3JWNH

Complex of fimc, fimf, fimg and fimh
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
279
structure length
279
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
molecule tags Protein binding/cell adhesion
source organism Escherichia coli
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
total genus 56
structure length 279
sequence length 279
chains with identical sequence N
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00419 Fimbrial Fimbrial protein
H PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnH01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnH02
4AVKA 4X50A 5IQOA 5FLUA 4AVIA 3JWNH 4CSSA 3JWNE 1QUNB 3ZL2A 5LNGA 5FS5A 4AVJA 4CA4A 2JMRA 2J2ZB 4X5PA 3BWUF 2UY6B 4AUUA 1N12A 2JTYA 4XOEA 5LNEA 4AUJA 2UY7B 2WMPB 1TR7A 5FWRA 5AAPA 5F3FA 1ZE3H 3ME0B 5ABZA 4BUQA 4J3OF 1N0LB 4XOBA 1KLFB 3RFZA 3BFQG 4J3OG 4AUYA 2W07B 3BFWA 4X5QA 5JQIB 4CSTA 4AV5A 1PDKB 4XOCA 5IQNA 5F2FA 5AALA 3ZL1A 5AB1A 5FX3A 3ZPDA 1KIUB 4J3OH 2XG5B 4X5RA 4XO8A 4XOAA 4AV4A 5IQMA 4XO9A 4AVHA 4LOVA 4ATTA 3SQBB 4AV0A 3JWNG 3MCYA 2VCOA 4XODA 2XG4B 5CGBA 1UWFA
chains in the Genus database with same CATH superfamily
3EJZC 1JPSH 3QRBA 3OKOB 5TPWH 3NFPB 5IFJA 1DANU 3WSQH 5DHEA 3O6FB 5GGVY 1A4AA 1X5JA 3G5ZB 1YVLA 4U3HA 5DC4B 3HE7C 5KSUB 3HC2A 4I3GA 4LKXB 5DURB 4MMZB 2IADA 1LO4H 4O00A 5D2NB 3T77A 5DRNA 4XNZB 3IMVA 2M83A 4XNYH 4F33B 3HBZA 3WTYA 4GI8A 4KHXL 3K74B 1OAQL 5DQJB 2GBVA 2NY1B 4XNYL 2JKRM 1CU4H 5EU6A 2MNUA 3H9YA 3OLIA 3LH2H 3WFBH 2W80C 3BAKA 3FKUS 4NFBA 5GZOA 5C7XL 5FUZH 5AB2A 3EBAA 4LCIL 1EJ6A 4NN7C 5KSBA 2MSPA 4J3OF 5CIPA 5EB9A 4G6KH 5JUEL 4JFZL 4JHWL 5AFAA 1NCAL 1DVFD 1OK0A 3T8VA 1AKPA 3TO4A 2XQ0A 3K46A 2BP0B 5JTWA 3P3SA 4M6NL 4I7ZC 1D5MA 4BYHA 5CJBA 2FEJA 3UCQA 4N0FA 1QRNE 4MDRA 3ZL4H 4KNQA 4QWWD 3QP3A 4AQ1C 1G7MB 3E1ZA 2WWMC 3CHPA 1F4HA 1YMMD 1DDHA 1KLGB 3VVVA 5K5YA 3SOBL 3WMQA 3F6JA 1TQVA 1JZ7A 4LLUB 1IVTA 1AJ7L 1L7IL 4LKCB 2BVQB 1FFNB 3X11A 3QORC 2ADIB 2C7FA 5B3NA 1BG1A 1J0ZA 2LU3A 4P99A 2I32A 3TH2T 4LHUG 4YDIH 2K1MA 2XV0A 5CEYA 1INEH 1KLFA 2D4FA 5DT1L 1G6RB 4Z7WF 5EZPA 1K85A 3DVFA 1G7LA 1JP5A 2YD5A 3LS4H 4PI2A 5JOFB 3L3DA 4JAMB 3L1GA 5JLZB 1XF4B 1CICA 2F1BA 3OPZL 4P57B 2JXMA 2BRRL 4TULL 2MH4A 3DV4B 2AEOA 43CAA 4Y4KB 4D7BA 4ZUSB 2FTAA 2XICA 4X98A 1V3MA 3KNBB 1T5XB 4KVNH 3LPWA 3X1BA 5K59E 1JV2B 2EH8L 2AXFB 3OR7B 4JZOB 3HI1B 1PSKH 1ZA3A 2BNQB 1HDMB 2VMFA 3HPJB 3BO8A 1UXSB 3I75B 4J4PC 4QRTB 3G3LA 3TBBA 3IJEA 3V0HA 2YGPA 1YEEH 2ZZUT 3MRPB 4UB0H 1BG9A 3KM2A 4MHHG 1P7QD 3UO1H 5HYIA 2D3VA 2IV9A 2R1WB 4C4KT 2BNRA 4FG6D 2V2XA 3QDAA 2BVQA 4G9FE 4JRYB 4QRRB 3VWJD 1JV2A 2H3NB 2IANB 5SWZB 3OWEA 3HMXL 3ABLB 4TUJA 3EZ8A 1NEZB 4QJ3B 5B7FA 1CDGA 3L17A 2OSLA 3LS5L 3Q5TA 4JFDB 1Z3GL 1WBXB 1I8LA 1GC1L 4LFHD 1CFVH 2IMMA 2VDRH 2YBRB 3KPTA 1LNUA 2W9EH 3UO1L 2W8CA 2KPWA 2XQYG 2H41A 4YFLF 4B9JA 2R1YB 4NKIH 1D5XB 1MAKA 1UA6L 2CO6A 3NQKA 1Q38A 2Z7ZA 3BAEH 5CEZH 4YHIB 1VSCA 3KXFA 3MSPA 3UH8A 3QDME 2FLRT 3T3ME 2CLZB 4YFDB 3ARRA 3W3BA 3EYUL 5C0DA 5ACZA 3RQ3A 3WO4C 3JV0A 5F6IB 1S7XA 4NQCD 2EDLA 2A6DA 4W6YB 3QI9B 4UT7L 2GJRA 3EH4B 3QULA 1BF5A 4L1BA 1M6OB 3GSQA 5H8DA 3HTLX 4HOZA 2VABB 3PP3K 4W9EC 4HWUA 4LF3B 5D6CA 4PW4A 4Y9GA 5IR1A 1A5FH 4ZTPH 4AGLA 2IEPA 3GZQA 5CHNA 1DR9A 1IARB 4ODSH 1XAUA 3FRPA 4WGWB 4UDTA 1MHEB 3CCHA 2E4FA 2V2XB 3CZEA 5LO7A 1QVOA 5GS3A 1DZBA 4MD5B 1CL7L 5DR5H 3F64A 4Y4FA 2FO4B 3K1DA 4BCYA 2P8LB 2PCPA 1T4WA 3EF7A 3HKFA 3MV8D 2EVFA 5HJBA 2ZKHH 5DO2C 7CGTA 4AYDC 4JN1H 4ELKB 4OF0A 2CHWA 3GXUB 1ZGLB 4AH2A 4NOBA 2WQAA 1S7WA 4WHCA 2JTYA 2UZXB 2DD8L 1HXYA 4G6JH 4K2UH 1PS3A 3L4ZA 4LLDA 4U6XA 2QSTA 2JKJA 4LBEA 4K3JL 4KK5D 3RNKB 4IHBA 5HHMB 2DYRB 1J5IA 5CWSB 3ES6A 2Q3AA 4ELDA 5HSFA 4NIKB 5ACZB 4XMPH 2V3FA 3WJLC 2FDBP 5H2BA 3ZDXB 3V0DA 1U58A 2Z31B 3IWVA 4S0HA 3ULVD 1TMQA 4LEOA 2ZOTA 4Q6IB 1NMAH 5EMYA 5TDPB 5D2LA 2XN9A 2VDQB 4DKDC 4U1SB 1HQRA 5EU4A 3VE0A 1KLUB 2NY4B 5LNEA 4QUOA 1QSEE 3QJZA 1MJJA 4TNWK 1II4E 3QCTH 2DM4A 5HPMA 1SXNA 4H0IA 4G80B 4HHWA 5CILH 2OL3L 2OPCA 2CKNA 5C3TA 1I75A 3T6WA 5JOPD 2VJ8A 4E68A 4ES8A 2OZNA 5GS0C 2NY6D 1OAUH 5F1NA 1ZWIA 1I85C 2X1QA 3NFNA 4AZ8A 3MBXL 1MDTA 4HJ0C 3NZHL 1MWAB 3ARQA 1N6QL 3B9VA 3K6IA 4CN6A 3SKNA 1U33A 4CAGA 5DFAA 4QD2E 4Z7QB 3FQTA 1D2OA 4OFPA 3HCVA 1M3IA 4U6XB 2V33A 3X3FL 4EE2A 3QISA 1Q9LB 3G9VA 3UIYA 3IXAB 5M94B 1A7OL 2P43B 5JQ6L 4MNQA 4NP4H 4TL5A 1UHVA 2ZG3A 3O2DH 5J6SA 4MQ7B 3LD8B 3QDJE 1OY3B 2X70A 4LDEB 3TN0A 2A9NH 2QHRH 4QOKE 2ZCHL 4PJ9D 5C0BB 4GKSA 1DL7L 3WKPA 2G60H 2YD0A 2FATH 5FKAA 4MDJA 2Y5EA 4RESB 4NBXB 3MBXH 5DTFB 4ZMAT 5IHLB 3QG6B 3GO1L 2KZWA 5CKAA 4ORZC 5T1KB 1E4KA 1CPUA 5DEJA 1BV8A 4TM9A 4RAVB 1CZ8H 2QSQA 5GS0D 4XMZA 5IW1A 4ZFGL 4Y16C 2W9DL 3FTZA 2J44A 4NUJA 4TUUA 5MP6L 3NFSH 4JDTL 4XCFL 1Y0LB 4P3DB 3ALPA 5EOTB 4YC2B 2EVIA 2W0LA 5I9QB 1MWAA 3ZDWA 2BFGA 4E36A 2QQLL 3VSQA 5AKVA 4M1CD 2B3RA 1K3IA 4NHCH 1CG9A 5E4OA 5J13B 5KYYA 2X87A 3LQMA 2I60H 3BPLB 3QIWC 5JDJA 3GDCA 2AK1L 1D5IL 1HZHL 1WGOA 3C6LB 3WAJA 5EF0A 3S9DB 1FVEA 2HJFA 4UU9A 1WDAA 2H8PA 4GB9A 4Y1AA 5FUOL 3O41A 4KC3B 1OSPL 1L3NA 2W0FB 3TN0B 1JCKA 4BV1A 1PKQA 4C8XA 3O9WC 1OB0A 4YBQD 1WF5A 2X9XA 3TIEA 4MKMA 2QQLH 3BYYA 3VGHA 4UZUA 2R0LH 1BGXH 4ALAH 35C8H 1KN2L 4W9DC 4YO0B 4B27A 4X4MA 4ZX4A 5L6YH 1ACZA 5LHDA 2DQEL 4ODHL 3JWDH 1IJ9A 3OKKB 1F90H 4YDLC 1DQIA 2PCPB 5FYKE 1UYWL 3QZLA 2Q8BL 1T5WA 2XWJA 1BFTA 4NC1E 2WTPA 3PP3H 1Q9WA 3WIHH 4G9DB 1K4CB 2XX0A 1KYOK 3FO0L 3CFIC 4XWGH 1F02I 2RMNA 5B1AB 4BKLA 1I1AD 3MRDA 4ZFFA 5D5ME 1CLOH 2UZXA 1F1GA 3JUYA 1M7UA 4PJ5E 5BQ7B 3GRBA 3QQ4B 3SDAD 2FR4A 3RVXC 4JN2B 2BOBA 1LJMA 3TEXA 3IRPX 5FUOH 4CVUA 1P4UA 1A65A 1NGXA 3F01A 1QBMH 2JJSA 5IB5B 4PV9B 1CE1H 3O3BA 5CLTA 3JWOH 3QIUD 4W9LC 1HNGA 3DUHA 2NY2D 4KJPD 1IE4A 4K5OA 5EU4B 3VE0B 3ZUCA 1P2CB 2DM7A 4WWKD 3DO7A 3BEWA 3FCGA 1HHHB 4MLSA 2O61B 2BNUB 3BDYL 4P5MA 5DD3H 1R5IB 5TFSH 2ZYSA 4UUJA 4XNQA 5E6RB 5E6ID 2WMPB 3MRNB 1VHPA 1MJ7L 2WUBH 1D5MB 2XY2A 3NK4A 4LAQL 4LVHC 3UTPD 2WJ5A 4R3SA 1J0YA 2ZKHL 1NC4A 1EBPA 4CNIB 4O2CA 1S9YA 4DZBB 1S7TB 3OXRA 5GISH 1A64A 3Q1SL 4HS3B 1CGSH 2XXFA 5IB1A 4X7FC 3FOLA 2XG4B 1XB6A 1H19A 4KMTH 1XDTT 4UNUA 3Q43A 4CSSA 1UD8A 5TF1H 1WH0A 4MTMA 3Q8CA 2O6CA 1KBGH 3WFEH 5KJRL 1I1RA 1BXVA 5E94A 1U2HA 5E4EC 1N7MH 3N04A 1OO2A 1UD5A 3MLRL 4JFUA 4BFNA 2B4CC 2DTSA 4M7JH 2FQFA 4GMTL 1IGJA 1UENA 1DQML 3DMMB 4YPGA 5I1CH 4DCQB 2NY0C 1JPTH 4GBXA 3BQUB 4M1GL 5E03A 1H6EA 5I66B 3TH3T 2D2CC 4LDOB 3FB5B 3FT2B 1MCLA 5C0BA 4Q8BA 2W5PA 3FMGL 4IRSA 1UH4A 2IDQA 1A4CA 5DQDL 1S5HB 3S2AA 4JQIA 4JFXB 3P3YA 4P5MB 4UTBH 4FE9A 3C9NB 5IFAH 3ZIYA 1C5CH 4MFHA 4HUXB 3NJJA 1ID5I 3ZK0A 5LBSH 2WNWA 5T1KA 3QDMB 3ZR6A 3QYMA 1ZTXE 4UQDA 1YUKB 3L1FA 5B21A 1IV8A 3ESMA 1FC2D 5LGJB 1YEGL 4I18B 1R46A 3HFML 4ZAKC 3QCTL 3WXVL 4GQQA 3FCTB 5FB8A 4JO5A 3F04A 4G70B 2F2HA 3BVWA 4YSCA 1CLVA 2BHFA 2Y1YA 1TO4A 2Q86A 2XZAH 1R5VA 3QA3A 4RX4A 3EZJB 5D5MF 4QXTA 4JFHD 1P6FA 4Y5YA 4ZMQA 4HXAH 4ZOEA 4OFVA 3BH8A 5IUSA 5AB9A 1QO3B 3GB7B 3KPOA 3A6BH 3MFGB 2FVNA 5LN4A 2MTAA 2H6PB 1KCBA 3Q6GH 1OAKL 4FQJL 3OKEB 4PJ8C 4APQC 2YRPA 2E27L 1IAIM 3REWB 3QWRD 4ISVB 5EUKA 5IVXF 2DJ4A 5HJGA 4FC3E 4EI5C 3L8QA 3PPSA 1BAFH 4GS7C 2WO2B 3VWKA 1AS6A 3QI9A 3I85A 3W37A 4Y19D 5SWSE 1QACA 4GP4B 3H2WA 1VJSA 4X4YB 3PAVA 2EUZA 3BGFC 1EDQA 3BEVA 4I0CC 2ZAIA 3UCRA 3UTZA 3N1QC 5EPMB 1N18A 5GRWA 5CP3A 3O45A 1ZVNA 4WO0A 5HHOD 6CGTA 4N2EA 2CIKA 1VF5C 3FXIC 2WZ5A 4RMBA 3C5SB 3LIZH 3C60C 3Q48A 5CJOL 4HAGA 5E2UH 4X9HA 4QLRA 3RAJL 2CPCA 7FABH 3O8XB 1KB3A 4MYWB 1KWKA 2Y07H 5JHLL 2Q7YB 3STLB 1DFBL 1RUKH 1VCBC 3VXNB 2DLFL 4BXSV 2FT7A 3QCUH 1IAOA 4WSGA 4WI0B 1A7OH 2CO4A 1NOAA 4FXGC 5HHXL 1HWGB 2GVYA 4ZSOA 4LIQH 4ETYA 3MRLB 4YR6A 2EVJA 3FJTA 4J3OD 3QPXL 1HXYB 3P2TA 1ZS2A 3UBXA 1NFIA 3MGOA 4MRBA 4NPYA 4X5PA 5DFVC 4PVNA 4B9YA 1CFTA 1TSHA 4XVUC 3HI5H 3S48A 5GRUH 2A3TA 4IKIA 5TGBA 3MRPA 1TZIB 3LIUA 3OF6A 4F2MA 4MZRA 5DZJA 4H5SB 5J9PB 4ENZA 2MCAA 1INEL 1E65A 4YEEA 1OE3A 1MCBA 1S5IH 1IBGL 1N26A 3QDJB 3PUCA 3EGXB 4L3AA 1NBQA 5SWQA 1BFOB 3FSAA 2XRAL 3SIKA 1BLNA 3H3BC 4M6AA 1CTOA 2AQ1A 3N44B 2OW6A 3IEAA 2ZUTA 3FU3A 1J0KA 1AC6A 3FHAA 2N7SA 4WUKH 4X9YA 1NM9A 2J5LB 5FGBC 1F00I 4DQOH 2Y2WA 3NJHA 4NUGL 2FB4L 2V5TA 5I0DA 2D9CA 5KSVA 4FYRA 4LSVL 1D5XA 4PJ9C 5B1BB 1I1AC 2I27N 2YGNA 5GRZA 3GMRA 3RA7L 1WFNA 3GSOB 5CZVH 3T4YA 5L8KB 2YUXA 4MNHA 5ITFB 3NSFA 1BZEA 5BS0B 3D3VA 3ZHLA 3V5DB 1S5HA 3VSVA 4F2EA 2J73A 3K72A 3TFBA 2N56A 1WBZA 3WDIA 3NCCB 4NUGH 1BLNB 4Q0XL 1S7RA 4F7TB 2WO3B 1U91A 3HE6D 4OM1L 4UT9L 5AEAA 3K1KC 5CEXA 3OPZH 2FE0A 2XNAA 5HI3D 4K7PX 4OJEH 2D2OA 2YKKA 3BSHA 2HJLA 4XCCL 5IJDC 4UAOC 3ZQXA 5KSBE 3MJ9H 5GQBA 4DQAA 4RQQB 3KL0A 5IVXE 1G87A 1SOQA 2W60A 1JTTA 1RY7B 4HDIB 1JK8B 2XN0A 4WTXA 2X6VA 5IB3B 1JHKH 1F1DA 2VXTL 5TK4A 3HC3L 1U3JA 1WEJL 3HFFA 2EO1A 3Q8FA 3BYTA 3MCKA 3CXDL 3L5XL 3D8MA 2P26A 3DPDA 3CH1A 3GKZA 5AYTA 2F08A 4GOSA 4DGIH 3GM0A 3ZTDC 3FT3B 5SV4A 4HZAA 4P9MH 4X6CA 1KB5L 2AQ3A 2ICCA 4QRTA 3EIFA 4XVTL 2WIIB 4JFEB 3AABA 3TVMB 5EBLA 1N70A 1W72B 2B77A 4PJCF 1XBDA 2ZKWA 4K71B 4NEHB 4B96A 2Z8WC 2XZCH 4Z3FA 2R23A 1JTOA 4ZQKA 1EZUA 4Y2DA 3UMNA 1E6JL 2ZCZA 5L0QB 4RNRA 1X9RA 4WHYG 2NY0B 3KHQA 3SO3C 5BMFL 2HT2C 1BZ7B 2CKBA 4LDCA 1JWUA 3RI5F 2UWEB 1U92B 2F9BT 4MMZC 3KYNB 4YXLL 5I6XC 2OMWB 1XVSA 4W4OA 4JPKH 4YX2L 4ETQB 4O4YL 4IBVA 1AYRA 2AQRA 2BRRH 3ECVA 3O0LA 1KNOB 3V7AE 3G5ZA 5IJCC 3CHSA 4A6YL 5MEND 1U8IB 1EIBA 1YNKH 3GRWL 1Z9PA 5F89B 5SWSD 3I9PA 2YXVA 4DP0X 4HIHB 3CXDH 3L5XH 2QGCA 2VISA 4MA8H 5JXAH 1DBKL 1H3GA 3MBEA 3VA6A 4WKXA 3R4DA 2CLZA 1BYOA 2EDFA 1OAYH 2VN6A 2DM3A 1XIWB 3DURB 5ETUA 3NACL 2DBJA 2ZNXA 1JS4A 3BIKB 1DBAL 3VMNA 4CL7A 1JGIA 1FRGL 1XX9C 4ZD3L 4IGBA 4G8IB 4LGPB 2BNRE 5E95B 2FEDC 3ECUA 3ZE1F 1Q9WB 2VLRB 2HFTA 2A83B 1OAKH 4FQJH 1P4LB 3M17B 3MLVL 2X4RB 3OC5A 3CN2A 5EOCL 3SGEH 3RWCB 3ARBC 4B9FA 2F54B 2NPLX 1UWXK 4NP9A 1UXWB 1VDGA 3NTCH 1SGKA 2VXQA 4IKJA 1H3PL 1C08B 3GPSA 4UMSA 1G9NC 1Q9LA 1FL3A 1F2XK 4QXVA 5LAPA 4LLMA 4BBWA 5A2IH 4IYKA 4FFWD 3H8NA 2K7PA 3EO1B 4PRID 2KUTA 4NCC2 1HL4A 4FFZA 5F3HA 4J6RH 1NAMH 3UTOA 2X53A 4XCEB 2BVOA 5J11C 4WWID 3QJXA 3VG0H 1IIIA 1EFXB 4NO3A 4X6DB 2NNFA 1M71A 5D55A 3MUY1 3QWQB 4OIIL 4QRUA 2IVFC 5ID0B 2V2TA 3GSNL 1M3JA 1G9MH 3KWUA 1S7SA 1J18A 4AMKL 1HHHA 3MXWH 5JHDD 3NESA 3QC6X 4M1CC 2FJFA 2V17L 3M1BB 1XH2A 4N9GA 2WINB 4WY7H 3RVUC 4BFKA 2ITEA 2JB6B 1MW2A 3FO9A 4KVCL 4UIKH 1XSKA 1YNKL 1YY9D 1CDCA 4I0PC 2VDOH 1SEBA 5A7BA 3MODL 3U1SL 5LDSA 3D51A 1IM9B 1CBJA 2X6MA 3ULUD 4XCEA 1ETZB 1YJDH 1OALA 3EOTH 3QDGB 3VWKC 4XTRD 1WWBX 3UZEA 3G04B 4CC1A 4EZMA 1RJLB 5HYSA 1WCBB 4G8EB 4EUPG 4KY1L 3O2WH 1I1FB 5F9DC 3T4AA 5HDLA 1M1XA 4TSAL 4G1MA 2A6IB 3QHZH 5EFIA 1N2RA 4IRZH 1ORQA 1ZIBA 1LO5B 3GJFH 1SLUA 3BIAX 4WW1B 2IPKB 1KBPA 1BJ1J 2X4NA 4RFOL 4MQXC 4XGZA 1N8ZA 3BMVA 2YD2A 3WNIA 2ZYRA 5L4FA 5C07D 5TD4A 2HAZA 4P5SA 5I19L 4ZNEE 5F1NB 2ZQKA 2W60B 4AGOA 2D31B 4HGWB 1HH6A 2VAAA 9CGTA 3PDGA 5F7MC 3VFVA 3GMOB 4LPWA 1U3HD 3LKNA 2PXYC 4R96A 4QIRA 2WQSA 4OCXH 4JL1A 2GPZA 4C56A 4ELMA 4OTXH 4X8JB 1UKTA 2VLLB 4BSVB 2I5YL 5I6LA 5F70A 4WW1A 1WZ1H 1ZIAA 2D7TH 4HFUH 4DEWA 1KIRB 5DC9B 4B53A 2WTRB 4ODWB 5LAXB 3ETBJ 5AVTB 1MIML 4ZPVB 3X13B 1BZQK 3QQDB 2VUOA 3C2AL 3PGFL 3V8OA 2XN2A 1OANA 2E5EA 3P11L 2HT2D 3VB9A 3P4NB 3NCWA 1G7IB 5KBLA 3T1WA 1E8ZA 4AKQA 5KUKA 1FWXA 1NDGB 1NIFA 2H0JA 2ZUUA 4XNAA 3EJYC 5IP4A 2XSKA 4BSVA 3P2DA 1M9SA 2UWEA 3KHOA 5T33H 3ZE1E 4Z77B 1EEYA 4B50A 3BAJA 1MFMA 1S7XB 1MCFA 2CR3A 3G5WA 3VI4B 2Y7NA 3Q7JA 4PBWD 4OJFL 3S96B 4RWYH 4J23A 7FABL 5KSUA 1SDDB 4HC1H 4F24A 3KYOB 3LN5A 2ZSVA 3QFJE 2W91A 4J3OC 1ROCA 3QFJD 3M88A 4ICWA 4YHKL 3V4PB 1DJHA 3B1TA 3DX8A 4D7PA 2DQTH 2GCYA 1NIAA 1S5IL 4IOFC 1S7VA 2Z1PA 4YHPB 1DEEB 2X4OA 1AQ8A 2R69A 1I85A 2E9IA 2VLLA 4X42A 3ETTA 3POHA 5ETUB 4X8GA 2CHDA 1GAFH 3NIGB 4NRYB 4MNGE 2N3JA 3C60D 1VEMA 2XVKA 1I7TB 2J2ZB 5DD3L 3HI5L 5KAQG 2YA2A 4RMWA 3D2TA 5H4YA 1G9NL 1MCPL 4ONGL 4JDZA 2NQCA 4MDIB 5J89A 4KX7A 5ANHA 1EFXD 3VAEA 2R0ZH 4CSZA 2BP0A 2FQGA 5JXEC 2J71A 3GHEL 5DJXA 1ZANL 4NQEA 3QH3A 5CF3A 1P6AB 1U8MA 2VR7A 4M48L 2JV6A 1XH0A 2CIIA 4NO0B 3RX9A 3VI4A 2I26N 4JANB 1R3HB 1T2JA 2Y24A 4OZGF 4HPYH 4KGLA 2XA3A 6TAAA 4TTDC 2P5EE 4OW6A 4FQHA 1T4KB 2BP8B 2YRLA 1F58L 2DQHH 1WFTA 3TO2B 4Y2DC 1J1OL 1FFRA 3LJ3A 4ZFZA 4LFHG 2X28A 4XC3H 4Z7UB 3L08A 2HG5A 1A3RL 3CN3A 4Y16A 2WP3O 1LLAA 3CUPA 4F92B 4EF3A 4PV9A 4OCWL 4PJ8A 2BLFA 3N9GH 1ZLDA 4OLYH 3SKJL 4HKZA 5C0AD 2WSPA 2X7LA 3MRBA 4FZ8L 1G1KA 1OSPH 5HHQB 3WY1A 4MBOA 5A3IC 3VI4F 3PRZA 3HI1A 4ZG1A 1AZRA 1TJXA 4JHAH 3BSZL 5H37H 5HDBF 3T71A 4P4KD 3CFNA 4PBDA 4Q52A 4PTTB 1NAKH 2J1ZA 3IBEA 3L5HA 5F0JB 3C60B 5GGUA 5JDSA 4AQAB 3NABH 6FABL 3BSZH 4MMXA 5F7AA 4B9CA 4F9LA 2TAAA 2QDVA 1LK2B 3AWFA 3BKYH 4HKZB 1F3RB 2A74A 4M7LT 5JLZA 2DPKA 5J11B 1CI5A 1HSAA 4UM9A 1HE8A 3BGAA 1FI8C 3IDNB 5E70A 5B7MA 4GW1B 5E24E 5IMOB 1MCWM 1X6LA 3REWA 3TVMD 3C6SB 3PJSB 2OK0L 5K9QI 1NIBA 1KMGA 1KYOJ 1OGPA 1AQDA 2GIYA 4JPQA 1KIRA 4EI0A 1TQBC 3JWNG 3KLAA 5DA4A 5IFJB 1Y07A 1BM3L 2VDMB 3GEFA 4FXKB 2VE6B 2UWEE 1ZHLB 2FLBT 5T5FL 3GXDA 3HC4H 2YXWA 2V7NB 2WJ7A 3BDYH 4GSUA 1DSFL 1DVSA 2XIDA 1F3DJ 3SDDD 1HWHB 5IVXB 2COQA 3HUJE 4XRCB 5EU5B 1MF2L 1RULH 2VR9A 5CN2A 5C08D 3V6OA 5I0YA 4M43H 1E8YA 4HUMB 4GKNB 4KZ0A 4NZRH 5DMIL 3HLAA 4LLQA 4TVPL 2NUTA 4FLOA 4KPHL 1MG2C 4KKNA 3AWEA 5KTEL 5GRJL 5INDB 3GMQB 5FYJH 3X14B 4ADIA 2D9QB 3V4PL 2VDNH 4PSRA 1T7YA 2BVUA 3ARDC 4WTZG 1MF2H 1T6WA 3L9YA 4LCUA 4OD2B 1M2VB 1HKLH 4ZSOB 5TK2A 4AL8H 2C9RA 1B2YA 3ALXA 1TTUA 2CM6A 1HXMA 2X4QA 3RTQD 4Z3JA 1HSBB 1MJ8H 1XMWA 2D7PA 2Y7QB 1AP2A 3PWUB 1F41A 3LEYL 3RWHA 1BVNT 1HHGB 3QEHA 4XBEH 4WO4D 3WJJA 3D2UB 4LLWB 4K7FB 5M95B 4M93C 2OL3H 3GBNL 3PXHA 3KG5A 2CXGA 3UZVA 3CVHA 1N5YH 4JBSA 5INCA 4QXTB 3ARPA 4ANXA 3GUTB 3AM8A 3LKSA 2ETWA 4KJQC 3AS1A 4DAGL 2BWQA 5I1LB 2C8NA 1ORSA 3TWYA 5DD1L 3RGVC 4K5NA 1WZMA 3W82A 4D0DB 5K69A 1N64L 1TQCC 1MI5D 2XFXB 4F37K 4KFZC 4JY4B 3BE1L 1JDAA 3LRHA 5C09E 4I13B 4P4RB 5JMRA 5LGHL 4QT5B 5EIIG 1BFOA 3IFNL 4Z7QE 1A8JH 3LB6D 4EXKA 1ZAGA 5KTEH 3V52L 1F11B 1L9OA 2NSQA 3QFGA 2IPTL 3ISWA 2EJ1A 3D85D 4W9HC 4JDEA 3V2AR 3VWKD 2XPYA 1DQMH 4L8DA 3TWCH 5JQ6H 3L3DB 4JAMA 1E9QB 2IDFA 4IOSD 4MCNA 1MXGA 4I85A 4EDXB 2GC7C 3IVKB 1NLBH 1PZSA 3B7SA 4JO4H 3UAFA 3NJLA 4APXA 5LG1A 1Z3RA 2XPZA 3EFDL 1RIUH 4KKAC 2JKIS 4TPRH 1J0IA 3EYQD 3D52A 2JB5L 3GSUA 4HS8L 4CMMA 5JORA 2C1PA 4K71C 1KY7A 2BW5A 1JGVL 1BQLH 3UX9B 1ZT1A 1HNFA 4YHLH 5A2KH 3U4AA 2Y36H 4UV4H 5MHSE 3K6FA 4WWPA 1HAUA 3AB0B 1I9IL 4YBHA 1KACB 4G2AA 5GSRB 1QOKA 2BY3A 3WIHA 4OBRA 1AZUA 4L8SB 2OR8A 1EMTH 3TO4D 3DV6B 3REVA 1UZ8A 4PLKC 1KGXA 2F54D 2QLYA 2XZZA 1SY6H 5DJ6B 1E5YA 5AW8B 3I6SA 1R17A 4YFEA 4FFVD 4F20A 4YAQA 4ES9A 3L81A 1YYCA 5E8PB 1JXDA 5IIEA 4NPYB 3L3GA 3PWPE 3TWCL 3D85A 1A3ZA 2JB6A 3FO9B 3FQNA 3OZLA 5IQ9B 4PAZA 5BW7C 3BHBA 3DIFA 4NB7A 4LSRH 3TIDA 2NY4C 2WVVA 3ATEA 5TQ2L 5J56B 2ZUVA 2EDTA 3H7BA 3UJIL 1JI1A 2YBRA 1SVBA 1FE8L 4PJCB 2EXYC 4Y2DB 1EA9C 1INQA 3T8MA 5BUPA 2BSEA 5ADPH 2HH0H 1FFNA 3X11B 3PGDA 4EQ2A 1MHPL 5J6HA 2BP3A 4FKEA 4LLYA 2WLIA 1BQSA 2BY0A 4HT1H 1BD2B 3DVGA 4MJ6B 4LRIA 3PL6D 5MP6H 3O11B 5FYJE 2YK1L 1OTTC 4N3TA 2OMVB 3JV6A 4KXCA 2PMZA 3SJVB 5AD0B 3G5XB 4PW3A 1S8DA 5GRVL 1NGYB 2VDMH 3BIBX 2BIOA 3T6XA 3KJ4C 4ODHH 3KLKA 4WK2B 4P3DA 5MERA 3EJSA 1KGWA 1KJMA 4ZMYA 3UGXA 3V4VA 2CCLA 4RWHA 3BPCB 5D6DC 1JMZA 3IDIA 1SMAA 1D7FA 4YHKH 4P2OA 5D7IB 1AJ7H 3WD5H 1G1OA 3BUYA 1HX0A 4M4PA 3GQFA 4NWTH 3GSWA 4P49A 1PLAA 2H26B 1J1XL 5TE6L 3OKDA 1P5VA 3APNA 5CD3A 3DX4A 2NUTB 3NCBB 4FJYA 3EH1A 4HMCA 2MCPH 4BQCA 1VKXA 5E1AB 3DETD 2VLKD 4LLVB 1RK7A 1S8DB 4N6RA 4RGNE 4TUOB 4XO9A 1IEAB 3SHSA 3AACA 3HZYB 4QRAA 5AWNL 3GHPA 3A23A 4QR7A 3BWZA 3ARGC 4PRPD 2J6WA 1E7VA 2J6EA 3E6HA 3WEAA 1HWWA 1SRDA 5A2BA 3QIUB 5KYNA 1PZ3A 3FFDA 4S1SH 1X44A 2EZ0C 4G11A 4R26H 5GZOD 3H7LA 4XOEA 3APCA 3B2XA 2KLRA 3W2DL 1MY5A 3CSGA 3OJDB 3IGAB 5C0GB 3GSVA 1CZ8L 2Y6TE 2VDRL 4RMUA 3BMWA 4K4KA 1AFVL 3BP7B 3R4RA 4YGVA 3MGAA 1LWHA 1KF9B 3EF4A 3D3VE 3A47A 3BVUA 3G6DH 4QXUL 2WCPA 4ODSL 4D0DA 2N59A 4FA6A 5J3HC 4JHBA 3LD8C 4GRLA 4NQDE 4UINH 4BEIA 4XMUA 2J7LA 3HE7A 4XPTL 5C0EB 1PQZB 5LWYH 4X83A 3NIDB 4PUBL 5AB0A 1VFAA 2X4OB 1DFXA 2GYSA 4G80A 4CMHB 4H1LG 4JPKL 2PR4L 4Z3IA 4PRHA 4MS8C 1NOFA 3B5TA 1BW8A 2HKFH 4PRDB 4BQ8A 1YN6A 4NQXB 3BJLA 1PDKA 4TQIA 4HCRL 1UB5A 4QTHA 3IMBA 2PLTA 3QXDA 4NM4L 2JCCE 3I6GA 3IDGA 1U8NA 2XKNB 4JMNA 5LXGH 4P2YA 3JWNC 2Q7AA 3M45A 4X0NA 3S8WA 3L6FB 3AS0A 4XPHH 4DVRH 2L04A 4ONFL 4PUBH 2JIXD 4KVPA 2W95A 2FJHA 1TR7A 1OAYL 3U2IA 1LMIA 1P4IH 3RNQB 5GHWL 1IAIH 1CGUA 2GABA 2NXZB 4N9OB 4FEIA 3LS5H 2QVMA 3VI3F 2NUPA 5JHAA 4BSWB 1BZDA 4JFFD 2KL6A 2FYYB 4M93B 5D7JB 3U83A 1QFHA 2GJPA 2ICEC 3DRQA 4Z76B 4AMKH 3OAYH 2CRMA 3LZQA 4FQHB 3DJ9A 4WEUD 1VADA 1J0JA 1CFQB 4XMKL 3S4SA 5CCKL 4QMEA 5AL0A 1RQ5A 2ERJB 5T1KD 3HE7B 4YLCA 3KM1A 5E4EB 2YPVH 1F3JA 3NZ8B 1C08A 4M9PA 3MKKA 2AJUH 3QUXD 3L4WA 2B1HL 3WHE1 1MFEL 4LRNL 3RUGA 2YKLL 3CSFA 1FIGL 2W94A 5T3ZD 2XPGB 1JZDC 1RP8A 1VEOA 4TSBH 1ZRUA 3ZDYE 2PN5A 2UXFA 3QEQE 4CW1B 3FB8A 3AXHA 1J10A 2ZX6A 4MZIA 1MFCH 2VCOA 4ONHA 1M71B 4FCAA 2L7JA 5ILTH 4MQXD 4TSBL 1OF2A 4Z3GA 2EXYD 1I1YA 1RURL 3OKYA 3EOTL 4JMXA 3MOAL 4OGYL 3LZNA 4I48A 3B83A 3WTVA 4CJ1A 3QUYA 5F1OB 4J4PD 4EUPA 3BVTA 1RV6X 5E8OA 1JZEA 4XVSL 2Y5QA 1FGVL 1CC3A 1Y6NR 2UVFA 4FDWA 2F19L 4OKVA 3UIZA 1KENL 3U46A 3B3IA 3QJTB 2PW2B 3MXWL 1UWXH 4OT1L 3DTXA 4L4VB 4MCZB 2VXUL 5CBEB 2JI3A 3DX8B 3OZ9H 3JTSA 4L1LA 3WNNA 2WXFA 2PYEB 2VZ3A 2A6KB 1FGVH 4NO5A 5C9KA 2IGFL 3RVUD 4FAAB 1GOGA 3GIVA 5F7BA 1IAIL 3SZ6A 3BAIA 4G1MB 5EO9B 5KSAB 4HC1L 5B4MD 2ZP0T 4QHKI 4ZUWB 3C9NA 4D94A 4XBPB 1LGVA 3WNKA 1KGYE 3CPLB 1MFAL 1UD4A 3PWJB 4OIAA 1AKJB 5FFGA 1JPSL 2XWTB 1YJDC 1HYSD 1UXLA 3FQXA 2IWFA 5TH2A 1XF2A 2B59A 4J8RA 4HEMA 5I2IA 3LKNB 2E7MA 2VITA 1EAPA 1S9VA 3QCUL 3HRPA 2AJUL 4RAUB 2GK0B 3TURA 3WEBA 1X4XA 4OGAD 3IAPA 4R97B 4JJOA 3QRLA 3BZFB 4ZFOL 5DRWA 3RHWF 3QH3B 5F7DB 1ES0B 3L4YA 2YMOA 4PBVC 5LBSA 3WEXB 4Q58C 2YUZA 3O6FA 3CTTA 4JKLA 5DHDA 3EFFB 1QRND 5F3BA 3BI9X 1VA9A 2EYSB 2P7TA 3AADB 4GJTB 1N4XL 3HW7A 3KPLB 4KXZH 4DN4L 1CO1A 5I8KH 4KHXH 4N0CD 5IW1B 5CD5D 3LV3B 3S5ZA 5IV2B 4M7LH 3BH8B 4JM4H 3MACH 4WCYH 4UT6A 4YGAB 3TN0D 3IN0A 3U4EB 1NLDL 4OLXL 1CD9B 4KJQD 4NM8H 3RZWA 2WXMA 2A6KA 1KJ2H 4NO5B 4N5ED 4PJAF 4FQXD 3WFDL 4CRPA 1T3FA 2ZF9A 5ICZB 3O0RH 1DUZA 2HG0A 2A74C 1S9XA 2K6ZA 5DCCA 5EU6B 1PLCA 3ARBB 3LZRA 4OJYA 2JB5H 5DMGD 4UT9H 1KV7A 2E7HA 3L5JA 4PJ8B 2PO6C 4A1RA 1Q0EA 3UJTH 2Z0BA 1RZFH 2B4CH 1HHIA 2WQUA 2NMSA 3T4AC 4F7EA 3WY4A 5C2BH 1G7QB 2X2HA 1RUPH 5E0QA 4PJDB 1BBDL 3V4PA 3MLSH 5M7QA 1Q0YL 2XKNA 3MRGA 5AAMC 4YR6B 5J0BA 1QLEH 3NBNA 4YS4A 4AM0A 5E8EA 2GFBB 1DFBH 1RUKL 1Q9OA 3JTTA 2WKOF 3Q05A 1W9XA 3MNVB 4WQOA 4ZUVA 3D30A 1UOWA 1KELH 4NWUL 3QG7L 5F21B 4Z3HA 1QNZL 4WW2B 2H47C 4DGIL 4QRQB 2FX7H 2GK2A 3D2UD 1FP5A 5JIHA 4XN5A 4XB7A 3SCMD 2VKWA 2YUVA 4C4KO 1XGYH 4NZFA 1GYWA 4PJAA 5HGGS 1UWEH 3AWGA 5J6GB 4YWGL 2QGDA 2N7BA 3DETC 1VIWA 3R7QA 1GIGL 3QORD 3ZQ9A 2N1KA 1QI3A 5E6IC 1ZLUK 3RPBA 2EO7A 1RZGB 3F7LA 3GTTA 4PLJD 3I9GH 4PV8A 3ISYA 4JFXA 5L8LB 2WWMD 4XXWC 4RZCA 2E0PA 3GM8A 4FTVA 1J7VR 1DYZA 1S9XB 4N3UA 1UFGA 1XGTA 2VXQL 5E23A 1TVHA 3MTXA 4JQXC 4X8CA 4JFEE 5I71C 3NCJH 1QLEL 1DVFC 4G71B 5J8OA 2B08A 1LXMA 4DEPB 1HILA 3LKPA 2BX5A 3VM7A 2BP8A 5C9JA 1BOYA 1HAWA 3RGHA 2F8IA 4NRZA 3ARZA 3P73B 4FFYH 2HRLA 3HLAB 4LLQB 1PL3A 5KWYC 3B2VH 2IAMA 1WHOA 4N1EA 4PMFA 1D3CA 3HPJA 4UTCA 1GGYA 1KZQA 3B3IB 3TYGH 1OL0A 3TF7C 4JG1H 4K94H 1A7NL 1YEKL 3V4UL 5SX4I 5HYQB 4HS3A 4NFDA 5E08L 3PL6A 4E9YA 2NR6C 5AVWB 2K70A 1TJHH 2DM2A 5L2KD 5L9DH 3PV6B 2Z31C 1C9SA 1UATA 3GRWH 4NC0B 3UTTE 4XCNB 5DS1A 4F7MB 3P0VL 4BA8A 1XZ0A 1A8ZA 4FP8L 1XD1A 4ZO6A 2QVKA 3ET9F 3RWDA 1GPOL 1IL1B 2CK2A 2IANE 3KPRE 4M6ML 1U21A 4PGDB 5DK0A 2ZTBA 5SWZE 2NW3A 2CGZA 5LAXA 1OP3K 1T04B 4LPCA 4ZPVA 1BVLA 2P8MB 5T5NG 3VRJA 3ILQD 4IRJA 2JJUA 5KZCB 5AALA 2KDYA 5IMKA 5F9JA 3JWOL 3EUDA 2CDFA 4ATTA 1M7IA 5F9WC 1OAJA 1D6VH 5FO7A 4F58H 1IKNA 1T80A 3WFCH 2YAOA 1I4FB 2ICWA 4NRXA 1ZK5A 3QWNA 1FBIH 4ZMNA 4I5BA 4QRPB 1U6AH 4U1HA 4K07A 3H9SE 1AGCB 2BNQD 2ADGB 2HTLD 2I07B 2H4EA 4L1HA 1PG7L 1RU9L 2HLFD 1VFMA 1QWUA 2JKTM 4LHQB 4MVBD 3ZE2F 3DHMA 4LLVA 4N6RB 3FU6A 3IRCA 2VL5B 3FTGA 3U1QA 3C6LA 2J4WH 1NAMA 3NAAH 4JREB 5IKCB 4YZWA 1AHWA 2N1TE 4YXKL 1T0NA 3V7AG 1QSZA 4XWOD 2Q2LA 5C07A 3US1A 3FU5A 4ZW3A 3CCHB 4G6FD 3WNLA 4ODVL 1RZQA 3DXAB 4I5BB 4ZOBA 2MJWA 1JPGA 1XIWA 3DURA 3KPSE 3S36H 4N2KA 4OQ1A 4X9GA 1F18A 3GTNA 2N0KA 5D4JA 4X7TB 3RX5A 2G3NA 5I0XA 2ZWKA 2Z9TA 3QC5X 2AI0L 3HNSH 1N19A 5FYKH 1LK3H 1MI5E 4ECNA 1JE6A 3O4LE 2VW6A 4WWNA 2Z35A 3Q6GL 3U7AA 4L8CB 2HWZH 2XXGA 3D9AH 5F89A 4DP1X 3OVUB 2VZOA 4NCDA 4XO3A 1CUOA 4GRLB 2BSRB 4QAMB 4Z7VE 5AVQB 4M7KH 5F9OH 4FG0A 1N5AA 4NYLB 3KGTA 1BX2B 4XMLL 5CEYB 1U8JA 1WAAE 1RFDL 4NLAA 1EX0A 3FHEA 4KJYB 3L1OL 3TM6A 4QRSA 2APTA 2IFFL 3CVBA 2BZDA 1LK3L 4QO1B 3EJYD 3MMEA 5KSAC 4JZNA 4AQ8C 5I18H 4KY2A 1U8LA 1UJ3C 3CDZB 4K8RL 2ZYIA 5G5DA 3GKWH 1HOEA 2DBLH 3W9DB 2YPLD 4ODVH 2DMHA 3X1GA 5IJVA 1QPKA 2R2EA 3DO7B 4FQ2H 4DTGH 4IJ3C 4BXVA 2EADA 2RHEA 3G5VA 5I1JH 2DLIA 1A47A 4PJBB 4XNQB 2ZXBA 3TBWB 1IC7L 4D3CL 1OARH 4F57H 3NAAL 1JGVH 3QS3A 3VXUD 3ARWA 1WVZA 3EYFA 3T0VA 3A0OA 3H2QA 5LUMA 1PZCA 1MCHA 2X9YA 3GGWA 1SYVB 4L48A 3QPXH 1SJMA 4F1SA 1RZPA 3I3BA 5G5DB 4LE8A 4JEGB 4EZJA 1UH3A 4KROC 4K55A 1IGCH 1KBKA 3I74A 5ANMA 1UGKA 2OX5A 1VENA 1NOLA 1CFQA 3S4SB 3W5MA 3DUSB 4M43L 4WFGD 4AV5A 1VEPA 1ZT1B 4JG0H 4OSUH 4HJUA 5BV7H 4XE0A 1V3LA 1CF8H 3SDCD 4AW4A 3ZYJA 1JHLH 3HE6A 1XT5A 4LDLB 2NY0D 1V05A 4FABL 5BVPH 2AQ2A 2O6EA 5ABAA 3UDWC 1JZ5A 2FL5A 1NIDA 3IDNA 3UYRL 2YZ1A 5E6IB 1KCWA 1NINA 1SDYA 3KGRA 3DUSA 1KIUA 2G2RB 2HKHH 5C0BE 1TT6A 3HVNA 4LNVA 5A6LA 3ULUL 1A3LL 3BUTA 4GG6A 3RGVA 4L3EA 1AGBA 2JI2A 3DTDA 3C09B 4HFWB 4R26L 4GO9A 1KN2H 3H9HA 2NQDA 4G7YH 4DESA 1OGSA 3RTQA 2EIBA 3QXUA 5BQDA 5BV7L 3GRGA 3TCLA 1SYVA 3JTSB 4HUCA 2ICEB 2DQJL 3CC1A 4NJAH 1D5BB 2ENYA 4LPTA 5F8RC 3D05A 1J05A 2WNKA 1PG7X 4WI9A 3TASA 2DI8A 4BZ2H 3B9KC 1G7HA 1NL0H 1IZKA 3MHZA 1PF3A 4U6YA 4RRPM 3D06A 2NY2C 1ZLVH 4D9QE 3Q2LA 5EBMA 5GGSA 4LK4A 1ZD6A 3STZB 4R90H 3IAQA 4RBPH 5D4IA 2HJLB 2X2JA 4JFDD 5INDA 4Q4EA 3FQUA 3KWWB 3VFSA 5KVEL 1A6AB 2VYRE 5DJDB 4IBUA 3MCLL 1AMXA 1RJZA 5HI4D 4B7IA 4OF5A 1KGJA 1P4LA 3ENEA 1W0YT 7PAZA 2OV0A 4N2FA 2A77L 4DGVL 1Z7JA 1RHHA 4MKTA 2V2WA 5CILL 4Z7UE 2OMYA 4IOSA 3ZYOA 4HWBL 5T8IA 4QHNB 1P5VB 2DQHL 2R1XA 3MRKB 5CD3B 1PIGA 4HC1A 4G8AC 3FT3A 4PCSA 3VXOA 2KT6A 2VR8A 2W65B 1IEAA 1WIUA 5IB2A 5IUCA 5KVEH 2J12B 4QHLB 1COBA 3HG1B 1J8HB 4X4YA 5I15L 1LNUB 1TTBA 2EYTA 1OGAE 4R7NB 3SYAA 1INDL 3CWGA 3P30H 2B16A 4GBXC 4JY4A 2IADB 2BPBA 4KFMA 3ZDZF 2VDLB 5IROD 1AOHA 1BX2A 1W6WA 4P9HL 1CDYA 2VDPH 3IPFA 2D0FA 2ED9A 1H3XA 2UZYA 4YMPA 1XIWD 4KKBC 4KXBA 4PTUA 4ZXBC 4ETQA 2JKNA 1UTDA 3QT2A 5B7EA 2VZVA 5AAWA 2KS0A 1YEIL 2FO8A 2QHLA 5TE4H 1W0WA 5E99L 4RRPA 2VW4A 1L9TA 5FV2A 1GY1A 4U1LA 4UQ2B 1UFUA 4OLYL 4NPKA 3BRGC 1DVQA 4UF7C 2GFBA 3SDCC 1RHFA 3UTSE 5HVFB 5HYFA 1RJYB 2W0KA 3VXUA 1K2DB 5AKTA 2PYFA 5BNXD 3D0LB 1HXKA 5LNDA 2QMKA 4HIEB 1YMHA 3G6AA 2IXQB 3AJ7A 3LEVH 1QYGH 4XXDA 4GEJA 5D70L 4AY0A 3ROOA 3CSBA 2XZQL 4L37B 5FXCH 4A6YH 2HX9A 2MQ3A 1NBZA 3F65A 4JANA 4P23C 4P5KA 1HOCB 3DUUB 3N43F 3AXLA 4B5ZA 2XBDA 3PF2A 3S4SG 4FULA 3WNOA 4M03A 1I31A 4RIRB 1A7QL 3QORA 5GRXG 3NABL 5FR3A 3NH7L 4K5MA 3IGKA 4QRFA 2VSDA 4HBCL 4TOYH 3SY0A 1FIEA 2IOOA 4NHUA 5C09B 5I0ZA 1J5OH 3RY6C 4ZX6A 3WN6A 4OQTH 4APQA 2I7SA 1IE5A 4NNYB 5F7FA 1HCYA 5DK3A 1ZLSH 1L5GB 1A9EA 3KS0J 1KYUA 3JWOC 2KLSA 4JKNA 5IREA 3W0WE 4MA3A 1DDTA 5KJ4A 1VACA 2WTOA 5K9KA 3D25B 3EO9H 1KB5H 4XX1E 3CE1A 1NICA 8FABB 1UKQA 3I9AA 4JVUA 2GK0A 4O9HL 3T0WA 4LVOC 4X6CE 5J6HB 1GC1C 2WM0A 5T3ZL 5FHBL 4GRWB 4O51B 3KBEA 3EYOB 5DJCB 2B14A 1TJHL 3NA9L 2F18A 2X1XR 3QO1B 5IWLA 2IAMD 3DI3B 4H8QA 1L0PA 3C60A 5HTSA 3UPRB 4WJKB 4V2CB 1HDMA 1IGFL 3KYOA 3LN5B 3LQZB 5BS0D 5KVGH 4U6HA 4Y2OA 3H9SB 3IRZA 4AUJA 1DN0A 2EDJA 1C7SA 1RJLA 2AMGA 4AEHH 5HYSB 3ELAT 1UJ3A 4GIOA 5TDNB 3TIEB 3P9LB 1VFUA 4I48B 3BN3B 3QHZL 4JRWA 4I3RH 3CLEH 4AOFA 1YNTF 4JY6A 5IQMA 3J07A 4QHUB 2BJML 3GT6A 4OZ4B 4PJHB 1PD6A 1AY1L 1FZMB 1IM3A 3IM1A 1JG9A 1P5UA 1WG3A 4JZJC 2W81C 2YD7A 3MODH 3U1SH 4TVSa 3U9PL 4MA3B 2VJ0A 3MRMB 2R4SH 5K9KB 2XTLA 3PHSA 1FUNA 4HMEA 1AP2B 2F0CA 3PWUA 1XCQB 3EH3B 1JL8A 1A3LH 3KR3L 5DUPH 1X5YA 4YUEH 2D7TL 4HFUL 4WCYL 1QASA 4EXPX 5DLML 4N8CH 4WGKA 4AIZB 2Q3ZA 5F8QC 1VFOA 2XWZA 4J6RL 2FWUA 4KNTA 3MA7B 5I82A 3N1FC 2GTZB 3CFQA 3QO0A 3ZE2B 4I8DA 4LSPH 3UROR 3MLZH 3U0PA 2MEJB 1Y18A 1FG9C 2ZX7A 4F7PA 4N2HA 2ROXA 1NIEA 1UJ3B 4U2YA 2UWEF 3VXMA 2JK5B 5CIPH 5L2KE 2VM4A 3L7EB 1IEBA 4N4YB 4E9QA 1WTLA 3QNXA 3N41F 5EU3B 4L29A 2MNWA 2GBTA 5JPNB 3HUJF 3RDTC 3CFUA 1TU2A 4UI2A 2R56H 4LMQI 4BRVA 2LABA 5IV2A 5DMYA 2WNGA 2X42A 4F7PB 4P4KB 5CZXD 3FU8A 3D34A 1WD8A 2GCYB 5E2UL 3LXCA 4GSQA 3KH4A 1J87A 3MGTA 5DUBB 5C0FA 1T3FB 4C4BA 1Q1PA 3IF1B 1FFQA 1BBJA 1PKQE 4PW9A 1ADWA 4Q14A 3CU1A 5HGAB 4AENA 3EAKA 3QIBA 4JPWH 5J12B 1QFWI 4KK8D 5DUJA 1TXKA 1UEMA 2BVPA 1NGWA 1CICD 2O5XH 4IHOA 1SHWA 4KKZA 5LNGA 1FG2B 1Q0XL 5AOLA 3CC5A 3BKCH 4NDMB 2XN9B 5CINH 1GCYA 1K6QL 1QQDB 4XN1A 5CFAA 1NFKA 1BM7A 3N0AA 3H42H 5DJYB 2QTVA 3KVPA 1JGLH 1GYUA 5G55A 3MJ7B 1TETL 2ZCLL 3GLZA 5DURD 5IQNA 43C9A 2BSTA 4TSAH 1Z5LB 2AF2A 3Q2CA 4IJTA 1IT9L 3JBG7 4N2MA 5FKPB 1SXSA 1TLMA 2ITFA 1TZGL 1PX8A 4FQXB 4LCCA 2WXGA 2R59A 5GSRA 3PAYA 1RZFL 3AC0A 4JFZH 4NQTA 3WBDA 5BZXA 1PZBA 4OBSA 2P48B 5C0CA 1DJIA 4K7PH 3C8DA 4UM8B 4CADB 1E8XA 1U8PB 2A4EA 1U95B 2HJKA 4JW3A 2V9UA 4L8SC 1J9TA 4JZOA 3RE0A 5DUML 1L0XA 1AMYA 1MZZA 5E8PA 3JT0A 3NJMA 4P5TB 2CBMA 3VXME 3WO3B 4DNLA 5I24A 5JNYB 3IU4L 2EDOA 1A7RL 1PEZA 4ZI8A 1NC4B 1OAQH 1SQMA 3IJEB 1N8ZB 1NAMB 3UL4A 4NZDA 3QHFH 5FHAL 3PHOA 1JGEB 3B9AA 1E6OH 4KRLB 4QOKD 3V5HA 3LKPB 3O4OC 5JHBA 5D7IA 2E8YA 4H88L 4YZFF 4WNSA 5EU7E 3VGAB 3CC5B 1JUFA 5FW7A 3MLWH 2EDBA 2R29A 3FSOA 4N8VG 1MPAH 1TTFA 3EBIA 4PGEB 3D33A 1OW0C 3IXTA 2WXIA 5HHNB 1IGIL 2VXSL 4JO2L 3KL3A 4RH4A 3BN9D 3EJRA 2NY3C 3VX0A 2AJZA 3IB4A 4GG6B 3ZPDA 2W88A 2WLYA 4M62L 4ZTOL 1GYAA 3U9WA 4EPSA 1ZTXH 3BVVA 1KWGA 3M7FB 1DJSA 2QVIA 1AGFA 5HHXH 4MAUH 2FB4H 1FV1A 3TOPA 5F93C 1BFVH 4XPFL 4QWWC 3FFDB 4K8RD 2NOYA 2FGWL 4MMZA 5FUZL 2B59B 4ZDHB 4Y1AE 2VLKB 1CXEA 2XWBA 3HMWH 4KXDA 2RD0A 2MIZA 4IU3B 3VXPA 1F11A 2KERA 1AR1C 5LQBH 1JZ6A 3NN8B 2Q6WB 2XKUA 3E2HC 3TFKC 5D1QA 1RLBA 5L9DL 5EBMB 5D2LF 1QW8A 5E08H 1NMBL 2APFA 4N0UB 2DWYA 1X6NA 1YC8A 1OE2A 4HUKB 2JIXA 1QWHA 1ZT7B 2CZNA 1H8LA 4ZBJA 2RJMA 1AO7B 1CDIA 3PHOB 3ZKQD 1A9BA 5IY5B 5E6ZA 3VD5A 4QTFA 1TZAA 3AUWB 2D3NA 4AC2A 2ROYA 3F00A 2FT6A 1T7XA 5J5EA 2VQ1B 1LO3H 1S7VB 3TLRA 3NRQA 5LXGL 2FO4A 2ZAGA 2ADGA 1R3IH 1CFSB 4PJ7F 3QUXB 1PNCA 4XP4L 2UYLB 5JPNA 4H26A 3ZDYB 2VDPL 1A6TB 2D4DA 1E7UA 3NCJL 3KBPA 3T09A 4ELKA 1ZT7A 5CZVL 5L0QC 3UAAA 2HT4D 1J8HA 1CLCA 3N50A 2FBRA 3S8FB 1PU0A 4FNSA 3TVMC 1RZIA 4JJHA 2ADIA 4TULH 3C5ZA 3LY6A 2Z31D 1J8HE 3X12B 3RURA 4JM0A 4ZDHA 5MEPA 3QDJA 3JVGC 3AQXA 2OS7A 5GGQH 4APQD 1AE6L 4CVXB 3FQNB 4NOFA 4PRBA 4XMKH 4Y2NA 1CFBA 4PYGA 3BHBB 3DIFB 1G6RA 2LU4A 1EHAA 1TCRB 3SGJC 1NH6A 5JXEA 2FEEI 3VH8A 1KFAL 1P6WA 3PQYD 4KKCC 1RL1A 2OZ4H 2ZSWB 5C0IA 4UYPA 1YEGH 1FL5A 5LDUA 2WKGA 2V4LA 4D9LH 2FIRT 5JW4R 5HHME 3FPYA 3ISRA 1U36A 3O9WB 2OAAA 4PJ7A 1JWSB 4BH8B 4KZEH 2IBZY 1AIFB 2EUVA 1VRSA 1X7QA 3GRWA 3QZNA 4P2QD 4PWEA 1I9JL 4GXFA 1DVXA 3D87B 2YXFA 5IMLB 1F45A 4XPGH 2Z93B 3D0LA 2OP4H 3B7TA 4L8BB 1YMHB 2WZPA 2HG5B 1X5IA 1M57B 3BXNB 2IQAB 2VZUA 5D1QE 4NNXA 3L7FA 3WUZA 3F58H 3DX6A 1MVUA 5GRJH 1YRKA 1U2CA 2YAEA 4JGNA 2FH6A 3PDDA 4PJ7B 4LRNH 4HUVA 3L3HB 1XGZA 1R4XA 3QDGE 5IBTL 4LQFH 3RJOA 4G3YL 1JFQH 4H40A 5CGYC 5I8OL 3KJ6L 4PHXA 3DROA 3VFTB 3BCDA 3D39B 2CUHA 4FCHA 2E6QA 1MRCL 1Y1DA 1AHKA 4PHZA 1KJ2L 1SJHB 2VN7A 4N0RA 2LTQB 1UCBL 1LEKB 3WXVH 1WTGT 1FNEB 4H0HB 4KKLD 3PQYA 4CVXA 1EMTL 2OXGA 1E3XA 3FT4A 5TF1L 4MZ2A 3UTSD 3NDYE 3WFHB 2R2BB 1I9IH 4QKTA 3QYNA 4KQ0A 3ULUH 3F8UB 3V0EA 3VD9A 2Y7OA 1GHFH 4KKPA 1IBZA 1FL5B 2D8KA 1X9UA 2OI9C 3R0NA 4ZQKB 1Q94B 3HR5B 3S3JA 4FFZL 1C5CL 2AJ3A 3W57A 3ZQWA 3BVNA 5I5JA 4R7XA 2WB7A 2OXHA 2R51A 5FKAB 2R1XB 1I3GL 1WS7A 4LP5A 1WJ3A 5AW3B 1QFWM 2R69H 4UZGA 4ODWA 4Z7VF 1KLFB 2X1WL 3SKOA 5MENB 1KXHA 3SCMB 3CPUA 4QAWA 4FHBD 4IRJC 2R8SL 3MJWA 3QIBC 3IFLH 4NNXB 3JVFC 4BZYA 2MPAL 1C5DB 3VFWA 4Y4HB 3QEUB 1WCQA 4ZMWA 2BS9A 3ZBMA 3LXAA 3L9RB 1E0OB 2D3LA 2ZICA 1YMMA 3L3IA 4AQ8A 2JCWA 2QR0A 5CD5C 4N0CC 5I75C 3NIFB 5BZWB 5ESQB 2CA4A 1LQBC 5KOVC 3KVQA 1S7RB 3ZMNA 1D7CA 4YSQA 2EECA 1SBBA 1QW9A 3RIAF 3AREB 2CDGA 2BNQA 2IH1A 3IDYC 3QDHA 1IKOP 3QA3B 1QLRA 3MYJB 4X6CF 4A2LA 1KN4L 3D18A 4HWBH 5C08A 2VL4A 2JIXB 4EOWL 3O3UN 5JPMA 4HUWA 4HLJA 3EO0B 5BOJA 1RIHH 1ZVSA 5BPPA 4FS0A 5I76A 5ISZA 3HNVL 4J8RB 3VFGH 5I2IB 1F90L 2PCFB 5FW6A 1J05B 3DX3A 4H20L 3EHBD 3SDAC 1O7SA 4MXVF 3U0TB 3B6SB 1AC0A 2LGNA 4PY8J 1QI5A 4M9OA 4FERA 2G9HA 3OSKA 3IMWA 4XN9A 1ES0A 3EYSL 4GFXA 3DECA 4NRYA 3GMLB 5HI5D 3Q5OA 5D8JH 3BT2L 1EWHA 2XVGA 3VNZA 2XTJE 1ET8A 4PVLA 4DWHA 4N2NA 1CGVA 3OAUH 4IRSD 1OCRB 4JGUA 4QRUB 3G6JE 1H8NA 2GB2A 4PG9B 4Z7WA 3VU1A 2AANA 4F7CB 5AYUH 4ZUUB 4H1LB 4QOKA 4UOW0 3PWVB 3UACA 4A2EA 2F7QA 2OULB 2X88A 1ASQA 3HKZA 4NN5B 4ZMTA 3GSVB 5J1AA 3SO5A 5DRZA 1NFDF 2JQZA 4XWGL 1IBGH 2J21A 1A14L 4MAYD 4A63A 1AR1B 3PDOB 3T0ED 3DGCR 1X7SA 2H2SD 4BFFA 5IT2H 1V27A 3QFJB 1PBYA 1PGRB 4DOHB 1YQVH 2HP4A 3E80A 3SDXA 3VH8G 3C5XA 1H5BA 3PREA 4ZUUA 5GZNC 2BC4B 1MCEA 5BRZD 3H4HA 4J3BA 1EGJA 4F3FB 5GGTA 5EFIB 4Z3TA 1EXHA 3IMUA 2LTQC 2VLMD 4R90L 3CUPB 2E6JA 2I9LA 3BXNA 3LSOA 3AG3B 4EZLA 4S0TD 1JRHI 1KGIA 4GH7B 3AZUA 3DX0A 4U4IA 5F6IC 1S9YB 2E7DA 3IFPA 3TO4C 3UGEA 3SDDA 4GUPA 1PDKB 1OGTB 1J5OL 2D31A 4HGWA 4OF6A 2AK1H 4O2FB 4U1LB 4E9LA 2JKLA 5B38B 4TOYL 2E86A 5GGVH 2DQJH 4F8TA 5DHVB 3VNYA 5KS9A 4R96B 3BD4A 4MJJA 1RMFL 1N68A 3EYSH 3ZE1B 5BXFB 3VYOA 3OAYK 4F7CA 2VZSA 3LKQA 4GAYA 4Z7VB 3DSFL 2XN9E 4MMXC 2ZIDA 4IRJD 4KX8A 1TQCB 4FZ8H 3HE6C 1FO0A 4DO4A 1FAIH 2P5WA 3D50A 2BDNL 3ULAB 3R8BB 3TJEH 4FG2A 1ZVYA 3ZZ1A 1EEZA 5BW7A 1EXGA 1CFVL 1KT2A 1THAA 3PUUA 1L7TH 1W2KT 5F3HB 4A7UA 4AGMA 1ASOA 1MELA 4NUJB 3UDWA 1FZKB 1P7QB 5DZNA 1P53A 1DO5A 3STBA 1SNRA 3HS0C 2Y5TA 1FNGA 2FX8L 1GA2A 1T2QL 3EXJA 2A1WL 2C9UA 3R0MA 3ZRSA 4NHUB 3RBGA 3V6FA 5JHLA 3VXSB 4Q9RL 3OJ2C 4PGDA 5DK0B 2IAMB 3DK2A 35C8L 1T1WB 4I0KA 4PD4K 5L6YL 1A6VH 1D5RA 2AV7A 3I50L 3OR6B 4QCIA 5C8JA 4IEFB 1RMFH 3U9UA 5IOKA 1HH9B 1KPUA 2YD3A 4ILDA 4YSOA 4FFYL 2Y6SD 5CSGA 5C97A 4KK9D 2FWLB 5FM8A 2NYKA 1T83C 1YNLL 1CIUA 4J4PA 3GMPB 2LOEA 5ALBH 3IT8D 2EILB 5AZ2L 3L9EA 3ZGIA 2ZUWA 5IB3A 2ALWA 4BSJA 4S11A 4U1HB 1R9FA 3O6LL 3L7EA 4CGTA 1I3UA 5D6DA 1HQ4B 4BD4A 4RGOL 4XH2A 3QUYB 3NGBC 5KBMA 4ESKA 1JTPA 2VLJE 3FUEA 3Q3GB 4Z0BH 4D3CH 3UPRA 4OFQA 5E4AA 3BPLC 3CFJB 2Q7NA 3QQ3B 3AG1B 4DK6A 2Y4SA 1KGCE 1AG0A 3BKJL 4U1NB 2FBJH 3BD3A 3CZNA 4P23D 2FBOJ 3AVEA 1SJVA 1ODAA 1W72A 4KRMB 4AM0B 2WKLA 2O5ZL 4YHNA 1T1ZB 4PJFE 3WJJC 4UOZA 2DBLL 2ZOKA 4BQ9A 3V95A 3QIUA 2VUKA 4UQIM 1D5ZB 1WQVT 4DEPC 5IBLD 1D9KB 1N9PA 3ARGD 4WK0B 4X6DF 3QIBD 5EEVA 5ID1A 2TSBA 3HHMA 2A4ZA 3CZFB 3K6OA 4Z0BL 4JY6B 5EU7C 4AL8L 1JF1A 1XB8A 5C0GA 1OK8A 3CFJA 3EW3B 3CPLA 1UM4H 4E42A 2ENQA 3ORJA 3K8LA 4KUZH 4WNQA 2IF7A 1FCGA 3NA4A 3CSYA 4CGUB 1FBIL 2DWTA 2ZOKB 5I1CL 2ED6A 1G43A 1WO2A 3NUKA 3T6QC 2VN3A 3MVSA 5C07B 1J0HA 2IBGA 4HH8A 1AO7E 1RULL 3MLUL 5ADOH 1S9WA 2F7IA 1JMXA 2OCJA 2HFEA 3JWNE 2AI0H 5IROC 3PWLA 3DWTA 4WUUD 5AUMA 4ZXBA 3ZW3A 1A66A 2F53A 2ZUSA 1P84K 4OFYD 5EWIL 4BZ1H 3AY4A 4L0YA 3IFOA 4HWBA 4KI5E 1BJ1H 4OZFB 5BZZA 2YWZA 4UTAH 3HNTH 3ZIMA 4KTDH 2ATAA 3QR2A 2WAHA 3IDGB 4PJ5D 5HHQA 3MRLA 4AEEA 3BZEA 3U4EA 1WUZA 4JHVA 3HBQA 4AJWA 2DQFA 4YHPA 3L3OA 4EN3D 4U1KB 4BH7B 4YHML 3VRIA 1Z9SA 4AVJA 4HS8H 4JPVH 4GKZA 3DBXA 5E2JA 1N3NA 5F7KC 1HS6A 1YEJL 1ZT4A 5E51A 3ATAA 1QZ1A 2NXYB 1SUJA 4XP5L 4LSDA 4WTQA 4F2MB 1X5XA 2P5PA 3HUJB 1HZLA 2AZUA 2AEPH 3CDCA 5DJ6A 2MPAH 3L2MA 4HK3J 2XN9D 1KTKE 3DPBA 2HB0A 4YXHH 3BUIA 4JFPB 2Z64C 3GHEH 2EIDA 3L3OB 4N8VB 3QXAA 5ICXB 4C57C 4GMSH 4Y2DD 4O02H 5JIIA 3VJ6B 1I3GH 4H8WC 4NQEB 1TEFA 2CD0A 4MXWL 2PWDA 1Y7VA 3NZHH 1BVLB 2P8MA 5I26A 3VRJB 1HJBC 5JOFA 3UPAA 3GJEA 3OGOE 4MMYA 2KQNA 3V5KB 3N2JA 1IQDA 4OGZA 1F4XH 4IK7A 3PGDB 4GAFB 3HC0A 2PP7A 3ATBA 2D7MA 3MRJA 5BS0A 4K3EH 3LN4B 1DJWA 5EF3A 2E8ZA 2GT9A 3TBTA 4IOIA 4X0KB 4FXKC 3PHAA 1N2RB 4XO4A 1BGXL 5ESVA 5D1XE 3A3YB 5CR1A 1XGYL 4H4NA 1R5VB 4L1SA 2MQGA 4N0UA 5JYMA 1I3VA 3L3JB 5DI8A 5E2VL 2VR4A 4K7PL 4DP4X 3B7YA 3LB6C 1HT6A 3GBLA 1M2OA 2ZCKL 4UAOB 1ZTXL 3EOBA 3NP3A 3TZVB 1PZUB 1TZGH 1H5BC 1OB1B 4J3SA 5D7KD 3FO2B 4H25A 4NI3A 4JHWH 1MPAL 3VSTA 1JSYA 3UZVB 2GHWB 4FQQB 4HKJA 2PF6A 4YPJA 3DX2A 1TEGA 3SBPA 1RK1B 3DC0A 2RAMA 3S8GB 2Z35B 2PPEA 2VQTA 5CINL 4M4RB 1E6OL 1LO0H 2NW2A 2JKWA 3BP5B 4NNPH 5K9JL 5JHDA 3UC2A 2EDHA 3P0VH 5DEZA 4UYQA 4F9PA 1IB5A 1YN7A 5FAAA 3MACL 4F33A 1D9KA 4QHNA 4OV5A 1V54B 4YBLC 4DZ8A 1OGAD 1T89A 3W11D 4H25B 5FYLD 5EORH 2FX7L 2R0KL 1I8IA 3P02A 3LNIA 2CR6A 2Y7SA 4NWUH 2V3EA 1A4JA 2JSFA 4Y89A 3APDA 4R0LC 1I7RB 3L5WA 1EAJA 2DEWX 1MIEH 1R3JB 3ZHDA 1OTSC 5C6PB 3QIWA 4BDVB 5K59F 1OP5K 3K80A 4ZW7A 1NTDA 5IMLA 3RTLA 5GSVB 2QKIB 4KRNA 5IHUH 3S88L 3QCVH 4NRXB 4Y1SA 4Y4FC 3T0EA 2G3XA 4OV5B 1NCAH 2NZ1A 3PYCA 1V7ML 2Q6WA 4PI0A 4ZXBB 5EV7A 5KN5A 1ILUA 4MB3A 1CGWA 5F96L 3SKMA 4NQXA 3EYFB 2IIJA 1SLXA 2FAUA 3FQ2A 3VXOB 4DVRL 1QX1A 1FNSH 1WZAA 2B2XL 2WY3B 4Q2ZB 3W0WB 1OAXH 1XCXA 4MQTB 1NUFA 3LEXA 5DZAA 3FTYA 5KBPA 5E2WH 2UVEA 3LS4L 2XFGB 3MV9D 5CUSH 2F68X 3DX1A 4ZAKB 2BS71 3T8XB 4DGUA 3LMJH 2DEXX 4FQ1H 1L9RA 1MI5A 3EHBB 1B4RA 1E4KC 4BIKA 3WFHA 3QI9D 3H7BB 4XX5A 5JR1L 1FNSL 3HI6H 1AE6H 1CD1B 3VWKB 2X6BA 1OW0A 5IVNA 1GKOA 2G30A 5BUGA 1P0SE 3F83A 5TDPA 3ULUC 1UZ6F 2F8OA 3HUJA 1SBSH 5J6GA 3E8VA 2A9ML 4MCMA 3H2PA 2K4AA 3CFBB 5F0PB 3C08L 1MWAH 3UTZB 2BC4A 5J57B 2CLVA 3FYEB 2HTLC 3OF6D 4KQ3H 5EUOB 5GS1A 3TX4A 5D9SB 5KYUA 1G7JB 2CA3A 4B5EA 5IOPA 1GGIH 1LEIA 4HAFA 2UZIL 4NZTL 4ZOAA 5HGDB 3H9HB 4PJHE 4Y4HD 3SKMB 3T65A 2ZPKL 4PRIE 4NZUL 4RX4D 1W16A 1E9OB 3IKCA 5FYLL 3UP6A 8FABA 3RLSA 4LASL 4JKPL 1CI3M 2XV3A 4PYHA 2GITB 2Y06H 1DQDL 4MXVE 1WAEA 4P2RD 4P2QA 3QVAA 5IVZA 1M05B 1X7QB 2V17H 2P80A 3MOBH 1JI2A 4GKLA 3LKOA 5CIPB 4Y5VA 5IVOA 2X4TA 1MCCA 4P2QE 3G5VB 1F4WL 5C09A 4WDIB 2WBJB 1WUNT 1E5BA 1KYAA 4KDTA 5A43C 3ARFA 1SOKA 4RA3A 3IK2A 5T3ZH 1KGUA 3UOAB 4ODUB 3V6ZB 4U7MA 5C08E 2NCMA 5AVVB 2NR6D 2P47B 4KDWA 5KOMC 4EIZC 2F58L 2E7BA 3K2UL 1RZ8B 1L9MA 2VOTA 2WZ6A 4PJ6A 3ZTJH 2QQQA 2CU9A 3REVB 3R18A 4MS8D 2BJMH 5LXVA 5F1SA 1CDHA 4PGEA 5AB1A 2IV8A 3G9AB 1MRFH 4MB4A 4BFEA 4IMLA 5KS9F 3IGAA 5AW2B 1GJWA 5IIEB 3EYUH 3R7RA 3MRFB 1TZ8A 3QG6A 1JD7A 4IMKA 4Y7MA 4Z5RA 3RVWC 4A7GF 1MRFL 3M1OA 3C5ZC 1SBSL 3VYPA 4Z23A 1T22B 2EYRA 3BWUC 2P8PA 1TEYA 4Z7QF 1CURA 5HGDA 5KEZA 1DQKA 2EH7L 1XF2B 3K6DA 2IBBA 4P2RA 3N42B 1NGZA 4PLNC 1KDIA 1XCQA 1XSIA 4M6OH 4PJGF 5IGXL 5F88A 2OMUB 2AMUA 4PY7B 4LESA 4N90E 1OP3H 3ZSSA 5I6XB 4WENB 1WT5C 3P9LA 2OMTA 2DRUA 3FRUA 4N22A 1NGPH 1HQ4A 1WA1X 3KD4A 2DWSA 1P7HL 2QGEA 2WZPD 1CJYA 3HZVA 3LN9A 4XXWA 4KGJA 5FCUL 2HA1A 2Z3FA 4M6OL 4YSTA 3KR3H 1T21B 4FQLL 3FULA 4GW4A 5CJQH 5I19H 1U3NA 2YZ8A 1MCIA 5AVXB 1BAFL 4W70A 4B0MM 1Y18B 3CVIL 2VLRA 3KYKH 5I1DB 3WSQL 2HN7A 4GI9A 2CE6A 2DIAA 2R56L 4RBPK 2LVCA 1BEYH 5E2TH 4C47A 1T5KA 5D7LA 5GS0L 3VFOA 1PW3A 5I28A 2C34A 4P46A 1AY1H 3G6AB 1MH5A 2PO6A 4WTWA 3VI3A 4X5RA 4DP6X 1A6PA 4X5WA 3RJQB 2P1YA 4IU2A 3VFPB 4Y1TA 4XNMB 5DS8A 1JVLA 1ZJAA 1H8SA 1XCTA 3Q8AA 5CZXC 3D48R 2HLAA 4EDWH 3HS0A 1U2YA 4YIQA 2UXTA 4G42A 5T3XE 3TA4D 2NY1D 2DWEA 2H3XC 3TVMA 5I23A 4NBZB 1J5DA 1ORSB 1UOVA 5E6YA 1NUDA 1RXLA 5I76B 1WA0X 2DQGL 4J1UA 5DMGC 4KAQH 3PAZA 3BJ91 4PJIA 5DJ0A 1KUMA 4CU7A 1MH5B 2EDXA 2C9SA 1F5WA 1FO0B 1FLRH 1WWWX 3CFCH 2EIMB 2EKJA 2IDTA 4WO4A 4KX9A 2R4RL 1QR4A 3LZLA 2HLAB 3LQAC 1DJZA 4E0RB 3T3PB 2PCYA 1ERNA 1HL9A 4GSRA 4HF5L 4X6DE 2BWIA 3CG8A 1DSYA 3G5YA 3KPRD 3N0PB 1ADQL 5EN3A 5GRUL 1OWWA 4DKAA 3GSRA 1SHXA 2RA1A 4HKXA 5IESL 4C55A 4HPOL 3GF8A 4N0YL 4IS6B 1IGTA 4YL4A 5IJVB 4UILL 1HEZA 2ZKXA 5E8NA 2A0LC 1FFPA 3OKNA 4WJ5A 1BYPA 4W6XB 2XT1B 1M7XA 1D9KC 2IPKA 3VRIB 4ZOCA 4KQ4H 1HH9A 4DFHA 1I8MB 2V7HA 5JUEH 5IHZB 4WWKB 4NO2A 1MVUB 4RFEA 3NVQA 2B9AA 3CIQA 4ZFQA 4JFQA 2B5IB 3NPSC 5E2VH 1CFNB 1ZHKB 3U4BH 2MOQA 1MIEL 1R5WB 1CIDA 2VTFA 3I2CH 3C6LC 1VB9A 1A4BA 5AAPA 4GKSB 1UKSA 4GLRH 2G5RA 3CAFA 2WPGA 1CU4L 5BUAA 3ZXAC 2AXJA 3X3GH 4URKA 4HEPG 1DBKH 2HVJA 3T0EC 1URIA 4J2QA 1QYGL 4K3EL 2YSSA 2BSED 1D7BA 1XIWC 2WC7A 4YK4B 3TIDB 3TBCA 4YC2C 3BZ5A 3AUVA 1OGTA 2EIKB 3V5HB 2GJ6B 2B0SL 1OAXL 1E5ZA 3V8CA 4R8WH 4GBXD 1LO0L 1XHHA 4LHUB 4E2OA 5IMOA 3UABA 3FTWA 1ET7A 2O6PA 4XB8A 1IQWL 5D7LD 5E5MA 4HH9B 3BKYL 2ZCHH 5KZCD 3TA3D 1QP1A 4UOQA 2GBAA 2PCXA 1BD2A 3DVGB 1IO4C 4R2GB 2C9AA 3HB3D 3ZN6A 1NBVL 2EE2A 2YHGA 3KPRB 1Z6JT 3K71B 1IU1A 1U3YA 2DYPB 1WAPA 5I6PA 1QBML 2EIEA 2YAQA 3IE4A 5FOBA 4RFEB 3MLPA 4J7RA 5FDWA 3N43B 4U1GC 3V4VB 4RISH 2R0KH 1I4FA 2ICWB 2QMJA 4FXLA 3SY6A 5LVEA 2LV4A 4EI5D 2FECL 2YIHA 2IPUK 4W9IC 5EHFA 3VQMA 4HOWA 3QUXC 3G6DL 2F5AH 4QXUH 1DLHB 1DUZB 2DLEA 5DQ9B 3WLBA 1ID2A 3GWJA 4PJ8D 3VXSA 3BW9B 2CDEA 4D9QD 3ABKB 4MJ2A 1LO5A 5EIQA 1XGRB 2XG5B 1AHWC 5GZNA 4AQZA 2CXKA 1A3RH 1JZJA 3P4OA 2X3CA 2O5ZH 3IETB 2GUOB 1I1AB 2Z7UA 3ARDA 3BAXA 1FV1B 4U1IA 3LHPH 3V4LA 3A6OA 4O9HH 2JNZA 4NBYB 5CSZB 5J12C 4AYFA 1NCWH 4Q0XH 4NQUA 3UTTB 1AYOA 2VERN 3TZVD 1W0VB 2H1PL 2XWBB 1ZLWK 1DBBH 1PJ9A 1KTLB 4AENB 2G2NA 3KXFB 2P3YA 1OP4A 2BOBB 1X5HA 4BQBA 2VDNL 4HX1B 3MRKA 1QEWB 5AVRB 4WI5A 4OZ4A 3B1UA 2HVKB 5HYSG 3V55A 3ZHFA 1EZVY 1UM5L 3FQWA 3W39A 4OZIE 3GYRA 1R1CA 3QULB 4AYBA 4N85A 1YPZA 2WXHA 4OI9A 3G08B 4POZC 2WWKT 1DLFH 1YEJH 3JZ7A 5KYWB 1DQTA 4KKBD 5DJAB 4JR9L 4LPXA 1PJWA 4DAGH 4MJIB 4LOUC 3OX8B 1S3KH 3O81A 5A16A 3EJZD 5HDOA 3RYMA 3VFRB 3IGUA 3MLYH 4L0PB 2C7UA 2WLKA 3U2SA 2BSSB 4PRHB 4FQXA 3T2NH 3UEZA 3O2VH 3THML 5F7WC 2VR5A 3GLDA 2RQ8A 3QUYD 1LWJA 2EC9T 4PU2A 2EDRA 4WI0A 3AG4B 4X4ZA 5EC2A 5T1LD 3S3BB 4G8IA 5C9JB 4H44C 4UU9B 3ZKNC 1A25A 5CFHA 2QLVB 2VERA 4XBMA 3D08A 3MKGA 5TTRA 3T04D 3WENA 3MV01 3ZY7A 4ZQTA 4XZUB 5D2NE 3H56A 1K2DA 3O6LH 4UCFA 2OZ4A 1RIUL 4Q6KA 2Y9RT 5C0RL 2F15A 4LOFA 1NPJA 3IJ8A 4G1EB 4A2FA 4TVPH 3RL1A 4PREB 1GVIA 1CXHA 4PSPA 5EC2B 5HI4C 3ZJAA 1KCVH 4M7JL 2VZ1A 2H1PH 2K9UA 5C0RH 3DA0A 3X1EA 4GW1A 5AG8A 3UBXI 5E2TL 3QORB 3VWJB 1Q9OB 3JTTB 1JDCA 5DLLA 1GZPB 4X7SL 5DZLA 3LKQB 3IF1A 2WHVA 4UNVA 2C9VA 5D9SA 5KYUB 1N0XL 4TKWA 2QTEA 3DGGA 4LEXL 3TNNB 4G43B 3U36B 4UZSA 3ZHNA 4FFZH 4LSUH 1ZE3C 5DVPA 3LPOA 5FCUH 3ZKMC 4APQB 5I1HL 1GW6A 4EO5A 1U3HA 3FCSA 4WU5B 3V0WH 2FEEL 5DK2B 4P04A 5HVGB 2V7NA 2NNXA 5B22A 4UAHA 3FL7A 4XP6L 2ADYA 3O2DA 4PWHA 4OR1A 4PS8A 1E4JA 2UY6B 1RK0B 3LRLA 3MCLH 3VXPB 1OHZA 4XNXH 2GTQA 3EYOA 4TLKA 5DJCA 1UD3A 1EPFA 4MS6A 4RZCB 3FN0L 4UUJB 5CP7B 3GZKA 1R0AH 1BAGA 5FKPA 1EJFA 4A6YB 1N0LA 4MAYA 4BRJA 1NL0L 2WGNB 5FYJL 5I8EB 4MMYB 3H85A 2V9TA 1AS7A 4FHJA 1L4IA 3NSCA 4I18C 3HG4A 4N86A 5AAWC 2JE8A 4FI8A 2R2CA 2BVEA 1JXKA 1E5UI 2BVYA 4HDIA 2I60L 4DGWC 5LGHH 4CVZB 3ZUNC 5DYOB 3LN4A 2EAEA 4AEFA 2VXVL 1MDAA 4TRPL 1J48A 2CMRL 2HUEA 3IN2A 3IDJB 4U1JB 3QEGH 5DJ2A 3WLBB 3BRDA 1IC7H 2W1NA 2AXGB 1KULA 2Z4QB 4FRWA 4FMKA 2FJGB 1O9WA 4LZKA 1KG0B 3CFKB 3AREC 2DIJA 3QUZA 4JDTH 1P7KA 1X5FA 3HNVH 4L9LB 4XCFH 5EO0A 3TFKD 3FSZA 4QF1B 3ALWA 1Q1JL 4FEMA 2CJSA 2DDQH 1ZK9A 2R4RH 5GGSY 2WXKA 3E6HB 4DOHE 3CZKA 2CKBL 4P23A 4S1QL 5DVLA 5CJXC 1JWUB 4PJBE 1J5CA 4WW2F 5F1IA 3K4AA 4IRSB 3IJYA 4LGRB 4TNWF 3ZZQA 1CGTA 4LOEA 4IKNA 1U3ZA 3TPUA 3GXFA 1UB6A 3S5LA 1D7DA 1DQJA 3RVVC 2V5SA 2A9NL 4PJ5A 1GMIA 4JFDE 3UTTD 1OXYA 4A6YA 2G75B 4DKFL 1YDPB 4XBGA 4POZD 3I6KA 3D18B 4IM8A 3W1ZA 1R24A 1BAWA 1E27B 1U9KA 3WXWH 3ULUF 3ARUA 1K4CA 1PZAA 4UIMB 4CMMB 1CXFA 3IDYB 3PWVA 4YSDA 5B39A 4MJ5B 1FZOA 4G6KL 4HV8B 5IESH 4IU3A 3PGCB 15C8L 4Y4FD 5LKNA 1QFWL 3OX8A 4DGYH 5JOEA 3VFRA 1DJGA 3T65B 1AGCA 1J88A 2I07A 3OC8A 4OFIA 1TPXB 1BQHB 5HVHB 2ZOWA 2V5YA 3TA3A 1ADQA 5DHYA 5IK3B 4HVBA 3CFCL 1I7RA 2PXYA 2WD0A 3L3HA 1PPIA 1RZJC 1KB5A 2A83A 2J8UB 3MBWB 3EXLA 2DQMA 2Z65C 4E9XA 5D1ZC 3SDCB 2Y25A 2KH2B 5HD8D 4KWUA 3QUHA 2CJ3A 1LE9A 1LO2H 3NT0A 4LCWE 4TF4A 4OCRL 4XN7A 4PB9H 3QE5A 1G84A 3B9DA 3L3OC 3OKMA 1A6WL 1ACYL 3HA0A 1U8CA 4FXTA 4MSWB 3U6XA 4L37A 3II2A 3TV3H 4JFYA 3MOQA 2EXWD 3DUUA 3ELQA 2BVOB 2YEVB 3NFPA 4TQHA 5E5LA 3ZHKA 3HRZA 4MAUL 4NO3B 3UADA 3DHPA 2EKSA 4GW5A 5KS9B 3ULUE 4DHLA 4WLCA 4DUWA 1MRDL 5D7KE 5MI0B 1O9ZA 4L4JA 5CEZL 2XFXA 4LKXA 3UZQA 3BPNC 1TZHA 5D5MA 3CMOH 3B7RL 2Z8RA 3QUKA 3SKJH 2HTKD 3AS3A 4P9ML 3U30B 4JL2A 2I9LB 1FZJB 1ZTMA 2LAAA 3CZLA 5AZUA 2AVFA 1HINH 1GC1H 3WEOA 4U2ZA 4F9PC 1GGCL 1A1OB 8CGTA 5IBUG 3G5XA 4MB1A 4YDNA 2KKQA 5DJ8A 4PJCE 2YD1A 1G0DA 3CZJA 2DJMA 4KRPB 2EEFA 1ZWIB 3TONA 3KPPB 2O72A 4NC1C 4MGXA 4TYUA 3S97C 4LVEA 2Y2TA 3FQ4A 4RAHA 1A1NA 2MQ0A 3ML8A 5HDWA 3H9ZA 4L8BA 2VDKH 4U3SA 1BA9A 1BOGA 1JK9A 2VO5A 5E9DA 1A0QH 1YEEL 1LEIB 3H54A 1PG7H 1RU9H 3CZUB 2WWKO 2G5UA 3MOAH 4OGYH 5DJ8B 2Y2YA 1U6AL 5E7BA 4QEGA