3JX8A

Crystal structure of putative lipid binding protein (yp_001304415.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
b'DKRIDGNGNPETREIKISDYDEITFVGSADFEYEQSDKAPYLSVTIDENLFDYLVTEVEGGTLKIYPKSIKKGFNNNSYDLRPTVYKIKSNSKELKELNTVGSGSFIISKPTKVNRMEINMAGSGNVELRGPVKGYKLECNMAGSGNIIAKDIQLDNLSCSLASSGEIEVIGTVDRASFNVAGSGEIKAFDCQARKAECNIASSGEISVYATQILDANIVGSGEIHYKGDPEISKSIMGSGSINKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
molecule tags Cell adhesion
source organism Parabacteroides distasonis atcc 8503
publication title Crystal structure of Putative lipid binding protein (YP_001304415.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3jx8A00
3PETA 3JX8A 4OPWA 3LJYA 3LYCA
chains in the Genus database with same CATH superfamily
1RMGA 1NHCA 1O8IA 4U4BA 2VJIA 5C1CA 4OJ5A 3GQAA 2PYHA 1OFDA 4URRA 3PSZA 4YDTA 4YEIA 4YZAA 1EE6A 4MR0A 1LLZA 1O8FA 5AMVA 3BH6B 3T9GA 1WMRA 3GQ8A 4W8SA 3SYJA 4YZ0A 1EZGA 2BM5A 2VFPA 3WWGA 2NZMA 2VBMA 3GQ7A 1QA3A 2IOUG 4PMHA 2X6WA 2VFNA 4XONA 2O17A 1OOCA 2NSTA 4XLCA 4YELA 4YCQA 2NT6A 4W8QA 1AIRA 2XC1A 5JMCB 1EA0A 2BSPA 3N6ZA 2BM4A 1TYVA 1GQ8A 1OGOX 2EWEA 3ZPPA 4XN3A 4HWVA 1O8DA 1JTAA 4Z03A 4XM3A 2O6WA 1JRGA 2UVFA 4XOTA 1O8MA 4XR6A 4XKVA 1TYUA 3SUCA 1KCDA 4EW9A 4C2LA 1K4ZA 1BHEA 4YFOA 1QQ1A 2PYGA 2XTYA 1LLWA 1BN8A 4KH3A 2BM6A 1OFMA 2VFOA 3FY3A 3LJYA 2J8KA 1O8JA 2X85A 3VMVA 1DBGA 3SQVA 2NTPA 1LM1A 1O8KA 3P4GA 3PSSA 1TSPA 2QYUA 4OZZA 2NTQA 1VBLA 1QJVA 4W8TA 4OJOA 4XKWA 4YEJA 2VBEA 3EQOA 2PECA 2B0RA 2ODLA 4OJPA 3B8YA 5C1EA 4AVZA 1RWRA 1QA1A 1O8GA 3RIQA 3VSVA 2QY1A 2VJJA 1DBOA 1TYWA 1K8FA 1QRCA 2VBKA 4XOPA 4XMYA 3NB2A 1HG8A 1CZFA 2VFQA 2X6XA 4NK8A 2X6YA 1IDJA 1HF2A 2X3HA 3NAWA 4U49A 4XL9A 1WXRA 2YUHA 1QRBA 1H80A 4MXNA 3ZSCA 1O8EA 1QCXA 1RU4A 1OFEA 2XTWA 4OJLA 2VFMA 3B4NA 3AK5A 3H09A 4XQFA 1IA5A 3ML3A 4I84A 3PETA 3SY2A 2UVEA 4XORA 2W7ZA 2V5IA 1X0CA 2O04A 3GQ9A 4V02C 4XN0A 1KCCA 3B90A 1CLWA 1L1IA 3UW0A 1OFLA 2G0YA 4XLFA 4XNFA 2BM7A 1K5CA 4XLAA 1PLUA 3LMWA 4XLHA 1IDKA 1TYXA 2INUA 3VMWA 3LYCA 1XG2A 2IQ7A 2BX6A 1O8LA 2F3LA 4NK6A 4YC5A 3JX8A 4YZQA 5JLVC 3KRGA 1QA2A 1KQ5A 1DABA 4OZYA 5DNSA 2Z8GA 1PXZA 2O0WA 1O8HA 3N90A 4JRAC 4Z06A 4OPWA 2NTBA 2QXZA 3TH0A 2O0VA 3SZEA 2QX3A 2NT9A 3BH7B 1KTWA 2QZAA 4OM9A 2J8IA 2XT4A 2INVA 1PE9A 4Z05A 2XTXA 4OJ6A 1IB4A 3GRHA 2O1DA 3DU1X 3EQNA 4W8RA 3VSTA 1O88A 4YZXA 4XLEA 2NSPA 3VSUA 1OGMX 2XT2A 3JURA
chains in the Genus database with same CATH topology
2VFQA 1TYXA 1HF2A 4OJ5A 3LYCA 1WXRA 1TYUA 2YUHA 1QRBA 1K4ZA 2BX6A 1QQ1A 4KH3A 2F3LA 2BM6A 2VFOA 4OJLA 3BH6B 3JX8A 3LJYA 2VFMA 5JLVC 1QA2A 3AK5A 1KQ5A 3H09A 3SYJA 1DABA 2BM5A 2VFPA 3ML3A 3P4GA 3PETA 1TSPA 4JRAC 3N90A 3TH0A 4OPWA 4OJOA 3SZEA 1QA3A 2B0RA 2IOUG 2W7ZA 2VFNA 2V5IA 3BH7B 4OJPA 4OM9A 4V02C 1QA1A 2J8IA 1CLWA 3RIQA 2XC1A 5JMCB 3N6ZA 4OJ6A 2G0YA 2BM4A 1TYVA 1TYWA 1K8FA 1QRCA 2BM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PET A;  3JX8 A;  4OPW A;  3LJY A;  3LYC A; 
#chains in the Genus database with same CATH topology
 1RMG A;  1NHC A;  1O8I A;  4U4B A;  2VJI A;  5C1C A;  4OJ5 A;  3GQA A;  2PYH A;  1OFD A;  4URR A;  3PSZ A;  4YDT A;  4YEI A;  4YZA A;  1EE6 A;  4MR0 A;  1LLZ A;  1O8F A;  5AMV A;  3BH6 B;  3T9G A;  1WMR A;  3GQ8 A;  4W8S A;  3SYJ A;  4YZ0 A;  1EZG A;  2BM5 A;  2VFP A;  3WWG A;  2NZM A;  2VBM A;  3GQ7 A;  1QA3 A;  2IOU G;  4PMH A;  2X6W A;  2VFN A;  4XON A;  2O17 A;  1OOC A;  2NST A;  4XLC A;  4YEL A;  4YCQ A;  2NT6 A;  4W8Q A;  1AIR A;  2XC1 A;  5JMC B;  1EA0 A;  2BSP A;  3N6Z A;  2BM4 A;  1TYV A;  1GQ8 A;  1OGO X;  2EWE A;  3ZPP A;  4XN3 A;  4HWV A;  1O8D A;  1JTA A;  4Z03 A;  4XM3 A;  2O6W A;  1JRG A;  2UVF A;  4XOT A;  1O8M A;  4XR6 A;  4XKV A;  1TYU A;  3SUC A;  1KCD A;  4EW9 A;  4C2L A;  1K4Z A;  1BHE A;  4YFO A;  1QQ1 A;  2PYG A;  2XTY A;  1LLW A;  1BN8 A;  4KH3 A;  2BM6 A;  1OFM A;  2VFO A;  3FY3 A;  3LJY A;  2J8K A;  1O8J A;  2X85 A;  3VMV A;  1DBG A;  3SQV A;  2NTP A;  1LM1 A;  1O8K A;  3P4G A;  3PSS A;  1TSP A;  2QYU A;  4OZZ A;  2NTQ A;  1VBL A;  1QJV A;  4W8T A;  4OJO A;  4XKW A;  4YEJ A;  2VBE A;  3EQO A;  2PEC A;  2B0R A;  2ODL A;  4OJP A;  3B8Y A;  5C1E A;  4AVZ A;  1RWR A;  1QA1 A;  1O8G A;  3RIQ A;  3VSV A;  2QY1 A;  2VJJ A;  1DBO A;  1TYW A;  1K8F A;  1QRC A;  2VBK A;  4XOP A;  4XMY A;  3NB2 A;  1HG8 A;  1CZF A;  2VFQ A;  2X6X A;  4NK8 A;  2X6Y A;  1IDJ A;  1HF2 A;  2X3H A;  3NAW A;  4U49 A;  4XL9 A;  1WXR A;  2YUH A;  1QRB A;  1H80 A;  4MXN A;  3ZSC A;  1O8E A;  1QCX A;  1RU4 A;  1OFE A;  2XTW A;  4OJL A;  2VFM A;  3B4N A;  3AK5 A;  3H09 A;  4XQF A;  1IA5 A;  3ML3 A;  4I84 A;  3PET A;  3SY2 A;  2UVE A;  4XOR A;  2W7Z A;  2V5I A;  1X0C A;  2O04 A;  3GQ9 A;  4V02 C;  4XN0 A;  1KCC A;  3B90 A;  1CLW A;  1L1I A;  3UW0 A;  1OFL A;  2G0Y A;  4XLF A;  4XNF A;  2BM7 A;  1K5C A;  4XLA A;  1PLU A;  3LMW A;  4XLH A;  1IDK A;  1TYX A;  2INU A;  3VMW A;  3LYC A;  1XG2 A;  2IQ7 A;  2BX6 A;  1O8L A;  2F3L A;  4NK6 A;  4YC5 A;  3JX8 A;  4YZQ A;  5JLV C;  3KRG A;  1QA2 A;  1KQ5 A;  1DAB A;  4OZY A;  5DNS A;  2Z8G A;  1PXZ A;  2O0W A;  1O8H A;  3N90 A;  4JRA C;  4Z06 A;  4OPW A;  2NTB A;  2QXZ A;  3TH0 A;  2O0V A;  3SZE A;  2QX3 A;  2NT9 A;  3BH7 B;  1KTW A;  2QZA A;  4OM9 A;  2J8I A;  2XT4 A;  2INV A;  1PE9 A;  4Z05 A;  2XTX A;  4OJ6 A;  1IB4 A;  3GRH A;  2O1D A;  3DU1 X;  3EQN A;  4W8R A;  3VST A;  1O88 A;  4YZX A;  4XLE A;  2NSP A;  3VSU A;  1OGM X;  2XT2 A;  3JUR A; 
#chains in the Genus database with same CATH homology
 2VFQ A;  1TYX A;  1HF2 A;  4OJ5 A;  3LYC A;  1WXR A;  1TYU A;  2YUH A;  1QRB A;  1K4Z A;  2BX6 A;  1QQ1 A;  4KH3 A;  2F3L A;  2BM6 A;  2VFO A;  4OJL A;  3BH6 B;  3JX8 A;  3LJY A;  2VFM A;  5JLV C;  1QA2 A;  3AK5 A;  1KQ5 A;  3H09 A;  3SYJ A;  1DAB A;  2BM5 A;  2VFP A;  3ML3 A;  3P4G A;  3PET A;  1TSP A;  4JRA C;  3N90 A;  3TH0 A;  4OPW A;  4OJO A;  3SZE A;  1QA3 A;  2B0R A;  2IOU G;  2W7Z A;  2VFN A;  2V5I A;  3BH7 B;  4OJP A;  4OM9 A;  4V02 C;  1QA1 A;  2J8I A;  1CLW A;  3RIQ A;  2XC1 A;  5JMC B;  3N6Z A;  4OJ6 A;  2G0Y A;  2BM4 A;  1TYV A;  1TYW A;  1K8F A;  1QRC A;  2BM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...