3JWDH

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 29
structure length 220
sequence length 220
chains with identical sequence P
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwdH01
2VDLL 2O5YH 4N0FA 4R90L 5F9OH 2O93L 3BJ91 3RPIA 1MQKL 2AEPL 4QHLA 4QRPB 4ETQB 3KPNB 1OM3L 1IGTB 2BC4A 1T0MA 4MA1B 4M1CD 3TV3L 5DWUL 4Y4FD 4WWID 4MJ6B 3HNTH 3OX8A 5EOTB 3K4AA 3VG9C 1NMAL 3VXUB 3NN8A 5B38G 1T89A 2Z31D 3S4SA 3ARDA 1NC2B 4JHWL 3O4LD 4KTEH 3V6BR 2AS5M 1J11A 2EYRB 3T2NH 4X8JA 1B6UA 4QRRE 3H9SD 2B7DT 3NFPB 5MERA 5IB4B 1S9XA 4WWKC 1Z2KA 3GK8H 4BQBA 3FTGA 5FOBB 5I75B 4KQ4H 4X6CE 3IDMB 3FN0L 1JTPA 2F54E 3W5MA 3MZGB 4NQSB 4NDMB 2MFNA 3AY4A 4OFPA 4UIMA 3C09C 4PREA 4Q6IC 3C60A 4V1DD 4DK3A 5JOEA 3L3OB 3BP4B 1TVDA 4XVUD 3OAUH 3NCYP 1U3HC 5AD0B 3O41B 1MEXL 1MVFA 1T20A 3HCVA 5F96L 4RWYL 3V79C 1RURH 3OMZA 2F5AL 4MLSA 5F88A 3RGVB 1K8DB 1HKLL 3QHTC 4JDTH 5ALBL 3WO4C 5CBAA 4U7MA 3ALPA 3ARUA 1O7SA 4LHQB 1HOCA 2NY7H 2ARJB 2HFGL 2X89A 4FXLA 4YC2B 2EIEA 1NC4B 2V2TA 4X7TB 2R1WA 3TYGL 2C7UB 1WVZA 4P2RE 4HPYL 1G6RA 3QFDA 3BSZH 5I1JL 1ZLVH 1FH5L 3WFEH 4B7IA 2BNUB 3PP3H 5F7KC 3Q3GB 1NBYB 5JA9A 2Q20A 4WRLA 3AMLA 2Q7YA 5FYJH 1II4E 3HG1A 5F7FA 3HC3L 5HYJB 3F12A 3V0WL 4JFHD 1X5KA 2I9LB 4QXUL 3AM8C 3K46A 4UTAH 2VITA 1WGOA 2P7TA 1T1WA 5DJAA 4OM1H 1JGEA 4RRPA 5DD1L 3GSVB 5TDOB 1G6RH 2BCKA 2VL5A 2YPLD 2NXZC 3LQAH 1VGKB 1I1AA 3UTSB 4MAYD 5AYUL 2E8ZA 5KN5A 3H9ZA 3BMVA 4OV6F 4EN3D 3ARTA 3B5GA 1GGUA 2NY6B 5DD3L 1VA9A 4O5LL 5HHOA 5K9KB 1NLBL 4QOKA 4OZ4A 4H8WC 1EO7A 2QTEA 1T03H 1EBAA 3MRNA 4ZDHB 3HR6A 4DVRH 1F2QA 2A9ML 1A7BA 2X4TA 1UADC 2XG5A 2W65A 2FWOA 1WIUA 4ONGH 5KOMC 3IJSB 3DVFA 5DUPL 2BSRA 5J3HC 1KJMA 4AQOA 3VXNB 2DLEA 4R7DB 1J8HA 4XWOC 1U91B 3L3HA 1CG9A 2AK4E 2ZCHH 3KNBB 4NJ9H 3QCTH 4LKCA 4PLKD 1WBZB 2YMXH 2YD1A 4JO3L 4AYFA 3KJ6L 4MMZC 5LWYL 4NUJB 4I5BA 1A9BB 2EDXA 4IIQB 4BH8B 3QFJD 4HK3J 5DMJB 2AEQL 3TVMA 1CLZH 1R5IB 5F71A 3D18A 3FHQA 3SDXE 3U4AA 2OP4L 2LTQC 5E2JA 4HV8B 4POYA 4R7NA 4M6OL 3V6OC 5BRZE 4K8RD 1RULL 5I1IH 5ID0A 3QI9A 1YMMB 3LEXB 1QRNA 3D85B 3EUUA 2IBZX 3QH3B 4MXQD 4KXZI 2EO9A 4Y5YA 5FHBH 5KTEH 1OLLA 2NY0C 5IMMB 4GBXC 4EI6A 4NGHL 1OAXL 4WEBL 3OGCB 3EYFA 4X6EB 4UV7H 5SWQA 1WICA 3QIBA 1H3XA 3NZHL 1U8PA 2LE9A 3MGOB 3SKMA 1VESA 1MCRA 1IBGL 1I1YB 4NKOA 2GFBA 1GAFH 3CX2A 1Q1JL 1MFAL 2EE6A 5C08E 2H41A 4MXVE 3QISA 2A6KA 4X6DA 5E4EC 1YQ2A 1FSKB 1UM4L 3P30L 1CTOA 2VC2L 2X5PA 3BE1H 3QAZC 1JGDA 2VMFA 3T77A 5ACZB 1A5FL 1FC2D 1MF2L 2XA8L 4PJEA 3MACL 3O9WD 2R0KL 2MQ0A 3MLSL 5J9PB 3RIAK 3HNVH 2J5LB 4N8VB 2XT1B 4ENEC 5KSAC 2PETA 4XNQA 1JNNH 5C0JA 4GMSL 4FFZH 2ZZUT 4QHNB 4P4KA 1S7SB 2IALB 3QO1A 4G6JL 4PJHA 4JQXA 3DX6B 2ZP0T 2BVQB 4KK5D 5LCVL 4F2MA 2IG2H 2CDGA 5IP4A 5D6DA 3PP4L 4KHXL 4GSDH 4L1HA 4JRXE 4P5TB 1T22B 5E9DA 4LEOA 3GJFA 3V95A 3PHOB 3PWPE 3SDCA 1QFWH 4NKDA 1MRCH 1ZHLA 2V9QA 2NY1C 4HK0B 4DUXA 4QNPE 4JM2D 5BVJA 3PNWB 1CGUA 4X7SL 2YBRA 1L0QA 4P3DA 2IH3A 4DGYL 4HG4K 4KI5D 5DF0A 4JFPA 3ZO0A 4BQ6A 4ZFOL 5IQ9B 3RZCD 1KN2L 3TC9A 2M2DA 1BFOA 3SE3A 4K8RL 3CZFB 4HUNB 1OF2B 3T1FA 4H0IA 5EUOF 1FO0A 3FB6A 2VO5A 3QRGL 4Q58C 4FQQA 5D1XB 1TTFA 3IFNL 1AGDB 2APBA 2VLJA 4HWBH 4KU1A 2FCBA 2A9NL 3GBMH 4WFHD 3TO4A 4XVTH 2MCPL 1UWEH 2R69L 1YECH 1VADB 1JNHA 4RGNC 4Y4KD 2A6IB 4KMTL 4M43H 1B0RA 2R1YB 3GMLA 4WHTB 3QEHB 4F7TA 2XN9A 1T5WA 3O3BA 4XMLH 1BOGB 5BXFA 1C7TA 3VXRB 4OCYL 1Z5LA 5FGSA 4ZFFA 1IGIH 5FM5O 5C0DA 1V8HA 1GPOL 3HC4L 2VWEC 1OP5H 2VR9A 1Y0LB 4L3CA 3P0VH 4JJ5B 2B2XL 2APTA 4K9EL 1RZFL 5JW3L 3NFNA 5DRNA 4ZS6D 1LEGB 3CLEL 4YWGL 4X4XB 2DRUA 2VDQL 2WIMA 1WBYB 1HH6B 1Y6NR 4W6YB 1EJOH 4WENB 3S37H 3FMGH 3EOAA 3N0PB 4NQDA 1K4DB 2QSQA 2P5EA 1IEBB 4QO1A 4KJWD 1RFDL 5HBBA 5T3XE 4X99B 3CDFA 3PXJA 1P4LB 3I3BA 4TNVK 4QT5A 1NBVH 5AZEH 4KQ3L 3WDIA 1KCSH 1K85A 3LN5A 1A6VH 4KUZL 3RWGA 4HJGA 4WHDA 1BBDL 1DBKL 1GGCH 3D39E 3JTTA 4KKCC 2VQUA 4NP4H 5FKPB 1IZKA 4ZNCD 4ZOCA 5JIIA 5IWLC 3PGCA 2HP4A 5D70H 3MA7A 1GXEA 5EO9A 5HYQA 4PD4K 5C0AD 1JZ2A 1UH3A 4ODWB 1ZVYA 4TOYL 4Y4HC 4L4VE 1YN7B 5C0CB 5I8KL 1PLGL 3C5ZA 2FSEA 2H26A 3BOVA 5D7LA 2K9UA 1AE6L 5D1ZA 1M7DA 1QR1A 5HGAA 1CFNB 2UUDH 4NM4L 4GAGL 3S7GA 3MBEB 3MRLA 4U3CA 1NCWL 3BGMA 1S9YB 2DQGH 4JRYB 4UAOB 2ICEB 2QQKL 4YGVB 4HWEH 1BZ9A 5I17B 2QLVB 1T7XA 2JJSC 5GGTA 3GSNB 2XNAB 4EI5A 3BUTA 5EULV 4L3EA 2WIIA 2R0WL 4M62H 2AJUL 2R4RH 4HKJA 4FQXC 2CH8A 3CVHA 3DRTA 2PYFB 4RA3A 4NFCA 3T65A 2JJTC 2EC9T 1A7QL 3CUPA 5DRZB 3FQXA 5B39A 5L0QC 1GRWA 3L5WB 4TULH 1UXSB 4GAYB 3KS0J 4HH9B 3KJ4B 4NO0A 1Z9LA 2BNRD 5DS8A 2AJVL 2EIDA 4AIZB 3ZE0F 1QLRB 2SEBA 1DL7H 1ZS8A 5GGTH 4M4PA 3SY0A 3VRLE 1DEEA 2EDEA 4LGRB 4KRNA 5HY9B 3GMPB 5SWSD 4XI5D 1ZHNA 3AAZA 1BLNB 4HJJL 1VEPA 3O4OC 3CVHH 4O2FA 3TT3H 5JW4Q 3MRQA 4YDJA 5CD3B 3BWAA 5DJXB 1KCVH 4JKPH 3HC0B 3MCLH 4R4ND 5HI3D 2QR0B 5FCUH 4AEFA 4Z7UF 4N0FB 1FORH 4XNZC 3L1OH 3THMH 3HR5B 4YBQC 4I4WA 4N5EC 4PGDA 1TIUA 4TRPL 1U93A 3SCMB 3QJFA 3N85H 4FTVE 5TE6H 2VDRH 4M7LH 3T0ED 3S34H 4RIRB 4G80A 4U1GC 1JFQL 3OX8B 2XY1A 3QIUB 4NBXB 1NCBL 5C9KA 2EE2A 3QIWD 4UTBL 1X5GA 3SKJH 3WFDL 3SBWA 4R2GD 3CK0H 1MAML 4OF7A 1VACA 3UBXI 5JHDD 2GSIB 4LCWE 5MERB 1A6PA 5C0BB 1F00I 1V5JA 2IBGA 4LASH 3FTGB 3QCUH 3STLA 1DVFB 3QUYB 1MCIA 1OOAA 4XMKL 4UIMB 3B8YA 4N5UA 4PREB 3C60B 5H2BB 5EOCH 3MRHA 2DJUA 4N0CC 2EH8L 4ZAKD 4RFNC 3HCVB 1UJTA 1LGVA 3WIHA 4L4TA 4YFLI 4E5XB 4WUKH 5CBAB 4HZLA 3C6LC 4DKEL 1HOCB 3VXOA 4LSQL 2NXYC 4WU7A 4WU5A 4K55A 1R6VA 2V2TB 2R1WB 5ESVB 4HAGA 1LVEA 3ULUH 2FEEL 5K33A 3QUXA 1X9QA 1TMCB 4O2EA 5CP7A 5T1KD 1E0OB 4WTWA 1FG2A 3C2AL 3CXDH 1T04B 2Q7YB 1NMBH 1XF5B 3HG1B 1MPAH 3OKDA 3VGGA 4KRMB 1QACA 4ELMA 5CWSA 3F12B 2G9HB 2HG5A 3MUJA 4WO4A 4C4KO 2XRAH 3U9PH 3CD4A 4KY1H 4QTIH 1UB5A 2WWKT 2H2PC 5T1LD 3RY6A 2VITB 3E6FA 2P7TB 1T1WB 5DJAB 1D9KA 1JGVL 1I8IA 1XIWA 4GXVL 1JGEB 2GQHA 3S98A 2XKSA 1QSED 3I6LE 3QUZA 4JFOA 2BCKB 2VL5B 4M00A 4OQTA 3O6LL 5IM7B 3BP5A 4P9HL 5KN5B 5B3NA 5BW7A 1YPZA 5GZNC 2JTDA 5HHOB 1A6UH 1JI1A 3GMQB 1KT2A 4QOKB 4TYUA 4OZ4B 4YLQT 4MA7H 1NBQA 4HIXL 4KROC 5BQ7B 3ZMRA 5C6TH 2X4TB 3CVIL 4G9FD 1PSKL 5F97E 2X4OA 2W65B 3P4NA 3K3QA 3DUSB 3HMXL 5TDPA 4OQTH 5DJZB 2BSRB 4WV1C 1J8HB 3P40A 4IMLA 3L3HB 1CG9B 3MLYL 4JN1L 1PYWA 2ID5A 4LIQL 2OR9L 4XNMB 4XX1E 2Z31C 2WAHA 4F9PC 4DN4L 5KVFH 5LGJB 2J6EA 1KTRL 2IFFL 3PGFH 4M7KH 2Y1VA 5HYFA 3QXVA 3X3FL 3D18B 4H26A 4ESKA 1KCLA 5I71C 1BFVL 3BD4A 4KMQA 1EFXD 3DTXA 3WUWA 1C5CL 3MYZA 4R7NB 2YA2A 3RVVD 4Z7QE 2CLRA 2D9CA 2MPAH 3MOAH 1UWGH 2ORBH 3QEUB 2QSTA 3RGHA 2HAZA 4JO1L 5E6ZA 5ID0B 4XVUC 4PJGA 4X7DC 1QRNB 4RMQA 3I9GH 1E28A 4PR5A 1MIEL 2J6EH 5HI5D 4LARH 2HVJA 3QXDB 1GJIA 4XHJC 5DGRA 5DMIL 2D9QB 1CXEA 2NZ9C 2FGWL 3WNPA 5GIRA 4RGNE 4LSVL 2C3VA 5BO1L 4F37K 4PJFF 4Z0XA 4ODBD 4W6WB 3QEGL 4EOWL 4KVCH 1KSRA 1C16A 1EMTH 2XV6B 5SWQB 2R29L 3QIBB 1WT5A 5CCKH 1U8PB 3EDJA 3NABL 3IDJB 2B20A 3G6AA 3SKMB 1CGSH 1DFBH 5KVMC 3BQUB 4L8CA 3TPUA 4NKOB 5C7XH 3ARGB 2GFBB 4KDWA 1P5VA 3GB7A 1LP9B 1JV5A 1QPPA 2BFVH 4UOW1 1YEKL 4MD4A 4RSVA 3NH7H 3QPXL 4QY8A 2H6PA 2OTPA 4W70A 5AUMA 4KJYA 5I2IB 5DA0B 3SN6N 3HS0A 3N1PC 1N5AA 3KLDA 3GSQA 1P4BL 5HGBB 5ETUB 5J06A 3T77B 4D0BA 2FEEI 1YNLL 2FEDD 3PHQA 1QBMH 1A7NH 1U8JA 5DUMH 2PYEE 5GPRA 3BGFC 4IDJL 4X0KA 2VXVL 4P0DA 3QUKA 3GI9L 1N26A 2HA1A 4P4KB 4WHYG 2VLRB 3GRWA 3QO1B 5FYJD 2A6JA 4JZNA 4U4BA 1H3GA 1SJHB 3SKNB 3V4UL 5F9JA 4UDTB 3QUML 4UT6L 4F2MB 1SEBB 2CDGB 2D7MA 4WY7H 3MNZA 4LLWA 2NYYD 4PY8I 3P3YA 5J1TC 3GJFB 3VCLA 1BD2B 3A6OA 3SDCB 2D3VA 3BDYL 4NKDB 3T4YA 1ZHLB 4X7CC 3TM6A 2AXGB 2KH2B 3LV3A 4PLKC 4X6FA 2HTLD 3SE8H 1VFUA 3WHE0 4P3DB 4JFPB 1T6VN 2O5YL 3MV8D 1AR1C 1W0WA 3IDUA 4BM7A 1M7IA 1RZGA 5IMOA 1BFOB 5FUCC 4X4MA 1A2YA 3ROLA 1BWMA 5GXBB 1HHGB 4JZOB 4ZSOE 4LAJH 3P4MA 3IDYB 1FO0B 3LQZA 5SWZB 5D7IF 3FB6B 4KAQH 5GS3A 4JHZA 4GH7B 5HHVL 3V0VA 5M95B 1A21A 1F45A 2XTJD 2HFEB 3DROA 2CIKA 3ABZA 3T2NL 1DDHA 1CK0H 4KZDH 1RUPH 4MXQC 3FB7A 5EU6A 4PG9B 4U7KA 2WUCH 4PYHA 2UY6A 4TTGA 1R0AH 1B0RB 4F7TB 2XN9B 5I66A 2V9TA 1T5WB 4JFEE 1A4JA 1AGEA 3O3BB 2I07A 4PP2A 5AZ2H 4UT9H 3DBXB 1EZVX 4TVPE 1FFPA 2HMID 1CDJA 1BECA 3OAUL 1NJ9B 4X98A 1Z5LB 4ZFFB 4PJAB 1YDPA 5C0DB 2XWBA 5F9AC 4JDTL 4APQA 4ZD3L 3NFNB 2ZOKA 4PRBA 4TSCH 5CZKA 4XXCA 1RIVH 3I6GB 4H88H 4QXGH 4BZ2L 2E7LA 2CIIA 4NQDB 1MCBA 3BSZL 2E9BA 4HAFA 3WFEL 4FNLH 1G9NC 3GSXB 5EBMA 3OG4B 1ZT4B 3KYOB 3UPCA 3QG6B 1X4ZA 5CSZB 5BJTA 3RAJH 1XT5A 3RWGB 4HJGB 1MNUH 2Z4QB 2AERT 5TF0A 2JF1A 5D96B 2UZIH 4BJLA 1S7XA 4YHYB 3RGVC 4LSUH 5BV7H 3EGSA 3HHRB 5DZLA 2F53A 2EDNA 5CSBA 4YC2C 1ZANH 2XACC 3OJMB 3TT1H 3LQAL 3PL6B 2GIYA 3JWDH 4YDVA 2C3GA 5H35A 4P59L 4QRUB 3V52H 2NY3C 5CINH 2VDOH 1FGNL 1RVFL 1VENA 1V3MA 2FSEB 1JPSH 2H26B 3H7LA 5D7LB 3RY4A 1XH3A 4P23A 4JM2C 4K3HA 5D1ZB 3L7EB 1M7DB 1UYWL 2LU4A 3R0MA 4MNHA 3TJHD 4Z7VE 1T03L 1X5YA 3FO2A 3RZCC 5T1MB 4DVRL 4N8CH 2XQYG 3U4BH 2CRYA 3MX0A 3U7WH 3EDEA 2Z8VC 3BGMB 1YJDH 3OKNA 4YHKL 3TGXA 2N4IA 4OLZL 5ILTH 3BXNA 3TYFB 2DIJA 5D7JD 4U1KA 4EI5B 1I7UB 4L3EB 2WIIB 4I18A 3JV6B 3SKOA 1R5VA 4HKJB 1XGRA 4ZYKB 1T3FB 1QKZH 2PXYA 2VL4A 3CVHB 3DRTB 5TE4H 1NPUA 3GUTB 4PJ5D 3CUPB 3MGTB 4UIKH 1OTUD 1U8KA 2IAMC 2OYPA 3VXMD 4R9HA 1UJ3C 4NO0B 1MI5A 3WD5H 4PRHA 1DTUA 4HZAA 1GC1L 3SY0B 1JTTA 4LU5L 1ITBB 4KK6D 1IKFL 4WNQA 4JAMA 1F6AB 4I77L 1R3IL 1ZHNB 3AAZB 3BHBA 2OXHA 4ZUUA 1Z3GH 5GRJL 1EHNA 2KBGA 5ECJE 4O2FB 3MRQB 4YDJB 3RWHA 1GZQA 4D3CH 3BWAB 5F7HA 3LKOA 4DGVL 3MRRA 1C5BH 1Z9SA 4HUVB 1H3PL 2A0LD 2VLKD 1M6OA 1PKQB 4YUEL 4FHBD 4H1LG 5D72L 3GMNA 4UV7L 1BM3H 5KS9F 4NQCD 4HPOL 1RIUH 5I9QC 4I4WB 5AAMA 4PGDB 4F8QA 1P9MA 2C3WA 2WK2A 4G8GB 4BA8A 1GAFL 4G80B 3TO2A 4YE4H 5L2KE 1RU9H 1MCEA 2R39A 1WZKA 4H25B 3K80A 1JTOA 4HIEB 2VLJD 5I19H 2NX5D 4ZUWA 2BVOB 1VACB 4YDIH 2Z93B 3VFVA 1MWAH 3VRIB 5ABDE 3JZ7A 4P49A 3STLB 2DF3A 2VQ1A 4JLRA 4HIJA 1MFCL 1NCTA 1DQJB 1QYGH 1P6FA 5FK9A 4B7LA 4LCUA 1IQDA 2W59A 2GJJA 4LPUA 5FYLE 4FABH 1JNNL 4OGZA 1S7RB 4Y5VC 4NFBA 4XZUA 4FFZL 5FOJA 3V6ZA 5DJYA 3BAEH 2FDBP 3VD7A 1IMHC 5SX5H 4U2YA 3RWIA 4L4TB 1XF3B 1NLDL 3UTPE 4KVNH 2DN7A 4BFBD 4KDTC 4OI9A 4U6VH 4WU7B 1FSKC 5EC2B 2E3VA 4WU5B 2XXCB 1S7VA 4LVOB 1F6FB 1JWSB 3DYPA 2E27L 3WIFA 1ES0B 4PS4H 1MVUB 2P5ED 3MUY1 3VFNB 3MLXH 4MDIA 4I3SL 4MD5A 1A3QA 4O2EB 5CP7B 4JPVH 5IQ7H 1FG2B 4JFDB 4CVXA 3OR6B 4ORGA 1R3KB 3FOMA 4ELMB 5CWSB 4PGEA 5IF0A 2HG5B 2A2QT 4WO4B 4AJ0A 3MO1A 4ZG1A 1UB5B 3QHZH 3E6FB 3T08A 1D9KB 4MA8H 3LEYH 3O6FD 3PGDA 2JIXA 3UO1H 4PRAA 4JFOB 4WW2B 4HWBL 1MRFL 2BHYA 5DYOA 2P8MA 2LABA 5DFVD 1KEML 4J3OC 4GW4A 3C5ZD 1OGAA 1WISA 1YPZB 5A1AA 3QXAA 3MV7A 1KT2B 5BS0A 1INDL 4UQ2B 4HUXA 3KLAA 3QDJD 1A7OL 3LHPL 2BJMH 3ZT5A 2YUZA 4ELKA 1E4XH 1CFQA 2X4OB 3DSNA 1CT8A 2Q7NA 3F62A 4PJCE 4F58L 2ZUQB 4PG2C 5DHVA 4DWHA 4IMLB 3CDCA 3VE0A 8CGTA 3LKSA 1S7UA 4PRDA 1PYWB 2HLAA 3VI4F 5JO5A 3QIWC 2XFXB 3ET9F 1EJOL 1EXUB 1Q0XL 3FMGL 5D9SB 4WVRA 1PQZA 1BWWA 1X3DA 2AGJH 3U4EA 3KPSD 4U1JA 5FUCE 4K7PL 1CLYL 1IAIH 1DBBH 3LDBB 4H26B 3DTXB 3WUWB 4G6MH 3G5XA 4DVBA 4PJ8A 5LBSH 1KCSL 3CFBA 5DHVH 2X70A 5CIPB 4XMPH 5L8JB 1A6VL 4YO0A 5GJTL 3L5IA 4LSRL 4PJGB 1E27A 3SE4C 1YNTA 1E6JH 1M4KA 4NHCH 4GT7A 4FZEH 2HVJB 5CUSH 4BELD 4Q9QH 3W9EA 2FLBT 5KZCD 3D3VE 5GIRB 1G7JA 3C08L 2C3VB 4FQPA 4U1MA 4O51B 1EPFA 3GSWB 3KPOA 4Z0XB 3WFBL 1B4JL 5F6IB 3GGWB 5E1HB 3MLZL 3G6AB 1N4XH 4QRPE 4L8CB 3TPUB 4HFUH 1QQDB 4X80H 1CL7L 2R2EB 1U8LA 3GB7B 1JV5B 3N50A 4MD4B 4BUGA 1CYGA 2BRRL 1OAZL 4QY8B 2DQGL 5E8PA 4IMKA 4KJYB 1UFUA 4KH2A 1K8IB 2OK0H 4HWEL 1N5AB 4BFEA 3GSQB 4I0PA 1ZGLP 1QHOA 3CXHK 2WW8A 3P73A 5CGMA 3PHQB 5IVNA 3QO0B 4GRLC 4M62L 4Z95L 5JXED 5IJKC 3DWTA 2GTZB 3ULUD 4OCLC 5KSVB 4ERSH 3WJLC 3QPQC 4DAGH 4TULL 3AMKA 2DD8H 4PGJA 3WJJA 3U0WH 4JZNB 5JMRA 3MBEC 4JFFB 1R3JB 5F9JB 3VMPA 3QNYB 2ZSWA 2NY5H 3L3KA 2GTWB 5B38A 2D0FA 3DO7B 5CLWA 3D87B 2OS7A 1T2QL 5D2NB 3TT3L 1HDMB 4F7PA 3T4YB 2IQAA 4GG8B 5EN2B 5J7CC 3CSPA 3MV9A 1HNGA 3LV3B 1HXMA 4X6FB 1KCVL 4AH2A 3MCLL 5IFJA 3ARED 3G5VA 4L29A 1K2DA 2R56H 5FCUL 5FYLL 3NTCL 4PBWD 5HGHA 1MY5A 1ZXQA 3O8XB 4PP1D 5IMOB 1MJJA 1VEMA 1A2YB 1YEIH 3ROLB 1I8LA 3ARQA 1HSBB 3N85L 4KK8C 2IBZY 4M7LL 1TJHH 3P4MB 5JLZA 2IGFL 2P5WD 3S34L 3RVVC 3U0PA 3NCBB 1MCPL 1H8NA 2OSLA 3V0VB 4Y19D 3SKJL 5HVWA 2XZQH 3DROB 3ISWA 2CIKB 2NR6D 2V17H 3WDJA 3UTSE 3RI5F 4GW1B 4J23A 3O6MH 1GGBH 1AHWC 2X1WL 1CLOH 1PZ5B 3FB7B 3C2SA 3FRUA 4PJBA 5EU6B 4LASL 3PQYA 4YQXH 1KLUA 5E99H 4CN4A 1TJIL 2YWYA 3SQOH 3VFSA 4RX4D 3U46A 5IT2H 1LP9F 4G6KH 3VWJA 1XR9A 7FABL 1AGEB 4DJMA 5I1LA 2I07B 4PP2B 3VGEA 3NIDF 1FFPB 2VLMD 1J10A 4JE4B 2FB4H 4CVZA 5J1AB 4YBLB 1PZUB 1H0DA 4AT6A 4IRSB 1CD1A 2BVTA 4NZUH 1JN6B 1YDPB 4AEIL 4WUKL 4APQB 1TZIA 2GJ6D 3FT4A 3FONB 1T89C 4LCYA 2Q3AA 3ARDC 4PRBB 4OD3H 3K81A 1DLHB 3D1MC 3ZTJG 1NCNA 5A3ID 3RPKA 2EKSA 4OM0L 3ULUL 2B5IB 4HFWA 4PRIA 4PB0H 5E08L 2Y6SC 4ZNEE 3BVNB 1X5FA 5GRUL 4ZODA 1U41A 1CL7I 2L4OA 3AY4C 3CXDL 5KSBA 5BJTB 1PG7X 3C60C 2OQJB 5I1CH 2EICA 4N0YH 3MRCB 4J4PA 3UTTA 1YMME 2AAVA 3Q6FA 2CKBA 4KY1L 3MFFB 4QTIL 3SGEI 1S7XB 5MEPA 4MB3A 1DQDH 1L7IL 3LVEA 2AXHA 3EGSB 5F93C 5C0AE 2ICES 1TPXC 2F74A 3CC5A 4YDVB 2C9AA 5IBUG 1CE6B 2E6PA 4NBYB 1B88A 3AROA 3GMOA 4JPKH 4P3CH 4HIHA 4P46A 1D3CA 1XH3B 4XAKD 3LQAC 2Y25A 2CKBH 5HYJD 4LVHC 5JZ7C 4MNHB 3ZKSD 4LHUA 3S36H 4KUCF 3UXFA 1UZ8B 1OPGL 2AV7A 3S88H 4WI6A 1URLA 4FP8H 5ICYB 3L3DB 2KQMA 3OKNB 1FL5B 2E7BA 4S1SH 2F15A 2F8VA 1IM9B 3BXNB 4JHAL 1VFMA 4P5KB 1FZKA 1A6AB 4Z7NE 4RQQB 4M7LT 4I18B 1I1AC 3EO1B 3GSRB 5B22A 3SKOB 1R5VB 4Z7WA 3RNQB 1XGRB 5ESAA 3N06B 4Q0XH 4XCNA 3WMSA 2R8SH 4M1GH 3PGFL 5F9WC 2CUMA 2PXYB 1LEIB 5E2WH 4GUPB 2AJYL 4EKXA 3ES6A 3LKPA 4WGVB 2FX8H 2B0SH 1EUTA 4PJAF 4Z5RA 1RUML 1U8KB 3VWKB 3MCKA 1SY6L 3F6IA 4RBPK 5T33L 3WFHA 1G7LA 1S5HA 1YEEL 2VN4A 3F7PC 4PRHB 1LO4H 3G6DL 2P43B 1MCCA 1P7HL 3DOSA 5GGVH 1TENA 1KC5H 3I9GL 3QZWG 4DN3H 5E4IA 4NQTA 5GS2H 1NDMA 4WNQB 3G9VA 4LARL 3BHBB 4AG4H 2VOTA 1GZQB 2Q1EA 2XKNB 3LKOB 3MRRB 1A3LH 1M6OB 1FZJB 3QDGD 4S1DD 4KVCL 3GMNB 4XP6H 4WFFE 1CE1L 1IC4L 5H94A 1CGSL 3DECA 1DFBL 3TVMC 4MA3B 1KJ3H 2YSSA 1MLCA 4NQUA 3SPVB 2ZPKH 3O3EA 1OT1A 1KPRA 3TO2B 5EBWA 5LXGH 3QI9C 2IF7A 1LD9A 3REWB 1BZQK 4OCMC 1P84J 4LAQL 3CH1B 3SDDD 2W0KA 2HFFA 1ACZA 4Y5YC 1F97A 1S9VA 4MAUL 3MR9A 1KB9J 5C8JA 3NCEB 1HK6A 1IAIM 2VXQH 2VQ1B 2W38A 35C8L 1AKJB 4XP4H 5FK9B 2XG4A 3QIBC 4OF6A 3BEVA 1HXYB 5IUSA 1FP5A 3MOBH 4OGXH 4Q9RL 3VXRE 4PFEA 4XZUB 2QHLA 3QWRA 2G2RB 1CCZA 5AYQA 3RWIB 2AJZA 4WWKA 4OUUA 3KYKH 1HQ4B 3FFDB 4ZO7A 3WEXA 4XBPA 2YK1H 5ICZA 4MS8C 4K94H 4OZGE 4MJ2A 1HILA 3UYPA 3WIFB 3MA9L 2PTUA 5I74B 3CJJA 4NJAH 3U30B 3UAJD 1IGML 3S37X 4E41B 4MD5B 1IAOB 3AVEA 3X17A 4Y16A 4CVXB 5C07A 1OY3B 1SJVA 4ORGB 2F9BT 3FOMB 1CVSC 4A6YH 2K1MA 4PGEB 5EU7C 2EDHA 4P4KC 5M7QA 2N7BA 4JQXC 1D6EB 1BQUA 2W9EL 1KLFA 2F53D 4J6RL 2CDFB 4U1NA 3LMJH 2J8OA 2ADGA 5I6XB 4P5TD 5J6GA 1QSVA 3PGDB 4XCCH 5J11C 4PRAB 3RTQA 3E3QC 4L8SA 5DD5H 5D6DC 4O02L 3VJ6A 3CFIC 3D2UD 4KK6C 4S10A 4KZDL 2P8MB 3SDCC 3BN3B 4XP1L 5EB9A 5C0CE 3BZEA 3UTQA 3QXAB 1NCAL 2WUCL 3HKFA 4PB9H 5BS0B 2PO6D 3AM8A 1EHXA 4XHQA 4HUXB 1IILE 1XF1A 3WIIL 5CZVH 3ZYIA 1DANU 2B39A 3KPRB 4UT9L 4ELKB 3ARWA 4LSTH 5ELIA 3V7AE 4ZUTA 1S7WA 2CJUL 1QG3A 2PN5A 4HK3N 1ZLVK 1EO8H 3T0VA 3A6CL 1RMFH 1I9RL 1FNEA 3VE0B 1WCBA 5DVNA 1PFCA 2HJFB 1S7UB 4PRDB 2IANA 5JO5B 3TCLB 4TSCL 3L6FA 1JGLL 1CR9H 5GGSY 4MDJB 1BIHA 1U8QA 4QXGL 3TO4C 4PY7B 1PQZB 4TQEH 3INUH 3CFDA 3O6KH 3U4EB 4U1JB 1WEJL 3DGGA 2AKRB 3KPPA 4U1HA 3G5XB 1MI5D 4DVBB 4EUPB 4PJ8B 3CFBB 2X70B 1OHQA 5ADPH 4YPGA 4YO0B 1MNUL 2NQCA 1TZGH 3OKEA 3R1GH 5H8DA 1T83A 1E27B 2UZIL 4QRRB 1YNTB 5KAQF 1P4IL 3QT2A 2XICA 1ULVA 3P11H 3CU1A 4LSUL 5DI8A 2FO4B 5D1QB 3BPOB 3W9EB 2F54B 4P2QD 3TZVA 4K7FB 4X9GA 1G7JB 2JELL 4DEPC 3UYRL 1YC8A 5CINL 2VDOL 4ELMF 3ETBF 2DQTH 1JPSL 5GGQL 4QF1B 3HNSH 4RFOL 1MRDH 4D8PA 4HBCH 1DANT 1I3GL 4CN6A 4N9GA 1KENH 5MENA 4LSPH 4UINH 2V2WA 3U4BL 3TIDA 3U48A 4J3SA 1Q0YH 5IG7B 5FDYA 4WW2F 4WI8A 4OJFH 2W60A 3IRPX 1F4HA 3TA3A 2CMRL 5FO9B 1YJDL 3O3AA 4LPXA 5ILTL 3QHFH 4I0PB 2EE3A 3WFCH 1AIFB 4I0CC 4JFXA 4HKBB 3W11C 3P73B 1EEZB 2AK1L 2O26U 3TCXA 2YD8A 5E6YA 3VI4E 5CGYD 2G60L 5C0ND 2GK0A 4WI4A 1IL1A 3C5ZC 4UIKL 3ARFD 4JG0L 4XXDA 3QCVH 4KRPD 5K9OA 3R8QA 5FYJE 2H1PH 2C4XA 5J8OA 4JRYD 3X3GL 3OKOA 2ZSWB 2QSVA 4HUUB 4K3GA 3O2DH 3HAEB 3L3KB 4G8FB 4MJIA 1K4CB 3QJHA 3LIZL 4R0LA 1CIDA 3MXWH 4MVBD 1Z0NA 5KSAA 4H0HB 2ICWA 1N2RA 4F7PB 2IQAB 2QBWA 3HUJA 3MV9B 1HXMB 2H32A 5IFJB 4L29B 1K2DB 1MJ7H 1ZVSA 1JPFA 1HN1A 3HMWL 1OAUH 4NC2B 1U6AL 1B90A 1JUFA 1RIUL 3HG1E 3SQBA 2NLJA 1GGTA 4PJGF 2VDNH 4UOW0 2HTKC 4PJ9D 3G6JF 3BZDA 5CILH 1KNOA 2AK4B 5CJXA 5JLZB 5TQ0H 1N6QL 1LO3H 4U6YA 4YE4L 2JIXD 1KB5A 2OSLB 1I3VA 4XPHH 5I19L 5ADOH 2H32H 3RDTD 1ADQA 5E8EA 3EYVB 3I75A 1UZ6F 1JVKA 1MWAL 2BY3A 5CJQL 4U6TA 1TCRB 1QFHA 3MV7D 3FRUB 1UA6H 5T5FL 1KLUB 1P6AB 3WXWH 5HHOE 3VFSB 4QOKE 4JR9H 2GY7B 3U46B 3IU4H 2NZIA 3VWJB 1WBXA 1XR9B 4XWGH 5KJRL 5GHWH 5I1LB 3SCMD 2VDPH 3UP1A 4K3JL 4CVZB 4WTZG 1H0DB 5EC1A 1HH9B 5JR1L 5DRXB 2Q8AL 3QIUD 4OIIL 4Y7MA 1ADQH 1SMAA 1JPST 1TZIB 1J8HE 2QJDA 1HHKB 4HC1L 4L3AA 3FT4B 4KVNL 3E2HB 3ME0A 4OT1H 4UZGA 4YGAB 3WXVH 3M07A 2W0PA 5GS0H 3LAFA 1AQKL 1XAUA 3KYNA 1ZGLM 4P2OD 2DQDH 4XB7A 3WL9A 3OPZH 3U0TB 3MV11 4PS4L 3QUYD 4PRIB 3BPCA 2H9GA 4HFWB 1T6WA 4S1QH 2X4SB 3RX7A 4XPGL 4TUJB 2R1XA 5IEHA 5IQ7L 4YK4B 5JXEC 5KSBB 1KCRL 5C08B 1KXQE 3ULUC 1YYLL 5JW4M 4XB8A 4TUKH 1N6UA 1ZLUK 3Q6FB 2CKBB 1KEGH 1QRNE 5ISZD 4LGPB 3IF1B 4N1EA 4W81A 3LZFH 4MA8L 2DBLH 4TTDD 4NRYB 5ENWA 1NAMH 1EV2E 1KJ2A 4P57B 5J12B 1IEAB 1KYOJ 1S8DB 3AS0A 4OZHA 1OP5K 4XBEH 5CKGA 2PW1B 4Q97A 4IDLA 4P46B 3QUXC 1T7VA 1JPGB 5EO0B 3AREC 1QTYT 2Y7QA 4I3RH 2VUYA 3ZL4L 1KACB 1X6LA 1ZA6A 4LHUB 4LLQA 3VGAB 2AV7B 1UKTA 2VKWA 4WO4C 3C8HA 3HE7D 3T2PA 2IMMA 3NIDE 3PWPB 1AXTL 1CICD 3LPWA 4X6DE 3NIFF 1DUYA 2WBJA 3VW3L 2J4WH 1KJ2H 3RY6C 1XGQA 1T1XB 1D9KC 3LKQB 4NN6C 1XIWC 3T0WA 1FZKB 1FZOA 2R0ZH 1CXFA 3QUZC 4PJEE 1I1CA 1UM6H 3ZKXB 4LSDA 3ES6B 3LKPB 1QLFB 2XKUA 2ERJB 5EU7E 1IAIL 3EO0A 1MH5A 4OI8A 4HEME 2ZUUA 3WS6A 3MCKB 1Z0MA 2EDWA 4PJHE 2EEBA 4F9LA 1FLRH 4A2MA 5EZIL 1G7LB 1S5HB 4XMPL 1HYRC 4FQCH 3AGVA 1OGTA 2ZCLL 1YMHB 1ACYH 3MLPA 2FYYA 5EBLB 3E3QE 3DUUB 1SEQH 4D0DA 1Z9MA 2PF6A 3CZJA 5E9DE 4AMKL 2CQVA 1S9WA 5GRZA 4Q9QL 2UUDK 4OLXH 1J87A 1AY1H 1Q9WA 4GOSA 1YEGL 1G9ML 5L2JA 4G5ZH 4XT1C 2DM2A 3VXQB 5C0GB 3FZUD 1TQBC 1S3KL 3W0WD 4CJ1A 1JWMA 3GHBH 4U6HA 1I3UA 5DD0L 4FFVD 5H94B 1D6VL 1NCDH 1UH4A 4MNQA 1DCLA 4OSUH 3HI6H 4WHCA 5DLMH 4HFUL 3DYMA 4X80L 1H5BA 4U6XA 4X7EC 1QLEH 4K23H 3P9MA 4GKZB 4HCRA 1CGXA 4RMTA 1KPRB 4NO3A 4QHMA 2K7QA 3OXRA 5EBWB 3QQ3A 1RIHL 3QQ4B 4XP9H 2RIKA 2X41A 3K1DA 5FGRA 2K3TA 4NRZB 5D71H 1XGYH 2VLJE 3OJDA 1DUZA 2HFFB 1A22B 1S9VB 2C1PB 2DJSA 3MR9B 1NEUA 5C8JB 4HQQL 4FFYL 3JUYA 2DLGA 3L3GA 5IVXA 1NDGA 3GEWB 5I1GH 25C8H 3SDYH 2MCG1 2XN9E 3R0NA 4AIOA 4WHYH 3VG9B 1DQMH 1WT5C 3OR7B 4HCRH 5FGCE 5MI0C 1DBML 4XNYL 3LEVL 2IJ0C 4WGWB 3ARGD 3VGDA 3WE6B 4F33A 2CRMA 1AQDA 1HZHH 3EFFA 4U31A 5DTFA 4DAGL 3EFDL 2DD8L 4HXAL 1AO7D 3BIKB 1P1ZA 4OB5L 4YZFF 1KIUA 3W81A 2AJZB 4WWKB 5GRWA 1QOKA 3H7BB 2JLLA 4OUUB 2NY5L 2DYPD 5ICZB 1VGEH 2X7LA 1KCUL 4TSBL 2VDLH 4Q6IB 4R90H 4XCFL 1HILB 1VHPA 3MROA 1DLFH 1MQKH 2AEPH 4NQDE 4WIQA 1JHTA 1U3HB 2GCYA 3LKRB 4OZFG 4LDEB 2ESVA 5IOPA 3TV3H 5DWUH 5CFHA 4JREC 4WFGD 2CLVA 4DTGL 2FATH 5CJ5A 5C07B 4JY4B 3B5TA 4XC3L 1PG7L 1YYMH 3VDCA 1NMAH 3EZ8A 1RZKL 3K8MA 2VLRD 4J4PD 4HGKC 3UTTD 4JHWH 4X5LA 4E9LA 4POZD 2YRPA 1CDIA 4RMRA 1TNNA 1JHKL 2CR6A 2ADGB 2YEZA 1A4KB 3GSUB 5J6GB 3G9AB 3FN0H 3RTQB 3TLRA 1BD2D 3MRGA 4JY6A 2J8UA 2Q8BH 4KK9C 1RUAL 3VJ6B 3QEQA 2EXWD 4Y1AA 1GGBL 4FQHA 4OCXL 1G1CA 1JYVA 1F8TL 3UTQB 5FYKD 5IMKA 4YQXL 5E99L 5D7LE 1MEXH 1OP9A 4RWYH 3BGAA 4DUVA 4G6KL 1HKLH 5ALBH 5CD5D 5DR5L 1MREH 2OI9C 4BSJA 2YD5A 2HFGH 4ZUTB 2NXZB 5SWZD 1N3NA 5KSUB 2BNQD 2LQRA 3TYGH 2XWTB 3DVNA 1RUKL 2VN7A 2IMNA 1FNEB 4HPYH 2PW2A 4ZTOL 1WCBB 1JF5A 5I1JH 3R8BB 1FH5H 4WI5A 2GY5A 2IANB 5FA3A 5DJ2A 4W68A 1FVDA 3H2WA 3JSSA 4L3EE 2GITA 4DCQA 1H3WM 2V5YA 5IW3A 2HJLA 3HC3H 2Q86A 3OQ3B 3SDDC 1ORQB 3PUCA 2EYSA 5DK3A 5I0ZA 4FTVB 4YX2L 4LPVA 3DGGB 4QXUH 2Z0BA 4LLVA 1XR8B 3LPGA 4Y4FA 2OZ4A 2W0LA 1JBJA 1FCCA 1J5OH 1L7TL 5DD1H 2L7JA 4BQ9A 2EIBA 4YPGB 2Z31A 4N0YL 4YBLC 3B3IB 2O61B 3O4LA 4LCWB 5AYUH 4Z8FL 3ULVH 1NFIA 2DQJH 1DQDL 3H9SA 5CAYB 5DD3H 1V3LA 5DI8B 2VXSL 3L95B 4O5LH 4X7FC 2NTFA 3TZVB 1NLBH 3ZE2F 1IGCL 1BQHB 4OGAD 3RBGA 1A0QL 4JN2A 2VLLB 4OCNC 3RWJB 2Y06L 4V1DA 4XXCC 5BV7C 3MRFA 2A9MH 1WAAA 2X4UA 5DUPH 2FHBA 2OTWB 3JWDC 3S35X 2IWGA 4RMSA 3T0XA 5MENB 2GUOB 2V2WB 3X12A 4XVSL 4JO3H 4GBXB 3KJ6H 5K9QI 4NM8L 3S88L 5LWYH 4N9OB 2W60B 1SJEB 3IFLL 5DO2D 3TA3B 1TLKA 3O3AB 4JEGB 2E9JA 3U9UA 4BKLA 1VFBB 3C9NA 3TFKD 2VAAA 3ZTNL 4JHBA 1ERNA 4JFXB 4KKBD 5FYKL 2OP4H 1HINL 1YJDC 3HZYA 2HWZL 4M6OH 2GK0B 3F5WA 4MX7A 1OSZB 4JQIL 3VRJA 4MWFB 4P23C 2FX8L 1KPUA 4QGTA 3LB6C 5E4EB 3P0YL 5BZDA 4XXDB 1NKOA 4G42A 5D4QA 4M5ZL 5K9OB 4J3WA 4IBLT 3UZQA 3HZMB 1DQQA 3QAZB 1HKFA 5EFIA 4L4TE 1LO4L 1NFDF 1RD6A 1OAXH 4WEBH 1WTGT 2YPLA 1MY7A 4MAYA 4MJIB 4CADA 3QJHB 4EN3A 3HI1A 4LQ1A 1OAKH 5KSAB 1N2RB 4IRJA 4H1LH 3HUJB 4PJ7A 4C55A 1IBGH 3ALWA 4J3VA 1JK8B 5HD8D 4I18C 1IC1A 1ZVSB 1JPFB 1Q1JH 3MLTA 4MD0B 5FECB 1MFAH 4UBDC 1JUFB 4ELME 4ODSL 4LVEA 4YEFA 5TPWH 5FYKU 5TH2A 1KNOB 1A14L 2D0GA 4R8WH 2VC2H 5DJ0A 2GAZA 1OB1A 1RZJL 2NY1B 4XNUL 3FT3A 4ZOEA 2XA8H 1SM3L 1MF2H 1KB5B 3MACH 1C5DA 4X4YB 5BVPL 3UTZA 4NWTL 2R0KH 2XYCA 3FQNA 3MLSH 4G8EA 2BXYA 4GG6A 5T3ZE 4O9HL 4KDVA 5JORB 3QFJA 3I75B 3TNNA 2QHRH 1YPZE 4GMSH 2OTUB 3LQMA 3RKDC 3RHWF 4RGMC 4ZFOA 4X83A 4JPIA 3OBAA 3WLBA 5LCVH 5FDWA 4G8GD 4ZXBD 4OGXL 3PWJA 4Y8AA 3PP4H 4KHXH 2VLME 1P9MC 5EC1B 3VFGH 1BJ1H 3VGFA 4LNVA 2EXYD 2HT2D 5F1NA 1HHIA 3KPQA 5FCSH 4RGNB 3RL2B 4X7SH 3VD4A 5MEQA 2D03L 4DGYH 1QFWI 3RVUD 3KYNB 4KMLB 1KN2H 4K94L 2GW5A 3UPRB 5F3BA 5DSCA 2CK0L 2W0FA 3UEZA 2H9GB 1SYVB 4K8RH 5FO8A 4I2XA 3TIEA 1A7RH 5CGYC 4MQTB 1RJYA 5IKCA 1QA9A 1NGPL 3QRGH 4WFED 4A6YL 1ZEAH 3TJEL 4R4BA 3VH8A 1FCGA 3ARFC 4PJGE 5DFWH 2A9NH 4KRPC 4KJQD 2MCPH 5EA0H 2BHUA 2R69H 3LMJL 43C9A 1FG9C 3L7FA 2Z92B 2DL2A 3G5ZB 3O9WA 1B0GA 2Z8WC 4LQFL 2E5EA 2CUIA 1MJUH 1OD9A 4OZHB 4J3XA 4OCYH 4CNIA 1UZ6E 3E8UH 1Q9OB 2FL5A 4JFDD 3U30C 5ID1A 5K93A 5I1DA 1LK3L 3RWDB 3HC4H 2D4FA 3F7YA 3LRSB 1KV3A 2B2XH 1ZA6B 3BO8A 4K9EH 4LLQB 3HA0A 2OJZH 1BGXL 4LSTL 5JW3H 1JZ7A 3CLEH 4YWGH 3ARVA 1ONQA 3CMOL 3JXAA 1EO8L 2VDQH 4Y4HB 5I18L 5EU4A 4MZ2A 3W9DB 2WBJB 3VXPB 1XGQB 3LS5L 5C3LD 4DFIA 5I6XC 3V5HA 4JM2A 1FZOB 4UV4L 2R9HD 4YBHA 1CR9L 2FECI 2AEIT 2CSPA 3WSQH 3MFGB 4GRWH 2FJFA 3QB7C 3LCYA 3FO0H 4KUZH 1BBDH 4KJPD 1JRHL 2Y72A 1PBYA 1MH5B 3KDMA 5GQBA 4JKKA 5ANMA 1K6QL 4I9WE 3B6SA 5FHAL 1CFTA 4JPWH 3PDOA 3BPLC 5D5MA 2G5BA 2FYYB 4TOYH 4PJIA 5ESQA 1OCWH 1F02I 4D0DB 3D5OF 4FMFA 5C3TA 1PLGH 1S9WB 2NTSP 5D2NE 5LKNA 3DETD 4N8VG 4L8BB 4Y4KA 1Q9WB 1AE6H 2VZSA 5L2JB 3VU2A 4JFEB 4LCCA 2XA3A 1R5WA 1UJ3A 5KSBF 1FYTD 4NM4H 4GAGH 1ZAGA 4MXVF 4P2OC 3EYUH 4NSKA 4U6HB 1NCWH 4J1UB 1MQ8A 1NGWA 3IDNB 4MNQB 5DJ6A 1J8KA 4NNXB 2NCMA 3O4OB 3P9MB 2P47B 3TBTA 3T3PF 1YEFL 1Q0YL 4S0TD 4C57C 1CIUA 3QQ3B 4OJFL 1CFSB 2AJUH 5L9DL 2ATPA 3OJDB 5DDHB 4XNZB 3BPOC 2HT3D 5JUEH 1A7QH 1UH2A 4LKXA 5GRXG 5IEKA 1NFKA 5D2LA 4TTDC 5EU6E 5E6IA 5GS0D 1KCKA 4N90E 3WLWC 3LPFA 3L3GB 4U1GB 3ZDXE 3MZTA 1D5ZA 3O45A 4F33B 5E03A 5HHNA 3EFFB 5DTFB 1HYSC 2EE9A 3EOTH 1MIML 1P1ZB 5E5MA 4HJJH 1G7PA 2H1PL 1BMGA 2ARJQ 5E94A 5T3ZL 3O2DL 3R06A 1T66D 4IMKC 5IR1A 3QDMD 2MKLC 4PRPD 4I0PC 5MP6L 3RUGA 1T4KB 2NY5C 3BW9A 4LHJB 5L8LB 1JHTB 2GCYB 1LO0H 5DK0A 5E8OA 2ESVB 4WEMB 3HZKB 5IOPB 1VKXA 1JFQH 3V5KA 4YIQA 1OAUL 5M94B 4IRZL 4UTBH 3AS1A 3K2MC 5FV1L 2NXYB 3WFDH 1MAMH 1TZHA 2DB8A 4JFFD 3H3KA 3WJJC 5TQ0L 2LVCA 5E8DL 2YEZB 3M8OL 1MCSA 1AGBA 3V2AR 3MRGB 3MUHL 4JY6B 4XMKH 1WK0A 3QEQB 2Y9RT 4Y1AB 5SX5K 2YXFA 5IHBA 2EH8H 3ARBD 1JRHI 1UA6L 5IMKB 5CSGA 2IPTL 1FFOB 1U8NA 3BD3A 2BNRA 3HRZA 4XPBH 3SEPA 5HYSA 1A6WH 4DKEH 3RIAF 3I02A 1VDGA 4M7ZC 5IBLD 4LSQH 3VFOA 3T1WA 4FQLH 1P7QD 4S1RL 4WUUD 3REVA 4ZPVB 2V5MA 1ZMYA 5SWSA 1JJUA 1F4XH 3DVNB 3DXAD 5FM8A 2Y07L 4D94A 1KIQA 4PGCA 2KZ1B 4OT1L 3BKCL 2JCCA 4DKFL 5GS0L 1FVDB 3NVQA 3WHXA 3C2AH 2GITB 3OKLB 4KROB 5GGSB 2HJLB 3OPZL 4G9DB 3PABB 4ZQKA 2Q86B 3FFCD 1FDLL 1MCNA 3FQWB 3K0WA 5K59F 1EFQA 2FD6L 4HF5L 2IPUG 4PG2A 4WV1B 3T0EA 4Y4FB 4V2BA 3VWJC 2VR4A 1JGVH 2J8HA 2VNCA 4DW2L 3QIWA 3HMXA 4TUKL 2CDEB 2Z31B 4PRHE 1I7RA 3RU8H 3O4LB 3O6LH 4P9HH 5MHSD 4ODHL 5JHDA 1NFIB 3H9SB 3KLHD 5GRYA 3M1BA 4IOIA 5I71B 3MLVL 1NAML 4X9BA 4V1DB 5HJ3A 1CDUA 1MCQA 4QYOA 3CVIH 4CMMA 4YHLH 4XBEL 4F57L 2FBOJ 4ZAKA 4NQED 4GW5B 3HMXH 2NNAA 4ZOAA 3UJJL 4HHAA 5ICXA 5DMKA 4I3RL 4Y5XA 3DNKA 1JF1A 3A0OA 3PWNA 4OLUH 1AGFB 4ZUSA 3QXTA 4JN1H 3X12B 4AZ8A 4LIQH 2VXTL 2HKHL 5IB2A 4J4PC 2X1OA 4POZC 1QSFD 3KR3L 2J4WL 3QZWA 2MHAA 3U9UB 2IFFH 4BKLB 3WYRA 1GVIA 3VFWA 4YNYA 2P8LA 2VAAB 5C0FA 3X3FH 5GS1A 3SJVD 1BFVH 5T1KA 3MUGB 3KWWA 1C5CH 5J12C 5C70A 1FNGA 4MX7B 1R3LA 3F5WB 1UM6L 5FKAA 2GT9A 1EVUA 1GYAA 1N64H 3VRJB 1MCKA 4P46C 5C2BL 5DEGB 1KPUB 5C92A 5BZDB 1MIEH 4G42B 5T1LA 3BH9A 5HGDA 4JDVA 1PVHA 3LS4L 4LF3B 3VGAC 1G84A 1QSEA 4TNVF 4ZFGH 4LSVH 2BY2A 5BO1H 4FQJL 2YPLB 4RBPH 2FJGA 3QEGH 4EOWH 1WIOA 4YAQA 4CADB 4UUJA 5JPMA 3HI1B 3VFMA 2DLIA 3LSOA 1EO5A 4Y2DD 3MLRL 4DZ8B 2OXGA 4F7CA 3ZE2E 4E41E 2E7MA 1K9TA 1HHHA 3MLTB 1YEKH 3ZKXC 4G9FA 1SVZA 5DMGD 3VWKD 3DRQA 4ETYA 4BH7B 1ZLSL 3DLQR 4PJXA 5FA4A 2WBWB 5DJ0B 3QUMA 1OB1B 2WINA 3F58H 4IHOA 3FQTB 4LLDA 1C5DB 2VZ3A 1KIRB 5D71L 3B2UD 5IHLB 1XGYL 3PWLA 1ZHBB 1N8ZA 3VXSD 4OD1L 3CFCL 2VXVH 3QFJB 3ECBA 1OGAE 1OQOA 3MV7E 3QYCA 2DKUA 2D4DA 4OGAC 1C12A 1EFXA 5F21B 5BS0E 3V4UH 5I1GL 4JPIB 4G43A 4AL8L 4L9DA 3QUMH 5FDWB 1ZHKB 1IAKA 3KPRE 1MSPA 3QDHA 5JDSA 1WQVT 1HZHL 2EIZB 3PWJB 2Y5TB 2DI9A 1UC6A 3FN3A 1S5IL 2NW3A 5F1NB 5K9QG 3BDYH 5EU5A 1HHIB 2X9YA 4D9QD 2Q76A 5GGRY 1UT9A 2BK8A 3ESUF 5MEQB 3ULVD 4XC1L 1OAQL 5HVGB 3CSYA 2XZCH 4KKAD 2QV2A 1JWUA 2NW2A 2D7OA 5DSCB 1DLFL 4JGJA 4KKBC 3TIEB 3FQUB 2FATL 4K94C 1RJYB 4QWWD 3MXVH 4YJZL 1QPXA 2MMXA 1YYML 2VABA 5HHVH 2ZNWA 5BMFL 4NO2B 1FJ1B 3VH8B 3DV6A 1OWRM 2AJ3B 1JZ3A 5A16B 1KG0A 3EJZD 2XWJA 3HUJF 3WS3A 5F7LB 1CGTA 3L7FB 43C9B 1MLBB 3RJQB 5F7DB 3O9WB 2Q8BL 3T4AB 4ZO9A 5FAAA 4NO5A 3LN4B 1CD9B 5AWNL 5I8OL 1FRGL 1PEZA 2KDGA 3PWVA 4MNGA 3IVKA 4CNIB 2YD6A 5F3HB 4D9RE 4G6FB 2FL5B 5ID1B 3VFRA 4W4NA 4V2CB 5I1DB 1XGPA 4RMVA 4ZOBA 5IK3B 4Y16C 4GRWB 3S35L 1CDGA 4ZD3H 1MREL 3F7YB 1H9VA 3IKCA 4PLJD 3SGDH 3UJTH 2ZJSL 32C2A 5EU3B 5C0EA 3MRBB 5C09D 1OTSC 2CR3A 2NY3B 3GO1L 3DX8A 3JWNC 5IGXL 4C56D 4BZ2H 1U95A 1Q9LA 1YY9D 1UB6B 1MHCB 4BK5A 4JM2B 1JPTL 5E56A 3RTQC 5BOZG 4L8SC 4Z7QF 3JUZA 4JQVA 1P2CA 5I0DA 3RZCB 3MV8A 3FCTA 4DOHE 1MFDL 1J0HA 6FABL 5HHQB 4M6AA 1OAYL 4XP5H 5CEXA 5DT1L 1BAFH 2VDML 4PY8J 3S5LA 1V05A 3KDMB 5C0IB 1HEZB 2NY4D 5ANMB 1J5OL 1FBIL 2CXGA 3DIFB 3B6SB 1U92A 1CFTB 4Q2ZB 2ZG3A 4U0RC 5F6HJ 4ZXBC 4A2LA 1X4XA 1GH7A 3BN9D 4P59H 5ESQB 3ULVL 2HRPL 1FGNH 2DQJL 1U36A 1I9JL 4RFEA 2YN3A 1JHLH 1RVFH 1KBGH 1GZPB 5I1AB 2PTTB 4IRJD 4Y4KB 3MV9E 1UYWH 4NUGH 2IAMB 1T7ZA 1UJ3B 4HG4J 4GKNA 2ENYA 3MCG1 3GM0A 3C5SA 5DQ9B 1L6XA 2E6JA 3LKNA 2UV3A 4DQOH 5IB1A 4KKLD 3ZDYE 1NGWB 5DJ6B 1AD9A 1MUJB 5FB8B 4YHKH 2MKWA 1U8IA 1FL6A 4OLZH 4U1LA 5AAWA 5DURB 2JK5A 3FB5A 2X05A 1LE9A 3TBTB 2JJVA 2M1KA 3D25A 4QRRD 5JOFB 2VZVA 4FQIH 4IS6A 5KBNC 1IT9L 1KGCE 1T83C 2BSTA 5D1QD 2D31A 2F19L 3MRDA 1U58A 4KJQC 1DQTA 1ZSDB 3T8XA 4OZHF 1NGZB 5I9QB 4YHZH 4LKXB 5GSRB 5IEKB 5INCA 2HN7A 5D2LB 3TZVC 3GMMA 5MEOA 3MJ8A 4PJBE 3O2VL 3VD5A 1ZT7A 3PQYE 1CXIA 2BZDA 3MRJB 1D5ZB 1RHHB 2OX5A 3O45B 4FMKA 1GC1H 4O4YH 5HHNB 4LU5H 4FG6D 1IKFH 4I77H 1R3IH 3KS0H 5GRJH 5E5MB 1G7PB 5ITBL 4P99A 4D2NA 3BP7A 4NNYA 1SJXA 5HHXL 4DGVH 4P2RD 3BH8A 4HDIA 4PYGA 5C0AB 5JHLL 3UTOA 4RAUA 5CMAA 1H3PH 3R06B 3TA3C 4YUEH 4FQ2L 5GRVL 5IR1B 5D72H 3CX5K 3V7MA 5CEZE 4IOFD 2IPKB 4B0MM 4ZFZA 1OAKL 2VE6B 1KF9B 1T2XA 3IXAA 4HPOH 3TN0A 3LOWA 4Y5VB 4M93C 4PRIE 2I26N 2VSCA 2X4NB 5DK0B 2FR4A 1N5YL 3EOBA 3B9KD 4WFGE 5KSBE 1CTNA 1A02N 4F37F 4LVNB 3L9RA 1X5IA 2APVA 5CJOL 4XVJH 4EDXB 5TPWL 1ZA3A 4LLMA 1TZHB 3UTTE 5DD6A 4R8WL 2YKLH 5D7JA 1X5XA 2WWMC 2WP3O 4YHOL 4S2SB 1NCUA 1AGBB 3T3PE 3JWOL 4PD4J 1MFCH 4OLWH 1WZ1L 4YHIA 2EH7L 3H3BC 4R0LC 5LGHH 2W9DH 3PIQA 2QHRL 4PJ5A 4TUOA 5CZXD 4NQVA 5DUBA 4O2CA 1F13A 1J1XH 5IBTL 1M05B 3VXMA 1NL0L 1W72L 2ADJA 4U33A 5D7KE 2EZ0C 1U8NB 3H9YA 3FAXA 5HYSB 1NLDH 4JZJA 5HPMA 1XF2A 5IHUL 3VFOB 1BX2B 2C3XA 3REVB 1Q9KA 3VFGL 4RGOL 3UYOD 1IGJA 5SWSB 2QQNH 5CJXC 2E27H 1CFBA 5I1HH 3ZZ1A 4M8QB 2RFXA 4PGCB 4HWBA 4I3SH 3STZA 2E8YA 3GHEL 1CXKA 2VLKA 3WHXB 5ACLA 1NUNB 1F58H 2A77H 3LN9A 4NQCA 4ZQKB 3KPLA 1JYNA 2HT3C 3CDYA 3MLUL 3ZKND 1V3KA 2CXKA 5BRZD 4ODTH 4M48L 1A7RL 3K8KA 1BIIB 1MOEA 3HE6D 5EO1B 2IH1B 1CZ8H 1ZEAL 3QIWB 4MCZA 5LGKA 1FZMB 1I7RB 5EUOA 1MRFH 5E2UH 2NX5A 1X4YA 2YA1A 1RZIA 5C0RH 5JHDB 1NGYA 1KEMH 5EA0L 4MSWB 1ZLUH 1LNUA 4LFHD 4P4RB 1MCDA 2COQA 1INDH 4Z7VF 4XCEA 4X4ZA 3BZFA 1T66C 1A7OH 3LHPH 4BFIA 1ZT1A 4U1SA 1MJUL 5HJ3B 4QYOB 3U82B 3IJHA 5FIEA 5EZJA 1TITA 4ZAKB 2WUBL 3E8UL 5HDBF 1G7QA 5CGTA 2LU3A 1E4XI 4F58H 1WV7T 1EHAA 3J8F7 3DYOA 3PWNB 2W07A 1KTDB 2OJZL 1U8OA 1QBLH 2CLZB 3G08A 5IB2B 2VJXA 3RWEA 3O3DB 4OZGB 4IJ3C 1Q0XH 2MHAB 2R0LH 3DUHA 3VFWB 4YNYB 4Z0BL 4U1IA 3ZDZF 3D9AL 2UZXB 3ULSA 4K7PH 1CLYH 5D6CA 5E6ID 2CUHA 3P9LA 4EXPX 3WFZA 3OL2A 1C08A 3KWWB 3M17A 4M6ML 3WSQL 1FNGB 1HSAA 5FKAB 1GIGL 2H8PA 2C3HA 2GT9B 3FO0L 4QXWA 3QA3A 5GJTH 4HMDA 4LSRH 3ARBC 3N9GL 2QADC 3HZVA 2X6MA 2I24N 1X5JA 2BSSB 3P77B 5K59E 5HYEA 3ROOA 2UZYB 4JRXD 5HGDB 3GKWL 1CFVL 4DKDC 1QNZL 1LK2A 3O6FA 4WDIA 4JPWL 3PWPD 5DC0A 2FJHB 1QSEB 5JW4N 4QCIA 5IBLC 4D9LL 3C08H 3FQRA 1I7ZA 4GRLB 4LOUC 1OCWL 3WFBH 5EORL 1B4JH 2FJGB 4XRCA 2WBJC 4UUJB 3W2DL 4PBXA 5JPMB 3VFMB 3MLZH 1KXVC 3LSOB 1FFQA 4X9FA 4DK6A 4F7CB 5I73C 3QDJA 3RNKA 1CL7H 3EOYG 2YS4A 3RL1B 5C86A 2DKMA 3EYUL 5C07E 4R96B 3KXFA 2BRRH 1OAZH 3D69B 9CGTA 3DRQB 2PR4L 4DZBA 5FEBA 1MFEH 3WS6C 4PJXB 1I4FA 1T0NA 5FA4B 4F9LC 5KAQG 2WINB 4G8IA 4IHOB 2HT4D 4BZ1L 3MBXL 2RHEA 1SBSL 4LLDB 4FFWD 1VFAA 5F89A 2LFGA 4Z95H 4JO2H 3CPLA 2XPGA 3PWLB 1N8ZB 1ODAA 5JUEL 3QNXA 3ECBB 1FAIH 5CEYA 2F58H 1R24B 3KPSA 3QULB 5F8RC 3KLHC 1KULA 2OR8A 3D0LA 1V7NH 3RVWC 3SO3B 1C12B 1EFXB 3ILQC 3MJ7A 4XGZA 4G43B 1S7QA 5F1IA 4B53A 2VRAA 4OV5A 3MRMA 1WUNT 5JDSB 5TGBA 3X13B 5JIPA 4HSQA 1NUDA 3DURA 1YQVH 3EOTL 4P3WA 1H5BC 1T2QH 2IBBA 2NW3B 2V5TA 1AHWB 4HS6B 5EU5B 2Q76B 3BRGC 1T21B 5GGRA 2A83A 2IANE 5DRWA 4XCYA 4OBSA 5DJCA 5FYLH 4ACPA 3NTCH 2EDOA 5T3XD 3CSYB 1KLGA 4MXWL 4OZFH 4OF3A 2NW2B 5T1DL 3DMMD 4PGBA 3RPIB 4QHLB 1LO0L 5JOPE 4ZTPH 2BC4B 1T0MB 4Z7UA 3EJJX 3D39D 2IGFH 3SE9L 5B4MD 1I9EA 1HCFX 1MCPH 3NN8B 1CBVH 3S4SB 3ARDB 4GRMA 3DV6B 3C8DA 4ONHA 4TSAL 5CBEA 4X8JB 1NGQL 2WSKA 1KG0B 1S9XB 4EBQH 5AG9A 4L4VD 1NEZA 2XWJB 3IFOA 3E6HA 1TJIH 3IT8D 4Q7DA 2HYMA 2ZCKH 3WKMH 5JXEA 4NO5B 7FABH 3V6OE 3C6SA 3PWVB 1V3JA 4PJCF 3IVKB 2BMKA 4Y2DC 1T20B 5C1MB 3VFRB 1MELA 3DSFH 1XGPB 1OP3H 3EW3B 5F88B 2YRZA 4AEIH 4XPBL 1A6WL 2Z35A 4OFDA 5MENE 1H3UA 4FQLL 4N1CA 2BRQA 5C0EB 3B9VA 5HPOA 1TPXB 3TBSA 2VIRA 2WWKO 4HS8L 3DX8B 1F4XL 4OM0H 2WQRA 5JA8B 1U95B 1G6RB 3QFDB 2ADFL 5E08H 3AREA 5GRUH 4LVHB 2UVFA 1P2CB 5JTWA 2V7HA 2QQLL 3FCTB 1MAKA 3TP4A 4JVUA 1S9KC 4WEUD 2VISA 5CEXB 2HKFH 3OAYH 3S5LB 2GK2A 3HLAA 4YXHL 1SMOA 3BKYH 2AJXH 2P5WA 1L7IH 1WCQA 1D5MA 1BJ8A 1PD6A 1YEJH 4XPFH 3U6RA 1U92B 2BOCA 4Y19A 4M61A 3RP1A 3RU8L 1MFNA 2X1PA 1I1AB 3NFSH 3BPNC 3NOIA 4RFEB 4MJIE 4WI7A 5F9WB 4WJ5A 3IFPA 5T3XL 2DWDA 4RZCA 2ADIA 3HUJE 5KVEL 5IW6A 3IKKA 4RX4A 3ULVC 3MRNB 1F90L 5I1KL 4GKNB 4FTVD 1OPGH 1IGTA 3C5SB 4YHLL 5J3HD 2VH5H 2FWOB 5EOQH 4NZTL 1INEH 4MJ6A 2ZNXA 4XWOD 4H20L 1AD9B 1KJMB 5EOTA 3OXSA 1SY6A 4M1CC 4ZS7L 1FL6B 4Y4FC 3VXUA 2JK5B 4OLUL 3QXUA 4JHAH 4QWWC 3FB5B 4LKCB 2GJ6A 1LE9B 3B2VH 3ARRA 2EYRA 3D25B 4LCWD 1RJLA 4I5BB 4IS6B 4YPJA 5IB4A 4NCDA 2BSTB 5FUOH 2D31B 3MRDB 1U58B 3NIGE 5FOBA 1RQ5A 3PE9A 2AJYH 3EJZC 2FIRT 2QEJA 3TVMB 4M7JH 2LAAA 2UWEA 3GMMB 3O81A 1L9MA 3MJ8B 4LRNL 1RUMH 1ZT7B 3L3OA 5D7SH 5IFAL 3PDDA 1SY6H 5LG1A 5T33H 5IJVA 1YEEH 2DDQL 5AD0A 1N64L 3G6DH 3QI9B 4TPRL 5DXWA 4OUOA 2P4AB 1CVRA 2NY0D 4GBXD 2E7HA 2ARJA 2DWEA 3TPKA 4Y5YB 4P2CG 7CGTA 1NAKL 4KHTH 4NNYB 4JM2F 4PLNC 4X7TA 4ZFGL 4EI6B 4HDIB 4KI5F 4OLVH 5CMAB 3EYFB 1GHFL 1LHZA 1CE1H 1IC4H 2BNUA 5JXAH 3IXAB 1NBYA 3Q6GL 1I3RA 1EGJL 5KOVC 4PJFA 2HRLA 5HYJA 3EOBB 4JGUA 4HWUA 3O0RH 4LP5A 2VWEE 1GOFA 5T5NF 5EWIL 2A6KB 3TBYA 4X6DB 4MHHI 2DQFA 1ZA3B 4LLMB 3SOBH 3V4PL 3I6LD 4LAQH 2DLFL 1NMCC 4G3YH 3AS3A 1JGDB 2WBKA 4HKXA 2FX9H 4MAUH 1E6OH 2F5BL 3F58L 5D7JB 1ZTXL 1OD7A 4H8WL 1VGKA 3VFUA 4PJEB 4NN7B 3BN9C 3SDAD 4AEEA 4ENED 35C8H 4MAYC 4YHIB 4EN3C 4AIXA 4KPHL 4XNQB 3PIQB 3G5YA 4TUOB 5C0JB 4IRJC 3T0AA 4OZHE 1TTUA 4Q9RH 1W0VA 4ZDHA 4O2CB 5IV2A 4PJHB 3VXMB 1WWWX 4MQSB 1HCVA 1FN4A 1MFBH 3IJSA 4JZJB 3ZHKA 5HPMB 1IC5L 1XF2B 5J11B 4KKLC 5E9DB 4LEOB 2NY1D 4L1DA 2KZWA 4O58H 3BESR 4NUJA 1JNLL 5F44A 3MA9H 1A9BA 3IDGA 5BVJB 4N8PA 5F6HI 8FABA 2YBRB 1IGMH 1A3RL 5L7XL 2IH3B 4IIQA 4QRQA 4BH8A 3ARXA 3QG7L 4Q6YA 2VLKB 3QDGA 2AI0L 4I1NB 2XZCL 1OARH 4NQCB 3JBG7 2D0HA 5A2JH 1JGUL 1U2HA 2DICA 2YC1A 3T1FB 1F11A 1ZE3C 2W9EH 1YMMA 1C1EL 3MXVL 4J6RH 3LEXA 4KRLB 4K8RC 4MCZB 4FQQB 1MHEA 2VLJB 4O02H 3IETA 2HLFD 5D7IA 4FG6C 1T5XA 1RZIB 1N0LA 4XP1H 1NGYB 3TO4B 5IMMA 3SDDA 1JNHB 3BKML 3L5JA 1LNUB 1NCAH 5IVOA 3W82A 3JTSA 4X6EA 3EZJB 3GMLB 4XCEB 4Y0GA 2GKIA 3WIIH 4BFIB 3WHE1 4X5WA 5BXFB 5FGCB 1I1YA 3IJHB 1QR4A 5EZJB 2XY2A 3HPLA 2CJUH 5DHYA 3JVGA 1G7QB 4MNQE 2YUWA 3A6CH 3QXWA 2EDRA 1I9RH 3BD5A 4Z7NF 4L3CB 3OAZH 3UJTL 1U8OB 5DRNB 1JP5A 1JGLH 4DEPB 1SYSA 2VDKL 3NACH 5ACZA 3KLSA 5KVDL 1FNAA 3EOAB 4K9EC 1KFAL 2P5EB 2PYED 4U1IB 5J9PA 3UPAA 5K9JH 1WEJH 2AXFA 3ULSB 1ROWA 3P9LB 4N8VA 2CO7B 3O9WC 1CGYA 5DGQA 4QT5B 2VAJA 5IVXE 3CDGA 1HSAB 5DVKA 3B5HA 1PW3A 2H8PB 3CIQA 1J86A 3LN5B 3K1KC 4XP5L 2IALA 1BAFL 3QA3B 5CZXC 3JTTB 4BFGA 2BVQA 1FHGA 4JG1L 1P4IH 2Q3ZA 1LO5A 5DK2A 1E4KA 4KK5C 1UKQA 3PGCB 1KB5L 1LK2B 3MA7B 3PV7A 3QP3A 1T22A 4P5TA 4WDIB 1QSZA 4Y4HD 4ODUA 5EO9B 5HYQB 1LO2H 2JELH 4EZMA 5JMOC 4OCWH 3UYRH 3D2UA 2XQYK 4HK0A 1JE6A 4MMXC 4XRCB 1JHLL 5IVZA 1KBGL 3PNWA 4JGMA 2D7NA 3C5ZB 3TN0D 4M4RA 5GGQH 4RFOH 5GGUA 1XGTA 3HFMH 5I30H 5IQ9A 1QR1B 4NUGL 2PO6A 1A47A 4KI5C 5HGAB 1I3GH 4NC0B 3QDJB 3RNKB 2ESVE 3CZFA 3MRLB 3UX9B 4HUMB 1OF2A 4DQOL 3WKNA 4FZ8L 5FM5M 1O7VA 2CMRH 4DZBB 5HDBE 1NCCL 1BZ9B 4HIIA 1T0NB 1TNMA 4NN5B 3L5XL 4LLUA 3GZKA 1AP2A 2EDQA 1AGDA 4FQXD 4FQIL 3QR2A 1YEHL 1KTKE 2AK1H 1VFAB 2EKJA 5F89B 2G60H 5ALCL 1DP0A 5FUZH 3CPLB 2J8UE 5E2TL 1S7TA 1LILA 3QEQE 4XBGA 3T65B 1TJGL 4EQ2A 2R2HA 4Y1AE 4YHZL 4WHTA 5CEYB 3KPSB 3FQXB 4Y4KC 4JG0H 4PGZA 1CLCA 5B39B 4HWZA 1WFOA 3ZDZE 3D0LB 4PV8A 4TVPD 5SX4I 1EAPA 3BYYA 4LCCC 5SV4A 5DS8B 3MJ7B 5HHME 1MCOH 2SEBB 1S7QB 5F1IB 5AG8A 3X3GH 1ZS8B 4OV5B 1NQBA 3V6FA 4O4YL 1DEEB 3DPBA 3MRMB 1Z6JT 5TGBB 3FJTA 4OZGF 2RGSA 4JJ5A 2DMCA 3LIZH 1IFHL 5DEZA 3RIFK 4P2QA 5KZCB 5L88L 1JMXA 4ZS6C 5GGRB 2A83B 4QEGA 5DRWB 5HTSA 4XCYB 1K4DA 4YBQD 5DJCB 1MWAA 4N5ED 1IEBA 3HMWH 1CDCA 1U6AH 5CJBA 4X99A 2B4CH 1P4LA 1B3JA 2RJMA 4KJWC 1U93B 1NANH 5E6IC 3QJFB 4F7MA 4NOBA 4Z7UB 5KS9A 5EUKA 1N6QH 4HMEA 3CSGA 3MRIA 5JPNA 4OZIA 4XVJL 2APXA 4L9LC 1DE4A 3O4LE 5CBEB 2ICWI 2YUXA 5J13C 1J0YA 2OL3L 2X1XR 4HC1A 2YKLL 5CJQH 3H9SE 4ODWA 1QHPA 1NEZB 3V5DA 3IFOB 5T5FH 1TQCC 1YN7A 1RAMA 2CK2A 4OLWL 4N0CD 1IQWL 2XTLA 5LGHL 5KJRH 1L6ZA 2W9DL 3RVXD 3C6SB 3MRHB 4V1DE 4K3JH 4EUPG 3ARFA 4YR6A 1WAAE 2BMKB 4QKXB 5JR1H 1J1XL 2Q8AH 4NIKB 1J1PL 4TNWF 2BY0A 3C6LD 4PJXF 3AB0B 4NQXA 4OIIH 1KOAA 2R2BA 4HZLB 2Z35B 4HC1H 1S9YA 4JRYA 4LVNC 3VXOB 3FT2A 4YGVA 2Y36H 5I17A 1AQKH 2QQQA 2VIRB 4X8XA 2BXZA 2QQNL 4B5EA 2DQEH 2XNAA 5I1HL 3HB3D 5GZOD 4XAWH 5EH1A 2VSDA 3QUXB 4QGYA 4XPGH 5CP3H 4MJ5A 4FFWC 3AREB 3CXHJ 2PYFA 1F5WA 4TVPL 3OB0K 3CLFH 1KCRH 1WWBX 5DRZA 1F58L 1YYLH 2A77L 3OKDB 4YHML 4R97C 2H2PD 4HH9A 4PJ9A 4HBQA 1IM3A 3QBTB 5BCAA 4JFHE 4ODTL 3QQ9D 2X4RA 3HLAB 3OKKA 2P5WB 5DQDH 3Q5TA 3GSNH 1XIWB 1I8IB 2MQ3A 1CZ8L 4NN6B 1RZ8A 3U6RB 5HY9A 3QUZB 3RVTD 3GMPA 2BOCB 4GO6B 4Y19B 5E2UL 3BP5B 2YPLE 3RDTA 15C8L 3I84A 4XI5C 5C0RL 2P42B 2FO1A 4Z78A 2B8OT 3OKMA 4ORZC 4UILL 4RZCB 2QR0A 2YHGA 4KROD 2ADIB 4PJ7E 4P9HC 1OWWA 4R4NC 5HI3C 5IW6B 3HR5A 3ZL4H 2ED7A 3SCMA 3KXFD 1TTGA 3P4NB 3DMMC 1HWHB 1FGVL 4RIRA 1AXTH 5TDPB 3TWCL 5L2KD 3QIUA 3OXSB 3K2UL 3T0EC 3VW3H 3HAEG 3C87A 3ZKMD 5B4MC 1G0DA 3DO3A 2GJ6B 3UBXG 3E0GA 1QBLL 1DQLL 5IFHL 1NH6A 1RJLB 2GSIA 3SKUD 1TQBB 3A6BL 4R2GC 5C0BA 2VTFA 1NBZA 4P2OA 4GG6E 1D5XA 2R0LL 2DM3A 1B9ZA 1DVFA 3QUYA 2V2XA 3QFJE 4KTDL 2UWEB 2AQ3A 5H2BA 5FYLD 2BDNH 1UM5H 3AUVA 3BDXA 2CLRB 5EZIH 5IJVB 3B9AA 3BIAX 1F2XK 1GL4B 4NZRH 2ZCLH 5LAXA 1RJCA 4JB9L 4ZAKC 3B9EA 4E5XA 2IEPA 3NPSC 1FVEA 4XHJD 5ISZA 2BSED 4KV5F 3UTPD 1E28B 2NMSA 4PR5B 4FXKA 2NZ9D 2WMPA 4Y5XC 4AMKH 3D48R 3NMEA 2DWEB 3FRPA 1YEGH 1G9MH 3WNLA 4CMHB 4F15B 5ESVA 3UC0L 1S3KH 1BVZA 1EERB 1C16B 3CMGA 1C8PA 5MI0B 5DD0H 1I3RB 1D6VH 5GS1C 1T04A 1MCFA 4PJFB 1XF5A 5DC9B 1Q94A 1QBBA 4I2XE 2VZOA 4JFQA 2G9HA 4EDWL 4OAWA 1FNHA 1F3DJ 1TVHA 1RIHH 1J88A 12E8H 3HE7A 2H6PB 5AUMB 3TBYB 1CICA 2DQFB 3HS0B 1MFEL 1CDHA 1MJ8L 1ND0A 4LFHG 4HKXB 4D0BB 2Z8RA 5IM7A 4M9OA 3VFUB 3U36A 4UT7L 4HQQH 4FFYH 2NY2D 1U8JB 4JREB 3C8KA 4JO2L 2E9IA 5JQ6L 4JO4H 3Q48A 3GMQA 4X0KB 3BKJH 1FAIL 3QUKB 3G5YB 1DBMH 2F58L 4XNYH 3LEVH 2W9LA 1V7NL 1W0VB 2IQ9L 3EFDH 4HXAH 5BQ7A 2OZ4L 3CH8A 5IV2B 2A6JB 4OB5H 5LJYH 3DUSA 4GRWE 1FN4B 5DJZA 3EBAA 5FGBC 1U8HA 3N1QC 2GJZA 3MNZB 4LLWB 1YQVL 1WFNA 1KCUH 3LH2L 1CU4L 4TSBH 3VCLB 1PY9A 3WUZA 4XCFH 5I8CA 4XNMA 2FX7L 4RCAA 1GGIL 5I1EL 5LGJA 3IDGB 3MUZ1 8FABB 1AR1D 4QRQB 3W0WA 5IIEA 4DTGH 3X11A 4KI1A 4KI5E 3QDGB 1W0WB 1M7IB 1RZGB 1WLHA 4XC3H 1PG7H 2OI9B 4MB4A 3BIBX 2ARWA 4R4FL 1RZKH 4LHUG 4ZTPL 5HXMA 4NC1C 1I1RA 2YC1B 3SO3C 3QEUA 3WN5C 4L5FL 1F11B 3LQZB 3MGAA 3S97C 3JV5A 1J0KA 1JHKH 5ANME 5AEAA 4HD9A 1CBVL 1FFRA 1MHEB 3VGHA 1X5HA 2EDYA 3QXDA 1RUAH 3IETB 3D3VD 3QNZA 5D7IB 5D5ME 4M5YL 1DDHB 4PJIE 5HI5C 1T1YA 4OGYL 1T5XB 4OCXH 3AFLA 4EBQL 1EJ6A 1HHJA 4WFHE 3SDDB 1F8TH 2DQCL 1VB9A 3JTSB 3WKML 2ZCKL 4MCYA 5I66B 2KQNA 1A4JB 3IDJA 5DR5H 4X5WB 1B6DA 4QRPD 3BQUA 5I15L 1WFUA 3ARGA 3EO9H 4X6DF 3HPLB 4X98B 3GIZL 1LP9A 5DHYB 3I50L 4HXBL 3DSFL 1AO7A 2XWBB 2BHZA 3TH2T 3VXUD 1CGWA 1RUKH 4HS3A 5HYIA 1NC2D 2ZG1A 5EDXA 4ZTOH 5I2IA 4MHHG 4PJEF 2ZOKB 2DYPA 5HGBA 5IW1A 2JB5L 3CU7A 5ETUA 3IU3A 1SYSB 5CHNA 1IZJA 2RCSL 5HGGS 5IMLA 5BV7B 3T04D 2CIIB 4YX2H 2FEDC 2AXFB 5EBMB 3MJGX 3OZ9L 4PJHF 5D2LE 3SDAC 1WF5A 3CDGB 4G6FD 4DGIL 1L7TH 1U8MA 1YY8A 3BYTA 4XPAH 2VLRA 2HKFL 3SKNA 1SJHA 3RGVD 4Z8FH 4CU6A 3UZEA 2WP3T 2AJXL 3BKYL 4UDTA 1Q72H 1LO5B 2Z91A 5DK2B 1SEBA 2DM4A 4KGJA 2VXSH 1OVZA 4P9MH 2F53B 1YEJL 4XPFL 1IARB 1IC7L 4HLZG 1NC4D 2AEWA 4UB0L 1J1OL 2NY3D 1W2KT 2VZ1A 4ODUB 1BD2A 1IGCH 2NYYC 5H35B 3ARPA 4KKNA 1A0QH 3NFSL 4GKOA 4NWUL 5HDQL 2Y06H 2AXGA 3D2UB 1CS6A 3CSBA 2O5ZH 5IVZB 5H37G 5GISL 1PG7W 1P69B 1A6TA 3RUGE 3PV6A 4P23B 5GGUB 3EDDA 1XGTB 2HTLC 4UOJA 2PO6B 4JQVC 3U7YH 3FO2B 3IXTA 4ZO8A 4OFKA 1HHGA 1UACH 4XVSH 4JZOA 1J18A 2VH5L 3IAGC 4NM8H 1BFSA 5EOQL 1INEL 3H3PH 1G0YR 5SWZA 3GJFH 3IFLH 3GMRA 2BNQA 3W39A 2G75A 4Z6AT 2QSCL 5C9JA 4HIIB 1J0JA 4HMCA 3MODL 2YD9A 3ZTNH 4LLUB 2HFEA 3B2VL 1AP2B 3UTSD 4GQ9L 4U1KB 5FYKH 2RR3A 1HINH 2XTJC 2NY6D 2HWZH 5FUOL 2HLFC 4PG9A 1S7TB 2A38A 3V8CA 4XBGB 1DN2A 4JQIH 2GSGA 2PCPA 2R2HB 2IAMD 4M7JL 3P0YH 4HWZB 4J12A 1ZGLA 4PV8B 1FO0H 5TQ2L 5D7SL 1EAPB 4M5ZH 3DBXA 3ARSA 5J57B 1MI5B 4JKWA 1LEKA 2BNRE 1NJ9A 2A74A 1VCAA 2ZOLA 2HMIC 3V6FB 4PJAA 4GXUM 2DQUL 5JW5A 5DURD 4JAMB 2BX5A 4ALAL 4ZUUB 5SWSE 4KHTL 1G9NL 1GC1C 3RWHB 4AEHL 4P2QB 4Q9BA 4OLVL 4RGMB 3I6GA 1SQ2N 3G04A 1ZVHA 2YA0A 2JCCE 4Z77A 1MWAB 2I60L 3GSXA 4Q74A 5JXAL 2EC9U 1ZT4A 4LPCA 3KYOA 3QG6A 4ODSH 3NA9L 4OCSL 2BVUA 5CSZA 1MHPL 4F7MB 2BVYA 1A14H 5KS9B 4YDKL 1JL8A 5EUKB 1UEYA 5B8CC 1YMMD 3O0RL 4HWNA 3T0EE 2Z4QA 3D85D 1RZJH 1VPOL 4XNXL 4XNUH 1EHLH 1Q38A 3MRIB 1SM3H 5JPNB 4OZIB 5BVPH 4NWTH 5CJ8A 4ZUWB 1DE4B 4LMQE 3SOBL 4O9HH 4G3YL 3VFVB 5JHDE 2FX9L 1E6OL 3PL6A 4LIQE 4QRUA 3U7AA 3V5DB 3DI2B 5TDNA 4JLRB 4HIJB 2DQIH 1U2CA 1FNSL 1NUFA 2AABL 2Z9TA 3FOLA 1SVCP 4LCUB 1UCBH 1IQDB 4NNPH 4ZO6A 3L7EA 2B1HH 1AC0A 1UVQA 3TN0C 1PEWA 3ARFB 4YR6B 4NKIL 3V6ZB 1UGNA 5DJYB 4NZDA 5T1MA 3VFTA 4KRPB 1QFUL 3TJHC 1HWGB 4NQXB 3TNMA 3WV0A 2XIDA 2R2BB 4A6YA 1MFBL 3STBA 1TVBA 4DUWA 2D03H 3FT2B 3TYFA 1S7VB 4EIZC 4M1DL 3RKPA 4O58L 1BQHG 1AD0A 1F4AA 5EIVA 2CK0H 5D7JC 1I7UA 3ILPA 3MJ9L 2A6DA 3JV6A 4MDIB 2E9WA 4ZYKA 4MJ5B 1T3FA 4NN7C 4UQ3A 3GUTA 4CL7A 5E7BA 1MAJA 1F4YL