3JX8A

Crystal structure of putative lipid binding protein (yp_001304415.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
DKRIDGNGNPETREIKISDYDEITFVGSADFEYEQSDKAPYLSVTIDENLFDYLVTEVEGGTLKIYPKSIKKGFNNNSYDLRPTVYKIKSNSKELKELNTVGSGSFIISKPTKVNRMEINMAGSGNVELRGPVKGYKLECNMAGSGNIIAKDIQLDNLSCSLASSGEIEVIGTVDRASFNVAGSGEIKAFDCQARKAECNIASSGEISVYATQILDANIVGSGEIHYKGDPEISKSIMGSGSINKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative lipid binding protein (YP_001304415.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Cell adhesion
molecule keywords Putative lipoprotein
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3jx8A00
3JX8A 3LYCA 3LJYA 4OPWA 3PETA
chains in the Genus database with same CATH superfamily
4MR0A 3ZSCA 1KTWA 2O04A 3ML3A 3SQVA 4XLFA 4YEJA 2QY1A 1LLZA 1XG2A 3N90A 3NAWA 1DBOA 2VFNA 2BSPA 4XL9A 4Z03A 2VFQA 1O8MA 4V02C 2QYUA 2NSPA 2QXZA 4OJLA 4YZAA 5JMCB 1CZFA 5AMVA 4XLEA 2ODLA 1KCDA 1O8IA 2IOUG 2XTXA 1TYUA 2VFPA 4YZXA 4NK6A 5C1EA 1K4ZA 2XTYA 3GQ8A 3VSTA 2B0RA 1LM1A 1TSPA 4W8SA 3VMWA 3PSZA 2VBEA 1OFDA 2J8IA 1EE6A 2PECA 2X6XA 3UW0A 1AIRA 2QX3A 3BH7B 4YDTA 1K5CA 1O8KA 2XTWA 4XLHA 1HF2A 3ZPPA 1QCXA 2Z8GA 4W8TA 1GQ8A 1RWRA 4XKWA 4OJ6A 1QRBA 1EZGA 2O17A 1TYXA 4YEIA 1EA0A 4XMYA 3PSSA 4XONA 1O88A 1O8FA 2PYGA 4EW9A 4XOTA 1BHEA 2NT6A 3WWGA 4OJ5A 2O0WA 4OZZA 3SYJA 2BM5A 3B8YA 2VFOA 2NTQA 3GQ9A 2XC1A 3SZEA 4HWVA 1QA3A 4Z06A 4XLAA 1HG8A 1QA1A 1OFLA 2X6WA 4KH3A 3VMVA 1LLWA 2BM7A 4XORA 2VFMA 2W7ZA 1PE9A 1VBLA 1TYWA 3LJYA 2VBMA 1BN8A 2XT2A 3FY3A 3EQOA 3B90A 4OJPA 2XT4A 2NSTA 1PXZA 1K8FA 4YFOA 1DABA 2O6WA 3KRGA 4AVZA 4YZ0A 2UVEA 1OFMA 1X0CA 2IQ7A 3GRHA 4XQFA 1RU4A 1IB4A 1DBGA 2NZMA 2V5IA 1JRGA 4XKVA 3TH0A 1O8LA 4XN3A 2NTBA 4XNFA 1TYVA 4C2LA 1WMRA 4YELA 1QA2A 3N6ZA 3AK5A 3LYCA 4YCQA 1IDJA 1OOCA 1IDKA 1QJVA 2X6YA 1OFEA 2X85A 3GQAA 1O8EA 3DU1X 3VSVA 1O8DA 3H09A 1QQ1A 1RMGA 3SUCA 5C1CA 2NT9A 4XN0A 1IA5A 3EQNA 1OGMX 4U49A 2UVFA 4NK8A 1O8HA 1O8GA 3SY2A 3B4NA 1QRCA 3T9GA 4W8RA 4OM9A 2VJJA 4OZYA 4XR6A 1KQ5A 2VJIA 3GQ7A 5JLVC 2F3LA 2BM4A 3NB2A 4OPWA 4PMHA 2YUHA 1PLUA 1NHCA 1WXRA 1O8JA 2BM6A 2BX6A 4YZQA 2QZAA 3JX8A 4YC5A 3JURA 2O1DA 4XM3A 2O0VA 3P4GA 4OJOA 4JRAC 1JTAA 2INVA 2INUA 1CLWA 2G0YA 2VBKA 4W8QA 2X3HA 4URRA 4XOPA 2J8KA 3VSUA 1H80A 3BH6B 4I84A 1OGOX 4MXNA 4XLCA 5DNSA 4U4BA 4Z05A 2EWEA 3LMWA 1KCCA 3RIQA 1L1IA 2PYHA 2NTPA 3PETA
chains in the Genus database with same CATH topology
2BM7A 2VFMA 2W7ZA 3H09A 1QQ1A 1TYWA 3ML3A 3BH7B 3LJYA 1HF2A 3N90A 1QRCA 4OJPA 2VFNA 4OM9A 1KQ5A 1K8FA 5JLVC 1DABA 2F3LA 4OJ6A 2BM4A 1QRBA 2VFQA 4OPWA 2YUHA 4V02C 5JMCB 1WXRA 2BM6A 1TYXA 2BX6A 4OJLA 3JX8A 2IOUG 1TYUA 2VFPA 2V5IA 3P4GA 4JRAC 4OJ5A 4OJOA 3TH0A 1K4ZA 1CLWA 3SYJA 2G0YA 1TYVA 2BM5A 2B0RA 2VFOA 3SZEA 2XC1A 3BH6B 1QA3A 1TSPA 1QA2A 3N6ZA 1QA1A 3LYCA 3AK5A 3RIQA 2J8IA 4KH3A 3PETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  3LYC A;  3LJY A;  4OPW A;  3PET A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  3ZSC A;  1KTW A;  2O04 A;  3ML3 A;  3SQV A;  4XLF A;  4YEJ A;  2QY1 A;  1LLZ A;  1XG2 A;  3N90 A;  3NAW A;  1DBO A;  2VFN A;  2BSP A;  4XL9 A;  4Z03 A;  2VFQ A;  1O8M A;  4V02 C;  2QYU A;  2NSP A;  2QXZ A;  4OJL A;  4YZA A;  5JMC B;  1CZF A;  5AMV A;  4XLE A;  2ODL A;  1KCD A;  1O8I A;  2IOU G;  2XTX A;  1TYU A;  2VFP A;  4YZX A;  4NK6 A;  5C1E A;  1K4Z A;  2XTY A;  3GQ8 A;  3VST A;  2B0R A;  1LM1 A;  1TSP A;  4W8S A;  3VMW A;  3PSZ A;  2VBE A;  1OFD A;  2J8I A;  1EE6 A;  2PEC A;  2X6X A;  3UW0 A;  1AIR A;  2QX3 A;  3BH7 B;  4YDT A;  1K5C A;  1O8K A;  2XTW A;  4XLH A;  1HF2 A;  3ZPP A;  1QCX A;  2Z8G A;  4W8T A;  1GQ8 A;  1RWR A;  4XKW A;  4OJ6 A;  1QRB A;  1EZG A;  2O17 A;  1TYX A;  4YEI A;  1EA0 A;  4XMY A;  3PSS A;  4XON A;  1O88 A;  1O8F A;  2PYG A;  4EW9 A;  4XOT A;  1BHE A;  2NT6 A;  3WWG A;  4OJ5 A;  2O0W A;  4OZZ A;  3SYJ A;  2BM5 A;  3B8Y A;  2VFO A;  2NTQ A;  3GQ9 A;  2XC1 A;  3SZE A;  4HWV A;  1QA3 A;  4Z06 A;  4XLA A;  1HG8 A;  1QA1 A;  1OFL A;  2X6W A;  4KH3 A;  3VMV A;  1LLW A;  2BM7 A;  4XOR A;  2VFM A;  2W7Z A;  1PE9 A;  1VBL A;  1TYW A;  3LJY A;  2VBM A;  1BN8 A;  2XT2 A;  3FY3 A;  3EQO A;  3B90 A;  4OJP A;  2XT4 A;  2NST A;  1PXZ A;  1K8F A;  4YFO A;  1DAB A;  2O6W A;  3KRG A;  4AVZ A;  4YZ0 A;  2UVE A;  1OFM A;  1X0C A;  2IQ7 A;  3GRH A;  4XQF A;  1RU4 A;  1IB4 A;  1DBG A;  2NZM A;  2V5I A;  1JRG A;  4XKV A;  3TH0 A;  1O8L A;  4XN3 A;  2NTB A;  4XNF A;  1TYV A;  4C2L A;  1WMR A;  4YEL A;  1QA2 A;  3N6Z A;  3AK5 A;  3LYC A;  4YCQ A;  1IDJ A;  1OOC A;  1IDK A;  1QJV A;  2X6Y A;  1OFE A;  2X85 A;  3GQA A;  1O8E A;  3DU1 X;  3VSV A;  1O8D A;  3H09 A;  1QQ1 A;  1RMG A;  3SUC A;  5C1C A;  2NT9 A;  4XN0 A;  1IA5 A;  3EQN A;  1OGM X;  4U49 A;  2UVF A;  4NK8 A;  1O8H A;  1O8G A;  3SY2 A;  3B4N A;  1QRC A;  3T9G A;  4W8R A;  4OM9 A;  2VJJ A;  4OZY A;  4XR6 A;  1KQ5 A;  2VJI A;  3GQ7 A;  5JLV C;  2F3L A;  2BM4 A;  3NB2 A;  4OPW A;  4PMH A;  2YUH A;  1PLU A;  1NHC A;  1WXR A;  1O8J A;  2BM6 A;  2BX6 A;  4YZQ A;  2QZA A;  3JX8 A;  4YC5 A;  3JUR A;  2O1D A;  4XM3 A;  2O0V A;  3P4G A;  4OJO A;  4JRA C;  1JTA A;  2INV A;  2INU A;  1CLW A;  2G0Y A;  2VBK A;  4W8Q A;  2X3H A;  4URR A;  4XOP A;  2J8K A;  3VSU A;  1H80 A;  3BH6 B;  4I84 A;  1OGO X;  4MXN A;  4XLC A;  5DNS A;  4U4B A;  4Z05 A;  2EWE A;  3LMW A;  1KCC A;  3RIQ A;  1L1I A;  2PYH A;  2NTP A;  3PET A; 
#chains in the Genus database with same CATH homology
 2BM7 A;  2VFM A;  2W7Z A;  3H09 A;  1QQ1 A;  1TYW A;  3ML3 A;  3BH7 B;  3LJY A;  1HF2 A;  3N90 A;  1QRC A;  4OJP A;  2VFN A;  4OM9 A;  1KQ5 A;  1K8F A;  5JLV C;  1DAB A;  2F3L A;  4OJ6 A;  2BM4 A;  1QRB A;  2VFQ A;  4OPW A;  2YUH A;  4V02 C;  5JMC B;  1WXR A;  2BM6 A;  1TYX A;  2BX6 A;  4OJL A;  3JX8 A;  2IOU G;  1TYU A;  2VFP A;  2V5I A;  3P4G A;  4JRA C;  4OJ5 A;  4OJO A;  3TH0 A;  1K4Z A;  1CLW A;  3SYJ A;  2G0Y A;  1TYV A;  2BM5 A;  2B0R A;  2VFO A;  3SZE A;  2XC1 A;  3BH6 B;  1QA3 A;  1TSP A;  1QA2 A;  3N6Z A;  1QA1 A;  3LYC A;  3AK5 A;  3RIQ A;  2J8I A;  4KH3 A;  3PET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...