1E4WL 4X7FC 5DGQA 4EI6A 3M17A 3BRDA 2GFBA 3S36X 5FYJE 3B6SA 4TTDD 1Y6KR 3FMGH 3MBEB 3HI1B 3IKCB 4OD1H 3S97C 5E8DL 2WINB 3L5IA 4PG2C 4AEFA 5B38G 1JCKA 2QHRL 1ND0B 3P30L 4PRIB 4TTDC 4TNWK 1KJ2H 5IMOB 2XZAH 4EN3C 3A67H 5E03A 3VFRB 1IGFH 1OAUL 4JDZB 2A1WL 1N0XH 5CILL 4H5SB 4L5FH 1CD1A 3ZHDA 3QDAA 3VMPA 1CFQA 4HQQH 4UB0L 3MC0A 1XR9A 4R2GB 4HJ0D 4PBXA 1UWGH 5T5FH 2VDMH 1RK1B 1NJ9A 5L6YH 5IB5B 4FABL 2DDQH 4XI5D 4QRSA 3UTZB 2ADGA 1WFUA 4GS7B 4F7MA 2FJGA 5C08A 3SJVA 4YFDB 4HGWA 4G80B 2VL4A 3S3JA 1SY6H 4F7CB 2YEZA 4X4YA 4U0QB 5D2LE 4HDIB 3MRNB 1WEJH 1V7MH 3WXVH 1J1OL 2J7LA 2BJMH 1A7OL 3S35L 4JFPB 1KFAL 1KJ3H 3GBLA 4N1CA 4JZJA 1CL7I 2YC1A 1XF1A 3K3QA 1LO5A 4EDWL 5HHPA 2G5BB 5DQDH 4Y4HC 1HOCA 2A6JB 5IBLC 3S36L 4FQCL 3ZYZA 5FGCE 2APTA 4OD1L 1V7NH 3DUUA 1GH7A 3DXAB 2BOCB 3O2DA 4HEPG 5DQJA 4D9LL 3DPBA 3FRPG 3ARFD 3M8OL 4MA1C 4GW5B 1ZHLA 3SGDH 3QIUB 1S9WB 3K1DA 4QHNB 4AEIH 4F7EB 3O3AB 3OJDA 1NEZB 1LE9A 1EUTA 1NBQA 1XGQB 2C3GA 1HSAA 4PG2A 5FYJH 3VFUB 5KSUA 5ESQA 1FRGH 3CPLA 2C3VB 1KCSH 2PR4H 3R06B 3EDDA 3EDKA 4YX2H 2Q20A 4OCYH 4FABH 2X9XA 1O5DT 3QXAB 1YNTB 2DYPD 3P11H 4JB9L 4YHIB 4Q6IC 2W60A 3ILQC 4JZNA 1NKRA 1CFVL 3G5YB 1KTKE 5T3ZE 5MENA 1RU9H 4WJ5A 3GBML 2LU4A 4M4PA 2DMKA 1C1EL 1I7ZA 1K2DB 1NSNH 5HYJE 5AZ2H 3RWIB 1ETZA 4XZUB 2IPUG 1KPRB 1V7ML 3G5XB 5EU5A 2DQFB 3TVMD 1ZV5A 1YQ2A 4TVPE 4KJWC 1RK0A 1TJIH 4UNVA 4LVOC 5F7EH 4QNPF 1KCRL 5CIPB 2R0KH 1VFBB 4QRUB 5DURD 2DQEH 1WWWX 1DQLH 4NRXA 1S3KH 4YHNA 1RMFL 3K8LA 5DD0L 1B4RA 4OUOA 1QA9B 2VLME 5BO1L 1NDMA 1Y0LA 2ADFL 3BPLB 1KC5H 3HRPA 3O3EB 3TC9A 2AI0L 3TIEB 4MMXC 3S3PA 1C5BH 2L7JA 2UUDK 2AEQL 2Z4QA 4MJID 3EDEA 4NJ9H 4YDIL 3WJLC 3D25B 3LKSB 1EAPB 1RUAH 1A22B 4LSQL 5KSUB 4AG4H 4G8GB 3ARDB 3WLBA 1IT9L 5IB4A 4JFYB 1ZT1B 3GO1L 3K2UH 4HK0A 5FO7B 4XTRD 1CQYA 4LCCB 5IKCB 4NHCH 2A0LD 4GW5A 1F4YH 5LG1A 4M02A 4OZ4A 2XACC 2XIDA 2QADB 2BMKA 4FA8A 2IMNA 4IOIA 5CKAA 2BY3A 4XXDA 4HKBB 3ULSA 2APFA 4L8DB 2B5IB 8FABA 3HZKB 1PG7X 4OLUH 1EVTC 4QY8A 4ELMB 4HIIB 3T0WA 3UEZA 2YC1B 4JFPA 3BPNC 1RFDL 1MIEH 2PXYA 2IANA 2NZ9D 5F1NA 5ETUA 1NC2A 4PR5A 2J6EH 3EKCA 2O93L 5C2BH 2DM4A 5ECJE 3BWAA 4JPVH 3QJHB 3LSOB 3RKPA 3LEVL 1KC5L 1DLFH 1NAML 2EDKA 2R15A 2Q6WB 2OR7A 4PJAE 4MHHG 2DICA 2HWZH 4LCWE 3WXWH 4QCIA 3ZDXE 1OLLA 4G8GE 4ZPTB 1OD9A 1BFVH 2ICCA 1GL4B 1GOFA 4JFDE 4F15C 2R69L 2MKLC 1F6LL 4U6TA 2AXGA 3MGTA 5C3LD 1NUDA 1T3FA 3H9SD 2C4XA 1RJCA 2NX5A 1D9KC 2VLKD 1ND0A 5GS2D 2VERN 2IQAA 2EDEA 2ZJSL 3SDDB 3U2SB 1MHCA 5H37H 4XCNB 1KENL 2E27H 2PYEB 2R1WB 2ZP0T 3NIGF 4WI3A 1TZIB 2DOCA 4YDJA 3TF7C 5EIIB 1AC6A 5HJ3A 3RGVB 5GS0H 4Z78A 4ODSL 2CLVA 1RURH 3HI5L 4YK4C 2MHAA 5I0DA 1RZJH 2CKBA 3L6FA 3DO3A 1FVEA 4MQXC 3LN4A 4TRPH 4FRWA 4X6EA 5DJCA 2W0FB 2VXVL 3BDXA 5JHDE 1I8IA 3LD8B 3LRSA 5DJ8A 4PRAA 4WW2A 5J11C 1RIUL 3P0YL 2L4OA 3O9WB 1YY9C 3ILPB 4TVPD 5BVPH 4XVUC 1J0HA 1JNHA 3HG1D 4LQFH 1GYAA 1ERNA 3BZFA 1MJJA 3NAAH 4ZTPH 4FXKB 1QSFD 2BVQA 1G6RB 2G60L 3V4PH 4FZ8H 4LSVH 2F15A 2LVEA 3FTGB 1A6VL 1QFWI 2E7LA 4HXBL 3U79A 4L4JA 4HKXB 1E6OH 2NZIA 2HTLC 2QSVA 3O4LB 1N6VA 5GS3A 5BMFH 2NXZC 5CJXA 1DVFC 4Z7WE 3BD3A 1ADQL 3VWJB 1BFVL 3TPKA 3DX8A 3PWPD 1IL1B 4Q9BA 5C9JB 1HEZB 1DQML 1BBDL 4V1DE 2VR4A 4PJ8B 4RNRA 2W9DH 4FMKA 1T1WB 2DKSA 2X4QA 5C70A 4D0BB 2JJVA 3KDMB 3QWRD 4FQLL 4BSWA 5TE4L 2EH8L 3LN5A 4XVTL 5TDOB 2PN5A 4RGOH 7FABH 3U0PA 2GSIB 2BFVL 4OFIA 1S78D 4OI9A 2EDNA 5JIHA 5GSRB 3RWFA 3T77A 3X3FL 1AY1L 2XKNB 3NCYS 4QHKI 4TRPL 1Y6MR 4Q0XH 1GPOH 5L2KE 3D85D 3H0TB 3QEGL 2B2XL 3H6JA 2NTFB 3GMRB 5T3ZH 2GJ6B 5DK2A 3DUSB 3P0YH 4OJFH 4U49A 3EFFB 1IVLA 3GIVB 3FQWB 2IBZY 2HA1A 2JLLA 1VESA 3HE7D 3QUMH 4JO4H 4QOKE 3QXVA 4ZOEA 1D5MA 1WF5A 3MOAL 4JN1L 1IGCH 2G9HB 2HN7B 4Q9QL 5ESAB 3FT3A 4OB5L 1DVFA 4LKCB 3VMOA 1J0ZA 4X6CF 1OWWA 2RAMA 4D9QE 3DMMA 4PV8A 1X5XA 3BGFC 3OGOE 4HIJB 5BRZB 4HWBL 5DJ2A 1NBVL 4IMLB 4UDTB 3ZE0F 4EBQL 3QPQD 4JZOA 4QHLB 3VFMB 2Y06H 2YWZA 5FUOH 3UTSA 5EWIH 5E6YA 1DVFB 2DF3A 1OHQA 4PP1D 2W9DL 2GT9B 5KSVA 1Q94B 5FHAH 1DBKL 5I66A 1YEGL 2V2WA 1ONQA 1KBGH 3HS0B 3IFLL 1AD0B 3TT3H 2GAZB 4OFKA 1FZKB 3F12B 2XTJD 4UILL 3MRKB 3SGJC 5JLZA 3JV4A 5L7XL 3EYSL 1FL6A 4IDJL 5IWLA 5A3ID 2OL3H 5FYLL 2BSRA 3HAEH 3WLWD 5JW4R 3VXUA 1OQOA 3LIZL 3FRUB 2G75A 2GY7B 3HZMA 1AIFB 3UAJD 3GJFB 2XV6B 2QKIB 1CIUA 2VQTA 3FONA 1B0RB 3QZWG 4L9LC 3X3GH 1MLBA 5TDPB 3STBA 3MOAH 3B5HA 5IVOA 4JDTH 4GFTB 4FFYH 4P3WA 2Y23A 3VXUD 2IAMD 2UWEF 1F3JA 4NNXB 2R2HB 4BFIA 4NM4H 2ZUYA 1MFBL 4EUPA 1H5BA 4ZS7L 1IKFH 1TCMA 1QRNE 1YMMA 3B83A 1KEML 5BZDA 4FS0A 4N1EA 1U8PB 1OAQH 4N9OB 4OAWA 2E3VA 4E42B 1U93A 2VL5A 3BYTA 1OB1A 2VISA 4LLQB 3DMMC 1LEIA 3PV6B 2PYFB 2ICWI 1HCVA 5HHOE 1YEIL 1AJ7H 3OKMB 5KTEL 4UU9B 5JR1L 1L7IL 2XOTA 4FQ1L 3BO8A 4PJBB 4YHOL 5ANMA 3GGWB 2EO9A 1T7WA 1HHKA 3MRHB 3O6FB 5J56B 5C0RH 4NGHH 4FFWC 3H9ZA 4U1GC 3I84A 5FYKD 4L29A 3QRFM 3PJSB 4O2FA 1DE4B 1MWAA 3HE6B 3NZHH 3ECBB 5FK9A 2EEBA 3BD5A 4EXPX 2YPKB 4BZ1L 2R1YB 3W0WB 3QHZH 5DD1H 4ISVB 2V5SA 2HTKC 1JGLL 4P46D 1Y18A 1BJ1H 2B39A 3BQUB 3AC0A 1TPXB 4NOFA 4MAUH 2VSDA 3O2VL 3HE7B 5CHNA 1FP5A 3WEXB 2AV1B 4X7TB 1KF9B 5EOQH 3IDXL 1RPQA 3U7WL 1F5WA 3HMXH 3IGAB 4YHPB 3UJJL 2SEBB 2P4AB 3GMPB 4G8FB 1ZWIA 4Z7OF 3GMPA 3BGMA 1W8OA 3TZVB 5HVFB 4PJ9D 3FMGL 4YAQB 3O0RL 1Q9WA 5JO5A 3T1FA 4JY5L 4JR9H 1T5XB 3BYYA 4XTRC 3SKJH 3WJLA 5SWZE 4KDVA 1K9TA 5DJAA 5C0BA 4R2GC 4ODWA 3TJHD 3P30H 3PWPA 5EU7E 3IYLW 3MCKB 5I8EA 5HHVL 5IBUG 3AXLB 4LCYA 3VFNB 1G7HA 4LHQB 5DD6B 5CILH 3WFEL 4JCLA 1S8DA 4XNUH 5EFIB 4RFEA 4P4KD 4HK3N 1E0OB 5I8KL 3GIZH 5J1AA 5L8KB 5LWYH 4YGAB 3MFGB 4QY8B 4XP9L 5E00A 4Y16D 2QSCH 2ICWJ 2OTUA 4WUUA 3Q6FB 1OSZA 4JHBA 5HGHB 3L3JA 4D0CA 1NMCB 4I48A 1FAIL 3QHZL 3RZCB 1BM3L 3CSPA 2PO6B 1B3JA 3LY6A 1QFWH 1SY6L 1JUFA 3TWCH 4NM8H 2X4NB 1XGPA 4Z7VE 3WIFB 3OHXA 3AFLA 5DJ0B 4KJWD 2BJML 1U8QB 3VFTA 3V2AR 4JFEB 3QQ4A 1XF5A 5IW3A 5T1DL 1E6JH 3T4AB 4YFLF 3ZKQD 4UQ3B 3BRGC 3F6LA 4NPYB 2WMPA 5MENE 3SGKC 4MQ7A 4PRBB 3MLUL 3D0LA 3NFSL 4ZS6D 2M26A 4OZHF 1PW3A 4FFVC 3T2PA 1JN6B 5HDQH 1NDMB 2EECA 4QT5A 1T6WA 1J5OH 4JFFA 5EU7C 2VC2H 1T1YB 1B6UA 3UMTA 1G9NL 3QBTB 4PYHA 3B9KC 3EDFA 4D8PB 3EO1B 3GMLB 4ZUSA 1R3LA 3LMJL 4M6AA 3VD5A 3NIFF 5FYJL 2BRRH 4OCXH 4JHWH 2FJHA 3EOBA 1KXTB 3HR5B 3LQAL 4M1CC 1MF2H 4RGND 5GJTL 5B38A 5ICZB 5DHYA 2X09A 1WCQA 4OCYL 4Q9RH 2NY6C 3VD9A 2FL5B 4XVJL 1MCCA 1YMMD 2LU7A 5KANG 5GZNC 4JRWA 3QEUA 2BC4A 1FL6B 1KTLA 3MXVH 1OW0A 4MAYD 1C12B 3BGAA 2VXUL 2EZ0D 3S6CA 1RJYA 3F6IA 4AQ1B 4Y16B 2GT9A 3O9WD 5BOZG 5IFHL 1TXKA 4KUCD 1PZ5B 5F7EL 2GK0A 1GC1L 2HG5B 4M00A 1A02N 1OLZA 1LE9B 2XZZA 1YZZA 3BPLC 2Q76A 3GSUA 5IB3A 1J18A 3V5KB 4IMLA 3CAFA 4E41E 1CICC 3L3JB 4D0CB 4F7EA 5CJ8A 2VN7A 5EUOE 1YPZA 3IFOB 1P5UA 5SWQA 3SCMA 5C0BE 1OPGH 4LKCA 4YHZH 1ITCA 1DCLA 1UEYA 4PJ9B 1I3GL 4MQ7B 4XAWH 3FO9A 3IDNB 4MVBC 1F8TL 2I60L 3QO1A 1KCUH 5I1CH 1FIEA 3WS3B 1BQLL 1I1AD 2BRRL 2WIIB 4OCWL 5C8JB 1HKFA 4MJ6B 3LQAH 2VDKH 4Y4FB 1JZ8A 3B9KB 3I9GL 1WBYB 3P4NB 5FKAA 4W4OC 1JPSL 4P4KB 1X5KA 3CLEH 5KSAA 3JVGA 1QYGH 4NNPL 3RDTB 2J8UE 1FN4B 4F3FB 4MA3B 3WFHB 1F6FB 3IGAA 3CFJB 5E1AA 1MHHA 3TO4D 5ICYA 2YD2A 3PQYA 4PJDA 1TDQA 5D7SL 3L3IA 3SDAD 1UM4H 2DD8H 3HE7A 4OGYH 5MERB 1B0WA 3DSFL 5DJZA 5FYJU 1L0YA 5MERA 5E2TL 1MPAH 4MAYA 4RDQG 2YPLB 4GRLA 4PJHF 5FHBL 2BVPB 1RZKC 3INUL 2BVPA 4M7JH 2YPKA 3MCKA 5I8EB 1NCAL 3V0WL 3VWJA 5FK9B 4R7NB 1J8HA 1MCOH 1R3IH 1BFSA 2Q7NA 4DKEH 3ZYOA 1I4FA 1MCPH 2EICA 4R0LC 1CLYL 5J0BA 3EYQD 1LO2H 4XCYA 3RHWK 2Y9RT 4PJEB 4F15B 4NQEB 1I3GH 5HYSA 1NGYA 4PGBB 1TTFA 2NTSP 2ZOLB 3GBNH 3QO0A 4YHPA 1HH6B 5C71A 3DX9B 2X4RA 3ALPA 2NNAB 1MQ8A 4WW2B 3H9HA 5T33L 2IPKA 3SDDC 3TA3C 4PJ9C 3DARA 4G8IA 3C8HA 1HHGB 4AMKL 5DR5L 4J3OC 5ICXB 4OF6A 2DB8A 4NHUA 3C60A 1AQDB 1WIOA 5I1EL 1LO0H 3HPLB 2AXJA 1JHTA 4GAFB 4HS3A 1BOGB 4Z7VF 5FYLE 1BLNB 1FDLL 1NBZB 5MEOB 1B4JH 3QPQC 4ONHA 1TVHA 3U0WL 1YMMB 4NQCB 2X70B 3U36B 3TFKD 3BN9D 3OJMB 5TGBA 2ATKA 4MNHA 2OP4H 4OGYL 5HVWA 4X6DA 2D7TL 1J87A 4YIQA 4HFWB 2YK1H 4F80A 1MI5E 2GYSA 2Q3AA 5GS1A 1PYWA 2VXVH 2C4FU 1MRDH 2EDXA 1FVDB 1T1ZA 1RJLB 2IAMB 3MLYH 4KH2A 1MCOL 5DRNB 3SPVB 4ZTOL 1FLTX 3QFDA 2B0SL 3QUZC 1I7TA 1JMZA 2X4SB 5EC2B 1N7ML 4M6NH 5D2NE 2Q86B 2Q3ZA 5TFSH 2X7LB 3W9EA 4XMLH 3F12A 4Y5XC 3FFCE 4JAMB 3RWDB 3QT2A 4ODUB 3V6OE 1OOAA 2JJUA 5DHYB 4PJ5B 3D0VA 1M7XA 4HS6B 4JM2B 3EOBB 4JFFB 4E41D 1MHPH 2VZOA 1A1OA 2BERA 1X5FA 5FDWA 3L7EB 3EIFA 1BGXH 3KPNB 1CFNA 1U3HD 3TYFA 2QKIA 3GI8L 4PRHE 5F7UA 2YRLA 1FGVH 1J11A 3HTLX 4IIQC 3JUYA 4PJ7E 2P42B 2FR4A 4NWTH 1Q38A 1TQBB 3MROA 1VSCA 3QYCA 4MCYB 5CP3A 5JIPA 3OPZH 1RUKL 4P5KB 1RZKH 2BSRB 3TO4B 4R7DB 2VITB 1G7PB 3IF1B 1A1NA 4HGMA 2AJXH 2AJUL 3M1BA 5E2VH 1KB9J 4LARH 5SV4A 5T3ZL 3WN5A 2CH8A 5ILTH 4OJFL 2GW5A 2NTFA 4KHXL 5SV3A 2JCCB 3HFML 2B0SH 2Z93B 3I02A 4MJ4A 4XCFL 5HBBA 1MJUL 2HKHH 5K9JL 3WKNA 2HLFD 4EN3A 4HC1H 1KNOA 5GJSH 3OR7A 2VDOH 3E3QE 3HPJA 1IEHA 4NC0B 3F58L 1RUPH 2DI9A 4YXLH 5K9KA 3MRLB 2NY5C 4NQDA 4HF5L 3WUZA 25C8L 5J9PB 5CIPH 4PJ5E 5CIPA 1Q8MA 3DVFA 3BESR 1F6AA 2IMMA 2XG4A 3FT3B 5J1AB 4L8CA 5EO9A 3R8QA 4XNMB 4JO1H 3GSQB 5FHAL 1AI1H 3D69B 1V3JA 2AK4A 3DUSA 3VFGL 4PJ7B 4N0FB 2CK2A 4UILH 1SMOA 1YEKL 2MQ0A 5DRXB 4PLJC 4OZIF 3NABH 1S7WA 5GRZA 4P9HC 3FOMA 4ZDHB 3BSZL 1I7UA 2Q8AH 5T5NF 1KPVA 4RFOL 5FECA 2BVQB 2EC9U 3UP1A 1IGMH 4LRNH 1EIBA 3BZFB 5B4MD 4OGXH 3PABB 4HBCL 3QEQD 1I9JH 4ZPVA 2SEBA 1Q9KB 4MDJB 3F7VA 5HHMB 3SE9H 3QDMD 1J1XL 1IBGL 2EH7H 2ADJB 1CI5A 3DVGB 2BVOB 2X41A 1TVDA 2EZ0C 2KH2B 4OV6F 4D0DB 4BZ2H 1QKZL 4GH7B 1Y18B 4IRSA 4M93B 3LVEA 4AIXA 2R2CA 3RVWC 4HAFA 2PTUA 1R24A 4KXZI 5JXAH 4U1MA 4XCEA 5B8CB 2MTPA 3RNQA 4FTVE 3LHPL 3MV7A 3VWKB 2F58H 5EORH 3PHSA 3OF6A 5F6HJ 4JO1L 1MJJB 4YDKL 2ICEB 4NT6A 5FUZL 2AXGB 1BWMA 1T7ZA 3GDBA 5L8LB 3KR3H 5CJOL 3UYRH 1YEIH 3G5VA 3OKKB 4L3AA 4JGUA 1RZ8B 1ADQA 1U8PA 4NO3B 2BRQA 3ZKNC 4UQ2A 3FB6A 3SBWA 3WS6A 3QXUA 3MV8A 4YHOH 1S7UB 4GBXA 4XC1H 5IG7B 5JNYA 5L2JB 2ITDB 3E8UH 3QA3B 1DEEB 4ELKB 4IMKC 3OXSB 3QA3A 2VL5B 4UB0H 2CLVB 3W11D 5FYLD 3TT1H 3VE0A 2XRAL 1DUZB 4OF7A 3SE9L 4XPBL 4OQTL 1CR9H 5L88L 5D6CA 1BD2D 1AR2A 1OWRM 2IQAB 2ZUTA 2XWTB 5CGYC 3SOBH 1JPST 3I6GB 1F4XL 2DL9A 3UTTD 1P6FA 3OGCB 3QI9A 4KDTC 5C08D 1IAIH 3WNPA 2XPGA 3I2CL 2CDFB 1MRFH 3CCHA 5BJTB 3ULUD 4M9OA 5LQBL 5AAMA 1A3QA 5I9QC 3WFBL 4DZ8A 2R56L 4OF5A 4OZFG 1CE6B 2GCYB 5LAXA 1YA5A 5D7JA 3OZ9H 1KUMA 1MUJB 3QQ3A 4D0DA 2D03H 4JY5H 2EIZB 4EUPG 5F1IA 5GRUH 2AK4E 3KR3L 4LHUA 5ADPL 5I30L 1QBLH 3W5MA 3UXFA 3O45A 2OJZL 1FHGA 4Y8AA 2Z4QB 5I71C 1Q9KA 5IFJB 1OP3H 1A9EB 4XNUL 3F62A 5ALCL 4U3CA 4Z76A 1EUUA 2VUOA 5JOFA 2AVGA 3RWEB 3VRIB 4J2XA 1KCLA 1IMHC 5DO2D 4XHQA 3Q1SL 1M7DB 3V6ZB 1T6VN 1G7LB 1CR9L 2EXWC 3SDAB 3KPOA 4YBLC 3TH3T 4C55A 5B21A 3RGVC 5J3HD 3VDAA 3T2NH 4ZUWA 3SOBL 2CLRB 2DQDH 5K93A 3G6DL 4GRLC 3K46A 5KZCD 4NM8L 3HZYA 3KAAA 2R23A 4JFYA 4FXLA 5BS0A 2CDEA 5D72L 3ARDA 4CVUA 4JFFE 1JRHI 1IAIL 2CRYA 2O5ZH 4LQ1A 3HE6D 3G5XA 3RWFB 1NFDA 3KLAB 5DMGC 4Y19D 1YNLL 3TNNB 3WIIH 3GSNA 3W0WD 3ZTNH 3RVTD 4X6CA 4QRRD 1ZT7A 3AGVA 3GK8L 1GGTA 3KDMA 1N2RA 1BOYA 3TIDA 1RMFH 3U0PB 5IGXH 5D93C 2HTLD 3AS1A 5ITBH 2H2PD 3KYKL 4HPOH 3N1QC 4F9LA 2ADFH 1MAJA 1NLBL 4WHDA 5E4EC 3IB4A 4FG6D 4X6CE 3VXMD 3GEWB 1FNGA 4Y89A 5EZLA 1C5BL 3QULB 4MXQC 3Q48A 1ZA3B 3B9EA 2AEQH 2KKQA 2Z8SA 3R4DA 3K81A 5FM5M 3PV7A 3O8XB 3QCUH 3P9MB 1MF2L 5C9JA 1EHLH 1WIPA 4FTVD 1IT9H 1KT2B 2HKFL 5ALBH 4IHOA 5J3HC 2D7NA 4UV4L 5KW9H 1P53A 2V7HA 4OLZL 1JZ4A 2J4WL 4LCIL 4G9FD 3AM8A 3IU4L 4LLYB 1OT2A 1F58H 3L7EA 1YEDA 1X4ZA 2RR3A 1SYVB 3TCLB 1UM6H 2R29H 5DJ8B 3MR9A 1T04A 2V7NB 3BDYH 3BZDA 5E95B 4JKLA 5I0ZA 2Z35A 2OL3B 3ARBA 3W39B 2CKBB 3BRFA 3R06A 5HHQA 3KXFA 3NIDE 5D1XA 4Z5RB 3OKDA 5HI3C 4NSKA 5KN5A 4O2CB 2Q86A 2J8UA 3BKJH 1S7VA 3GJFH 3CCHB 3HC0B 4R8WH 3GK8H 4X6EB 4YDJB 5DJCB 4JCMA 4DVRL 4A2MA 1EGJA 2VJXA 1VPOL 3E6FA 4GKZA 3IAGC 1HINH 2E9JA 2IPTH 1INEH 4RISH 1KEGL 2A83B 4OCMC 5ITBL 4KGLA 4Z7UE 3RVWD 3BGFB 3LEVH 1JF1B 4PGZA 4FXGA 3ARBD 2Q8BL 2I60H 4S1QL 2WUBL 2XZCL 5CLWA 2H9GB 4PJBF 3JVGC 1MCIA 2GUOA 1I1AC 2R69H 2VDKL 3MRRA 5J6GB 3PDDA 4K2UH 3I9GH 2VSCA 3MRNA 5T3XL 1JPSH 4Q2ZA 1JGUL 2CIKA 4HT1H 4IIQA 4D3CH 3AS2A 5J06A 1JF1A 1BAFL 1OAKL 1G7MB 2J8UB 2E5EA 5SX4H 1OQXA 1BOGA 3G5VB 1KENH 5E6IB 2Q6WA 5A2JH 3P4OA 1WFTA 4NQUA 1Z2KA 1K6QH 2IGFH 1K8DA 2VYRE 5GS0L 3QJHA 3U7YH 4UI2A 1RZ7L 1KLGA 3RIFF 4U6HB 1EFXA 1NDGA 3FB8B 4O58H 5ESVB 1RZJL 4N8CL 1WISA 1JGDB 4A6YA 2JJSA 3OKDB 4WO4B 4WI2A 3NH7L 2DKUA 2R0ZL 4L9LB 2WZPD 5DD5H 3CMGA 2VDPH 1CXLA 4UT7H 1JPGA 4NYLA 4PJDF 4DAGH 1E28B 1U42A 3QDGD 1VPOH 2YPVH 6CGTA 5D1XC 1RIUH 4DOHE 4QRRA 2J8HA 1AE6H 4Y5VC 5IVZA 4HWBA 4NRZA 5IHUH 3V6OA 1MCPL 3VXOA 1AO7D 1X7QB 5FV1L 1DDHA 4N5ED 4HK0B 3F7YB 4FP8H 3KHOA 2VZTA 3ULUC 1A7RH 3IDJB 2IBBA 1UH4A 3R0MA 2GSGA 4I2XE 3EW3B 4X80H 3PP4L 1CLOL 3T3ME 4MDJA 3PGCA 1JJUA 3TM6A 2YPLA 5CMAB 1P7KA 4ZPVB 2NZ9C 3D39A 3D48R 4AMKH 3L3IB 2B1AH 4KRNA 1OM3L 2QQKL 1G7QA 1GZPA 5C9KA 3DRTB 3A6BH 4OUUA 4ZUVA 3MRCA 1OAKH 4YHNB 4F3FA 1NGXA 4BQ6A 1FDLH 2YXFA 2AJ3A 3E1F1 3NCJH 4Y4KA 1CXHA 4M5ZL 3ZYJA 3EOAA 4WEBH 1TJHH 5ISZE 1IC4H 2IBZX 1GGBH 4OF0A 3MYZA 4J1UA 4V2CB 4Y4FA 1FL3B 3JWOL 4Y1AB 1CL7L 2MSPA 4O58L 3CFDA 4N8CH 1AFVH 1ORSB 1TCRA 1MAML 3H3PH 1A6ZB 4QTHB 1ZT4B 5GGTA 3SQOH 3O6LL 4JRXE 3GKWH 1PY4A 4C56A 2NY1D 4I0KA 4KUZH 1HXMA 3WYRA 1WIUA 4DOHB 5EIQA 3LPWA 4MNQD 1DQDH 4NFBA 1AE6L 2UVEA 2W60B 2E8ZA 5GRJH 3QIBC 4ZUWB 4M1DH 3SCMB 3DJ9A 3IXTB 2BSSB 3EJJX 5DC9B 4NZJA 1AR1C 2B8OT 1M7DA 3ARZA 3V6ZA 1IQDA 5LGHL 4LIQL 3HUJE 1XCQA 4ODVH 2JE8A 4UT6L 4U1HB 2KQNA 2GK0B 4YE4H 1Q1JH 2HH0H 3OMZA 3VD4A 3MLVH 4UIMB 5CJ5A 3P4LA 1JTTA 3MLRL 3NCMA 4X4ZA 3X11A 5DZNA 3CXDL 1BD2A 5TH2B 3VGFA 5HYSG 2R4SL 4FNLL 3V5DA 2EDOA 3V4UL 4K3DL 1R3HA 5KVDL 1P4LA 4HUVB 4IS6A 2RBLA 3ARFC 3FQTA 3RHWF 2F53D 2WP3O 1CZ8L 5TPWH 4DKDC 2Y5EA 5LBSH 5CD3A 2A77L 1WZ1L 5IVZB 4LSTH 1UCBH 4XNQA 1DBAL 3OG4B 3D3VB 2CIIB 1FFPB 3T0EB 1J0YA 3QI9B 1EEUA 3B2UC 3X12B 5L8JB 3BKML 3IKKA 3MUJA 3RP1A 1JNJA 2D0HA 1ZTXH 3KWWA 3UROR 3ES6A 3SQOL 2DJUA 3S9DB 1MJ8L 4XP6L 4HDIA 1SQ2N 1M1SA 3GRWA 4L8SA 4M7KL 3ZHKA 2NXYB 2DL2A 1TZHA 4KDTA 3LKOA 2EE3A 1UJTA 5C08B 1IFHH 1KULA 2DM3A 2CLZA 5LAXB 3RJQB 3CDGB 1KLUA 2HT3C 1ZLUK 4F7PB 1WTLA