3JX8A

Crystal structure of putative lipid binding protein (yp_001304415.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
DKRIDGNGNPETREIKISDYDEITFVGSADFEYEQSDKAPYLSVTIDENLFDYLVTEVEGGTLKIYPKSIKKGFNNNSYDLRPTVYKIKSNSKELKELNTVGSGSFIISKPTKVNRMEINMAGSGNVELRGPVKGYKLECNMAGSGNIIAKDIQLDNLSCSLASSGEIEVIGTVDRASFNVAGSGEIKAFDCQARKAECNIASSGEISVYATQILDANIVGSGEIHYKGDPEISKSIMGSGSINKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of Putative lipid binding protein (YP_001304415.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Cell adhesion
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3jx8A00
4OPWA 3LJYA 3LYCA 3PETA 3JX8A
chains in the Genus database with same CATH superfamily
1PE9A 2O6WA 1NHCA 1IA5A 3UW0A 4AVZA 4XL9A 1IB4A 4XLCA 4XLFA 3FY3A 2J8KA 1O8KA 2VFQA 4XOTA 4YEIA 3N90A 1OFEA 1O88A 1DBGA 1RMGA 2QX3A 3RIQA 2NSTA 4OJ6A 1KCDA 3EQNA 1VBLA 3KRGA 3SZEA 4XR6A 1IDJA 4YFOA 2Z8GA 2YUHA 4OZYA 1XG2A 1QA3A 2XC1A 3H09A 4OZZA 2NSPA 3GQ8A 1TYVA 4W8TA 2QXZA 4W8SA 4XM3A 2BM5A 1EZGA 4XKVA 4XMYA 1QQ1A 1CZFA 1O8HA 2X85A 5AMVA 3PSZA 3B90A 4YDTA 1TYWA 4YC5A 4XN3A 1BN8A 2O17A 3BH6B 3NB2A 5C1CA 1HG8A 2VFOA 2O04A 2O1DA 4C2LA 1K5CA 3TH0A 3ZSCA 4YELA 2XTYA 3BH7B 3LYCA 1TSPA 4YZXA 2PYHA 1OFLA 4Z03A 2X6YA 3JURA 1QRBA 4EW9A 1O8MA 4OPWA 4I84A 3LJYA 3PSSA 1O8IA 2J8IA 2B0RA 2NTBA 3LMWA 1WMRA 1JTAA 2NZMA 2VBEA 4U4BA 1GQ8A 4XLEA 4NK6A 1O8EA 4OM9A 1AIRA 2IOUG 4OJPA 2V5IA 5JLVC 2XTXA 2VFMA 4XONA 4OJ5A 2VBKA 4OJLA 4YZ0A 2VFPA 4JRAC 4URRA 2G0YA 2O0WA 2VJIA 4NK8A 3SYJA 1K8FA 4U49A 1OGOX 4YCQA 2O0VA 1CLWA 4YZQA 1O8LA 1QA2A 1WXRA 4XLAA 3T9GA 4V02C 1BHEA 4XLHA 4XN0A 3VMVA 1QA1A 1HF2A 1O8JA 3GQAA 4KH3A 1QJVA 4YEJA 2NT6A 3SQVA 1TYXA 4Z05A 3B4NA 4XORA 1K4ZA 1OOCA 3ML3A 1QRCA 3VSVA 1QCXA 2BM6A 1JRGA 2VJJA 1EE6A 5JMCB 1DABA 3AK5A 4W8RA 2VBMA 1IDKA 2INVA 2VFNA 3NAWA 1KQ5A 2BM4A 4YZAA 3VSTA 3P4GA 1O8DA 2F3LA 2EWEA 2NTPA 3PETA 3GQ7A 4OJOA 1H80A 4XKWA 3GQ9A 3EQOA 2BM7A 2XTWA 4PMHA 4XNFA 3VMWA 4MR0A 2NTQA 1O8FA 2UVEA 1RU4A 2UVFA 5C1EA 2QZAA 3N6ZA 1L1IA 2QY1A 1X0CA 4Z06A 1DBOA 2QYUA 1EA0A 2NT9A 2ODLA 1KTWA 3GRHA 4W8QA 2IQ7A 3SY2A 1LLWA 2BX6A 4XQFA 2X6WA 2XT4A 1PXZA 3ZPPA 2W7ZA 4XOPA 3SUCA 3B8YA 2XT2A 2PECA 2X3HA 1TYUA 3JX8A 1KCCA 3DU1X 3VSUA 1RWRA 1LM1A 5DNSA 2BSPA 2PYGA 1OFDA 2X6XA 1O8GA 4MXNA 1OFMA 1PLUA 4HWVA 2INUA 3WWGA 1OGMX 1LLZA
chains in the Genus database with same CATH topology
4OJLA 2BM7A 2VFPA 4JRAC 2G0YA 1TYWA 3SYJA 1K8FA 3BH6B 2VFQA 2VFOA 1CLWA 3N6ZA 1QA2A 3N90A 1WXRA 4V02C 2VFMA 3TH0A 3BH7B 3LYCA 1TSPA 1QA1A 1HF2A 3RIQA 4KH3A 4OJ6A 2BX6A 1QRBA 4OPWA 3SZEA 1TYXA 3LJYA 2J8IA 2W7ZA 2YUHA 1K4ZA 3ML3A 1QRCA 2B0RA 2XC1A 3H09A 1TYUA 1QA3A 2BM6A 3JX8A 5JMCB 1DABA 3AK5A 1TYVA 2VFNA 1KQ5A 2BM4A 4OM9A 2BM5A 2IOUG 3P4GA 2F3LA 2V5IA 4OJPA 5JLVC 1QQ1A 4OJOA 3PETA 4OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPW A;  3LJY A;  3LYC A;  3PET A;  3JX8 A; 
#chains in the Genus database with same CATH topology
 1PE9 A;  2O6W A;  1NHC A;  1IA5 A;  3UW0 A;  4AVZ A;  4XL9 A;  1IB4 A;  4XLC A;  4XLF A;  3FY3 A;  2J8K A;  1O8K A;  2VFQ A;  4XOT A;  4YEI A;  3N90 A;  1OFE A;  1O88 A;  1DBG A;  1RMG A;  2QX3 A;  3RIQ A;  2NST A;  4OJ6 A;  1KCD A;  3EQN A;  1VBL A;  3KRG A;  3SZE A;  4XR6 A;  1IDJ A;  4YFO A;  2Z8G A;  2YUH A;  4OZY A;  1XG2 A;  1QA3 A;  2XC1 A;  3H09 A;  4OZZ A;  2NSP A;  3GQ8 A;  1TYV A;  4W8T A;  2QXZ A;  4W8S A;  4XM3 A;  2BM5 A;  1EZG A;  4XKV A;  4XMY A;  1QQ1 A;  1CZF A;  1O8H A;  2X85 A;  5AMV A;  3PSZ A;  3B90 A;  4YDT A;  1TYW A;  4YC5 A;  4XN3 A;  1BN8 A;  2O17 A;  3BH6 B;  3NB2 A;  5C1C A;  1HG8 A;  2VFO A;  2O04 A;  2O1D A;  4C2L A;  1K5C A;  3TH0 A;  3ZSC A;  4YEL A;  2XTY A;  3BH7 B;  3LYC A;  1TSP A;  4YZX A;  2PYH A;  1OFL A;  4Z03 A;  2X6Y A;  3JUR A;  1QRB A;  4EW9 A;  1O8M A;  4OPW A;  4I84 A;  3LJY A;  3PSS A;  1O8I A;  2J8I A;  2B0R A;  2NTB A;  3LMW A;  1WMR A;  1JTA A;  2NZM A;  2VBE A;  4U4B A;  1GQ8 A;  4XLE A;  4NK6 A;  1O8E A;  4OM9 A;  1AIR A;  2IOU G;  4OJP A;  2V5I A;  5JLV C;  2XTX A;  2VFM A;  4XON A;  4OJ5 A;  2VBK A;  4OJL A;  4YZ0 A;  2VFP A;  4JRA C;  4URR A;  2G0Y A;  2O0W A;  2VJI A;  4NK8 A;  3SYJ A;  1K8F A;  4U49 A;  1OGO X;  4YCQ A;  2O0V A;  1CLW A;  4YZQ A;  1O8L A;  1QA2 A;  1WXR A;  4XLA A;  3T9G A;  4V02 C;  1BHE A;  4XLH A;  4XN0 A;  3VMV A;  1QA1 A;  1HF2 A;  1O8J A;  3GQA A;  4KH3 A;  1QJV A;  4YEJ A;  2NT6 A;  3SQV A;  1TYX A;  4Z05 A;  3B4N A;  4XOR A;  1K4Z A;  1OOC A;  3ML3 A;  1QRC A;  3VSV A;  1QCX A;  2BM6 A;  1JRG A;  2VJJ A;  1EE6 A;  5JMC B;  1DAB A;  3AK5 A;  4W8R A;  2VBM A;  1IDK A;  2INV A;  2VFN A;  3NAW A;  1KQ5 A;  2BM4 A;  4YZA A;  3VST A;  3P4G A;  1O8D A;  2F3L A;  2EWE A;  2NTP A;  3PET A;  3GQ7 A;  4OJO A;  1H80 A;  4XKW A;  3GQ9 A;  3EQO A;  2BM7 A;  2XTW A;  4PMH A;  4XNF A;  3VMW A;  4MR0 A;  2NTQ A;  1O8F A;  2UVE A;  1RU4 A;  2UVF A;  5C1E A;  2QZA A;  3N6Z A;  1L1I A;  2QY1 A;  1X0C A;  4Z06 A;  1DBO A;  2QYU A;  1EA0 A;  2NT9 A;  2ODL A;  1KTW A;  3GRH A;  4W8Q A;  2IQ7 A;  3SY2 A;  1LLW A;  2BX6 A;  4XQF A;  2X6W A;  2XT4 A;  1PXZ A;  3ZPP A;  2W7Z A;  4XOP A;  3SUC A;  3B8Y A;  2XT2 A;  2PEC A;  2X3H A;  1TYU A;  3JX8 A;  1KCC A;  3DU1 X;  3VSU A;  1RWR A;  1LM1 A;  5DNS A;  2BSP A;  2PYG A;  1OFD A;  2X6X A;  1O8G A;  4MXN A;  1OFM A;  1PLU A;  4HWV A;  2INU A;  3WWG A;  1OGM X;  1LLZ A; 
#chains in the Genus database with same CATH homology
 4OJL A;  2BM7 A;  2VFP A;  4JRA C;  2G0Y A;  1TYW A;  3SYJ A;  1K8F A;  3BH6 B;  2VFQ A;  2VFO A;  1CLW A;  3N6Z A;  1QA2 A;  3N90 A;  1WXR A;  4V02 C;  2VFM A;  3TH0 A;  3BH7 B;  3LYC A;  1TSP A;  1QA1 A;  1HF2 A;  3RIQ A;  4KH3 A;  4OJ6 A;  2BX6 A;  1QRB A;  4OPW A;  3SZE A;  1TYX A;  3LJY A;  2J8I A;  2W7Z A;  2YUH A;  1K4Z A;  3ML3 A;  1QRC A;  2B0R A;  2XC1 A;  3H09 A;  1TYU A;  1QA3 A;  2BM6 A;  3JX8 A;  5JMC B;  1DAB A;  3AK5 A;  1TYV A;  2VFN A;  1KQ5 A;  2BM4 A;  4OM9 A;  2BM5 A;  2IOU G;  3P4G A;  2F3L A;  2V5I A;  4OJP A;  5JLV C;  1QQ1 A;  4OJO A;  3PET A;  4OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...