3JWNH

Complex of fimc, fimf, fimg and fimh
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
279
structure length
279
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding/cell adhesion
total genus 56
structure length 279
sequence length 279
chains with identical sequence N
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnH02
4XOBA 1UWFA 3MCYA 5CGBA 2VCOA 3BFQG 4XO8A 4X50A 4X5PA 5IQNA 2W07B 1ZE3H 5LNGA 4AVJA 3RFZA 1QUNB 3ZL1A 1TR7A 4CA4A 1PDKB 5FS5A 3JWNH 4J3OH 4XOCA 2UY7B 2WMPB 5FX3A 4AUYA 4XOAA 3ZPDA 2JTYA 5FLUA 3BFWA 1N0LB 4AUJA 4X5QA 4XOEA 1KLFB 2JMRA 3ME0B 3ZL2A 2XG4B 4J3OF 2XG5B 4AVHA 4AUUA 2UY6B 5LNEA 3SQBB 1KIUB 5JQIB 4CSTA 5F2FA 5ABZA 3BWUF 1N12A 4XO9A 4CSSA 2J2ZB 5IQOA 4LOVA 5FWRA 5AB1A 4AV4A 4XODA 4X5RA 4AV5A 5IQMA 3JWNE 4ATTA 4AVKA 4AV0A 5AALA 4BUQA 3JWNG 4J3OG 5F3FA 5AAPA 4AVIA
chains in the Genus database with same CATH superfamily
1A1MB 5KVFH 3NA4A 4WGWB 2NR6D 3TO2A 1DJYA 2F1AA 2HPTA 1MRDH 1I9RH 2EVGA 4XNQA 3GLDA 3FU8A 3OAYK 1NEZG 5T1JA 4GKOA 4KRPB 2XV2A 3AG4B 1UCTA 2LVEA 2OSLB 3L5WB 1SYSA 2C5DC 2W38A 4GKNB 4M5YL 3WJLA 3UBXB 1KBPA 3IDGA 4FKKA 5FYKU 4M6NL 3TL5A 1CGSL 3JWDH 4OZ4A 3HLAA 1CTOA 1UOWA 2OTWA 3WN5C 4TL4A 1CF8H 2IFGA 3U36A 2F58L 2GJ6D 2XN9E 3JTTA 4FZEL 2FTAA 4JKMA 5ECGA 1B3JA 1BJ8A 3IDMB 3B7TA 1FFOB 3LEYH 4FZ8L 3MA7B 4UM8B 5GGQL 4P5TB 3KL5A 1PD1A 2XQYK 1U4FA 3VVVA 2C9RA 1GSKA 3HMXH 4TNWF 3OXSA 3L4UA 3NIGE 4KK8C 4PJFA 4AQ1C 1AVAA 2NQCA 2OV0A 3RWEB 3VXPB 4D9RE 3OGCB 4GAGL 7CGTA 1OB1A 1S7VB 2AQ1A 1WS7A 4AW4A 5G2NA 5ABAA 3SGDH 2WLHA 1A8JH 3DDFA 2WO2B 4XOEA 4DO4A 3ROLB 1ZK9A 3MUZ1 5ALCH 3V79C 1R19A 4ES9A 4FCAA 1JNLL 4C54A 2YXFA 5DTFA 1NC2A 1FFPB 3MV9E 2LU7A 3LRMA 4JFED 5FLVA 5FM4A 2F5BL 1H15A 1JAEA 5CUSL 3WAKA 4Y8DC 4JM0A 1MJ8H 3DPDA 4HK0A 3ZN6A 4AYBA 4BKLA 3MREA 3NEEA 4HUCA 4JY5H 2WCGA 3B2XA 1M05B 3CDGB 1X7QB 3DRQB 5FYJE 5C08E 4OCWH 1ODAA 2HJLA 4LL1A 1TQCB 1YNTB 2R59A 5T3ZE 2XETA 1PZ3A 3PAUA 4A7GF 2CGRH 5FR3A 1OF2A 3X3FH 1MF2L 3BDYL 1E28B 2NUPB 2PP9A 2A9BA 1GKEA 2R39A 2XPZA 1X6NA 2A83B 2YAOA 2V9TA 1F02I 5C8JB 4A6YA 1DJSA 5HYJA 4HIIB 4OVVA 4KI5D 3DTXB 3W11D 1SY6L 5ANMB 5D55A 3MA9L 3AJ7A 1S9VA 4TULH 5KSBE 2FNBA 2QKSA 5CBEB 2O6DA 4OF7A 5KSAA 4FA6A 2VQ4A 2JCCA 3UBXG 4LLDB 2JQZA 4HJIA 2HRHA 3EG9A 5H2BA 3ZO9A 2PETA 3ULUL 3CSPA 1MAKA 3IJHB 1JHKH 4JQIL 3C5XA 3MTXA 3SD5A 2CJUL 4JHBA 4EDXB 5BXFA 3CHRA 3JWOC 1S3RA 3KD4A 2VXQH 4QRQA 1K3IA 4ZAKD 2GUYA 1F11A 1JWUB 5C0JB 1AKPA 3BUQA 3UIZA 2B5IC 4X6DE 2OBGA 3D3VD 2G5UA 3PUCA 5BS0E 3GTNA 4R0LC 3LQZA 1W6WA 3KLLA 3E6FA 5C2BL 1Q90A 3NIFF 4HK3J 3TH3T 5KBNC 4KQ3L 4P23B 1KJ2H 3GSXB 5LN8A 5GGVY 4TUOB 1U3HD 3FFCD 4XCYB 2DQJH 3HNTL 3AW5A 4JRXD 5FO7B 3WTTA 3DVNB 1HHHB 3OR7B 3QCUL 3CFEA 4TVPL 1XCQA 1KB9K 2CBQA 5CU9A 3DYMA 3AG2B 2A9DA 1JWMB 5CSGA 4QT5A 4HS8L 3AREA 4GQ9L 3K6DA 3OKMB 2ATPB 5AW2B 5D5ME 4ZX3A 1C7TA 3AS2A 1EAQA 3W39A 3EYQD 3II1A 3SYAA 4XOAA 1WLHA 4ZXBD 5F7WC 1RJYB 1IGFH 4Y4FB 2ZUSA 3CVDA 4LSRL 2FQDA 4M43L 1HXYA 3UO1H 1T6WA 5KSUB 4LKCA 5AW1B 4ABUA 1MFBL 3O3DA 4C57C 3H2WA 2Z92A 3T1FA 3LHPH 2VIRA 2NY6C 2X4UB 1RZJL 3DJZA 4NHCL 5K1JA 3GXNA 3F12B 4MJIE 5E0QA 3QS3A 2GY7B 3QA3A 2CA3A 2DMCA 3OHXA 2EYRA 3OZLA 3TJEL 5DUMH 4XPAL 4Q7DA 5CCKL 4JNXA 1QI4A 3U9PH 1CFSA 2HSIA 3GMMA 5IR1B 4L9DA 5D7JB 2J1YA 2YC1A 3R06B 4KJYB 1TTUA 2EINB 3GTVA 4KKAD 2F8XC 5HDOA 1OE3A 5F96H 4WNJA 2GTQA 1DBAL 3DOSA 4JCMA 1L6XA 2WSDA 1ZS8A 4KXZI 3RKPA 3VFPB 4OZIE 1CXHA 3TTYA 1ZGLP 3ARGD 2HJFB 4LOVA 3LRGA 3O6FD 4QYOB 4O58L 1AGDA 5C0CB 4L8BB 3STBA 3H42L 5EFIA 2F74B 3OAUH 1WFIA 4Z7UA 3D33A 1PX8A 4PTUA 4YFEA 3PGFL 5IKCA 4IBZA 3V0HA 4DOHE 2B59B 4FNSA 5HHNA 1G0DA 5TDOA 2XX1A 2PWFA 3QJUB 2BP8A 3PABB 1IFRA 2YJQA 3VFTA 1BZQK 4E9LA 3GZKA 5K9OB 1D5BA 3CQQA 2MH4A 4HOWA 1DJWA 1MFMA 4RMUA 4PWJA 1ZHNA 4NBYB 3EJRA 5I28A 2BIMA 1TCMA 4UDTB 4YHYB 4EI5A 1A64A 1O7SA 3NIGF 5DDHB 2OMZA 3SCMB 4BZ2A 1WZAA 4TSCL 4LDEB 4XCFH 5CCHE 3L3DA 2QMKA 4W9JC 2VM9A 2BSSB 2IDSA 3L9YA 4GW1B 4U0RB 4DUVA 3N9GL 2NNCA 1W0WB 2V2WB 1CE6B 1MIML 1KFGA 4PBXA 2Q76A 3RAJH 3JWOH 4X7SL 2Y5TA 2DM2A 4NNXA 3ZMEA 4KRLB 2XWRA 5DZVA 3OSKA 4CKQA 3ZJAA 5DD3L 5CBAB 4M62L 5C0AA 4XOCA 2BCKA 3CSBA 4L4VA 4YL4A 4X4KA 1ZA3A 1ZLUK 1KY7A 2WKLA 2GW5A 3B7UX 2B9BA 3LRSB 1R3KB 3PUUA 5AKSA 2HKHH 5JW4M 2NSQA 3PQYA 5LQBH 4AXWB 4XAKD 4R7NA 1CGWA 3PV7A 4HSCX 4RGOL 2D2CC 1BOGA 1UH4A 2IPTL 1OPOA 4WO4B 5T33L 4G8GE 1BYNA 4FXKB 2H26B 3DK2A 4KVNL 3IFOB 5KSBF 4GRLA 1MCCA 1MFAH 3V4VB 3KHOA 1H6UA 1MRFL 2ZKWA 4KH2A 4P5MA 5DJ2B 3IDNB 4KK9C 5F8QC 4EKXA 4KITB 4M00A 3HE6B 1OGTA 4KK8D 3L3GB 3LV3B 3ECUA 1U21A 5CF3A 4PHXA 4A7GA 3CBJB 1OTSD 4L0PB 5EZLB 4PJDB 3H9HB 3ZMRA 2VLJE 1A0QL 2P5EB 5J13B 2YMOA 4KNQA 4XO9A 4JM4L 1BAWA 4CSSA 2V3FA 4YDIH 3RHWK 5CWSA 3RWIA 4O51B 3JTSB 4HG4J 2OJEB 5CP7A 2R69L 3C8KB 3JT0A 3NTCL 4P48A 4X6DF 5SX5K 3T0WA 2CHZA 5L7XL 2ZZUT 4ATWA 1G7IA 2DTML 4U6HB 4DQOH 1RK0B 2EIDA 3TT1L 3T4YA 5IJDC 3MRJB 3TIDB 3ESUF 1JG9A 1NC4B 4OFVA 2D7NA 3TU6A 5E9DD 3UACA 1W0VA 3L2LA 3HAEG 1SXNA 4A37A 2WGNB 5DQJB 4NQVB 3UAAA 2F68X 1KXQE 3QJOA 4Z0XA 1T66C 1Q9LB 5D5MF 5KW9L 3V5HA 2Z65C 1EBPA 5CZVL 2ZSVA 5DK0B 1SF3A 2VITA 4QMEA 3KCPB 4F8QA 5EEUA 4HIJA 2XWZA 2GAZA 3HC3H 2DW5A 1OKEA 2EQDA 4OZHE 2ED9A 1MW1A 4LO9A 3KYKL 3GSNB 1LO5A 2XZZA 5B3SB 4YGVB 3D25A 3LKQA 4R8WH 1I1AC 2NXYB 4I5BB 3WEXB 5F3BA 1XXFC 3IJ7A 1D9KD 1FNGA 3RWCA 1DL7L 3L5HA 4J27A 1S7UB 2OTUA 4KX9A 1U2YA 1FAKT 4JHZA 1MHPL 4H44C 1UT1A 3NIDF 4XAWL 1NEZA 1WIPA 2I85A 4OT1H 5I0VA 1AJ7L 2JWYA 1FYTB 2VISA 3PIQA 2WINB 4I0PD 5F6IB 4OZIF 3ECBB 4XNMA 3BKJL 3VX0A 2EVFA 3DV4B 4ONFL 1RPUA 2J25A 1OY3B 2AVFA 2GUOA 2ZF9A 3CFKA 4LCIH 3OKNA 3QZLA 2Z31B 5E2JA 1QR1A 4AJWA 1JPGB 1GPOH 2JKRM 3C2SA 1E6OL 3RVUD 4TTGA 5GHWH 3GEWB 2FYYA 3BH9A 3MCKA 3ZXAC 4JDZB 5LBSL 4FERA 2ADJA 2OYPA 4Z3JA 1OAZH 1CLZL 3CZSA 2GY5A 3VWJB 4PGBB 1SNRA 4R5VA 1JCKA 3SYCA 2W60B 1MCWM 1FNEA 2AHIA 1FL3A 1M71A 2J5LB 1NM9A 5ABDE 3T4AA 4CJ0A 4YO0A 5ID1A 3SDAA 3VDCA 3B8SA 3BUYB 4IHOB 1BFVL 5EU4A 4LLYB 4LEOA 4MCYA 4YLQT 1CIUA 4ODTH 4DZBA 3K2MC 1WV7T 2WKOF 4M4PA 3WBDA 3P4LA 1G0YR 1UZGA 2R1WB 1VCBC 3MV01 4Z18A 2QTVA 1D5RA 2ALWA 4QHKI 3HIZA 2JLPA 4PRAB 2XN9A 2ZWSA 5D7EA 3WFHB 2ZF8A 5F1NB 4U3CA 3BW9B 1G94A 4JM2B 3MRKA 2APFA 4HDIA 1RZKL 4J23A 1S7SA 2MMXA 3R4RA 1A14L 1BA9A 3UTSB 3QFJB 3R0MA 4F9LC 1D5MA 2YD9A 4JFZL 3X12B 3WD5L 3VD1A 1IGCH 5IBLD 1VB9A 3FTVA 3RJDA 2CO2A 4Y16A 3WKQA 3PWJB 1HL5A 5AYTA 4Y5YC 3S96B 1EJOH 3QQ9C 2OW6A 1MWAL 4FHJA 3I9GH 3FQXB 3Q2CA 3TVMC 2FBJL 1DCEA 3GMNA 5DO2D 5EZIH 1IAMA 3B9VA 3PNWA 2DQDH 3MSPA 3MV9A 4FJZA 1DSFH 3W9DB 4DWHA 4I2XB 1XBDA 2APXA 3PHAA 1NKOA 2ZOLB 5T1LB 3ATFA 4U0QB 2XPGB 1U8KB 4FN0A 1J8KA 2VLMD 5IHWA 4NZFA 3BWUC 3FT9A 3N1FC 4O02L 2HG5B 4EBQL 4HIPA 5C08A 4FNTA 2K0RA 4XN4A 2AJUH 1ULVA 3AAZB 3G04A 1KGCD 1L5GB 1AD0B 1CFNA 2VXUH 3HS0C 1F3JA 1KT2B 2APBA 2VGLM 2APSA 3LRKA 3MA7A 4OIFA 3SDDA 2JXMB 1XD0A 4Q6IA 4QXGL 1JFQH 2VMDA 3QEUB 2XN1A 2ADGB 1DUYA 1E5CA 1MCPH 2FCBA 2O61A 2JIXB 2KYIA 4NI3A 4AUJA 4FABH 3B3BA 3W38A 2WCSA 2V5YA 1KLFB 2DZEA 4PJ8B 3G5WA 5HHXH 3BZEA 2J57A 1JERA 2CIIB 3QXAB 3WIIL 3UZVB 5KSBA 1ZPUA 4P2CG 2WQXA 4DP9X 1YEKH 1RLWA 5GSVA 4AUUA 1NCJA 3ROLA 1BREA 5I75B 4HUXB 4ZQKB 1N5AA 4FA7B 2R23A 4N1CA 1ZK5A 2YAFA 3G3LA 2QLVB 4P46A 4RGNB 3IDIB 4W9HC 1CD0A 2JF1A 1WWBX 2K6WA 4UI2A 5IREA 1LE9A 3UBXI 3S8GB 5E99L 4APQC 2J20A 4V1DB 1T7ZA 1TENA 4BSWB 4WU7B 4X6DA 4HS3B 4A63A 7PAZA 4M6MH 3DVGB 5BS0A 4X7TB 1ECYA 3KPNB 1EFXB 3MN8A 4OCMC 1XBRA 2X6CA 5AW6B 2CGYA 2V7HB 1LTXA 2DLFL 2XA3A 2XA8H 4MHHI 2O6FA 2AK1L 4A2DA 2Y3NA 3O3BB 4XBPA 1G6RA 2HXAA 4I7ZC 3ARQA 3ZHFA 3KLHD 5JYMA 4GRWB 3MLXH 3SKOA 3D0VA 4HCRA 5FGBA 2BMKB 1YY9C 1GGYA 5D5MA 1I7UB 3IBEA 5KYUB 3MRBB 3JV6A 4LESA 4BFIB 1FBIH 2DIBA 4ZQTA 2BP0A 3LN4B 1EXHA 4LLDA 4OCNC 3W81A 2N7SA 3STLA 2KZBA 3ET9F 1A66A 3MRHB 1N2RA 2AV7A 3QQDB 4UB0H 4AX3A 4P4KB 2NT1A 1U2HA 4AGNA 3CE1A 2DEXX 2KS0A 3MFGB 2UVEA 4LFHG 4KTEL 1XIWB 3GHBL 4HS6A 1MEXH 2WWKO 2FNWA 5JR1H 5FOJA 4WGVB 2LU4A 3QXDB 3HG1D 4PJEF 4MJIA 5FB8B 4M3KB 5IROC 3LMJH 5IEHA 3MRCA 4LSUH 3N40F 1THCA 1V7NH 2P5WE 1I1CA 1TYRA 1KCUH 3FOMB 4M29A 4P23A 4RX4A 4P0DA 1XH3B 1AXSB 1T66D 1ZDSA 3UERA 4G9FD 1JGUL 3W5NA 5DD5H 3RZWA 3MOQA 5DT1L 3KYNB 5AKTA 3QW9A 3UJIL 4NUGH 4Y2OA 3KBEA 3NEOA 4NX0A 4OY9A 5LB1A 3M07A 5KVEH 1RUML 4GRWE 2B9AA 3HE7C 4MB4A 3CZLA 2EUZA 4EQ2A 3OX8A 3NN8A 1WTGT 4L5FE 5HJ3B 1JHTB 5L88L 1RJYA 5ADOL 3EUUA 1XHHA 3LKOB 5IMOB 2YA0A 4GQZA 1MI5E 4MLIA 1HTYA 4Z23A 2JKJA 1FRGL 2E86A 2X9WA 1VENA 3HG4A 3KPMB 2MNWA 4MCMA 1ZEAH 5KSUA 1MRCL 4WHYG 1PNDA 5EF3A 3E3QC 3SN6N 4OJDH 2G60H 3FO1B 4AZ8A 4J4PA 3HJ0A 2WO4A 2B1HL 1IBZA 5DZ9A 2VDMH 4OJFL 3TA3B 4AYGA 3L5JA 4FQLH 3N1PC 3S4SB 2WPGA 2ZUQB 3BZFA 3ZKNC 2I07A 5JW3L 5DSCA 1WHPA 4G6AC 3BN3B 1W72B 3IU4L 4S1SH 5KG9A 3APCA 4GIOA 2Q7YA 5GJSL 3RVXC 5EULV 3CU1A 3PWNA 2E6QA 3Q8FA 2ZKHL 1N12A 2IDTA 1FNSH 5AAMC 5IR1A 4HWEL 1XGUA 4WEMB 1HKLH 1DQJB 1FVEB 3VXMD 2CXKA 3AWFA 4MJ6A 5D4IA 3OV6A 5FOBB 4XWGH 4XH2B 1YEDA 1QACA 1P5VA 2WUCH 4EQ3A 2OMYA 1HHJA 2NT0A 4R84A 1D6EB 2HJFA 3I6KB 5HDWA 3D07A 3KMDA 3MNDA 1EERB 1V3MA 5C0CA 5AALA 2F19L 3UEQA 1X5GA 3NACH 1QAWA 3PF2A 1M3JA 4N8VB 5ICZA 1IC7L 3EFDH 2R0ZL 1U8PA 2A1WL 4P49A 1E4XH 5B8CA 2KQNA 5E00B 3QEHB 5KJRL 5KBLA 1R0AL 1A7OL 5IMLB 3K6FA 4FYTA 3MLUH 3GSUA 5DHDA 4JO5A 4HUNB 1YJDC 3SKMB 3HNSH 1GH7A 1AQKH 2PMZA 5E5MB 1AQDB 3R8QA 4JO1L 3RNQA 5DDHA 1CR9L 1OT4A 1G9MC 2FT7A 4OTXL 2E7LC 1XGYL 3GMOA 1JZEA 4G8GA 4XCEA 2MIZA 1A3LL 5TQ0L 1KFAL 1WICA 3O4OC 4PJIE 1QSFE 3CDZB 2WBJC 3LTVA 2IBGA 2EH7H 2XZQH 3NCBB 4AIXA 4TM9A 3HAEA 3GKWL 1DBKL 4WHTB 3QNXB 4M1DL 3N06B 4OUUB 1MW2A 1GZHC 1YYCA 1OP5H 2EH8L 3VNYA 4V33A 5A7BA 1PGRB 2WTOA 1I75A 3F8UB 2E7MA 2RBLA 1MCRA 3L4WA 4N87A 3ARDD 2VLJA 4OB5L 5LG1A 4HZLB 3N43B 2EDYA 2EICA 2XN0A 4OF0A 3QARA 5HHPB 3VGAB 4ZNEE 4MJ5A 1H8NA 4GAAA 5EO9B 2I9LB 1HDMB 5DURB 2AXHA 4OD3H 1P5UB 3TVMD 4BSVA 3H0TB 3QJHA 4FP8H 4NJ9L 5CIPB 3G5XB 1T21A 6FABL 3FULA 1NGPH 3U4EA 4OFIA 3CD4A 3MGTB 1IVLA 4CAGA 2ERJC 2RHEA 3PP4L 5E6IA 1ZHBB 4X6BA 1OW0A 1N5YL 1J5IA 4MB1A 3FDWA 4BM7A 5LGJB 4B41A 3WLBA 2IFFL 2XN2A 2D03L 4NHUB 2OMBA 2H26A 3IFOA 1KXQA 1XQ4A 1ZMYA 4XXWC 1YEFL 3V4VA 3T2QA 2PUQT 3APFA 2VE6B 3AGVA 1A25A 2J6EL 1KXTB 2OZ4H 3L6FB 2QDWA 3L3GA 4N8VG 4ODVL 1XF2B 4M9PA 3ZTCC 1L7TL 1C1EH 1TKWA 2QSTA 4PGEB 4PRIB 5AUMB 3S37H 4K9EL 4OZHA 4AI7A 2JSFA 3PFUA 3PU7A 4OM0H 2Q1EA 3IXAA 3MKGA 1I3VA 4JFQB 2J8HA 4NIKB 5CILH 3EYSL 1PAMA 1UXSB 1JRHI 4I4WA 3WNLA 4FQXA 4MQXC 5GZNC 5BQDA 3OKLB 4ESKA 2WZPD 1NCCL 3C8KA 4L8SA 4ZUTB 4UQ9A 1CFVL 5SV3A 3SDYH 3U1SL 1OAJA 3P30L 4Y2LA 3QIBC 5EUKB 1RK0A 1FFNB 3NP4A 4F3FA 2ENJA 4LCWD 3MRJA 4K71B 5IFAH 5KJ7E 4IKKA 3V4UH 1LO4H 2WTRB 3FQTB 4ETQA 3AZUA 3RU8H 5GRYA 4YN3A 4G6JH 4FHKA 3ZRSA 3IVKA 4Z0BH 4OGAD 3UROR 3K5RA 4UT9L 1FL5A 1FZOA 1QA9B 2WXNA 3L3IA 4K5MA 3P4MA 5JLZB 1CMOA 2Y7SA 2WJ5A 2ZXWB 4X4YA 1SHWA 2Q8AH 1Q9LA 3K80A 3TS8A 3MRPB 1A7QL 4HKJA 5DK0A 3J2PA 1AHKA 1KB5A 4CN1A 3KCPA 2Y7LA 4XP5H 3FPYA 1OEZW 4XO3A 4X4XA 1CVSC 1F86A 1VFAB 2AQQA 3OWEA 5I1CH 4D3CH 3ULVD 4PRIE 5J6HA 2EXYC 4G70B 2NY3B 4JDTL 1ND0A 5AKVA 3EJSA 1OAQH 1YY9D 1XMWA 1THAA 3A6CH 4NUMA 2OX5B 5CN2A 3V0WL 1CG9B 1FHNA 3QUMB 3BUDA 1I9JL 4G3YL 4GQRA 2FJFA 1NJ9A 4XTRD 4DO5A 5F7DB 3KGRA 2FIRT 3FZUC 3QWQB 4FKEA 4WI7A 1KCLA 3PWUB 1UA3A 4QY8B 43C9A 1HSAB 4ODWB 4PY7A 2VDRH 4PMFA 2YAPA 5I74C 3CFJB 1AIZA 2AAAA 3DPBB 1S9YB 2AKRB 2GITA 2O5ZL 4UQCA 4UCFA 2PF6A 4MCNA 4WY7L 2NX5E 4LRNH 1IFHH 2I7OA 4Z7OE 4NRYB 4Q9CA 2RIKA 5IROD 4KI1A 4IRJD 1UD4A 3RWDA 2J7LA 2C7FA 2YPKA 2VSCA 4YIQA 4RMTA 1A2YA 1Y7VA 5JOFA 4K2UL 5JHLH 2DQHL 3DXAE 2A4EA 3PL6A 5C3IA 4RBPH 3ZVVA 3HC4L 1JPSL 2B8OT 5FFLA 2DQGL 4JDZA 4D8PB 3VCLA 2OMUA 3ZT7A 1NUNB 1GGCL 1ZRUA 3TBVB 1RQ5A 2XZCL 5KYWB 3ETTA 3FUDA 4XPFH 3VWJA 5L6YL 3WJLC 4PGBA 1LGVA 3D0LB 2W60A 4F8TA 4UQBA 5IQOA 4YAQA 1NGWA 1HZHL 4JFFB 4OJAA 4AV4A 3V9FA 1J7VR 5SWQA 3P11L 1L6ZA 3U7YL 2X4NB 2LGNA 1KIQA 3ME0A 3OLIA 5LAXA 3ZQWA 3ZDWA 1ACXA 1LMKA 3UPCA 5CNHA 3A4EA 2F54E 2FE0A 3QCVL 1C5BL 5CJXC 5EU6E 4ZBJA 3S9DB 3ZKND 5GGRB 1OP3K 1MDTA 2FWOB 1DDTA 3QORD 5ACLA 4XWOC 1BVNP 1BZ9A 5E1AB 3RVXD 3T3MB 5FA4B 2ZWLT 1T89A 2V6HA 3QHTC 5HDRA 1C7SA 1MWOA 4JM2A 3T3PF 2MFNA 2J55A 4YHNB 5LWYH 4XBEL 1FO0H 2VDNL 5HBBA 3NEXA 1QBBA 3N42F 5AVXB 3II2A 1TQTA 5EOTB 5GS1B 4LLMA 5FUZL 3U46A 4HHAA 4WCYH 1KEGH 3WY1A 2H6PA 4BK4A 4Z3TA 2IPUG 5DU7A 5C0BB 4LSVL 1KTLA 1DQTA 32C2A 2DKMA 4LMQI 4IRSC 3O4LE 2YPLB 4OLYL 3ZKMD 2F9BT 2VSMB 2Y24A 3OJMB 3DSNB 4TF4A 5FUCC 4DH2A 4PIRF 3OJ2C 1X44A 2GK2A 1MLCB 4DGVH 3CX5K 3APMA 1QUNB 4MS8C 1LD9B 4WF7A 4QRUA 3UTOA 1TEGA 3OB0H 4NP4H 2Z8SA 4HJSA 4XN2A 5IGXL 5DFWH 1X5JA 5DZNA 2Q2EB 3DTDA 5IJVA 1QBLH 5FX3A 3RWGB 3EO9L 5C0FA 1D5IL 3GO1H 1XH0A 4O2EB 4DPCX 3EBIA 1A4AA 4Z76A 3IDJA 2R9HD 5AWNL 5I17B 1IKFH 1TYJA 1YYLL 3OKKA 2HG5A 4PS4L 5IB4B 3ABGA 1MCJA 1HHIB 1PQZA 5CD3A 2ICEC 2DBLL 1OPGL 5T5FA 1IV8A 1L5GA 1AD0A 3BFWA 4H88H 1NGQL 4R83A 1TTRA 4HFUL 3RPKA 2D0HA 4LASL 4PV8B 3ZGIA 2ADGA 5KZCD 2YQBA 4G7SB 4RGMC 2WVTA 1K4CB 1FPTL 5KSAC 3HRZA 1KZYA 2ITCA 2VR9A 3WIHL 2HH0H 2QADD 1KLFA 1B2WL 2IPKB 1UT2A 1RV6X 1WCBA 2CIIA 1T04B 5J9PB 3P0VH 3BKCL 3IE4A 3WIFB 4H8PA 4PP1D 3FRUA 1SLWA 3SKUD 1BM7A 4M5ZL 1EEYA 3V0AC 2Z35A 4GI6A 3MTRA 3TBYA 4C56D 1DCLA 3MJ8B 4KY1L 3N2JA 2H3KA 1XDTT 4U1KB 5DJ6A 1P4BL 3RIAF 4ENEC 3LRLA 1Z32X 2CDEB 5LCVL 2QKIA 1I9IH 4PHZA 1UHVA 5A3ID 1MJUH 3B8YA 1X5ZA 3TXAA 5J12B 3RTLA 3H7LA 2YGVA 1FF5A 1CC3A 5KVFL 5D70H 4V1DA 2Z3FA 1E8ZA 3CLWA 3SDXF 4BSWA 1MRDL 1I9RL 2V2TB 1WYJA 1Q38A 4DAGH 4X7TA 4W70A 3P73A 4FD0A 4QTHA 3S3JA 2P5WA 4X8JA 3O6KH 1ZLSL 2VNCA 3AREC 5I6NA 2G9HB 5IB1A 4FQPA 2EP6A 1S8DB 5AB9A 4J3OG 1IARB 3NJHA 4PJ9A 2NY2C 2IALB 4J3SA 2BSRA 4X7DC 5DZAA 4E0RA 1LP9F 3O3BA 2Z8VC 4N2AA 1O9VA 3FU5A 1CF8L 3NA9H 4ICWA 5GGTA 5B39G 4TLKA 3QUZD 4JHWH 5D93B 3TBCA 3PWLB 5AZ2H 3MRNA 1I7UA 5KYUA 3MRBA 3LEYL 1PPIA 4N6QA 4WAFA 1TJHL 1IIIA 1S9WB 2CUHA 3MXWH 3IMRA 3GSQB 5DVMA 3MX0A 3QQDA 1MREL 3HMXL 4I48B 4KJPC 4Z7OF 4N8PA 1GW6A 1RVFH 1M7UA 2IC2A 4YBQC 4WI5A 1ZLWH 3A47A 3BAYA 1MWAB 1MH5B 2MCPH 2EIEA 3OHXC 3ABZA 2IAMA 1ZS2A 1AR2A 2Y7OA 4PB9H 4ZX5A 5JTWA 5CZRA 4P3WA 2VYRE 2IMNA 2VUYA 3T1WA 1DVXA 3MJ7A 3VWKA 4U3SB 4RAUB 1VDGA 3WMQA 4F57H 2VUKA 4ZOAA 1AYOA 1SVCP 4O02B 5AB2A 1MJ8L 3VFWA 1ACYH 4NO0D 3C5ZB 4JY5L 5ICUA 1NFIB 1YA5A 2E8YA 4OCWL 2VDLB 3MBEC 1FDLL 2MQ3A 2HCZX 2WAQA 2CGRL 1BZ8A 1L9SA 3RWFA 1SXZA 3X3FL 4HIQA 3E1ZA 4DEWA 3KYMB 3TFKD 1PEWA 5DJ0B 5DWPA 5HJ3A 3VXOB 3NJXA 1J8HD 2R29A 3UG4A 2W88A 3KPMA 1VZIA 2EABA 4F8LA 2OMXB 2MOVA 2O6PA 2GJRA 3BWAB 4YDLB 4EI5C 4HKBA 1A1NB 4N8CH 4GT0A 1JE6A 1NBZA 3UL4A 5GGSA 4K7PY 3LNGA 1SN2A 3CAFA 1JHKL 5HI5C 1W72A 2WZ5A 2YD7A 3H9SE 4BZ1H 4JFHD 4NPYA 2X70A 2VXQL 2W0FA 1B2YA 1HCVA 1N26A 4PJIA 3KPSE 1QSFA 3RL2B 1C16A 3IDYB 3JWNE 4YHKH 5EO1B 2OL3B 1QRNB 3WGVB 1NPJA 3DX7A 5B1KA 4ZTOH 1MXGA 4XH2A 3MV8B 5CR1A 2VC2H 2QQLL 4NQDB 3FFDA 3WS3A 2BFVH 1KJ2L 4JUTA 4KNSA 3RA7H 1EHXA 4UTCA 2NNFA 1GTFA 3N44F 3AQYA 4AGOA 2W65A 5HY9B 2DQJL 3W1ZA 4NS0A 4ZNEA 1SF5A 3TYFB 2XQ0A 3I3BA 3GXIA 2QGCA 4MSWA 1IC4L 4YK4C 3IF1A 1IAIH 3Q8CA 4WWKB 2OR7A 1XGQA 3QEHA 3WHXA 4Y2DB 1LO2H 4R4BA 5IMLA 3DUSB 3EZJB 3TJHC 5A2KH 3IAQA 3PP3K 2QGBA 1BIHA 4LHJB 3QUXA 5EZPA 3ASNB 3TN0B 2X0UA 5FDWA 4LPTA 4UV4H 3SKMA 1IGFL 2ALAA 4GRLC 4NUJB 1KLUA 3PWPE 4UIMB 1YECH 1AGFB 4XWOD 3UO1L 4NCC1 2BERA 2FO4B 5DD6A 2L0DA 4GUPA 3B5GA 3I74A 2VERN 1JSYA 4LU5H 1KN2H 1ZA6A 3WLWC 2HFFB 3LSOB 1TEYA 1CDYA 1MQ8A 1NL0L 3S36X 1IQDB 1KJ3H 4AC4A 3MFFA 4WI4A 4NQDE 3FQ2A 3RE0A 3CMOH 4GG6E 1UJ3C 1CZ8H 1IEBA 3NSXA 4S1QH 4DGYL 4HC1A 5T3XE 4P07A 3S48A 3M17B 5EA0H 5IBUB 4F1ZA 1CE1H 1NC2D 2BP3A 1OM9A 4HVBA 4PJXB 1M3IA 5FA3A 4MX7B 1GIGH 3IRPX 3QWOA 4Q2ZB 1NCNA 5J06A 1Q9WB 2ORBH 3H0TA 3BVNA 4HOXA 2R1XA 4MS8D 3G5XA 4I9XA 4P59H 4YFLF 5DMGC 1H8OA 3VGHA 1FGNL 2RQ8A 1YDPB 3V0FA 1J9RA 1XGPB 4K3JH 2CLVA 4JN1L 4J28A 1JGLH 4WI2A 4JPIB 1XCWA 3OAUL 2AQRA 2UY7A 3NPSB 1OCZB 3TASA 3HC0A 4RH4A 4JKPH 4LCUA 3RWJA 5HYJD 5L4FA 1S3KH 3QIWB 3S36L 2X28A 2WXPA 1NINA 2DQIL 2NLJB 1CI5A 1UEYA 4M4RA 6TAAA 2UZXA 1CFQB 1X5YA 2B1AH 5KSAD 1KXTA 4N2EA 2FATH 1AKJA 1IM9A 3L1EA 1F8TH 3WCYA 3NBNA 4PRIA 1H3UA 3F5WB 3WNMA 1MPAH 2HAZA 3FT3B 3VI4B 1ILUA 3BSGA 2AXJA 4BZ2H 5KANI 1F6AB 4J3WA 3NUKA 1SQMA 1INQA 7PCYA 3OKOB 4YHZH 3QWNA 3A21A 3OKLA 1XAKA 4QR7A 5E94B 5FW6A 5KBKA 2AZAA 3RAJL 4ZUTA 3JWOL 1KYUA 3FN0H 2YUZA 1T4KB 1ZXQA 1DFBH 4KJQD 3DVFA 1TFPA 1T1XB 4AJ0A 2AXGB 4ZS6D 2QQQA 3FQTA 3EGXB 2LOEA 4WFEE 5HVHC 2N01B 2VMJA 1N18A 2X09A 5JPNB 1CT8B 2NX5A 2X38A 1JVOA 1RSYA 3QAZB 1L9NA 4L1SA 5DFVD 3ULSA 1WJ3A 4XMPH 1L9TA 3SKNB 2X4RB 3FAWA 4DKDC 4HV8A 3Q1EA 1OAUH 1ZV5A 1E7VA 2XWEA 5F88A 1EO8H 2CGZA 3ARED 4NZ8A 3MRPA 5I76A 2WWNA 2XTSA 3C6LD 5AQ0A 5F7YC 2I32A 3DXAA 3HCVB 4U6YB 5FGSA 3HVDA 4WW2F 4YUEH 3HI6L 4GXFA 1AHMA 4RISH 1ETZA 3ALWA 1LO0H 4MA1C 2E59A 3T4AC 3QUMA 3DK0A 3CFNA 1P84K 3SDAC 3P1VA 2A9CA 3BWSA 4N6RA 5BVJB 3RTQB 5E8EB 3WDIA 4A38A 3V0DA 1G5GA 1YSOA 4KJPD 1HSBA 3VD2A 5JZ7C 2N7AA 1PFCA 4IIQB 3OLGA 4ONGL 2EIZA 2CD0A 1PZDA 2VH5H 2PWGA 4GW5A 3DPBA 2JELH 4XO5A 4PLKC 2QV2A 2P43B 3ILEA 4IQHA 4BFRA 4QAWA 4YDIL 1S9XB 3QT2A 2F54A 2I7SA 5EU6A 3MV7E 5F7LB 1FZJA 1ZVHA 4PJBE 2KDGA 5SWZD 2IQ9H 1NMCB 3S88L 1FSKB 4WSKA 4DETA 1HJCA 2YUWA 3S3PA 1M1XA 1NUDA 2OXGA 4DQOL 3GIVA 3SHSA 4QWWD 3IK2A 2P8LA 4HULB 5HHOE 2FQGA 4XNXH 2K78A 3NPZB 3MQIA 3MYJB 4Y16C 4XVJH 2P28B 4AYFB 5GRJH 4JDVA 4HWZB 4G59C 1K2DB 3C87A 2BO0A 3EYUL 2WLNA 1LK2B 3TBVA 5KYWA 4BKTC 3O4LA 4MJJA 4GBXB 1AHWB 1DQMH 1HQ4A 3D69B 1U33A 1KTDB 1GCYA 2YJLA 4JFPB 3MGOB 2ZT9C 5I5MA 2TSBA 3S35H 3UJJL 4NQTA 4Q97A 3D39E 4WHCA 1HVXA 3VFNA 2X4PB 4BUQA 1M2VA 1HK6A 3TEXA 2QZ5A 5TH2B 4GNKB 4ZPTA 3GB7A 1XAUA 2BRQA 5DHVH 4AVIA 1HOCB 5I15L 1HT6A 5HI5D 3SDDC 2Z4QB 4NN5B 4Q6IC 5D1XE 1UURA 3QK0A 1H3WM 4GG6F 4CVZB 4K94L 4W6WB 3JVGA 5DGQA 5JIHA 2ED7A 3NCCB 2Y06L 1T5XB 3AFLA 5EOTA 1FWXA 4LE8A 3DROB 4OT1L 3ZR6A 5C0AD 5GRVK 3BISA 1M6UA 2ZUWA 3RGBA 1FLTX 5I2IA 4L4VD 3DIFA 5BZDA 4MWFA 3CQFA 3Q5YA 4GXUM 1J18A 3AMLA 1TZHA 2BZCA 4G71B 3B2VL 4HH9B 5TPWH 2C3VA 1M6OA 4GXVH 5IJCC 3KYAA 2MPAL 3KYOA 2PPCA 2AXFA 5LN4A 4HD9A 4P46C 4LCIL 3IGAA 4GKZA 2X7LB 1GPOL 4LPYA 5B39A 4G1EB 3PQYD 3FSWA 1MLCA 1TOXA 4K23L 5CJ8A 3V6ZA 4EI6B 3ZT6A 4Q4EA 1Y0LB 2WWMD 1I3RB 3T6ZA 4R7DA 3K46A 3KW8A 4ENZA 2GTWB 3FHQA 3SPJA 3BSZH 35C8H 4PSRA 5ESVA 1ADWA 3C60A 2VZ1A 2CK2A 2D7TH 5I17A 4GRLD 5H94B 1OHQA 3TNNB 2LLGA 1HHIA 3EGSA 2VERA 3OR6B 3DIDA 1YPZF 2NY7H 4X0KA 4L3EE 2YQ3A 3O8XB 1UT9A 3QSKB 4KUCD 1ZWIB 3UG3A 3UTQA 3VM5A 5FECA 1FI8C 5FGBC 4PV8A 2K9FB 3C08H 3FT4B 2XNAB 3NFNA 1QVOA 3I6GA 4KPHH 4L4TE 3B6SB 2YO3A 5JIMA 1EGJA 2P44B 4Z7WB 4ZW3A 4IU3A 3HZKB 5IK3A 1T04A 5J9PA 5BOJA 5L2KB 4UBDD 3FF7A 3BP5B 4EUPG 2BHZA 1I4FA 3R18A 4LPVA 2CKBA 3SY6A 4DQAA 1RIVH 2PKDA 3MJ8A 4U1KA 2R8SH 4NZTH 5E70A 2CLRA 5E1QA 1SLVA 5HPOA 3JT2A 1RIHH 5HD8C 3F62A 3MLTA 4JJOA 4EDWH 4LVOC 4IBLT 3H3KA 2V7NA 5JIIA 2GSMB 1UGKA 4GINA 1BD2E 4QCIA 1MJJA 3VFGL 5K33A 4GXUN 4XXCA 5FWQA 2YD4A 1NFDE 1EJOL 3CFMA 3H2PA 2YWZA 5AOJA 1IT9L 3I50L 5EZIL 2Y5EA 3MVSA 1OAKL 5DK2A 2DLIA 1A22B 1DSFL 1CICA 4PY8J 1NPUA 3BYYA 15C8L 4AK1A 4I3RH 1OAXL 4LDOB 3K8KA 1KB9J 1MVUB 4ABQA 1BZEA 2NY4C 4DEPC 4KZEH 3OF6A 5H8DA 4JKKA 2HRLA 4KZCA 2XYBA 3CFCL 3KLAB 3PGCB 2VDNB 5T3ZH 5I66A 1NBVL 2VXUL 2DMGA 3TV8A 3INUL 3FCSB 4EVNB 5A40E 3HZYA 2JKSA 1A4CA 1ASOA 4I85A 3BEWA 4Q9QL 4XE5B 2OM5A 1G6VK 4J4PC 1T83A 1QQDB 3RFZA 3LY6A 1MCPL 1MLBA 4I48A 5B21A 1KENL 4N9OB 4OAWA 4FI8A 1Z0NA 1NCWH 3D4YA 1G87A 2G75A 3O0LA 5KBMA 3QUYC 2Y07L 3TO4C 5HHXL 3IS1X 4JHAH 4ZZFA 4PIBA 5TQ2H 2EO9A 2ZWYA 4JFEB 2N56A 5JW5B 4IOFC 4M5SA 4UTAL 2DL9A 1HN1A 1RY7B 3P02A 4FL4B 1UUNA 4QGTA 2PP7A 3ZPDA 4MA7H 2OPCA 3H9SA 1KCRH 1IU1A 2G2RB 3B3IB 2P8MB 4HPOH 3X11A 4GEJA 1KELL 4D0BA 1LHZA 3KPSA 5AW4B 1FAIH 3V7MA 1PZ5B 3H3PH 3VAEA 3IN2A 4M6ML 3ZE1B 3FBQA 1QW8A 2W59A 3MRFA 5C0DA 4OD2A 3C6SA 3AB0B 2YN3A 1MNUH 2R1YA 4QRRB 1SUHA 5CP3A 1NDGB 4OLZH 4F9PA 2YHGA 4JY6B 4NKMA 5DMIH 3IGUA 1FLRH 5DJZA 4G7VL 4HYTB 1JI1A 4HAFA 3K6OA 4H8VA 4NKOB 4HCRH 4YSUA 1BWWA 1P1ZA 1UA6H 3E2HC 3KWUA 1FBIL 1KPRA 2XV3A 4QI3A 3VQ2C 4PAZA 3QFDA 5A2AA 5AENA 1OE1A 3LQMA 5J5EA 2PTTA 1J10A 4ZW7A 4DHLA 3PWPA 1MKFA 3EHBD 4KH9A 4LLWA 1SM3H 5E6UB 4W6YB 2X2UA 1F3RB 5JHMA 5DEGB 1U3HB 2OL3A 3FFCB 1JPTH 4D9RD 4IOSA 1OGAE 4L8CB 2OCFD 2QHLA 1D3CA 3ZE1E 2LW3A 3LMJL 4NQDA 4MXWH 3HLKA 1J0HA 2ZPKH 4LSUL 1YCSA 3VXRB 1KCUL 3GMLA 1RPKA 4GG6A 1B0GB 4Y5VB 2XV6B 2VDOL 3T08A 3FB8A 1JF1A 4X5XA 1CL7H 5DD5L 4AQ8A 3TCLB 4DTGH 3MV9D 3RZCB 1TQUA 1U95B 1NWPA 4ZFOA 4B9PA 1NLDL 2GIYA 3GRGA 5KVEL 1NAMA 4ZXBB 1MFVA 2AJYL 3MNMA 1X7SA 2NCMA 3GM0A 4YX2L 3TV3H 4F7EB 4DKAA 5DEJA 5FYJD 5C08D 2H5UA 3VXUE 1IEAA 4HALA 3WUWG 3QXVA 4LHUG 2XTJE 3VJ6B 3QJVB 1UB6A 3NK4A 4C83B 3X17A 5C92A 3SDDD 1N64H 1KBVA 3CQPA 5L2JA 4KTDH 2WVSA 1UQSA 4XHJC 2DQUL 2BSEA 5F0PB 1X9UA 1YMHB 5KVDL 2G60L 1URZA 2VDML 4OCSL 5IT2H 3P9MB 4FQLL 3LPWA 4EJ1C 1FZMB 2DH2A 1C12B 3VRIB 3SD2A 5AVYB 4G9DB 1HWHB 4L3AA 4S1SL 1AY1L 1G4RA 2X6UA 2C9UA 3A24A 4L8SC 1B4RA 4B0MM 2F61A 2DKUA 1FNSL 1IGYA 2J88L 4XNYH 1N3NB 5DA0B 3WXVH 2V9UA 4ZOEA 1WC7B 3ARGB 4ZUVA 4P46D 1EDHA 4ODSL 1ZT4B 5ENWA 1KBGL 3ZYOA 1NFDF 1Q9WA 4H0IA 4XN7A 3RB5A 1QBAA 4P8QA 4ZW5A 4JPKH 5BUGA 3OC5A 5DMKB 1QPPA 1DDHA 2EDMA 4O5LL 2O72A 3O2DA 5BS0D 4KK6C 3N1MC 4AMXA 4DIXA 2ZOUA 3Q06A 4BEIA 5IMKB 4NQCE 1EZLA 2C1OB 1GJIA 4AWJC 2NYYD 5KSVA 1LE5B 1LMIA 2LTQC 4GW4A 2ZCKL 2G0KA 4LGPB 3WIAA 3WFEH 1QOKA 2EKJA 1DVUA 1SEQH 2DWDA 1HE7A 2E0PA 3UOAB 3DMMA 1J0YA 1DQDH 3MLUL 5HDBB 2A6IA 2K3TA 1GGUA 2PWHA 5IHUH 3QJTB 5BMFL 5K9QG 1CFQA 1QLRA 4MMZC 2AANA 3ULVL 4CADB 2E3VA 3IMBA 1M7DA 1AQKL 3U2JA 3G08A 1A1OA 3MUGA 4ILDA 3CVBA 4I18C 4JL1A 4ODXA 3U30B 4AT6B 1UZ6E 4ZO8A 1JXFA 3THMH 3SQBA 4JHUA 4XPGH 2YBRB 5I8CB 2FR4B 1G7JB 3LH8A 4OF3A 4G8EB 2DKSA 4TMPA 2ZYRA 3HAEH 1KJ2B 2AEQH 3KJ6H 3M1BA 3HTLX 2NSXA 2H32H 3UZQB 4MCZA 4ISVA 1Q94A 4JVWA 2FX7H 1FG2A 1BM3H 3FTSA 1YEIL 3GLAA 2AXGA 4GMSH 4P23D 4P2YA 4TNVF 5JPNA 2CDGA 4S1RL 4PW4A 1QNZH 5KJ4A 1S46A 1X4YA 2EDDA 3MV7A 2YD8A 4PJBA 1TJGH 1ZKAA 1MG3C 2X4RA 4TVSa 3BPOC 4P57B 2AS5M 3WN5B 4E41E 4OCXH 1AS6A 3PL6C 4KV5E 4PGCA 3ARVA 4LB8A 1GOGA 2X4QA 5DGRA 1GVIA 2ILLA 3WYRA 1YAIA 1NGPL 2CHWA 2ICWB 3WMSA 1PFOA 4WI9A 3DHUA 2OJ1A 5HHOA 2J3SA 5FO8B 3EAKA 4PJ5B 1EEZA 3TTSA 3LXBA 2QFPA 4IS6A 3QRBA 2EIMB 4IKIA 2HLAB 1URIA 2DIJA 3CH1A 4G6FD 3LIZA 4LIQH 5B1JC 4AQ1B 1B9ZA 2YRBA 4MD0B 3I9AA 3MLRH 1A6WH 1BQHB 1N0LB 4NKDB 5E8EA 4R7VA 5E08L 4J4PD 3G6DH 3AWEA 1SQ2N 4HQQL 4BQBA 5DRXA 1IL1A 1T1ZB 2OZ4L 3CBRA 4ELMB 4X8XA 4PRHE 3ZSTA 1C1EL 5ILTH 1MSPA 3DHJA 1BCIA 4MLSA 2JKIS 3D39A 3V0IA 5HYSG 1R34A 5CILL 2W1NA 1S9XA 1M56B 1T89C 3T5WA 3DV6A 4N2LA 1MCHA 4NFDA 3CPLB 3OPZL 2VW6A 5D1XA 4YHIA 1GZPB 4NUQA 3BRFA 5E9DB 3IJEB 3VNZA 1MZZA 3WXWH 4CW1A 3V6FA 3EXLA 3RGVA 1PLAA 1NCAL 4P2RE 3W82A 5JQHC 3V4UL 1LO4L 5J6SA 3PDOB 4NERA 2BOBB 5ID0B 3N0PB 5C0CD 2DQ6A 1C08B 4PG2A 4L23A 1NMAH 2QSCH 4AYFA 1QLEL 3STZB 4HWZA 4NQSB 3SZKC 1T0MB 4WWNA 3B2UC 4F7MA 3KLQA 2PPEA 1T6VN 1YEHH 4QDGA 4R90H 2A4CA 3WFZA 2W0PA 3SJVB 43CAB 2MSPA 4WENB 1S5IH 2EDLA 1AHWA 3D69A 3NFPB 1KB5H 4BCYA 4XP5L 1MFDL 3PRZA 4BH8B 3TESA 5GISH 5I1CL 2X9ZA 5I1IH 2BVQA 1OAQL 5J1AA 4GO9A 2PR4H 3U1QA 3A6CL 2X4PA 3C5JB 4EUPA 3IAPA 1YJDL 3FB6A 1FA4A 3C09C 4G8GD 5I0XA 4HKXA 5TH2A 4FQQA 2F7RA 1FE8L 4U1JB 1CDIA 2Q86B 3NSYA 3EGDA 3MACH 5G5DA 1G9ML 1HOCA 4Z7QE 3WDHA 1E8YA 5ESQB 2B5IB 2WUBH 3H9YA 1KMGA 2ATKA 1HCZA 3G5VA 3T0DA 4R0LB 3HRZC 4R5TA 4JW3A 3RX8A 4OLXH 4L3EA 1A4BA 1A6ZA 4HUVA 1T5XA 3UBHA 3P4NB 2VLJD 3KNBA 1IFHL 4I9WD 4NQEE 4U33A 2VRKA 3D05A 2Z0UA 4L4TA 4XN8A 1NGXA 2YK1H 3F85A 4MKTA 1SBSH 2AJXL 2WZ0A 2OA9A 2I26N 2OR8A 4HH9A 3V5DA 3ZE2E 4BFOA 3N0AA 3AS3A 1ACCA 2QKIC 1IAOA 3O3UN 5BW7C 2X7LA 4GP5B 1KGIA 3IM1A 4EI6A 5DHYA 3C8DA 5E6ID 4FQHB 1HXMA 3KL0A 2ZX9A 1I3RA 4OD1H 3EW3B 1VEOA 4Z5RA 1HILB 4QF1A 5ESAA 5B1AB 4XPFL 1BD2A 3HUJE 5AAWC 2UZYB 1NFDA 5H94A 3AACA 4FNQA 2NY6B 4J5VA 4PVNA 2X12A 1V5JA 1ORQB 3FOLA 4JO8A 5SX5H 2X4SB 4PJ9C 3WS6C 1T7YA 2GSGB 4R97C 3MODH 2ZG3A 1UZ6F 5K59F 1JNNH 1NCIA 1M9SA 1NDMB 2AMUA 3B4NA 2G3XA 3LPPA 4KQ0A 4LP8A 4L3CA 3IMWA 2P5ED 3LVEA 1I8IB 1GOFA 1HQRA 2R2BB 2YPVA 4OIIL 2TRYA 4X6EB 4FQXD 3FQYA 4UQ3B 5E2VH 1U9KA 2JQMA 3MNVB 1NANH 2Y0SA 1TO4A 2JVUA 4GIPD 2B08A 2JK5B 3QNFA 4B9GA 3F7VA 1A4JB 4B50A 3BP5A 1FO0L 3I75B 1TMCB 1QSZA 3DUUB 1MAJA 4G8AC 4L8DA 2IAMC 4KQ4H 1KG0B 5DO8A 1KEGL 1HYSC 2XRAL 1FV1B 1KJMB 3U25A 4K07A 2AP2A 3GSRB 4K7PX 5E2TH 3HI5H 2VLLB 4KV5F 3X1NA 3DX3A 3VWKC 4AIZB 1YEJL 3MNWA 5EUOE 4QXUL 2P8PB 4BJLA 3A22A 4X7EC 2XJKA 2BRRH 4K3EH 4PLNC 3US0A 3PREA 4U1IB 5K39B 3QNYA 5HGAA 4DGVL 4UTBL 1JK8A 5TK4A 4GB9A 4Z6AT 3BH8B 4NP4L 1CYGA 1ZT7B 4X2UA 4M3HA 4UZUA 3WFDH 1QBLL 2HYMA 3GO1L 2D31A 3TCTA 2XKNA 3MROB 4XNUL 1U58B 2VXVH 4IBQA 1IKFL 2NXYD 3EOAB 1QSEB 1OSZA 1VFUA 5IG7A 3TYGH 3PGCA 2GTZB 3MJ6A 4B9KC 4B6ZA 5KTEH 3BKYH 4PI0A 4ZPVA 2DQTH 4MXVE 1MCNA 4HHGA 1YO4A 4ELKA 3ARFA 3L8QA 3AS1A 1WVZA 2FGWH 3OAZH 1U93A 4ONHA 2BNRB 1ZANH 2P7TA 3LN9A 1WWWX 3VH8B 2EKSB 2OCJA 1UWEL 3LZRA 4U6VH 3VB9A 2ZAGA 3B9KC 4FG6C 4E5XB 2M8XA 1E5YA 5C9KA 5ITBL 4XP6L 4X80L 5TGBA 2GSIB 4ANUA 3GMPA 3BPNC 1CDCA 2EXTA 4B9JA 2D4DA 3L95B 3V4PL 2RQEA 4PRNB 1A3ZA 3PL6D 1I9IL 1VF5C 2KL6A 5H4YA 1CYXA 3WUWA 4EZMA 4ODHH 1RHHB 4LHUA 1F4HA 1E2ZA 1X9QA 3P4OA 5DWUL 5J3HC 4MXQC 4AGPA 4JFYB 1PLGH 3PHOA 4JG1H 3S3BB 5I18H 2WKGA 4BUGA 2A3TA 2Y2YA 4WKZB 3SO3C 5D70L 5I6MA 1N5YH 4QIRA 1GS7A 5C9JB 5IB2B 1OGAA 5D1QE 3VWJD 4BYHA 4N25A 4NRXA 2YEZB 5ISZE 5H37H 4KXBA 1OM3H 3MMEB 3VQMA 5I6OA 3O6KL 4FLSA 3VG9C 3RIFK 1RD6A 2H2PC 3TT3H 4BWTA 5HHVL 3BUIA 1YUHA 4QRRA 2Y7QA 3D18B 1JN6B 4HGWB 3GSVA 4NZUH 4UNTA 4EE2A 1TTFA 4FF9A 4DK5A 2WQWA 3QUXC 1U42A 4PUBH 2EVHA 5DJDB 2OMTA 3BLKA 4X9GA 4QHPA 4OFYA 4ZX4A 3MLSL 4AKQA 1BJMA 4P2AA 3OAWA 3VXUA 1UB5B 3SSGA 4L5FH 3O3AB 1FN4A 3QXWA 2CMRH 3CWGA 3HHSB 2R2EA 4RZCB 4JM2D 4U4BA 4JPVH 1SXBA 4A7UA 2BLFA 4KDWA 4U1MA 3GBNL 4HIEB 3HG1B 2R2HB 3QEQE 1BFOB 3AU0A 2QPEB 4HEMA 2YXMA 3ZE2F 5DEFB 5EIIG 2H4EA 5D72H 1DTUA 1SHXA 3O11B 4X6FB 3OJDA 4G9FB 4PB9L 4N5EC 4L8CA 3LB6C 2W91A 4AENB 3E8UH 4JFOB 1N6QL 3EYOB 3BC9A 3VH8G 1B0GA 2H41A 4XX5A 3FHAA 4MVBC 2EZ0D 4NXKA 4HGKC 2BJMH 1Y18A 3VA6A 5GS0C 2APTA 3RZCA 1U95A 2X6BA 1IGTB 2C3GA 2FUTA 1I1AB 2H47C 3Q44A 3INOA 3RY6A 3DX1A 5AVSB 1HIMH 1F13A 1GYUA 1OF0A 2YD0A 1PTZA 5I1AA 5MHSE 4LT7A 4N28A 1ZVSB 4LFHD 4D2NA 3KEHA 2VXSH 1BVOA 5F7EH 2A0LD 4W6XB 1OARL 3O9WA 2FZ3B 2Y2TA 4A6YL 5CN1A 1OGSA 3B34A 4FCHA 5D1ZA 1NCGA 1EEQA 1OSPH 1F4WH 4CVWA 4ODUB 2IJ0C 1P7KB 3GGWB 5DYOB 1L9RA 4F15C 3NSCA 5DS2A 2ZJSH 3J27A 2X0VA 2WIMA 2YGQA 1FZMA 4PR5A 1NSNH 2BW4A 4A68A 3QQ3B 2E75C 4XRCB 4WV1A 4DJMA 1HWGB 3OG4B 5F9JB 5D7IB 4KVCL 4E36A 4UWQB 4DEUA 2DJMA 3SPHA 4BA8A 4RGND 3VXTA 4Y0GA 3EH5B 5K9JL 1IBYA 1PKQB 2COQA 2WNWA 3MO1B 2I24N 4HFWA 5BJTB 3CFBA 3AG3B 3ULUF 2OK0L 4NCDA 5DMKA 3LQAC 4V1DD 2BFVL 3G5ZA 3GHEH 1A4KB 2LR4A 4DVBB 3US1A 3V0VA 3F7QA 4FMKA 2CR6A 2YD2A 2P5WD 1AGBA 1ZJAA 1I9EA 3D30A 4XVOA 3X13B 4NO5A 3FQNA 3JV0A 5E23A 2Y1AA 2YMXL 1RJLB 5IQMA 1VGEH 1XF3A 1EAOA 4PJ9D 4JB9L 5HVFB 4JBSA 5HYSA 2UYLB 4S2SB 3O2VH 1QZNA 2DJSA 4E41A 1BAFH 1OCRB 5T1KA 1LO2L 3OC8A 5F44A 1P7QA 1J8RA 2ZX5A 4P04A 3SGEH 3LEXA 4MXVF 4R96B 4CC4A 3WY2A 2RFXB 3NFSH 2BVPB 2BVUA 1Q9KA 3ABLB 2DQMA 3N43F 2A73A 2CXGA 4FG2A 3H7BA 2HMIC 2Q2LA 4P4RB 4UZGA 3BPLC 4FLHA 1RULH 5I8EB 5E4OA 4EF3A 2FR4A 2FD6H 2GQHA 3GIZH 2XWCA 3VFOB 1BP3B 1KJ3L 3RURA 2IAMD 2QVFB 4Y5YB 3UZQA 1OCWH 1A6UL 5DRNA 5IUSA 3CMOL 4PRHA 3FQWB 1X5XA 4P5KA 3TVMB 5FC9A 5EBLA 1MFCL 3DARA 4HC1H 1K9TA 2BNUB 1G7PA 3BP6B 3J7HA 2RAMA 5CEZE 2CDFB 4WJ5A 1E5BA 2J8UB 1T1YB 1PLCA 1CU4H 2ORBL 2BVOA 4YSCA 1LEIB 3ESVF 3WN5A 4P59L 3DO4A 4Z77B 5MEQB 5GS0H 1J0JA 4KNUA 3BP7A 2R83A 3L2MA 2ICES 2KKQA 4XNBA 4AOFA 1JZ8A 1Q0XH 2NNAB 4G7YH 4HW6A 4P2RA 1X5LA 1DVFA 1JGLL 5FO8A 3HS0B 4YE0A 1LEKA 4XPTH 4JZJC 5D6CA 2R27A 3DX8B 5HGHA 1ZGLB 3HN5A 1ESOA 5EZJB 5JORB 3K72A 2VDMB 4WTXA 5DUPL 1S3KL 3MLWL 4LL9A 1NKGA 1J1OL 4B96A 1YEGL 5BO1H 5CCJA 1PZCA 1JYNA 4XVUC 3KGUA 4UQDA 5F9OL 3TA3D 4ZSOE 4WJG3 4N9GA 2H0JA 2JJSC 4ELMA 3TZVA 4M7KH 2BY1A 3U4BH 3PJNA 1F4XL 3LNFA 5L0QC 2VLRE 1TXKA 3BOVA 4YC2C 3LZFL 4Y1AE 3D87B 3UG5A 2VL4A 5IMMA 1I7RA 1P2CA 1IKNC 1R3LB 1T1WB 5EIQA 4E9XA 1IILE 3EO0A 1CBVH 1QSFD 3JVGC 4APQB 3POHA 2E7BA 5I5JA 1QHPA 3FW6A 2O26U 3BX7C 2I9TB 1AZCA 2K7QA 1DFBL 1YEEL 4P5RA 1BZ7B 3CCHB 3HFMH 3CZNA 4MXQD 4NDMB 1A6PA 1GAFL 1S7RB 3NJFA 4MA3B 1NLBH 2ICWI 3LQAH 4NQEA 4W4OC 3VI3B 2A74A 3VG0L 2N3JA 2V17H 4FI6A 4MDIA 4UDUB 3ZDZB 1OAUL 3ASOB 3Q13A 2CIKB 3L5XH 1S7TA 1MVYA 4QJ4B 5IW3A 3D2UB 5ACZA 2C34A 2Z4TA 43CAA 5CS7A 4OCYH 3H3BC 4B5ZA 1JS4A 5AG9A 3L4ZA 1TO5A 3C60C 3CX5J 3PHQA 3QUXD 1K5WA 1F1AA 4DGUA 2YGOA 1R3IL 4Z78B 1AQMA 4RISL 3S2CA 4FQ2L 1LO0L 2TRHA 2ZCHH 3FB7B 3GJEA 4X98B 1J05B 1C5CL 5GXBB 3E80A 4G5AA 5FW7A 1RMFL 1G9NC 3HUJA 2Q86A 4N0FB 1L7IH 1MHCA 2NW2B 5A16B 4HJEA 1U8NA 2C8NA 2WXJA 4YSSA 2L7UA 4FNLH 4YNYB 3MLYL 2VH5L 3BHBA 4R0LA 2ZOKB 1ORSA 1YNLL 2UWEB 3LN5A 4NNPH 8FABA 3K2UH 1L0PA 3SBQA 5E7BA 1IGIL 1LO3H 1MW3A 4IBVA 1UYWL 1TSRA 5T1MB 1JPFB 1FNAA 4N5ED 2F7PA 2HFGH 1WT5C 1CDHA 4F7CB 2IQ9L 1CK0L 1XFPA 1K4DB 3L5IA 1H9DA 2VL5B 3BDBA 3O6LH 5DURD 1BVKB 3BAIA 4MZIA 5L9DH 2YRZA 1I1FA 1RK1B 4MVBD 2DQEH 1E9OA 5FFOA 2VAAA 4R6UA 2H8PA 4XNXL 2BC4A 1J9SA 4MBRA 5GGUB 3EOYG 3WY3A 3LNDA 4JZNA 4PGDB 4GH7B 3SBPA 1HILA 4KXZH 5IVOA 4C4BA 4NOFA 3T6WA 1KDJA 3E6HA 2YD5A 5I30L 1B0IA 3POCA 2NY5C 2Q8BH 3LJ3A 4FMFA 5EUOA 1CICC 3CLFH 3QVAA 4WEBH 3FL7A 3GM8A 1ORQA 3T0VA 2X6VA 1AKJD 1CYWA 4KWUA 1IM9D 2VLKE 3RIFF 1Z5LA 1O9ZA 1NDMA 4LF3B 4PRID 2GCYB 3WMPA 4HOMA 4J3XA 4IEFB 2VN7A 1G1YA 4NO2A 1SHSA 2BHUA 4YSEA 1E8WA 1D7FA 2BCMA 3MR9A 2HVJA 1KF9B 3RFZC 4LSSH 4XE0A 2JK5A 4NC0B 4WW2C 4NB7A 1J5HA 1IE5A 1NEPA 4UQ2A 1JD7A 5AG8A 5DMJB 3PPSA 4CN6A 1UENA 3NZ8A 1JHLL 1KG0A 1KV3A 3CHSA 4M7JH 1FV1A 3GK8H 2X3CA 3VMPA 1VKXA 3SEPA 2NX5D 1Y07A 3VRJB 2FLBT 2BVEA 2DRUA 3BVDB 1EXUA 4P2QB 5FKPB 1TVBA 1GYVA 5TPWL 4AIZA 5FF6B 1VLXA 3T0AA 4HSQA 2P8PA 3DA0A 1AO7E 1HI6A 4JO2L 1SOSA 1S78C 4NGHL 1RUQL 4U1IA 5K39A 5CZKA 3UPRB 1ZCRA 4BQ9A 3JWNC 1HHGA 4DKFL 2NSMA 2W9EH 2Q6WB 4PV1C 5EOQL 1RUKH 3DX2A 35C8L 4HCFA 2NY3D 3QUHA 1OTTD 4FFWC 1U30A 4TUJB 3TBTB 3DHMA 1SXCA 2VDRB 4LPUA 3NCMA 4F9PC 3I6SA 3MLZH 5KZCB 5CJQH 4LLQB 5D2LE 1B4JH 2W95A 4PJCE 3RL1B 1GR7A 5ISZA 4EIUA 5EIIA 2HMID 3WNPA 1G9NH 2PCPB 5EO0A 2J4WH 1ES0B 3GBLA 3WNKA 4YH6A 2V9QA 3L3JA 4P99A 1KBBA 2LLLA 4RNRB 4QJ3B 3MLVL 3DOIA 3VH8A 1QX1A 3ZBMA 3ZE0E 1EGJH 5F1IA 3G6JB 4F24A 3NGBC 4JFVA 4Z3FA 1DFXA 4IYKA 3DSFH 1KJVB 1XF1A 2XFXB 1MCFA 3TIEB 4IMKA 2CKBH 4XB7A 2CO7B 2EDQA 2ERJB 4PJ7F 4NZTL 1LEGB 2WQUA 1TU2B 3S5LG 4UUJB 2O30A 4EDWL 3KVDD 1VPOL 2XKUA 3QEQA 1QPKA 3GJFA 5IJBC 3BSHA 4DKTA 4L18A 1J1XH 1VERA 4JPWL 3GXTA 2OJZH 2LABA 4UMGA 4AQ8C 3FO9A 5F0MB 3O4LD 4F33B 4M5TA 3BRDA 4U3HA 1OP3H 4Y4KA 1QZ1A 4EXPX 3DI3B 4JFFD 1H9VA 3QUZB 4O9HL 2L3BA 4I3RL 5GSRA 2NY1C 3ATDA 3SY0B 1N6VA 4A7QA 1JN6A 4XVUD 3WL9A 3IFNH 5I1DA 4EIGB 1YZZA 5FYJL 1PJWA 2EXWC 1FO0B 1XL4A 1Z0MA 4WW1B 2D0FA 5FPIA 4O00A 3I6LE 4O2FB 3QIBB 3EFFB 1UZ8A 2GI0A 2M26A 4M6AA 1XF4B 3O3AA 1MAML 4MASA 4LSDA 3HHSA 1IKOP 3QHZL 5IHZA 5HGBA 1FH5H 4HIHB 4XMVA 2YOCA 5GGRY 2XWTB 5FXCH 1NCWL 2ZP0T 1FGVH 1X9RA 3GZPA 2VXTL 5FYKH 4HIEA 5K9KA 2R2HA 3U0WH 5EPMB 1R3JB 2ENQA 2ROYA 1CXFA 2K6ZA 1EJ6A 3KPPA 3O11A 2HLFD 5GZOA 2UX7A 4J3OD 4TPRH 1RHFA 1YC8A 1XB6A 3F7YB 1P0SE 1U8JB 1ZSHA 4K4KA 2LU3A 4LLAA 2C7UB 4AENA 4Z3EA 4NO0B 3SQOH 3PGDB 1UG9A 1OD7A 3K4ZA 4MA7L 1KCRL 2B2XH 4QRPB 1TZGH 3JV5A 4TV3A 4F27A 1BPLB 3BFOA 5I6PA 4HPYL 3BGMB 3LZOA 4PWFA 1FAIL 1IGTA 3KPLB 5I0ZA 2OP4H 3JWNH 4QOKE 3C60D 4E42B 3L3KA 5A7EA 3BEVA 3H53A 4G7QB 3LKPB 3D48R 1TZOA 4BHUA 2A9ML 5I5IA 5GJTH 5IB5B 1DBJH 5C2UB 1YAZA 3PCYA 4JG5A 1ZSDB 3DMMC 2BWQA 5I74B 1K8IA 1DHKA 3ALXA 4R4FL 3OL2A 3BE1H 5JO5B 3FUJA 5DMIL 1NGZB 1YC7A 1H5BA 3GWJA 5CHNA 5AD0B 4JRLA 1G6RL 1WE5A 1RH8A 4JK0D 3KPTA 4D0CB 4D0DA 4YEFA 1RZIB 1P7KA 2VAJA 4HCRL 4TSAH 4WI0B 4KO9A 5E1HB 1OZUA 4DW2H 3JTBA 4ZMAT 1UA6L 4W93A 4ABVA 1Q1PA 4G6MH 4X42A 2OYKA 3D50A 5ANHA 1DJIA 4NWUH 3FUIA 2XACC 3QDGB 4IGBA 1Q4NX 3OXRA 3VXQA 3ORJA 3W0WE 4AQZA 2HP4A 4GMTL 3L9BA 4ZT1A 1JPST 1SM3L 1CD1B 1SZNA 7TAAA 3TO2B 1TYEB 4XNQB 1JJUA 4ORGB 3TPUB 1JZ2A 1N59A 5JA8B 3AU1A 4JZOB 4LARH 1J5OH 5PCYA 1SYSB 2TSAA 3W57A 5BJTA 3KVQA 3AM8A 3I02B 4RETB 3UJTH 1PD0A 3IDGB 3NAAH 1Z9OA 5AB1A 2HKAA 3WFBH 4OLUL 5MENE 3HLAB 4DVBA 5B7FA 2GBAA 5T3XH 2OTWB 1CL7L 2BOCB 2MCMA 4DTGL 1PLBA 3O41A 2C9SA 1CICD 2ADFH 3X13A 4E9TA 1Q0YH 2C9XA 5EOCJ 2L4OA 1E3ZA 3JTTB 1RIUL 4UINH 4XCCH 1C5DA 3N41F 1NAMH 1OK0A 3OLDA 1YYML 3IXTA 3ROOB 2UYLA 4S2SA 3B83A 2D73A 3QPQC 5D2LF 3TV3L 1KIUA 1H3GA 2V5TA 3C9NA 3LZQA 3PV6A 3OXSB 5JDSB 3L54A 2A38A 3DRTA 4M9OA 2BVPA 5DD0H 3LEVL 4JS7A 4DP2X 3RGHA 4KTDL 1GGIH 4OFKA 3CN4A 2AJSL 4ZFGH 4PJXF 4FQ1H 4L37A 4F9LA 3K4DA 2WLLA 3S2AA 1KTCA 1HEZB 3OMZA 5FGCE 5T5NG 3S3CB 5IT2L 2F8VA 1NC2B 1AR1C 1X5MA 1LNUA 4IRSB 4WI8A 4XT1C 1BPVA 1LDPL 4ZSOA 3R7QA 2EDTA 4Y5YA 5CU5A 4A1RA 5KUKA 1H15B 2VM4A 4GKSA 4YGAB 3DLQR 4AYEC 2NUTA 1AD9B 2XLLA 4HK0B 1RZFL 1SEBA 1X7TA 3MREB 4KO7A 3LS5H 4XNYL 5D1XC 3T77A 3WXVL 4Y1AA 3CN3A 2KLTA 3HOGA 1WZKA 2HJLB 1BAGA 3RGVC 1XH1A 1S78D 3EH1A 2ZNXA 3NCYS 4MNQE 1OF2B 3KPSD 1YMME 4L48A 5FM8A 4XHQA 3C5ZD 1LEIA 5I9QC 2VW7A 1V3KA 3O2DH 5C09E 2ICEB 4PG2C 4DZ8A 1TVHA 1Q8MA 3ZDYE 5ALBH 4A6YB 4FFWD 5HYJB 1OL0A 3RDTA 2CQVA 3HS0A 5DVLA 2P24B 4NC2B 1R9FA 3DX8A 4YHLH 1S9VB 2HT4C 3QDJB 5GQBA 2WTPA 5DCCA 5EZJA 3WFEL 1SEQL 4RGMB 5KSAB 4NPJA 3Q0HA 3EG9B 5H2BB 4DN4L 4PB0H 3RI5F 2UZIH 1V3JA 3NABH 1EVUA 5IZ7A 3H55A 5BXFB 3CIQA 4JFXA 1WAPA 4QRQB 1AFVH 3ZO0A 4W9LC 1AG0A 4NXSA 5D4HA 1A9BA 2D3NA 4Z3IA 1BSIA 1NIFA 3UC0H 3LQZB 1T1WA 1TSHA 1Y6KR 3KJ6L 4DVRH 4AV5A 3K4AA 4APQA 1BYOA 1YUKB 4IOSD 1YRKA 2DM4A 4ZODA 3CK0H 1T0PB 2AMGA 3MV8D 1PSKH 4NQDD 5D7JC 3CFEB 1XCQB 3PP3H 3FUEA 1IM3B 4R2GC 1FIGL 3WTSA 2IOOA 3AITA 3EADA 4QT5B 1QNZL 3AREB 5T3XD 3QDJE 1P4LB 1HZKA 2X42A 1TJGL 4I1RA 2GJ6E 2NY2B 1RJZA 3ZDXB 4EIZC 2YUVA 3ALPA 4YSOA 1CVRA 4OCXL 3NT0A 1ZXKA 2CIKA 3S6CA 4A2HA 3B1TA 3RY4A 3D2UA 2F7OA 2NY1D 2WN3A 5BZZA 4Y2DD 1AYRA 3OGOE 1U6AL 5D7LE 1HXYB 1DQQB 4P9MH 4L0ZA 4AEFA 4FYQA 2E9JA 4LKCB 2ZG1A 4CMHB 3L3OA 2R56H 2Y1YA 5D71H 2CR3A 3T1FB 2NY0C 2CBMA 2VIRB 2FH8A 1NCDH 3LIZH 1T7XA 4NQUA 4RMWA 1F6FB 3GT6A 3T0XA 3Q7JA 3QI9A 2AW2A 4U6TA 1U36A 3KDMA 4CGTA 2BSED 3V4VL 3ABKB 4WNSA 1WZ1H 3OHXB 3B2DC 2EYRB 4YHYC 5DR5H 4ZUUA 1Z3RA 4F58H 3I3EA 3GMMB 2J73A 1M42A 4OLWH 3REVA 2YC1B 2ZOKA 2D7OA 4JO4H 3MOAL 4MS6A 3SE4C 3U9UA 4UF7C 5LBVA 4MQ7A 1G7QA 2VLKA 4PCTA 3DOSB 3HPLA 5J89A 5F3HA 1ZS8B 1R75A 4UOZA 5KVGE 2YXWA 2HFTA 2VZOA 1ODUA 1K4DA 1DZBA 3QYMA 5F7HA 2IBBA 4N0CD 1AGDB 1WFJA 1RSFA 2FX8H 2DYRB 5FCUH 1QFWM 4AH2A 5EFIB 1ZT1A 3MBEB 4P3CH 3HE7A 1A3RL 4Z7UB 2O6CA 3AUWB 4PTUB 3FQRB 5IKCB 3ARPA 1G5AA 1D2OA 3N1QC 5HHNB 3SDCA 2YAQA 3ARTA 2MEJB 5TDOB 5L4JA 1ID5I 4POUB 5BVPH 3IMTA 3L13A 2QSCL 4UAHA 1HZLA 4WFED 4R90L 3ES6B 2A6JA 2FL5A 3DMMD 3QJXA 3BLPX 4E2OA 3GSWA 4EI5B 3GRWH 1HX0A 1KB5L 3QIWD 3EKCA 1NA8A 2OMZB 1AO7A 1WAAE 2O5YH 2HN7A 1AQHA 5CXPA 3L4TA 4JLRA 1KTRL 5GISL 1V7MH 2FWLB 4PRPE 4YMPA 1NQBA 1R24A 4GSDH 2V0AA 2Y1VA 3DKHA 4YXLL 1MVFA 1AE6H 2BIIA 2Q76B 1A6TA 3D3VE 4PJAE 4N26A 2Y5TB 4P05A 3BXNB 3S5LA 1SMAA 2CU9A 3P2DA 5IFJB 3FMGH 1N8ZA 1F56A 5EOCH 2WUBL 3ARFC 3NVQA 5FK9A 1XV8A 4M03A 2VJXA 5D2LA 2ZCZA 4PJCA 5C0AB 4G83A 5J13C 4JRXE 5CGYC 1ZA3B 5TD4A 4TUKL 1CBJA 3MJWA 2EUVA 1R6VA 4ZTPH 2HRGA 3BN9C 2WSPA 3BVUA 5CZXC 4OGXL 3S0PA 1DZ0A 3CC1A 4ZW8A 2YK1L 2OSYA 3PQYB 3CSFA 3MV7D 5JNYA 2E27H 4P2QA 1SBSL 1DP0A 4N1EA 4YK4B 1G84A 4R7NB 5FF6A 2K4WA 3ZDYF 1IAIM 3CN1A 1P6FA 4ZMLA 2X1XR 1BOGB 3QIUA 4OBSA 4X5PA 2VSDA 4JQVA 3MBWA 4OSUH 4XVTL 3UPRA 5HHOD 1KOAA 2XWXA 4LSQH 5LNGA 4AVJA 4GRLB 3QZBA 4OD1L 2AABH 2AI0L 2RD0A 3B7RL 4P5MB 3ZYJA 5K93A 4G8IB 1BYPA 5E6ZA 5BV7C 1RZGA 5I82A 1F97A 5IFHL 3TJPA 1OGTB 3QRFM 1RUPH 2WBJA 4JO3H 4FG4A 2PO6A 1ZIBA 4Z7NE 5EN3A 1X5IA 3IRCA 3CIAA 5DJXA 4S1DD 2V9RA 1Z9PA 3MODL 1GZHA 1TZAA 3OMNB 4KKCD 5CWSB 3RWIB 1GXEA 1ZPLA 4BDVA 3Q6GH 5CP7B 5EEZA 2BIHA 1UOKA 2F5AL 1AR1D 1G7IB 5FEBA 2G2NA 4H2AA 3ISYA 2YPVH 5E2VL 5DLLA 3T4YB 2XTJC 3KG5A 2A9AA 5D2NE 2EC9T 4NRZA 3CSGA 5JHLA 1DQLH 5D1XD 2AVGA 3M46A 2C4XA 5F89B 3UMTA 2WWOA 3DNKA 3TIEA 4KUZL 1DBBH 4I87A 3F84A 3NCJL 2NZ9D 4KQ4L 2QSQA 3K91A 4Z0XB 2L7EA 3V5HB 1KB3A 3CSYA 1MFEH 3FO0H 5E2TL 1L0QA 3VYPA 3EOBA 2IQAB 5I71C 1GRWA 1IE4A 4KJWD 3ZTDC 1XXDC 3MZTA 1F41A 4JAMB 4K55A 4HIJB 4KK5D 2Z31C 4YHMH 2YIHA 5I6KA 4AE0A 4XXWA 5AZEL 1TDQA 2IH3A 3CNKA 5LHDA 4K3EL 3S8FB 2HT4D 4TQ8A 1GGBH 1LO5B 5SV4A 1WBZA 5A6MA 3HG3A 2JQAA 3D25B 1QYGH 3LKQB 5E2WL 2BSBA 3VFUA 1F58H 2GJZA 5DHVB 2JKXA 1S7WA 5F3BB 3WFDL 3VGDA 3SY0A 3KEDA 2VXVL 2GB2A 4IJ3C 4QOKA 1W15A 4W68A 2X89A 3GZQA 3HZMA 3WI9A 1T3FA 3L9RA 4KVPA 3TYGL 3O9WC 4HJ1A 3IJYA 4UANA 5KTEL 4U1NA 1DE4A 1PX4A 3BKYL 5T5FL 4EZJA 5E2UH 5D1ZC 1NEZB 2DQTL 1BFSA 3QIBA 4OIBA 1W2KT 2VISB 3GPSA 3PIQB 4LEXH 5F6HI 2FGWL 2UXVA 5E9NA 1XGTB 2J43A 4HIHA 2PXYC 4D9LL 5LGHH 5HVHB 4XNMB 3MRGA 5LKNA 2JLLA 5EU3B 3B37A 2ENYA 3GTTA 4PS8A 2GUOB 4U6VL 3A0OA 3CFKB 1CJYA 3OKNB 1QR1B 3O0RL 1RP9A 4L4TD 1GYWA 1JD9A 4WV1C 4XAKE 5C0RL 4LQFH 4R2GD 3NIFE 4TSBL 4PWHA 2FYYB 3BH9B 3MCKB 5DEZA 1KXVA 5TE4H 4KI5F 2ADJB 1JWSA 3H54A 2ITDA 2CO3A 5SWSE 3G5YA 1E4JA 3W0WA 2CBPA 2Z1PA 2WSKA 3NSDA 2YGNA 3D4GA 3CFTA 4BFJA 1SUJA 2NTFA 2LU5A 1V54B 4JG1L 1ILSA 1FNEB 2CK0H 3M8OL 1BBDL 1M71B 4MA1B 4YXHL 5F7KC 3KPLA 3T4AB 1JGVL 2SODB 4YO0B 3TX4A 4CU6A 2HX7A 2XHNA 5ID1B 3SDAB 4KTGA 4N2HA 5KYYA 1BD2D 2VR6A 5EU4B 4OKDA 1WAAF 4LEOB 1EJ8A 4MCYB 1EVTC 5BV7H 1T03H 3UIYA 1U8CA 1QO3B 4DZBB 3MJ9A 1LK3H 2AEWA 5MENA 3TT3L 2ZXEB 2O5NA 4J1UA 4H7VA 4NZUL 4PJAF 5JO5A 2UXGA 4A67A 2XN9B 4PUBL 5G4NA 5GRXG 1KCWA 4JG9A 4AVHA 2P1YA 5GGTL 2VZ3A 4JPQA 1HH6B 3MRKB 1F2XK 4CC4C 1RZIA 2R0KL 4HDIB 5A1AA 1MJ7H 1S7SB 4AEHH 1P7BA 5INDA 1JXJA 4U1GC 3FONA 3WDJA 3NIGB 3FQUA 3K0YA 5IJKA 2CM6A 1D5MB 1G1CA 2YAEA 3QULA 4EOWH 5ADPH 1E4HA 3MXVH 2BWIA 2F7QA 4HT1H 4NM8L 4Y16B 4EI0A 2MHAA 4H25A 4HXBH 1CLCA 3LXUX 4HUMB 2X53A 3EFOA 3RKDD 4ORGA 3EXJA 3TPUA 3GMNB 1KGWA 2AJ3A 4JZOA 1KYAA 3WKPA 3PNWB 3MV9B 3UPAA 3E8UL 3I02A 2ZXGA 5AVVB 4K8RH 2YSTA 3O81A 3LIUA 5DQ9A 5K5YA 4PJGE 2DM7A 1OANA 1KN4L 2BOCA 4XP4H 2BJML 3GXMA 4GUCA 1AGCA 3SYPA 5C08B 1XO8A 4WGKA 3BT0A 3G04B 4MNQA 1DVFC 1Z9LA 5CJXA 1CFNB 1YMMA 2AF2A 1F3JB 2J1WA 1PVHA 2WLZA 4HA1A 3REWA 3ROOA 3SDDB 4Z7NF 1DANU 2CLZA 4Q6IB 4ZS7L 3GBMH 3QPKA 5C09A 2PYEE 4KY2A 5HHQA 1DUYB 4DP1X 4TNEA 1DBMH 2HT2D 2O61B 4FGMA 4L2LA 5JDSA 5CJOL 4NNYA 5C07E 2G2PA 2R29L 3VD9A 2AAVA 5HDQH 3BZEB 1NCBH 1X3DA 3ARFD 5KSBB 4C58B 1OSPL 4MDRA 3NZHH 3SKJH 2FYVA 1WSST 1JNHA 5GSVB 3TZVC 1AC6A 5IQ7H 3F7RA 2ADYA 3QS2A 1HEZA 4M48H 2ZJSL 1F1DA 5EIVA 1N5AB 2N1TE 1QTSA 2R23B 3UYRH 3NH7H 4IRSA 4CMMA 3R19A 3VE0A 4IKLA 4P46B 1Q9OA 5AOMA 5LGYA 4R9HA 1W72L 3D1MC 3HVNA 3MCLH 1AD9A 2ZX7A 2VM3A 2FJUB 3C75A 1LE9B 2BP5M 4NKQB 4FNUA 5JQ6H 4NQXA 2ZUYA 4X6DB 4ZMXA 2GKIA 5BS0B 4LHUD 3TNMA 2D7MA 2Q7NA 4K3DH 2WM0A 3BD3A 2WYTA 3U2SA 4NWTL 2VWEE 1OGAD 4AQEA 2A74C 2ICEA 5HGDA 2DQCL 1T2QH 3F58H 4K15A 4OCLC 5C6TH 3UAFA 3IDXL 3QB7C 3FCTA 1J12A 4XBPB 1G6RB 4QLWA 2P24A 3UTTE 3SKOB 3D0VB 4QRRD 3QDJA 2E9GA 5D5MB 2KBGA 2GJ6A 3JV6B 5C7XH 3U6RA 2XICA 4H0GA 2BP0B 2HA1A 3O2VL 1BAFL 1SJEA 5CO1A 3STLB 4N2OA 5EEXA 1HNGA 1N2RB 2AV7B 3FH5A 5DQDH 4OFYD 4TLUA 3ZGHA 3D12B 4G42B 1X5FA 5D7LA 2EE6A 4BZ1A 3NFSL 3VXUD 3VSQA 4LZKA 4MNGE 1FVCA 1KGJA 1VCAA 3NK3A 2EXSA 4N4YB 4WSJA 4HS6B 4G6KH 4L4JA 3B9EA 2WXRA 1RULL 1MW0A 4LVOB 2ZUQC 4MJIB 1PG7H 2FD6L 2P49B 5IEHB 3BUBA 3MRCB 3IJSA 4MJ2A 3GIZL 4QXWA 5IBTH 2EDWA 3VA2C 5D9SB 2WJ7A 3WFCH 5K1NA 1Z6JT 2IANE 2BXZA 5CFAA 5F3FA 1QRKA 1ZOXA 1WEJL 5KS9E 4HC1L 4UOW0 4Y2OB 1K85A 5IVNA 2FRGP 3VXRD 1IM3A 1UFUA 1H8LA 2N1KA 4Q0XL 4XOBA 4AGQA 1JBJA 5E1GA 3WNOA 1A7RH 1P4LA 4OZIB 3A6BL 4KHTL 5F0JB 3RZCD 1CU4L 3OX8B 1CLOL 3NN8B 2NY4B 4DEPB 2Q3XA 2R2CA 3MRDA 4X50A 1I7TA 4TVUA 4N0UE 1TTAA 5EN2B 5BPPA 4MB5A 5IUCA 4G6FB 1EJFA 2QHRH 2OXHA 5F7BA 1HWWA 4Y1TA 2H6UA 4UM9B 1DQQA 4DOHB 4XPTL 3WKNA 2N0MA 3GS0A 1WBYA 4R7XA 4MD4A 3QNZB 4AZ8B 3FTGA 3ZTJG 4HG4K 1O6SA 1RZPA 3O9WD 1CUOA 3DJTA 4XMZA 2NRDA 4FFYA 4J8QA 4QRSA 1PDKB 5D1ZD 3FTZA 1YQ2A 3G9VA 3BZFB 3QH3B 4JKWA 4CDGC 2I07B 4L1BA 3QUYB 5I1GH 5DSCB 3FFOA 5KG9B 1XX9C 3NRPA 2Q7YB 1P7HL 1MUJA 1ADQH 1WAAA 2QV4A 5I1HL 3PWNB 3X1BA 2DDQL 5KAQF 3IMVA 3U4BL 1KYOK 1XGUB 2XVBA 4JJHA 4JQXA 4PV9A 3GMQB 3NIDE 4PRPA 5B1CA 4P5SA 3S5ZA 1DLFL 1FYHB 3GLZA 2HVBA 2QQNH 4MJ6B 3SBWA 5FYJU 1YEDB 2B0SL 1P5VB 3D3VA 2GJJA 4G11A 4OV6F 2OMYB 3GDCA 1HHJB 4NZRL 3CC5B 1CBVL 2YAMA 4I0CC 4WTWA 2WP3O 4YSAA 5BQ7A 3HN8A 1GMIA 4PQXA 4RQQA 3MBEA