3JX8A

Crystal structure of putative lipid binding protein (yp_001304415.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
DKRIDGNGNPETREIKISDYDEITFVGSADFEYEQSDKAPYLSVTIDENLFDYLVTEVEGGTLKIYPKSIKKGFNNNSYDLRPTVYKIKSNSKELKELNTVGSGSFIISKPTKVNRMEINMAGSGNVELRGPVKGYKLECNMAGSGNIIAKDIQLDNLSCSLASSGEIEVIGTVDRASFNVAGSGEIKAFDCQARKAECNIASSGEISVYATQILDANIVGSGEIHYKGDPEISKSIMGSGSINKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title Crystal structure of Putative lipid binding protein (YP_001304415.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Cell adhesion
total genus 88
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10988 DUF2807 Putative auto-transporter adhesin, head GIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.120 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3jx8A00
3JX8A 4OPWA 3PETA 3LJYA 3LYCA
chains in the Genus database with same CATH superfamily
4YEIA 3AK5A 1K5CA 4OJ6A 2NT6A 2Z8GA 1DABA 3ZPPA 2X6XA 1TYWA 2UVFA 3PSZA 4OJ5A 4XLAA 1HF2A 3RIQA 2BX6A 3B4NA 3N6ZA 4XLHA 2J8KA 3JX8A 2VFOA 1L1IA 1OFMA 2IQ7A 2X85A 1HG8A 1LLZA 2NT9A 4XN3A 4URRA 4YELA 1QRBA 3B8YA 2INUA 4U4BA 1RWRA 1QCXA 1EZGA 4JRAC 4W8SA 5C1EA 1O8DA 4XORA 1CZFA 1OGMX 1O8FA 4YFOA 3VSVA 4EW9A 4OJPA 3BH7B 2VBKA 4OJLA 4XOTA 1JRGA 3SUCA 3GQ8A 2B0RA 4AVZA 2VFMA 1BHEA 2YUHA 3T9GA 2X3HA 4XONA 2NTPA 1OFLA 2QX3A 2NTQA 2X6WA 1GQ8A 1K8FA 1O8MA 4NK6A 1X0CA 3SY2A 5JMCB 3NB2A 4XMYA 2VBMA 3SQVA 4XQFA 3VSTA 1EE6A 3EQNA 2NZMA 1LM1A 1PXZA 1TSPA 1QJVA 1RMGA 2O0WA 1JTAA 1OFDA 2VJIA 3ML3A 2O0VA 2XTXA 4YEJA 2O17A 1NHCA 4XN0A 4OZZA 2QYUA 3VMVA 1EA0A 2QXZA 4W8TA 3LJYA 2F3LA 3P4GA 4MR0A 3N90A 2QZAA 4XM3A 3EQOA 5JLVC 4HWVA 2EWEA 1XG2A 2BM7A 3NAWA 1IA5A 3TH0A 1QRCA 2IOUG 1KCCA 2XC1A 3PETA 4W8RA 2NSTA 1WXRA 4YCQA 2G0YA 1O88A 1OFEA 1OGOX 1O8KA 1O8LA 1BN8A 1KTWA 4YZAA 4YC5A 1O8HA 1QQ1A 2O04A 3ZSCA 2J8IA 4Z06A 4U49A 4C2LA 4XLEA 4XL9A 2XTYA 1QA3A 1K4ZA 1KCDA 4I84A 1QA2A 1WMRA 4XR6A 4YZ0A 1AIRA 1VBLA 2XTWA 1IDJA 2QY1A 2VFPA 4MXNA 3WWGA 3SYJA 2VJJA 1O8IA 1PLUA 3PSSA 3UW0A 1QA1A 2BSPA 1TYXA 2V5IA 1IDKA 4W8QA 4YDTA 5C1CA 4OPWA 2VBEA 4XLCA 4Z03A 1TYVA 4PMHA 2INVA 2XT2A 2BM4A 1KQ5A 2UVEA 3B90A 3BH6B 3LMWA 2VFNA 4YZXA 5AMVA 2PECA 1OOCA 1CLWA 4OJOA 1O8GA 3VMWA 2NSPA 2ODLA 3GQAA 1RU4A 3GQ9A 1O8JA 4V02C 1DBGA 3H09A 2X6YA 1O8EA 3SZEA 1LLWA 2NTBA 3KRGA 4OZYA 1H80A 2O1DA 3VSUA 1TYUA 1IB4A 5DNSA 2VFQA 4XNFA 3FY3A 2XT4A 2O6WA 4Z05A 1PE9A 3JURA 2BM5A 3LYCA 4NK8A 4XKWA 2BM6A 1DBOA 2PYGA 4XKVA 2PYHA 4KH3A 4YZQA 4XLFA 4OM9A 4XOPA 3DU1X 3GQ7A 2W7ZA 3GRHA
chains in the Genus database with same CATH topology
1QQ1A 3AK5A 2J8IA 4OJ6A 1K8FA 5JMCB 4V02C 1DABA 1QA3A 1K4ZA 4OJ5A 1TYWA 1QA2A 3H09A 1HF2A 3RIQA 2BX6A 1TSPA 3N6ZA 3SZEA 2VFPA 3JX8A 2VFOA 3ML3A 3SYJA 1TYUA 2VFQA 1QA1A 1QRBA 1TYXA 2V5IA 4JRAC 4OPWA 3LJYA 2F3LA 1TYVA 2BM5A 3N90A 3P4GA 3LYCA 4OJPA 3BH7B 5JLVC 2BM7A 2BM6A 4OJLA 3TH0A 2BM4A 1KQ5A 1QRCA 2B0RA 2IOUG 2VFMA 2VFNA 2XC1A 3BH6B 3PETA 4KH3A 2G0YA 4OM9A 2YUHA 1WXRA 2W7ZA 1CLWA 4OJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JX8 A;  4OPW A;  3PET A;  3LJY A;  3LYC A; 
#chains in the Genus database with same CATH topology
 4YEI A;  3AK5 A;  1K5C A;  4OJ6 A;  2NT6 A;  2Z8G A;  1DAB A;  3ZPP A;  2X6X A;  1TYW A;  2UVF A;  3PSZ A;  4OJ5 A;  4XLA A;  1HF2 A;  3RIQ A;  2BX6 A;  3B4N A;  3N6Z A;  4XLH A;  2J8K A;  3JX8 A;  2VFO A;  1L1I A;  1OFM A;  2IQ7 A;  2X85 A;  1HG8 A;  1LLZ A;  2NT9 A;  4XN3 A;  4URR A;  4YEL A;  1QRB A;  3B8Y A;  2INU A;  4U4B A;  1RWR A;  1QCX A;  1EZG A;  4JRA C;  4W8S A;  5C1E A;  1O8D A;  4XOR A;  1CZF A;  1OGM X;  1O8F A;  4YFO A;  3VSV A;  4EW9 A;  4OJP A;  3BH7 B;  2VBK A;  4OJL A;  4XOT A;  1JRG A;  3SUC A;  3GQ8 A;  2B0R A;  4AVZ A;  2VFM A;  1BHE A;  2YUH A;  3T9G A;  2X3H A;  4XON A;  2NTP A;  1OFL A;  2QX3 A;  2NTQ A;  2X6W A;  1GQ8 A;  1K8F A;  1O8M A;  4NK6 A;  1X0C A;  3SY2 A;  5JMC B;  3NB2 A;  4XMY A;  2VBM A;  3SQV A;  4XQF A;  3VST A;  1EE6 A;  3EQN A;  2NZM A;  1LM1 A;  1PXZ A;  1TSP A;  1QJV A;  1RMG A;  2O0W A;  1JTA A;  1OFD A;  2VJI A;  3ML3 A;  2O0V A;  2XTX A;  4YEJ A;  2O17 A;  1NHC A;  4XN0 A;  4OZZ A;  2QYU A;  3VMV A;  1EA0 A;  2QXZ A;  4W8T A;  3LJY A;  2F3L A;  3P4G A;  4MR0 A;  3N90 A;  2QZA A;  4XM3 A;  3EQO A;  5JLV C;  4HWV A;  2EWE A;  1XG2 A;  2BM7 A;  3NAW A;  1IA5 A;  3TH0 A;  1QRC A;  2IOU G;  1KCC A;  2XC1 A;  3PET A;  4W8R A;  2NST A;  1WXR A;  4YCQ A;  2G0Y A;  1O88 A;  1OFE A;  1OGO X;  1O8K A;  1O8L A;  1BN8 A;  1KTW A;  4YZA A;  4YC5 A;  1O8H A;  1QQ1 A;  2O04 A;  3ZSC A;  2J8I A;  4Z06 A;  4U49 A;  4C2L A;  4XLE A;  4XL9 A;  2XTY A;  1QA3 A;  1K4Z A;  1KCD A;  4I84 A;  1QA2 A;  1WMR A;  4XR6 A;  4YZ0 A;  1AIR A;  1VBL A;  2XTW A;  1IDJ A;  2QY1 A;  2VFP A;  4MXN A;  3WWG A;  3SYJ A;  2VJJ A;  1O8I A;  1PLU A;  3PSS A;  3UW0 A;  1QA1 A;  2BSP A;  1TYX A;  2V5I A;  1IDK A;  4W8Q A;  4YDT A;  5C1C A;  4OPW A;  2VBE A;  4XLC A;  4Z03 A;  1TYV A;  4PMH A;  2INV A;  2XT2 A;  2BM4 A;  1KQ5 A;  2UVE A;  3B90 A;  3BH6 B;  3LMW A;  2VFN A;  4YZX A;  5AMV A;  2PEC A;  1OOC A;  1CLW A;  4OJO A;  1O8G A;  3VMW A;  2NSP A;  2ODL A;  3GQA A;  1RU4 A;  3GQ9 A;  1O8J A;  4V02 C;  1DBG A;  3H09 A;  2X6Y A;  1O8E A;  3SZE A;  1LLW A;  2NTB A;  3KRG A;  4OZY A;  1H80 A;  2O1D A;  3VSU A;  1TYU A;  1IB4 A;  5DNS A;  2VFQ A;  4XNF A;  3FY3 A;  2XT4 A;  2O6W A;  4Z05 A;  1PE9 A;  3JUR A;  2BM5 A;  3LYC A;  4NK8 A;  4XKW A;  2BM6 A;  1DBO A;  2PYG A;  4XKV A;  2PYH A;  4KH3 A;  4YZQ A;  4XLF A;  4OM9 A;  4XOP A;  3DU1 X;  3GQ7 A;  2W7Z A;  3GRH A; 
#chains in the Genus database with same CATH homology
 1QQ1 A;  3AK5 A;  2J8I A;  4OJ6 A;  1K8F A;  5JMC B;  4V02 C;  1DAB A;  1QA3 A;  1K4Z A;  4OJ5 A;  1TYW A;  1QA2 A;  3H09 A;  1HF2 A;  3RIQ A;  2BX6 A;  1TSP A;  3N6Z A;  3SZE A;  2VFP A;  3JX8 A;  2VFO A;  3ML3 A;  3SYJ A;  1TYU A;  2VFQ A;  1QA1 A;  1QRB A;  1TYX A;  2V5I A;  4JRA C;  4OPW A;  3LJY A;  2F3L A;  1TYV A;  2BM5 A;  3N90 A;  3P4G A;  3LYC A;  4OJP A;  3BH7 B;  5JLV C;  2BM7 A;  2BM6 A;  4OJL A;  3TH0 A;  2BM4 A;  1KQ5 A;  1QRC A;  2B0R A;  2IOU G;  2VFM A;  2VFN A;  2XC1 A;  3BH6 B;  3PET A;  4KH3 A;  2G0Y A;  4OM9 A;  2YUH A;  1WXR A;  2W7Z A;  1CLW A;  4OJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...