3JXAA

Immunoglobulin domains 1-4 of mouse cntn4
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
382
structure length
378
Chain Sequence
PGSGPVFVQEPSHVMFPLDKVKLSCEVKGNPKPHIRWKLNGTDVDIGMDFRYSVVDGSLLINNPNKTQDAGTYQCIATNSFGTIVSREAKLQFAYLENFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLYIAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPAEKGTTVKLECFALGNPVPTILWRRADGKPIARKARRHKSNGILEIPNFQQEDAGSYECVAENSRGKNVAKGQLTFYAQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPLLTRDRIQIEQGTLNITIVNLSDAGMYQCVAENKHGVIFSSAELSVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Contactin 4
publication title The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 378
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jxaA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jxaA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jxaA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jxaA03
2CIKA 4MQSB 3S34H 2OI9C 4L1HA 3SJVB 3V9FA 4JRXE 5JPNA 5I74B 3KS0J 1KJ3L 7FABL 1N4XL 5EOTB 2COQA 4V1DA 3JBG7 5HYSG 1UZ8B 4J8RA 1SYSA 4J4PD 4XMLL 4C4KO 4X6CA 3O6FA 3IJSA 2HFEA 3QIUC 4LF3B 1KCUH 3H9HB 1TFHA 5C0CA 1G6RL 1RIVH 3QHZH 2LTQB 1F11A 4P9MH 3FQWA 2R69L 3S98A 1MHEB 4S1QL 2IH1A 4NNYA 2Q6WA 2BC4B 2OR9L 2W0PA 4LIQL 3SKOA 3T3ME 5C0AA 3S3PA 1MHHA 4S2SB 4Z9KB 5DMKB 4FXKA 3QHFH 1AHWC 5IT2L 4ZS6C 1I7TB 3KPLB 1KEGH 3DSFL 4HS3A 5CJ5A 1MREL 3NIFF 1YQ2A 4GH7B 3DXAA 1ZHNA 2LVCA 3HZKA 3VXNA 3RDTA 5J9PA 1IILE 3P73B 4QRPA 2BCKA 2NY6D 3ILPB 2V17L 1OSZA 3MO1A 4TVPH 1HYSD 4P2QE 1TITA 4WWKA 1GC1L 1OQXA 5F1IA 5GS0D 4KI1A 3EFDL 1OARL 1ZA3A 2QKIB 3CXHJ 1RHFA 4YHIB 3S7GA 2GKIA 2ICES 3MYJB 4XMKH 5C1MB 5GZOC 3HMWH 4QRUA 1HQRA 4JRXD 4FQ1L 2FJGA 4IMKA 3NTCL 4KUCF 4YUEH 4YK4B 1P4LB 2APXA 4BQ6A 3ARDB 5DJZB 2VKXA 5JPNB 1V7NL 3BDYH 5EO1A 1R6VA 2MQ0A 3DBXA 2NX5E 1JJUA 2W0LA 3FN9A 4U6YA 3VXOA 3JSSA 8CGTA 2VDML 1SYSB 1KCLA 1P4BL 2XN9E 1A0QH 4X6CB 5TE4H 1FDLH 3O6FB 3IJSB 1SJHB 4X6FA 3OJVC 5IVXB 3MA7A 3GSNB 3VDCA 4M7JL 2Z31D 5I30H 1MCJA 4OZHE 1FZMA 2VDOL 5IFHH 3FQWB 1CGXA 3BQUD 5DK2A 5LGKA 3NBNA 5DEGA 4PV8A 3EJYC 2NY1D 3RL2B 3DRTA 4HT1L 3MCLH 1O7VA 4FXKB 4Z7QE 1AP2A 5C6TH 4MHHG 4EDXA 3UTQA 4GBXA 4LLDA 3NA9H 1ZHNB 3A6OA 3VXNB 1FE8L 3RDTB 2AP2A 4YDKH 4NP4H 1YEGL 1NC4B 2VR9A 4ALAH 5SWSE 4LCIL 1BF8A 1RJLA 4X7DC 1RZFL 1FSKB 3GIVB 5FYLL 1GGTA 2AK1H 3Q5OA 4DFIA 4ZFOL 5DA0B 4YBQC 3TBVA 2GK0A 4M1CD 5ACZA 5LKNA 3WSQH 3S5LA 2ZOLA 5EOCH 3C5SA 4BUGA 2NY7H 3GO1H 4NPYB 1MFAH 1AGDB 2GY7B 5E99L 3FAWA 4HKBB 5GGTH 5FK9B 4P57A 2ORBH 2XN9D 4JQVA 4G6AC 1NC2D 1HILB 4U6YB 5I9QB 1IAIL 3TM6A 2FLBT 2IALA 1CZ8L 4PB9L 1SEQL 5CEXA 4NNXA 3UO1H 1AGEB 3AXLA 3FO1A 3AAZB 1MJ7H 3RY5A 5L2KE 4MLSA 4OM1H 2YBRA 4CU8A 1PKOA 4OZIE 4D8PA 5C08D 4ZPVA 3SDYH 5HSFA 1FZMB 35C8L 1B0GA 4AIZB 2VITA 4U6HB 5TH2A 4R3SB 1YY9D 5DQDH 4FOMA 3QO1B 3VW3L 4KZDL 5DMIH 1X44A 2XZQL 3B9AA 1VADA 3V4VL 3MOBH 4WWKC 4YZFF 2K3TA 4GBXB 1FAIL 4JB9H 1YEJH 5SWSD 4TULL 1U8IA 4NQUA 4CU6A 3WXWL 1M4KA 1A64A 2BVOB 1JPSH 4I13B 3N9GH 4PRPE 5EUKA 4PG9A 1PZ5B 4PJAE 5IQ7L 3V5DB 2ZCHH 4QGYA 3VGBA 1C5CL 3DHJA 3KPPB 3TBVB 5I19L 4TSBL 4GRLA 2ZUUA 2AJZB 3HC0A 4MS8C 1EFXB 3BAEH 3RI5F 1K5NA 5I75B 4G9FA 1RQ5A 5KTEL 3KYOA 4S0SD 2AXFB 3PWNB 3RZCC 5TDOA 5GGRA 2BNUA 3GMPB 5HDQL 5FHAL 5IESH 2FEEL 1BGXL 1F2QA 1BIIA 4NNXB 1I1AD 3QBTB 1U92A 4Y4HA 3BZFB 3D9AL 4Y4KD 2YBRB 2HJKB 2J88L 5HI4C 4C54A 1MHCA 2VDLH 4MAUH 3F8UB 1G7LB 4JM2C 3NPSB 3NIFE 5DO2D 5TH2B 3BPOC 3DURB 5LGJA 3C60A 1J8KA 5I15L 5FYJU 1OD9A 3QZWB 1EH9A 5IF0A 1DN0A 3Q1SH 1N8ZA 2B0SH 1VADB 1CICC 1I9JH 1OLZA 1IKNA 2NY5C 1LILA 2QR0A 5E2WL 4OD3L 1Y0LA 4UIKH 5A2FA 4EDWL 5MEQB 3EYUL 4DVRL 1R3LA 2R29L 4P2OD 4K3EL 4JKWA 5EUKB 4WW2C 3TJHC 1S7VA 3BSZH 4TTDD 3TH3T 3L3DA 2VLRE 4XPBH 1DUYA 2EDFA 2FJFB 4DGYH 4LPVA 2IANA 5ICZB 3SGDH 4GKNB 1QSFA 3JTTB 2V5SA 4OLYL 1GPOL 1FC2D 5J11C 2M1KA 2NR6D 1NCWH 3AREA 1BFVH 4TOYH 25C8H 1W72B 1IFHL 4GS7B 4WUUA 1QSEB 1ORSB 4J3SA 4I2XE 2G60H 2ZPKH 5C09A 1SJXA 1U6AL 1EEQA 5BQ7B 1JNLL 1IGMH 4HFUH 1QD0A 1SMOA 1FFOB 4JY6A 4Y4HB 1KELH 1OCWH 5B4MD 1L9MA 4BA8A 2D2OA 5C3LD 1CL7I 1K8IB 1KYOK 2R0LH 5BCAA 3H9YA 4ONFL 3C08L 4N5EC 1EVTC 3CCHA 2D4FA 3O6KL 1BVKB 5LGJB 3EOAB 3C60B 4JFFE 4WFGE 3DX6B 2BHZA 4I0PD 4P5TC 3MJ8A 4LGSB 5L9DL 3AB0C 4F2MA 4G3YH 5L8JB 3NN8A 4MCZB 4E41D 2VLRD 2Y06L 4QXWA 3A0OA 1E6OH 4GW1B 2JCCA 1S7VB 3RP1A 1CDIA 5LQBH 1QQDB 3INUL 4RWHA 3FN0L 5KN5A 1DE4B 2DN7A 1MRCL 5B8CA 1P5VA 4DEPC 4HZLB 1MVUB 3PQYE 3AREB 1R3IL 4LLUA 1CGSH 4TVSa 3QEQE 1S78C 1T2QL 4WV1C 3TN0A 2EC9U 5T33H 1MCLA 1IEAA 3OAYK 4R4FL 4LLWA 3AM8A 1IT9H 4JY6B 5D2NA 4MNHA 4JAMB 4IHOA 3BKYL 4MD5B 5LAXA 5JHLH 1V3MA 4JFFD 5DFVC 1I7ZA 5C3TA 1FZOB 4HUXA 1DBML 4YZFE 4MWFA 4I0KA 4LSTL 3IS1X 2V2WB 2X9XA 3TNNA 3CDGA 2EE6A 1CFTB 2VKWA 2ED8A 4PLOB 1Q94A 4M93C 4F2MB 1D5ZB 2VDKH 2DLFL 5INDA 1KXVC 4G5ZH 2MHAA 2FX7H 4YXLH 2ZUQC 2JCCB 4XH2A 1XCTB 1PY9A 3PP4L 5EN2A 2QQNH 4NT6A 5GGQL 2GSGB 1NBZA 2E8ZA 3U30B 1FVCA 1DBJH 1K85A 3PQYD 5JUEH 4MQTB 2VB5A 5IR1A 2YZ1A 3GK8L 3JV5A 3MC0A 4ZS6D 1RAMA 4G6KH 5B8CB 1OP9A 1JGUH 1E4XL 1JBJA 3ECBA 5ALBH 5TQ0H 2E9JA 1PKQB 4K9EL 3MV7D 5JR1L 3D48R 1BOYA 1A5FL 2CK0L 1GH7A 2AI0L 2PXYC 1I7RB 4LLWB 1UCTA 2EDRA 3FMGH 5GZOD 3LEXB 3VRJA 5D2NB 2BXZA 4MA8L 3BD5A 5LAXB 1UADC 2PO6B 3MCKA 4E5XB 5HD8C 1OVZA 3GHEL 1T6WA 4HUXB 1F13A 5GS2D 5AZEL 3A6BL 4H0IA 4C59B 2WP3T 2Z93A 4DGVH 3TF7C 4RMRA 5F9DC 1HWGB 1AQKH 1QRNE 3RAJH 4M3KB 3WKNA 2BSSA 4H8WL 4JZOB 3LRSA 3Q3GB 3LD8C 3GM0A 5DD5H 2PNDA 2B1AH 1ZV5A 1N5AA 1I3UA 4WI6A 2A9MH 4OD1L 3K1KC 1Y18B 2V5YA 1XIWC 3ARGC 3PV6A 4XH2B 2DKSA 2RQ8A 3WE6B 1JPFB 4NZTH 1WEJH 5C0JB 4HWBL 4Z5RA 3QWRD 1SJEA 3O45A 1NDGA 1AXTL 1YJDH 1VFAB 4OI9A 1FG2A 3OAZK 4JM4H 4Y16C 4EUPA 1JGVL 4JHBA 1NCDL 3TN0C 3ZKMC 5IK3A 4P99A 3UC0L 3UEZA 3ECBB 4NQSA 4BZ2L 4ZS7L 4QRPE 4JDVA 1WIUA 4I18C 2R56L 4U0QB 4Z7NF 2GITB 1F4XL 2G5BA 3D0LB 2FWOB 3GSUA 1GGYA 3EIFA 3MBXH 4ELKB 1KLGB 1X5HA 4YBQD 5CEZH 1BQLH 3LV3A 5IFJB 5HVHB 3HC4H 1B0WA 4KTEL 5A2KH 4HF5H 1V3LA 4XVSH 5ILTH 3KPRA 4XNUH 5BVJA 1Q1JL 1QRND 3ZTNL 1CFBA 5T1KD 1BAFH 3O6ML 2CJUL 3F58L 3QJFA 4G6AD 5DUML 1UCBH 1FLTX 2F5AL 5C6WH 3GSNL 4D9LL 3HAEG 3CK0H 2B4CL 3LQAC 2IPUK 3LRSB 4LCWA 2O5XH 3S4SG 1G84A 5CMAB 5EC2A 4MX7B 2XG5A 3QP3A 5E8PB 5IBUG 2R39A 1NANI 1R0AL 3VA2C 4OTXL 1RU9H 2ZG1A 2RJMA 3PV6B 3BKML 1WIOA 3A67L 3LS5L 3MPCA 3I75A 4Z5RB 1SJEB 3NCYP 3O0RL 3O45B 1SEBB 3PGFH 4X80L 4FQJL 4Z0XB 1A02N 4M7LH 1S9XB 1RZIA 3I6GB 5IBLC 3WIIL 2A6IB 1R3JB 3HI6H 1IM3A 3HZMB 3ZKXC 4FXLA 1EHLH 1QFWI 2I60H 2ED7A 1BWMA 1QOKA 5ITBL 3GMNA 2YKLL 3AU1B 5DEZA 3U6RA 4WRLA 4QHKI 5CIPB 4P3WA 1JF6A 4ETYA 1FRGL 2JCCF 3FT2A 2VO5A 4EEEA 2ATPA 2JB5L 4MS8D 4PY7B 3FFCE 2CO6B 3KDMA 3RZCD 1DSFL 2R4SH 1IGIL 3G6AB 4UQ3A 1Z9LA 1VGEL 2DTSA 3PXJA 1LO0L 3W39B 4L8SB 1HXMA 3B8SA 4Q6IC 5L88L 2P5WE 3TBTB 4HIEB 1DANU 3OKMA 5HI4D 2NY6B 5ID1B 4JM2D 3VFUA 1TCMA 1CL7L 5CSZB 5L6YL 3EO9H 3MRQA 3WIFB 1MAMH 1IGYB 3C6LC 1IM9D 4M9OA 3V2AR 3MFGB 2P8PA 3HC3H 3ARSA 4RBPK 2GAZA 1R3KB 4Y5YC 3UP1A 5IB3A 4QXGH 1G7IA 4JRXB 3RTQC 4E0RA 1CICD 4HXAH 1AGCB 5ETUA 4PG2C 4AEIH 1GHFL 4X6DA 4LNRB 1SM3L 4PUBH 1F45A 1IM3B 3CU1A 3WNPA 4AQ1B 3DVGA 4QHUA 3OGOE 5JMRA 3TJHD 8FABB 1NC2A 3SKNA 3CH1B 4JZNB 1AE6L 1RJCA 2DOCA 2V6HA 5IJKC 1ZA6A 2F15A 4KRMB 1N6VA 3FFCD 4ODVL 3UJIL 2WSKA 1X5LA 2VIRB 1T1ZA 4OSUL 3JXAA 5I71B 3RVUC 4FZEH 4GKSA 2Z92B 3U82B 3O6LL 4MDIB 1X5JA 4G9FE 3RA7L 4OCRL 2Z31B 3EHBD 5E95B 1CYGA 3EO1B 5C08A 2NXYB 1RZ8B 3EJJX 5E94B 3BWUC 2ARJA 2NW2A 3BQUB 3HCVB 1N4XH 2NZIA 4JY4A 2EYSA 2NY1B 1AFVL 2IPKB 2YPKA 1BVLA 4YH6A 1P2CA 2YOCA 3T65A 1HXMB 1C12B 1G6RH 4NZRH 3QFJA 4KMQA 2SEBB 3OKMB 3HS0B 4FNLH 3DVFA 4S1QH 4UDTB 1UJ3A 4JFEE 4P2RA 5DSCA 4LIQH 3MRQB 4KAQH 1ETZA 1I8KB 1JVKA 2FO4B 2DQUL 2D9QB 2GAZB 4MQ7B 2V7NA 1RZKC 3RU8L 3VE0B 3WJJC 5IT2H 3SO5A 4YIQB 4P5TD 2EEBA 3DSFH 4QHNB 1G7IB 1JZ3A 4ZO6A 4Z7NE 2BY1A 5DFWH 4MSWA 5C0IA 5BS0A 5BRZA 4X6DB 1H3XA 2V17H 5I8EA 3OHXB 1Z0MA 2B8OT 2FH6A 3DVGB 3RX7A 4R4BB 4QHUB 2XN9B 1OARH 1CLYL 1NC2B 4XNQB 4I9WE 1TETL 3K4DA 4L9LB 4K8RH 5KJRL 3FB5A 1Y6MR 1EXUB 1KUMA 1JFQL 4FQ1H 2ARJQ 1T1ZB 2OMNA 4RISL 5IJVB 1HHKB 1OSPL 3NTCH 3K7UA 1EZVY 3CD4A 1W72L 5D5MB 5C08B 1EO8L 1V7NH 1YN7B 1NEUA 4B7IA 3DYOA 4WUUE 4JFOB 1UFUA 3CLFL 4NBYB 3M17B 3TWCH 4Q9RL 1GIGL 3N1FC 2YPKB 1J0IA 3SE3C 1P4BH 3W9DA 3OKKB 4JFDE 4NKOA 1JNNL 4Z7WA 1FO0B 4QRQA 3MRRA 4Q97A 1UXWA 3O2WL 4JFED 4M7JH 5SWSB 3RGHA 4OGYH 1T83C 4RZCA 1U95B 2D31B 2P44B 4APQA 5DFVD 1U8JA 3BGMB 4CRPA 4FS0A 2ERJC 4OF6A 5I17A 1X5ZA 4NQXB 1OGAE 4WEUD 2V7NB 5I73B 5F7NC 2W07A 2WWKT 3S36H 1WCBA 4J7RA 5AEAA 5TF1H 2ADGA 1FE8H 4NQCE 2AV7A 5BS0B 5JIPA 2C3GA 4K7FA 4R7DB 2EDWA 4JJ5A 1J8HA 5I8EB 1YEGH 4HXBH 1ULVA 3KPSA 4Y2DA 3TFKC 2BOBA 3F7YB 3D3VE 2QSQA 2VOTA 5FYLH 1CFNA 2OLDA 4QYOB 1EGJA 1IGTB 2GY5A 2BVPA 3EYFA 1QFHA 4BKLB 4DQOH 3RWHB 1JYVA 3MRBB 1I1AB 3PUCA 3TYFA 3TZVD 5DS8A 4Y4KB 3MOAL 4PJHA 3X12B 1OT2A 1IC4L 4ZSOA 3T08A 2H1PL 5KSVB 3MOQA 4S0TD 1J12A 5EBWB 1QR4A 3MMEB 5E99H 5FF6B 5AZ2H 4GAYA 4MXWL 2FBOJ 4JFDD 2G5RA 4IRZL 1EEYB 1IAIH 3WDHA 1CZ8H 1FNFA 2H32A 4ISVB 2QL1A 4BK4A 2PXYD 3KR3L 2FNBA 4NKOB 1DUZB 1RVFL 3LDBB 2D9CA 1UJ3C 1KJMA 1UXWB 4UOW1 1B0RA 4P46C 4PJAB 1M7IA 3QDAA 5TGBA 2IFFL 2Y7QA 1OGAD 35C8H 4RZCB 2JJSA 4P2OB 4JRYA 5DFTA 1TJGH 1Z9SA 3QXAA 4KZDH 5FA4A 1BFOA 4NQCD 3IFLH 1F3DH 2GSIB 5CJOH 3V4VH 4MA3B 1S7UA 5HHXH 1FAIH 2PYEE 3OKDA 3C5JA 2B1HL 3D3VD 3WFDL 4TULH 1DEEB 4K7FB 3WXWH 5EOCJ 3MUZ1 4KKLC 3NA4A 4JQXC 5HDLA 5C0BE 1XIWD 3ARGD 1K3IA 5J1TC 2UZIL 2DYPA 2ZUSA 4H88L 5IQ7H 2YK1L 4XP6L 4LSUL 3S96B 2AXHA 3ILQD 1YNTB 4HWEL 4TSBH 4U3HA 1GGIL 3RPKA 1MIEL 5KTEH 4Y16D 4PJHB 2RCSL 5B39A 2NXZD 4D94A 4I48A 2BK8A 3FOLB 1BFTA 2YMXH 1YEFL 2J5LC 2OBGA 4YLQT 2EDBA 5DJXA 1MWAA 3B6SB 5HDQH 1SYVB 1BGXH 4QXTA 2EH8L 3JWOC 4I0PB 1QFWL 4ZFGL 2PW1B 4G9DA 3H6JA 1D9KC 1LD9A 1U3JA 3D9AH 4BFBD 1B0RB 2J88H 5JIHA 4L3CA 4Y7MA 2VLRB 4Y1AD 4E41B 1KB5H 1A6UL 2H6PA 5KANI 1CLZL 2BMKA 1KPVA 5IMKA 2DQHL 4PBWD 5M95B 1XR8A 4XPGH 5E56A 1ZHBA 2PYED 3JUZA 5I15H 5FA4B 3MA9L 3ALPA 3WUWA 3K2MC 2YUZA 4KUZL 3MFFA 5DRXA 4Y2DC 1OB1A 3KPTA 4UQ2A 4GJTB 5C0BD 2YD2A 5E2WH 4OFKA 3IXAA 4OD3H 1HIML 3KJ4B 3G5XA 3KPNB 3DRQB 3EYUH 2R29H 5HPMB 1GSMA 4WENB 4K3EH 5DVMA 4ZPTA 5FO8A 1MCQA 5EZJB 3MV7A 1P6AB 4I5BA 5F9WB 3V6ZB 1MOEA 3N1QC 3RWFB 2Q7YB 3B9VA 3BH8B 1I3GL 4X7TA 1GRWA 4OLYH 1MUJA 5IBLD 3O9WA 4BH7B 4IRSD 2JF1A 5KVMC 3MUGB 5I1CL 2ILLA 1UQSA 4I48B 1IFHH 1DN2A 5EBMB 1JV5A 2JB6B 3B3IA 1F6FB 4HKJA 4XBPA 5DJXB 1MWAB 4C57C 3O3AA 1U6AH 3G5VA 1JNLH 4F15C 2J6EA 3ZDYE 4OV6F 3L3KB 4G9DB 1LD9B 1NCCH 5DJ8B 3LS4L 5F1NA 1TTGA 3BT2L 2QLVB 1TZGL 5M7QA 2EDOA 4ONFH 3C08H 2XKUA 2H6PB 4U7MA 3KPRE 4Z0BH 4GUPA 2IBZY 3I02A 5IMKB 4B41A 1CXEA 3B83A 1IQDA 1ZHBB 5DRZA 1NLDH 3QI9C 5HI3D 3LY6A 2GJJA 4B53A 3FFDA 3PQYB 5L9DH 3B5GA 1GXEA 4UV7L 3PWPE 4XNMB 1AHWB 5IW3A 3SN6N 4JANA 3JV6A 5FAAA 4N0YL 1HI6A 4MJIA 3MJ9L 3THML 2ATKA 2OZ4L 4ZPTB 2APBA 1MI5A 5FO8B 3L3HB 1TZIA 4Z7WF 3QXDB 1W0YT 3GMMA 1UH3A 3MV7B 5BV7B 3VXSE 3INUH 4PRAB 4DTGL 3FN0H 3C6LD 3TJEL 5ALCH 1MRCH 3SCMA 3TESA 1SQ2N 1WVZA 5KSAD 3RTQD 3O9WB 4P0DA 2JIXA 3SKUD 43C9A 4ELMB 1RSFA 2NY3D 4MNGA 3RX5A 1E4KA 1JV5B 1LK2A 3CDYA 4HKJB 4XBPB 1PEWA 3O3EA 4YXHH 4R4FH 1DEDA 1DZBA 5D9SA 1OAXL 2FIKA 2K9UA 5F1NB 1Z5LB 1EZVX 3BKYH 5DWUL 3P9LB 4OM0L 4U1NB 3RVUD 3GMOB 3N1MC 5EO9B 1DFBL 1JPGB 4NO3B 1DBMH 3BW9A 4RNRA 3QEGL 4LSTH 5KS9E 1DVFD 1CTNA 2J2ZA 1HINL 2EC9T 2CLRA 3DUUA 3PWPD 3C6SA 5J57B 2WV3A 1TLKA 2CDEA 2UV3A 3FQUA 2WBJC 1A1OA 4K71C 1MLCB 1T89A 2DLFH 1TTUA 3WDIA 3H3BC 5B38G 1JYXA 4MDJA 3VXSD 3C8KB 2VNCA 4L3EA 5GS0L 3S8WA 4RAVA 4PRBB 2B5IC 3GMMB 2N7AA 3PP4H 3QXTA 2VLLA 4W6XB 2UY7A 3P9WB 2P5EE 5GGQH 4TUOB 4WHTB 3RWIB 3ES6A 4MAYA 5FKAA 4XPHL 1IC5L 1H5BA 4Y5VA 4KJWC 3GK8H 3E8UL 4LVOC 5JDSA 3SCMB 5ESAA 3WYRA 4OLXL 1A6ZA 1E4XH 43C9B 1NDMA 3IKKA 5F72S 1KJVB 2OTUB 1CXKA 2CKNA 4WTZA 1QRNB 4K9EH 4PGDA 1MPAL 1XGPB 5JR1H 5T1KB 1EEUA 1KCRH 2CK0H 5T3XE 1HHIA 4PJFE 4F7PB 3BP6A 3VH8A 4TQEL 5D9SB 2ZOKA 1P6FA 4MA8H 2MFNA 3S35X 2APFA 3DUHA 1BJ1H 1UKSA 3ULSA 3WFHA 3GHEH 2AEPH 3HE7D 5TFSL 5AZEH 4NN7C 2CDFB 3A6BH 2NLJA 4RGMC 4JGJA 4PJBA 1F90L 3RY4A 2BVUA 4OLEA 5TDPA 3Q6FB 3LEYL 1WFNA 2APWA 1CU4L 1KCSH 1TQCB 2VLJA 1R5VA 2JJWA 1L6XA 3E6FB 4KVNL 4OD1H 4MJ5A 2P5ED 4AZ8A 2Y36L 3P4MA 4GW5B 2I9TA 5HGHA 3HLAB 2YD8A 4TYUA 3V0WL 2ICWJ 4O4YL 4HWBH 4JCMA 3I3EA 5I1AA 3LKOB 1AXTH 4NQDE 1HCVA 4Y19A 1I1FA 2LABA 3ROLB 2AJ3A 1E4KC 4CMHC 5JDSB 4G6FD 1JGVH 1NJ9B 1NCDH 3RX8A 3UC0H 1LE5B 5HVWA 5BRZE 4ZS7H 3TYGL 2WUBL 2R56H 1U8QA 3TFKD 3RZCB 3NCEB 1F4XH 4Y4FA 3T4AB 4BSJA 5ADPH 4QOKA 4L8DA 4LFHD 4NKDA 3GM8A 5HDOA 3MV9E 3MRIB 4UOW0 1S7QB 4KTEH 4NGHL 3EYQD 1WFTA 3O2DL 4FQ2L 1Q1JH 5CLTA 1PSKH 3KYKL 3ZTNH 1NBYA 1AR2A 2H26A 3O6MH 4F7TA 2NLJB 2CJUH 4JM2B 3WNOA 1GAFL 4DGIH 4Q9QL 1IM9B 1FO0L 3BPOB 2F5AH 4U7SA 2J8OA 1DQML 4HFWA 3GSNH 3VG0H 4D9LH 1VEOA 2B4CH 3DX8A 3OXRA 5FEBA 4Z7WE 2P8MA 4U0RC 2QTEA 1WUNT 5D8JL 4ZDHB 1U41A 2F8OA 4Z78B 4JKLA 3QYCA 4NHCH 4HUUA 4YNYA 4P46D 1R0AH 1G0DA 1N3NB 1TENA 1RUQL 1SY6A 3IDIA 4OTXH 4NQDD 3BKMH 3RVVC 3RVTC 5HGHB 1PJ9A 3LS5H 4KKNA 3NZ8A 4WW2B 3T3PF 3KPMB 1HKFA 3JWDL 3O0RH 5I1AB 1D5MA 3UAJC 5EU7C 1A9BA 1RZJC 4X80H 4FQJH 3FFCB 3WIIH 3F7VA 4NQEE 2YA2A 5J13C 3F65A 4YHYB 3M1BA 4RFEA 5F1SA 5IHZB 5J11B 3I9GL 1J8HE 2VZOA 1G7QA 1QG3A 1U8QB 2A74B 4KKLD 1CGTA 1WT5C 4XP1L 5ITBH 1KPRA 4HS8L 1AXIB 2W65A 2YKLH 5FOBB 3TBYA 3KPQB 3G6DL 4Y4FB 5IHBA 1E4WL 4QOKB 4FQPA 5K9QI 1S3KL 1BQHB 1FRGH 2JB5H 3ZL4L 2XG4A 2ED9A 4LCYA 3HB3D 1KLUA 1T0MA 4KJPC 4ZSOE 4F7TB 4GT7A 1TVHA 5SWQB 3PDDA 3PHOA 1YPZA 5I66B 1MVFA 4FZ8L 2HLAB 1VGEH 3M07A 3OJ2C 1OP5H 1LO0H 2P8MB 4IOIA 5F96H 2GJ6E 4CNIB 2BSTA 3AB0B 1DLHA 2OP4L 2FBJL 4YNYB 4PRDA 3IDIB 1MJUL 2Z8WC 3KXFD 2QJDA 1UGNA 4YHML 1CL7H 5L6YH 3VWKD 5FHBL 4NQED 5FM5M 2EDDA 1X7QB 1D5MB 1ZVSA 2XXCB 4EUPG 3DUSB 1JTTA 1S9YA 4LRIC 5E70A 4FN0A 3M1BB 1DANT 4RFEB 1EHXA 2CKBA 2Q3AA 4GRWE 1SM3H 2HN7A 4PLJC 4QT5A 3JVGC 4F8TA 3UYOD 2X89D 4DEPB 2DQFA 4R4NC 2DL9A 2FEDC 1BJ8A 4KKCD 3CJJA 5MERA 3MJ7B 1I8IA 1KPRB 1AE6H 5KVFL 3SDAD 1T2JA 5J6GA 4LHUD 3UJIH 2E7LC 4XTRC 1ADQA 1CFQA 1AGBA 1MY5A 1NUNB 1IC7L 3O6LH 3L3JA 3SE4C 4LLVA 2V5MA 4R8WL 3OKOA 5ID0A 4JFEB 2OTWA 1BZ7B 2HJLA 4R6UA 4OGAD 1DDHB 4U1JA 5FA3A 1RV6X 1R3HB 4YPGA 2D7NA 2E6PA 3VGGA 3OX8A 4PGEA 5DHVA 1NUDA 1INQA 2VABA 1DQQA 2UYLB 4X5XB 1K4DA 4AENB 3CUPA 5HHVH 3ABZA 5E5RB 4M93B 5GHWL 1MRFL 3L5WB 2BSTB 1G9NL 1DLHB 2UZYB 2NTSP 4PRDB 3FHQA 4P4RB 2P49B 1B2WH 2H45A 2KH2B 4LLYA 4ZXBC 4CMMA 3OF6D 4K23L 3QI9D 3RU8H 4F37F 1N59B 5C0GA 1ZEAL 4RSVA 3TZVB 2VMFA 3EYVA 3L95A 1LEIA 4LSSL 4OZFA 4PJBF 1D5BA 2HVJA 3MV8E 2HN7B 2EIDA 3QPXL 4QT5B 2CUIA 2E7CA 2PTVA 3TA3C 5J06A 3G9AB 3I3BA 5MERB 4JFDB 3MRLA 1I8IB 5EBLA 2ITCB 4CVXB 1TETH 1JF1A 5KJRH 2Y5EA 2Y1VA 4UT9L 3MNZB 2ZKHL 3T2OA 1JFQH 5BXFB 4G8EB 2PXYB 3J7HA 4RISH 1OSPH 2HMIC 2CLZB 3QT2A 2P48B 3L3JB 4G43A 1ROWA 3OKOB 1W72H 3CFDA 3MXVL 3B8YA 1EO8H 1EHNA 4Z7UA 3GSOA 4YHKH 1J0ZA 2IF7A 3QJHB 3QIBA 3I50L 1OGAB 3L7FB 1FYHB 4YHNB 3BP7B 2P4AB 4UBDC 1EUUA 4AK1A 1ZHKA 2Q8BL 3CLFH 5CZKA 4Q9RH 2EE9A 4NOBA 3FL7A 3ORJA 4NOFA 4JG1L 4MMZC 1GIGH 5IROA 2RFXB 5CP7B 1HH9A 1JNNH 3FO2A 5D7IA 3ZE2E 2VABB 5GJSL 5IBTL 1NCAL 2A0LC 1GGCL 3O2WH 5F3BB 2PCPB 1G7HA 4JHWL 4UNTA 5D96B 3T3PE 4R26H 1BQUA 3BO8A 3D3VB 3PWVB 2ESVA 3LD8B 3QNZA 1T80A 3QXVA 1RUPL 3T2NL 5MENE 2A6DB 2MCPL 4DAGL 5HGBA 2YN3A 3K4ZA 2DQEL 3ARGB 3GKWL 1S7SA 4CMMB 5ESQB 1X5KA 4FTVA 5DYOB 5T5NF 3VXME 4R0LA 4JG0L 5T3ZH 2FL5A 3MV8D 3BZEA 1OP3H 3HI5H 2WBJD 3MRNA 3VFTA 1XCQB 5IB1A 5ISZE 4U49A 4GO6B 3EYVB 4Y16B 1LEIB 2H41A 3VFRA 2NXZB 5DEFB 5BMFH 3N1GC 4JREC 5C07D 4QRSB 4HMCA 1YZZA 4NRZA 1BECA 3MRLB 3PF2A 4I18B 5EBLB 1JF1B 5GRVL 5E6ZA 4MJ4A 3GB7A 4PP2A 5JXEA 2F54E 2RBLA 4OV5A 5F97E 3TO2A 3RNKB 4KJWD 1R5WB 3PWJA 5CILL 4G43B 1H3PL 1ONQB 1IC4H 4GKZA 2H1PH 5DVLA 4Y1AB 3GSOB 4LL9A 5CAYB 4MXWH 1CGUA 5E1HB 3VFGL 3DX7A 3FZUC 2F74A 4IRZH 4X0KB 4DZBB 1X3DA 2PYEB 4R2GC 4GW4B 2PF6A 3KR3H 3VDBA 1QYGL 3FO2B 4ESKA 5C0BB 3W5MA 4N8VG 4KK9C 2IFFH 3QFDA 1NGXA 1VFOA 4AEFA 4GG6A 5D7JC 1NMCC 3VXMD 4DN4H 5FYJE 1TCRA 1J11A 3BPLC 3BISA 1WAAA 5D1ZD 3MNWB 2QQKL 2E27L 3MRCB 4ONHB 5A1AA 5ISZD 4CU7A 1M05A 3SE9L 3MLWL 4PJ5E 2E5EA 2DQCH 1F58H 5D70L 1UEMA 2NY0C 3CFKA 3VI4F 1A1MA 3MRNB 5GPRA 3DVIA 1UXSB 1JN6B 2B1HH 3GHBL 3VFTB 3WFDH 5KSAA 5C92A 4I0CC 4HZAA 4IRSB 4HHAA 1ORQB 3VWJC 1YPZF 3HPJB 3LH2H 2F54D 2UZIH 5JW4R 4H88H 4NRZB 2YK1H 5I16B 1LO5A 1FYTE 4LVNC 3ZKXB 4JY5H 4XP6H 3LKPA 4LSUH 3HNVH 5F7WC 1MH5B 3I6LE 5TF0A 4HWEH 3GB7B 4PP2B 1RJYA 1GGIH 4U3XA 4OV5B 3WJLA 1MIEH 1ZANL 3PWJB 2X1OA 4UILL 5GGTA 2RCSH 3O41A 5CD3A 3CZFB 4ZFFB 5EU7E 3ZLQC 4JFPA 5IROC 2J8HA 5DC4B 3IVKB 5MI0B 1YEFH 1WF5A 1KN4L 2O5ZH 4XGZA 3BWAA 3TIEA 3ZKNC 4O2FB 3V6FB 1NKRA 2EH8H 3FONB 4OI8A 1QFWH 1KNOA 3E6HA 3FOMA 3GJFB 4X4YB 1JPTL 4JPWL 4M43L 1UWEL 5CBEB 5IQ9A 2BY0A 1IARB 4ZNEE 1HEZA 2W9EH 1JHKL 3GMRB 4FQLL 1CLZH 4Q6IB 5IMOB 2IBGA 4OCSL 4OJFL 4PJ5D 5E5MB 5BZDA 1MCEA 3OG4B 3BD4A 4EN3D 2VXVL 1Q9KA 3E3QC 4HMEA 4PGBA 2AXGA 1IAOA 1AC6A 3MA9H 2BNQA 3BRGC 5E8EA 1M05B 5CWSB 4KUZH 5KVGL 2RHEA 5F21B 3C6LB 4BZ1L 5IEKA 3UJJL 4GXVH 4O9HH 4XPTL 3Q6GH 2P7TA 3KGRA 5KSAB 1ITBB 3RTQB 2AK4E 4M8QA 1FYTD 2AKRB 2HFTA 4MNQD 3T8XB 1JYNA 2GCYB 2NY3B 5JXEC 3I6LD 4YEEA 5HHOA 5JOPE 3GKZA 1LEGA 4DOHE 5H37G 3RVVD 3RVTD 4Y0GA 4F9LA 4HD9A 4OUOA 4A6YL 1I3GH 3UAJD 3DNKA 3MR9B 1RJYB 4YE4L 5INCA 1K3ZA 4LHUG 3PGCB 1X5YA 4U6VL 1HHJB 2Q8AL 1A1NA 5CD3B 4JFPB 1PFCA 3OJDA 2EC8A 4CN1A 1HHHB 1DVFB 5FOJA 4L4VA 2MWCA 2JK5A 3BWAB 3TIEB 2FX8L 3PWPB 2WW8A 4QHMA 4U6XB 2BDNL 2VZVA 2YD7A 1FNGA 3BKCL 3GMQB 3BJ91 4PJEF 3HE6A 1UWXH 4PPTA 2YD3A 4AG4H 3BT2H 1TZGH 4TNWF 4U6TA 1INEL 3VXUD 3IGAB 2BRRL 4KJPD 3H3PH 5F71A 5BW7C 1XGUA 3CVHB 4UDUA 2BNQB 3ZDXF 2QHLA 5F1OB 2LU3A 3QG7H 2AK4D 1VHPA 4Z7UF 3OKEB 2NNAA 5DC9B 1U8KA 4LEXL 2NY5L 2QBWA 5JOPD 4N0YH 1J0KA 2EZ0D 3D39E 2OZ4H 4BSVA 4F7CA 1CXHA 5HHOB 5D7IF 4CVWA 2VDRH 2UWEA 3B9KA 2ZCKL 1G9EA 4DTGH 2ZG3A 4OIAA 4JFYB 4L8CB 4FABL 3FT3A 1WWAX 3TJEH 3I2CL 1IEBB 2E3VA 3HRZA 1P53A 5B39G 1OF2B 3TO4D 2DQDL 4GFTB 3G5YB 3BD3A 4WO4C 2AQ1A 4XP4H 3TBWB 2ADFL 4HK3N 3L7EB 1I85A 3P77B 1VFUA 3HE7B 4PLKC 5HY9A 1D5IH 5CIPH 3V6OC 2FEDD 5IMMA 4JE4B 2CDGA 4QHMB 5DZOA 4ORGA 3T09A 1OAXH 1KLFA 2V5RA 4ZMAT 5TDNA 4XVTL 1DFBH 3QRFM 2P5EB 2VC2L 1AIFB 3QEGH 3VI4E 1HINH 4F3FB 2AQ2A 3BDXA 3MLPA 5GRXG 5J0BA 2PN5A 1ACYL 4NWTH 1ED3B 1HXYA 2ERJB 1BOGB 5E9DE 3K46A 4QNPF 3QEHB 4G6FB 2PYFB 4QWWD 3LIZH 4ZAKC 4DUVA 4RMSA 5D1QC 4M48H 2WLYA 4PJFB 4CVZA 4KVCL 5GS0H 1A7RL 4BSVB 3TBSA 1I4FA 3ARFA 3L5HA 3RQ3A 2UWEB 5I8KL 3B9KB 4ETQB 1EDQA 1UB6B 4ZOEA 5GRUH 4ZXBD 5JXAL 1CK0L 4L3AA 1MCPL 4HK3J 1IC5H 1ZGLM 5L7XL 3UPAA 4GG6F 3HI1B 4U1KA 3T0AA 5FUCC 5D1XC 4MXVF 4RA3A 4OLXH 1WAAF 3CX5K 4K3DL 3BEVA 1IAKA 3F6IA 1PG7W 2W60B 4PJGF 1MPAH 1Z3GL 5IOPB 1MCDA 3TA3D 4WCYL 4WWID 2O93L 3KYNA 5JHDD 3SDDC 4HJGB 2YD6A 4PTTA 4GXUM 4TQEH 3U0PB 1U8HB 3NFNA 3VGDA 4UOJA 4N8VB 3V8CA 1AR1D 1CGVA 4WIQA 1MNUL 2HMID 1WWCA 2OTPA 5TDNB 3WMSA 1ZLVK 5L8KB 3JV4A 2YXMA 3VXQA 4C56D 2HFFA 3EKCA 5E9DD 4NQDB 1OAYL 4YXKL 1KJ2B 4K94C 1P7QA 2E6QA 4UBDD 4JO4L 5CFHA 5JZ7C 4H1LB 3LEYH 4XAKE 1CU4H 3MLXL 1MRDL 4Q6YA 4O5LL 4X4XB 1P7KB 3MNVA 3X17A 1F00I 5FO9B 2A0LD 4KVNH 4X6BA 1OAUL 2J8UB 4U1GC 1W8NA 4OD2A 1DQDL 3LEVH 4CVZB 5DJ2B 1NEZA 4KRPD 5DJAA 1T1YA 1I1RA 3ARFB 4O4YH 4YDIL 3JV0A 3HA0A 3SDAA 1P84J 4OKVB 1QLEL 1ZWIB 3RGVA 2HT2C 2XA8H 4WHYH 3HZVB 1ZLWK 2ICWA 1WC7B 2WUBH 4EOWL 3AY4C 4PJEE 5E4EC 1A6PA 4HUVB 3D25A 4PJ7E 4EI6A 3IDGB 2MKLC 2J4WL 3KYNB 3W81A 4HH9A 4OLUL 2EE3A 2IPUG 4PTTB 3OZ9L 4N0RA 1QEWB 3IKCB 4WU5A 5HYQA 3U0TA 4NBXB 4IMLB 3ZDXE 5A43C 1LEKA 5HHPA 3UTSE 4XRCA 4FQ2H 4Z7UE 1HQ4A 4JLRA 2HFFB 5E8OA 1LNUA 5JW5B 3KXFB 4PJ9A 5HPOA 1CD8A 2A6JB 1GAFH 1PAMA 3MRDA 3VWKB 4Q9QH 4NQEB 3FZUD 1FO0H 3SDCA 3CFJA 4JN2A 1DQMH 1MIML 4R2GD 3KS0H 2FO1A 2IFGA 3KYMA 5D8JH 4DZ8B 3MNVB 5GGUB 2ADIB 3U46B 5C9JA 4HCRA 4KGJA 4KK9D 1MCWW 5E2TL 4PJIA 1MCWM 3NFSL 2J1KA 1T3FB 5D7JD 3L6FA 3QEUB 1LO3L 5EC1B 1I8LC 2CMRL 1WZMA 5C2BL 3SDAB 1T21A 1FFPA 4OGXH 3VXRE 2BVQA 2OJEA 4NN6B 3EGSA 3RGVB 3VI3F 2NY0D 2YS4A 3E3QE 2EDJA 4NCDA 4HPYL 4F7MA 3MUHL 2Y5TB 2ICWB 3REWA 3DV6B 3I9GH 1RMFL 5K9OA 3FB7A 4YHPA 2IBBA 3V6BR 1AJ7L 4HS8H 1QA9B 2GTWA 2YD1A 3VH8G 1E4WH 3VA6A 1YC7A 1WFOA 4S1DD 4X7FC 2VQ1A 1S3KH 4HIXL 3N50A 2DI8A 5HYQB 3H42H 3ZL4H 1JRHL 2DI9A 1KFAL 2LU7A 2UWEF 4YHZH 1LEKB 3WFCL 3VJ6A 2E6JA 5ICYB 1LNUB 1FL5A 3IXTA 3PL6C 1VEPA 1PVHA 1N0LA 4JVUA 3EFFA 3CFJB 1KENL 5F8QC 4FZ8H 4U1LA 3QI9B 4PS4H 4GRWB 1FVEA 4IOSD 5C7XH 3QNYB 3LQAL 3ULUC 2MKWA 1S7RB 1EERB 1P69B 1U9KA 4X4MA 2VDQL 2FBJH 3MLTA 2BERA 2X9YA 2FGZA 3PNWA 1KB9K 1X4ZA 1MJUH 3MLSH 4ZFZA 4PJIB 3VXRD 3QRGL 4WI9A 5C07A 3C5ZC 3L6FB 4QRRE 1WAAE 5GISL 1FFPB 2V7HA 2BVQB 3QH3A 2OJEB 4OBSA 4PJGE 4QRTA 3IJYA 3EGSB 3KJ6L 3RWEA 4OAWA 3VFSB 3GSXA 3OSKA 2DWEB 5DJDA 2JELL 1CDCA 2G75B 3RPIB 4F7MB 5TE6L 1F4WL 3MGAA 3REWB 4L4JA 5K9OB 2PR4L 4PGZA 3LSOA 2YUVA 2AJUL 1A6TB 3IDJB 4WJ5A 5KVFH 3ZHDA 1U8PB 3N0PB 1UACL 5E03A 5IIEA 5DD3L 1IC7H 1CQYA 4LPTA 4PREB 5CLWA 4QTHA 5JLZA 1PG7L 3QUXA 4NO0D 4RX4A 4R97B 5E7BA 1NFDE 3SDCC 3L5JA 3VJ6B 5HHQB 3Q5YA 1YDPA 4NHUB 4NYLA 3IXTB 5DJ0A 3FAXA 4XB8A 4N8PA 1UB5A 4G42B 4GKOA 1N5YH 3EFFB 5JW4Q 1RULL 4IOFC 5DRNB 1V7ML 3V0AC 4Y8AA 5FO7B 2V2TA 3U7AA 4U1HA 2WBJB 1YJDC 3SKMA 1BX2B 3V6OE 4QRRD 5GHWH 1MRFH 5IMLA 4AMKL 3F5WB 4XHJC 5E2VL 4LAJH 3QULA 1U3HA 2CGRL 3LRHA 5C07B 2ICEA 3VFVA 3IU3A 5KVDL 4K23H 2ICWI 4GAJL 2B5IB 2GUOA 1VACB 3VDAA 3EZ8A 2V7HB 1E28A 3OBAA 5J7CC 1EPFA 3UTPE 1ZEAH 4ENEC 2HH0H 5HJ3B 4F9PC 3GSXB 3RI5K 5IB4A 2D7TL 3OWEA 2Q87A 4LSSH 5DJDB 1AC0A 6FABL 1JGEA 4X7SL 4NQVB 1AY1H 2WINA 3OB8A 4RGNC 4B5EA 2C1PA 4GG8B 3TT1L 2R2BA 1UEYA 1UC6A 4UT9H 4LGPB 3DPBA 1ZT1A 2YPLA 3U36A 1LDSA 4M9PA 1B4JH 2FZ3A 3MXVH 1QACA 1OGTA 1W0WA 5JLZB 3QUXB 1FLRL 3MRJA 3I50H 1MWAH 4WO4D 1I3RA 3VXMB 3G6JB 1PQZB 4OZGA 4EN3A 1YDPB 5FUCE 5CJBA 1RZ7L 2Q8BH 2ZSWB 4PLKD 1FPTL 4L4VE 5D1ZB 5HGGS 5F3HA 2EYTA 4JG1H 4M7KL 5ISZB 4RGMB 3ZYZA 1W0VA 4OFIA 4WGWB 1G6RA 4WDIB 5GJSH 5DJ6A 1NCAH 2WK2A 3IETA 3SKMB 1A7NH 4JHWH 5IMLB 1AKJD 4JGMA 4WI4A 5I18H 3D1MC 2GT9B 1CD9B 4MNQA 5E6IC 3QULB 1RUPH 3T2NH 1OTUC 3MLZL 2WQRA 3CVHL 4DAGH 3VI3E 3AS1A 2FHCA 3UTPD 1ES0A 3GKWH 2ICEB 3IU3B 1HDMB 2ENSA 5TQ2H 3DO7B 4JG0H 4KTDL 5AUMB 1SBBA 4FG6C 5CP3H 5ESVA 2IC2A 1C1EL 1TJIH 4HIJB 3TLRA 4PRHA 1AO7E 4HLJA 1QR1A 5FM4A 2RB8A 4N0FA 1S9WA 4P3CL 4LSQL 2QSTA 4HQQL 2WINB 1JHLL 4ZAKD 3ZSTA 2UUDH 2BOCA 3BGFC 4BSWA 3ROOA 1RIHH 4NC0B 2JJUA 4G8GA 1LGVA 3UTTE 3MREA 1ZT1B 4K3GA 3QUKA 4XVUD 4M8VA 3T4YA 5CILH 3IS0X 3GBML 5D1XD 1H3PH 3O3BB 1I9RL 2EDKA 2XWJA 3L5XH 2QSVA 3G5ZB 5GS2H 1S5HB 2HT4D 4NKMB 3VFGH 4PJ5B 3W0WD 4GLRI 4LSRH 4OZGB 4EN3B 5D2LA 5DQJA 5C8JA 4WW1B 3QO0B 5F3HB 2IGFL 3SDDD 2DS4A 1QYGH 4P4KA 4PJ8A 5CUSL 1FHGA 2X4SA 5CBAA 1V5JA 1FV1A 2V9TA 1G7PB 4LOUD 1CFSA 1QBML 4U0RB 4LEOA 5I1GL 1FYTB 4MNQB 5SWZD 4CL7A 1EAPA 5HBBA 1Y6NR 1NL0L 4IS6A 5E8DH 2QQKH 2E27H 5FXCH 4G6ML 3RY6C 3U1SL 4PJXA 3SE9H 3MLWH 3U7YL 1J1OL 1AO7D 1YQVL 5D70H 3U4EA 5I6XB 1XF2B 4JN1L 3IDYC 4XCYA 3VRLE 1MY7A 5I1IL 3GHBH 5E1AA 3MRFA 5T3XL 4NJ9L 1CIUA 3TO4A 5GGSY 1C7TA 1KBGL 5J13B 4YDLB 3KPOB 5D6CA 4ZFOA 3QNXA 4NO5A 4BSWB 5GIRA 4CBPA 3U4BH 3ROOB 3DIFA 4FQXD 5T1DL 1XGTA 1R24A 2FATL 5KW9L 4H0HB 1Q9WB 1J0HA 4ZO8A 5ANMA 3O2VL 5F6IC 4UILH 2HT2D 5IEHA 1DQJA 2YC1A 3UYRL 1OL0A 2XWJB 4PJDA 5FUOL 3VXUB 2Q3ZA 5E00A 4YGVA 2FSEB 1KN4H 2CIIB 5KBNC 4I3RL 3F12A 2MNUA 4ZOCA 1RUML 3RKDC 1M1SA 2AK4B 4OCWL 4JPWH 5H94A 4IJ3C 1KXQE 1UWEH 4PJ8B 1H3WM 5FKPB 5F7YC 3GSQB 1FV1B 2VN7A 1LE9A 1R5IA 1JHKH 3CSYA 4X9IA 4Z76A 4PTUB 1U91A 4RRPA 3WS3B 4G8FB 4DOHB 5J6HA 1KJ2L 4OCSH 2EE2A 2A83A 4OJFH 4PJCE 3NIGF 3CSBA 5CJQH 2VXVH 3VD3A 5IHUL 4UTBL 3B5HA 3WLWC 4BUHA 5KVGH 2VAJA 4YBLC 2QADC 5SX5K 1INDL 4LHJB 1BBJA 1KT2B 4POYA 4XCYB 4K8RC 5EZLA 4XPTH 5EO0B 5GSVB 3ZHLA 2VH5L 1T1XA 3MRFB 3TO4B 4RMVA 3KNBB 4AEEA 2PW2B 4YX2L 4OZ4A 4CW1B 5FYKE 2EKJA 5D7LE 5DUPL 4NO5B 4NRXA 2WUCL 5GIRB 3ULUE 2ZZUT 2W91A 3TC9A 2XKSA 1EEZB 1MFDH 3IFNL 1R24B 2Y07L 1LDPL 4HWNA 1MHPL 4UIMA 5FGBA 4HG4K 4X9BA 4LBEA 2Q8AH 4X9GA 2EKSA 5AWNL 3MGOA 3ZTJH 4OCYL 3MGTB 5E00B 1KPUB 2C4XA 1OAZL 4P4KC 4M5YL 1NBVL 3OKYA 2FX8H 2IAMA 1U8MA 1JF5A 3NABL 2BDNH 3MRMA 3JWOL 4OB5L 4Z7VB 4ODTH 3BKCH 4QCIA 3SGKC 1T04B 4LVHB 3HZYA 2IEPA 2IH3A 2GJZA 1VPOL 4RWYH 5DMYA 4M1DH 1TVDA 2BHYA 1G0YR 1JHTB 3ARZA 2R2HB 2DDQL 3T2PA 4Y5XA 2NQCA 3HG1D 1UZ6E 3QIWC 3ELAT 1VGKA 2UY6A 3PL6D 1NGQL 2XNAB 4BH8A 5D71L 5GS1B 4YR6B 5FYKD 1BBJB 4LEXH 2NY5H 5EZLB 1KEML 3ZZ1A 1MCHA 4M6ML 4OQTL 4R96A 3ULUD 2LV4A 3H2WA 5DDHA 3WHE1 1A7PL 3EUUA 4OZ4B 2YRLA 2XPGA 3FQRA 1A14L 3OR7A 1KIPA 2VZUA 4NRXB 2EIEA 3QAZB 4X98B 4RAUA 3BZ4B 5JHDB 4LKXA 4FABH 3ULVC 2XWTB 3WHXA 3AROA 4HAGA 5T1MA 3O3DB 3V5KA 4BJLA 4CJ1A 5LWYL 3LKSB 3MRGB 4KV5E 1XF3B 4LBEB 4TSAL 3PP3K 4OGZA 1IGJB 2EKSB 3MGOB 4QEGA 5EUOA 3WXVL 4HX1A 4C56B 4Z95L 5IW1A 5E9DB 3IF1B 5FECA 1U8MB 3C2SA 1VKXB 3G04B 2QSCL 2Z8VC 3FQXB 4H0GA 1U36A 4QCIB 4RGNE 1NGZA 2GJZB 5EIIA 3DVNA 2XZAL 5EU4A 12E8L 3UBXB 2DKUA 4XVTH 2C3VA 4RFNB 4N0UE 1TVBA 4Y5XB 4KRPB 4U1MB 4LHQB 2N7BA 3JTSA 1U8LA 3VD5A 3GBNL 4DW2H 3GSWA 3T0EA 4ZUUA 1VGKB 3OAUL 5JIIA 2XFXB 4YGAB 2ADJB 3O8XA 5F9OL 4IOFD 4WI8A 4XBEL 5I2IB 1CE6B 1GZPB 3FTGA 4XMPL 3D5OF 3L3IB 4R96B 5D2LF 1SY6H 3E2HC 5EA0H 5HDBF 3WD5L 1JZ4A 5DDHB 4BFIA 4M6AA 4JFZL 4XHJD 4HC1L 3IB4A 4KVCH 1A7RH 1IBGL 1J7VR 2Z91B 3OR7B 2X4OB 4IRJC 4NFCA 5DJYB 4MZ2A 4HGKC 4KZEL 4J12A 1M7DA 5I8KH 1NLBL 1KTKE 1NGWB 3QDJD 4HUWB 1S8DB 5JXAH 1CK0H 2OXHA 1MCPH 4LKXB 1Q9OB 4PIRF 5DURD 5HYJD 5L7XH 2WIMA 3WHXB 1BVZA 1ZLSH 3IFPB 3VGFA 3P4NA 1K2DA 3QCUL 4ENED 3QPQC 4K3DH 2AQ3A 1J1XH 4PJXF 3VFMA 5ACMA 1PYWA 5JQHC 1YA5A 1F97A 1Z3GH 1EK3A 3CFIC 5K9KA 4RGND 5IUSA 5MEOB 4KY1L 1XT5A 1XF4B 3TPUA 4EI5A 3STZA 3QA3B 3SDXE 4R2GB 4KDTA 5IGXL 1MNUH 1OWWA 1AGFA 4FQHA 3TNMA 3V79C 3O4LD 3EYOB 3W5NA 1E6JH 5IG7A 1IKFL 2DM7A 1OAYH 3L9RA 3GGWA 5D7JB 1NMCB 3JTSB 4G8IA 4JO4H 5ADOL 4YO0B 2XZCL 2HRPL 4ZUUB 1F02I 3T0EB 2OM5A 3BPLB 3PWLA 3FT4B 4PJDF 3MLXH 4GMSH 1MRDH 1WFUA 3SPVA 1JGLH 2D0GA 4U1SA 3T0WA 5K9JL 4HV8A 2NY0B 1YEKH 4XAWL 1OAUH 1WQVT 5EU5A 4TRPH 2XRAL 2E8YA 2D03L 5D72L 4LP4A 4BFIB 4AT6A 1CBVL 5E6ID 2WM0A 1OTUD 5JIKA 4YDIH 2DQJL 4K3HA 4ZQKA 1D5XA 3WFBH 1UYWL 3K81A 2FEEI 4LVNB 4LQFL 1QLEH 3PV7A 1J9CT 3P4NB 5JOFB 4Z7OF 4FFZL 2IG2H 1NGPH 4LCCA 5F7FA 3VFMB 1MCKA 4OLWL 1SVCP 3SJVA 4ZUTA 1QSVA 3UBXI 2J4WH 4P23C 3NCCB 4OLUH 1J1PH 3TPUB 1FGNL 3OZ9H 4KDWA 3MRKA 1CR9H 4MZ3A 4F58L 3O4OC 3F6LA 5EOTA 4DKDC 3Q2CA 3NGBB 4FQHB 3SKJL 3U9PL 2B20A 1PBYA 2X70A 1JMZA 3DTXB 1A7QL 3H9SE 4LF3A 3ZT7A 3VXRB 3H9HA 1QKZL 5D93B 3TVMD 1YMME 5EWIL 2Y6SC 1UWXK 5TPWL 1MIMH 3EDEA 4YHLL 1BZQK 4YWGL 1NFIB 4YQXL 1ZVYA 1MHEA 4D0CA 2DICA 3B2UC 1MCBA 2BC4A 4XP9L 3SPVB 2H3NA 4HJ0D 3QCTH 5EU5B 4S2SA 5DMKA 4D0BB 3H7LA 1YNLL 4HWBA 1I7TA 5E2TH 2OYPA 4AT6B 3KPLA 3NFSH 1HHGB 4W4OA 4QTIL 1LO3H 1XMWA 3LZFL 3P73A 1D5XB 2CMRH 1I1YB 2H2PC 3K3QA 4X4ZA 1QZ1A 3FQNA 3ILPA 2GQHA 2DQIL 3V0VB 3T0VA 3G08B 1X5FA 1A4JB 3RFZC 4YHIA 2QKIA 5FGCB 5C70A 4MB5A 4MA1C 4HPYH 3MYJA 4WI7A 4NO0B 1RMFH 5HTSA 4LCCB 4DVBA 4KQ3L 4KDTC 4F7EB 4ZUTB 4NUGL 3VMNA 3C8HA 4OF3A 1P4LA 1NKOA 3ARDA 5DJZA 5DZLA 1T7ZA 3MRKB 5FYJL 3U48A 2MQCA 3HR5A 3H9SD 3OJMB 1IGCH 2DTML 1HCFX 3RHWF 1AD9B 1BEYH 1VERA 4DN3L 4QRRB 3WFCH 4Z77A 4TNVF 2X70B 15C8L 3UPCA 1SJHA 4U05A 5DQ9B 5IVXA 4EVNB 3GSNA 2X05A 1KN2L 5CJ8A 1JZ8A 5HGDB 1FZKB 4QY8B 2XKNA 2E7BA 1KENH 2D7OA 4WFHE 3OMZA 3ARBC 3DJ9A 4D0CB 4KQ4H 5D6DA 5EUOF 3RKDD 5DK0B 3RL2A 2H3NB 1FBIH 3LRGA 4XXDA 3MBEC 3DMMC 2VDQH 1GZQB 5EU6E 2NY2C 3BVNB 1L7IL 1YEEL 1IQWL 4LLMA 1JNJA 5CHNB 5GISH 3QUZA 4K9EC 1OTSD 3FQNB 2W92A 1RZJL 2R1XA 3CFCL 4HK0B 1NC4A 4K2UL 2W0FB 3H8NA 5CGYC 2X4RB 1NFDB 2VDNL 3DROB 2VZSA 2VZTA 3OB0H 2BVYA 1X5IA 5BOPA 4K8RD 3GIVA 4JRWA 2JELH 5ACLA 1II4E 1FFNB 5TE6H 1F4WH 2ZUYA 2PR4H 1OD7A 4DVBB 5FYLE 1FJ1B 4WO4B 3W0WA 2AJUH 5L0QC 4GSDH 4AEHL 4FP8L 1UACH 4NPYA 1QUNA 1AGDA 5E4IA 4HKBA 2YD4A 3HR5B 3NIDF 4MB3A 5FK9A 5DD3H 3WKML 2EDTA 4P5KA 1CFVL 4JFQA 1HILA 3ARWA 3EDJA 5M94B 4Z77B 4TTGA 1AGEA 1YN6B 3ULVE 4PJDE 1YYML 5SWZA 3AAZA 4WFHD 1KG0B 1IZKA 5DHYB 2KBGA 3GJFH 2XKNB 2CR6A 2DM2A 3K8MA 4CDGC 1V7MH 4AIZA 1U8NA 5EB9A 1EVUA 4JCLA 4U6HA 4W4OC 4R3SA 1K9TA 1D6VH 4RMQA 4WUKL 3QO1A 2IQ9L 4XXDB 4AMKH 4P9HH 1S5IL 3WHE0 5E2VH 1HOCB 2CQVA 1NSNL 1E4XI 3QQ3B 4FFVC 3C9NB 4ODWB 4LLMB 2CGRH 4P2QD 4ZAKB 4Z7OE 4OFPA 4XNYL 3QHTC 3QIWD 3QUZB 1AD0B 4GAJH 3ZKQD 1BD2E 2BVOA 5J3HC 2CD0A 3NCYS 2R1XB 3K0WA 3BIKB 2WWMD 4LSVH 3MRHB 4IM8A 3GJEB 1PZ5A 3WLBB 1DR9A 3CFEA 2Q76B 2Z35B 2D7TH 4YK4C 5D1XB 1JTOA 6FABH 4XPAL 1U3ZA 4NUJB 3V5DA 4XWGL 3KPPA 4WHDA 3P4OB 5IV2B 2AJZA 4JZJA 1EFXA 5CZXD 3W0WB 3TT1H 1H15A 1U8OB 2NX5D 1Q72L 1UH2A 2BY2A 3KLSA 2AXFA 3PWNA 3R06B 1CQKA 1OW0A 3O6FC 3ULVD 4LMQI 4P5KB 2AJXL 3GMPA 4JFQB 2B4CC 5CKAA 4BFEA 3WL9B 4QO1A 3ZE1F 1AI1L 5SWZB 2F53E 5E7FA 4MD4A 3PHQB 2OL3L 3BZFA 1RZ7H 2HJKA 4J3VA 5KSBB 1FPTH 1RFDL 1MCSA 3STLB 4M7KH 1U2CA 1G7LA 4H25B 1U8NB 1AO7B 1G9MH 4CN6A 5GGRY 1MCNA 1WITA 3DURA 2P8LA 3RDTC 3QZWA 5GGVL 3MUY1 1BD2D 4ONOA 3MLZH 3CVHH 3P30L 4U1GB 4O2EB 1FNAA 1FSKC 1D7FA 4FQXB 5MEQA 5SV4A 4R7NB 4IMKC 3CFEB 2R1WB 2FJFA 1I7UA 2Y4SA 4N1HB 1XR9A 5ICZA 4HQQH 3ZSSA 2XA3A 3BHBB 1JHLH 4JDTL 5JNYB 4GKNA 4XX1E 4JZJB 3RWCB 3JTTA 4JPKH 4FXGA 3L3GB 4IRJD 1P4IH 5E4EB 1H15B 1MLBA 1A8JH 5I9QC 2DIBA 2CRYA 1IL1A 1XFPA 4L29B 1Q38A 1W72A 1QSEA 2HTLD 1ORSA 1AQDB 1ZE3C 2F53D 4Y8DC 2YRZA 3GBMH 5L2KD 3QUYA 3GSRA 1I9RH 5BQ7A 3QPQD 1TTFA 1FFOA 3DETC 4MD4B 3X3FH 2X9WA 1K8IA 1ZAGA 2IGFH 2AXJA 3CXHK 3EZJB 5CZVL 5CUSH 5C0DA 3MSPA 3WFEL 4Q7DA 4GBXC 1BVKA 3EOAA 2Z8RA 2P8LB 3DX6A 5I1GH 2MPAL 4N68A 1RURL 1OTTC 2V9QA 4PRPD 1NL0H 4MCZA 5C0EB 3LOWA 4G6MH 3V7AE 5KOMC 3U1SH 2CH8A 2G2RB 1QPPA 3U7YH 1J1OH 3VXPB 4GW1A 2FCBA 1BREA 5IFAL 4JN1H 1HH6A 2NTFB 5I1IH 4X6CF 5C0RL 4JPIA 5IVXF 4NJ9H 1N26A 4MCYB 4J3WA 1QQDA 1I7UB 5CEYB 1KBGH 1XR9B 1DE4A 1ZS8B 3NIDE 4MA7L 1P1ZA 1FAKT 4JQVC 4FXGB 1U93B 2C1OB 4P3DA 4HZLA 1MLBB 4OLVH 1MVUA 4NZJA 1IL1B 2OX5A 4I4WB 4LCUA 1YEHL 1NMAL 5HYSB 4PJCB 1GVIA 3QDGE 3QUYB 4JKMA 3GSRB 4AIOA 3UYRH 1X6LA 4PR5B 4G80B 5FUOH 4NSKB 3WN5A 1FFRA 3NPSC 4JAMA 4I3RH 3HG1B 4MD5A 2BNRE 3V5HA 4P23D 3PL6B 1FZOA 4EIGB 4LASL 4AH2B 4OCWH 2LFGA 5EBGA 5C0DB 2VZ3A 2A1WH 4KROC 3MRPB 2DQGH 2V2WA 4J3TA 4I77L 1CFTA 5GRJL 2AEQL 1HNGA 1KJ2H 3FO9B 5I1DB 1MFCL 1D6EB 1D5ZA 2VLKA 4UTBH 4H1LH 4IDJL 4KUCD 2W59A 1T7WA 1PDKA 2DAVA 4K55A 1MCOL 2I5YL 1INDH 2Y6SD 3E0GA 1HH6B 1XCTA 4GRLC 1JZ6A 1EO7A 2VH5H 4OFYD 3PG2A 4JPIB 1KTRL 3QDME 3QB7C 4L4TE 2GSGA 4QHLB 4YX2H 5HYEA 3BZDA 5DUPH 1P1ZB 2KPNA 2Q1EA 1YEDB 1KCKA 2HKHL 2XTJC 4P3DB 4CKVX 1F6AB 2R9HC 3IFNH 3QDGD 2Y07H 1LDPH 1MHPH 2H2PD 5I1KH 4LCUB 1PKQA 5MHSE 4Y4HC 4OUUB 3RNQB 2KQNA 3FKUS 1I9IL 5FIEA 3PDOB 1I7RA 2BNRD 4WFFE 4HIIB 5AWNH 3WN5B 2GEEA 1HSBB 1OAZH 1RIVL 3LEXA 5DD0H 1CTOA 3B9EA 2QV2A 2PO6A 3C60C 3BP4B 1FGVL 3NABH 1B9ZA 3V5HB 4E5XA 2EDNA 4WFGD 3JWOH 4OB5H 4JKKA 3SBWA 3EOTL 3UCRA 1IKNC 1RZGA 2FX9L 1VPOH 5F7UA 4AM0A 4PRIE 1WIPA 3UTOA 2J7LA 5CCKL 4OF8A 3D85D 2DDQH 3TPKA 4JZOA 3Q3GA 2VLKB 5EU3B 4U33A 4OQ1A 1GJIA 2CRMA 3QIUD 5I0ZA 1JZ5A 1NGQH 4XXCA 3BPCB 3QDJB 1LMKA 4Y89A 1Y18A 3QDMD 4L4TD 5DURB 5HYJB 4HLZH 5DD6A 2AJVL 2C4FU 1JPFA 1KEMH 3ARBD 3HMWL 3WE6A 4OQTH 5C0JA 3DI3B 1A7PH 1FNSL 3AREC 3MBED 3DMMD 1VFAA 1FIEA 3QEQD 5F7EL 4Q2ZB 2DWDB 4RGNB 3BDYL 5F8RC 2AEIT 1UVQB 32C2B 3I6KA 4WFFD 4O58L 5LWYH 4N0UB 2DBLL 4FFYL 1MJ8H 43CAA 1A0QL 2GITA 4TSAH 2B39A 3D0LA 2FWOA 3O4LB 5EZOL 2UZXB 1T66C 3WXVH 4ELKA 1KLGA 1FZJB 4P2CG 4Z95H 5IFJA 3LKRB 1F4AA 3MACL 4PRID 2QSCH 5B3JF 4XPFL 2EDEA 2X1QA 2JLLA 2XQYG 3MCLL 3RIFF 1RZGB 1NMBL 2X4NB 1LP9B 2F9BT 2XZAH 4LPYA 4AM0B 4B0MM 12E8H 4V1DE 3D2UD 3MLVH 3NA9L 1RJZB 5IVOA 1MFBL 2BSED 4X6CE 1QLFB 1AXSB 2WLZA 5E6IB 3UDWA 1JNHB 1ZT4B 3GBNH 4NKIL 3S35H 5CMAA 3HUJA 4GRWH 3OAUH 4MX7A 3FB6A 3PGDA 5E8PA 5C0CE 3LCYA 4UZGA 5F9OH 3MJ9A 5DD1H 1QBLL 5EFIB 5DD6B 4POZC 3LMJH 2OZ4A 4D3CL 4ZG1A 4HCRH 5E5UB 4XMPH 5B8CC 3WD5H 3OAYH 3QUMB 5C0AE 3RUGB 4EJ1C 3EJYD 3GSVB 1SEBA 1V05A 1CDYA 4JFZH 4HC1H 1QFUL 2D0HA 1IBGH 1T5WB 4Z0XA 1S9XA 3BKJL 3I6GA 2A6IA 3PWUA 4XCNB 2GTZB 2NY7L 1R3JA 3SDXB 4KZEH 2HFGL 1MFAL 1NLBH 3DXAE 3HKFA 3BGFB 4ODXB 4J3OC 5DHXB 4XHQA 3I6KB 2VN4A 3AM8C 3GDBA 3HZMA 3ZYOA 2APTA 5D2NC 43CAB 5I1EH 3AU1A 5CIPA 4OM1L 4J4PA 4NJAH 4R90L 3RIAF 4HUNB 3BE1L 2OJZL 1U0QA 4KY1H 3VMPA 1HWHB 4QXUH 4MHHI 3TVMB 4PY7A 1QBAA 3MYZA 4V1DD 4IIQA 5DQDL 4HG4J 1N2RA 3O6FD 3MOBL 2VRAA 2VUOA 4DKFH 3CMGA 2DD8L 2FD6L 3G6AA 4MJ6A 1YEJL 2EXWC 5C0CD 1IKFH 4KJYA 5AYUL 4QF1B 5MEPA 2WIIB 3W39A 1JPSL 4L8SA 3RJQB 3NACL 3TBTA 5ADOH 2CXGA 2HRPH 4YC2B 3HUJB 3FB6B 3PGDB 4HIEA 5C0AD 4GLRH 3M8OL 5ID1A 1U42A 1WJ3A 1T03H 5K9JH 5CSZA 5E08L 5JO5A 1FNHA 3WIFA 1NAMB 4XAWH 1IGYA 2VXTL 2H9GA 3DXAD 2L7UA 4HIHB 4XX1G 5D72H 1H3VA 1R3KA 1CBVH 2ZNWA 4QRPD 4JRXA 1B6UA 2BP3A 4C83B 3PWUB 1AGCA 4WWKD 5F89B 4HJJH 2R0KH 4LNRA 1UYWH 5I1LB 4S10A 4LQFH 3CU7A 4FA8A 5IESL 4M62H 8FABA 2Z9TA 3H9SB 5FDYA 5HVHC 3CH1A 4JZNA 5F6IB 3TCLA 2VIRA 3B5TA 4ZUSB 3SEPA 1FVDA 3T2QA 2Z92A 4MDIA 3O81A 2LAGB 4XT1C 5HVGB 2Z31A 3EO1A 4YDJB 2BVEA 1FGNH 4IIQB 1RZ8A 3N06B 2HWZH 5E94A 2GFBB 4NO2B 4F58H 2OQJB 1UM4H 3DLQR 3BQUA 3HCVA 3C87A 4S1SL 1N2RB 2B0SL 2D0FA 3S6CA 3SKJH 1SVZA 4MJ6B 2IPKA 4KI5C 3U9PH 3OAZH 4KJYB 1A7QH 5MEPB 1LWRA 3V7AG 4P2QA 3DETD 1QKZH 1U58B 4K94L 1C12A 2HVKA 5EWIH 1K4CA 2VXQL 1VFBB 1G6VK 1YC8A 2XV6B 4F37K 2SEBA 4HDIB 3HS0A 4YHLH 4YQXH 1A6AB 4UDTA 4DGYL 4XP9H 4YBLB 5JO5B 1I8KA 4GBXD 2C3WA 2FO4A 2H9GB 2XOTA 1YNLH 4ZUVB 4MQ7A 3VE0A 4YIQA 4QHNA 4OFDA 1OTTD 4TOYL 2YUWA 25C8L 2FGWH 4JJHA 4FFWC 1O7SA 2G60L 3OHXA 3U79A 5CJXA 5L2JB 4R4BA 1IGML 2XN9A 5TE7L 4MB4A 4XNQA 4XZUA 4LSDA 4L9LA 1ERNA 4X8XA 1EXUA 3HPLB 5F7HA 4KQ3H 1XZ0B 3TCLB 5IJVA 1HHKA 1FVDB 4NUGH 3OGCB 2HKFL 5D5MA 5DF0A 1J5OL 1YN7A 4DWHA 5AG9A 2N4IA 1KJ3H 3U7WL 4JFHE 3O2DA 4KGLA 3FQTA 2DTMH 7FABH 4L8SC 4JFOA 5JW4M 3M17A 2XTJE 4DN3H 2HP4A 2P5WD 2CO7B 3CVIL 4XMLH 2BRQA 1CT8B 3AS2A 15C8H 2NY6C 3OKKA 1KIQB 1FO0A 3LPWA 4YFDB 5ABDE 1PLGL 4P2QB 4AY0A 5SWSA 2HVKB 3CMOL 2CLVB 1K4CB 3A6CL 5H2BB 1U95A 2R69H 1TZHA 2D31A 5LQBL 5C9KA 4N5ED 2XT1B 3BGMA 3LPFA 2OR9H 4OCNC 1DCLA 3GMLB 4KROD 4NQXA 2D7MA 1YEEH 4D2NA 3BOVA 3MZTA 2CRZA 1T20A 3E1F1 4E42B 2A6KA 1MREH 5IP4A 5T3ZE 1MQ8A 3SGJA 3ZT5A 3EW3B 4MLIA 2NX5B 4R7DA 3MROB 3CFCH 4UU9B 1C16A 1GC1H 4NM8L 3F7YA 5EPMB 2VDNH 5F88A 3EFDH 4GRLD 1IT9L 1PG7X 5L2KA 4XB7A 2BVTA 4QYOA 3VD7A 2Z31C 1IGTA 4XZUB 4G9FD 2NXYC 4QLRA 4NFDA 4PYGA 4BKLA 4N8CL 4KI5F 2IANE 3BESR 3RWHA 3MRBA 1I1AA 3I3DA 4OZHB 1ZLUK 3T0XA 4Y4KA 1WZLA 3EO0A 1QSFE 3FRUB 3X12A 2NY1C 4MYWB 5BVPL 3MUJA 4FP8H 1LO4L 2XTJD 5KSVA 5I1HL 2R1YB 4KTYA 5EBWA 3MMEA 3BXNB 5FF6A 1JP5A 4XVJL 3NCFB 3WKMH 3FQTB 1OPGL 4X5WA 1EEYA 4H20L 1S78D 4GXUN 4GAGL 5C09E 4XBGA 2VDMH 4RBPH 4ISVA 1CWVA 1YYMH 2X41A 1BD2B 3ZYJA 1DUZA 2N56A 1WWBX 4PRPA 2FX7L 3T04D 4KMLB 1UM6L 4PJAA 4AIXA 1KULA 3C60D 2VDOH 5FYKL 4P2OA 1TZHB 3WS6A 3UX9B 1F3JB 3BMVA 3ULUL 4WUKH 2LU4A 1KF9B 4HT1H 5JUEL 1X4XA 2C3HA 3VRIA 4LGRB 1NSNH 2GSIA 4MA3A 4OIBA 4PB0L 3E2HB 3CFBB 1T20B 2A6KB 3ZO0A 1N6QL 4IRJB 1DEEA 1QSZA 2X4PB 4I9WD 4L9LC 3PXHA 1C16B 5F7MC 5I8CA 2IAND 3MJ6A 2JCCE 5C0FB 4LCIH 5F88B 1VDGA 2F53B 1RZFH 3DV4B 3WEXA 5L2KB 3UZVB 1QSFD 4XPAH 4V2CB 3IDNB 3S96A 5H35A 1RD6A 4OZIB 1JIBA 1YNTA 3ARED 4M4RA 3EO0B 4WUUD 1Q72H 2JKXA 2RGSA 4JO3L 1YMHA 5C09D 2JJVA 3FOLA 4DGVL 4WNQB 3QG6B 3PABB 2EIZA 1PKQE 4RCAA 1PW3A 4X5WB 3B6SA 1A21A 1SYVA 4PB9H 3HAEB 1SEQH 4XBGB 1IJ9A 1NH6A 2B1AL 4I0PA 2PW1A 3S4SB 4LRNL 3CSGA 5K59F 4Q0XL 4GMTL 4PRPB 5D2NE 1WSST 2WQ8A 5IBUB 1RFDH 4AJ0A 3ZDZF 2AJYL 3FHAA 4E41A 2VLRA 1WEJL 4MQXC 3LKNB 4PRNB 5FB8B 5HD8D 2A73B 1YNKL 1YJDL 3VW3H 1G0XA 3K8KA 2XZQH 3VRIB 2XACC 1DJSA 5DZNA 3T3MF 3J8F7 4H26B 5EG6C 1S9KC 3ESVF 3CC5B 3DRQA 3KPNA 4I2XA 1KTLB 4CADB 5HPMA 5LXGL 5I8CB 1I1AC 2O61B 1JI1A 3KLAA 5EZJA 1VFMA 3PE9A 3WEXB 4POZD 4KHXL 4LDLB 3V6ZA 3RWFA 2Q7YA 3BH8A 4I3GA 4LPXA 5H35B 1C5CH 5C71A 5I19H 4JDTH 1IE5A 4HF5L 3CLEL 5DJCB 3NVQA 5DO2C 4KFZC 2BSRB 4OIIL 5T1LD 4BH7A 3MUGA 1YMHB 4JFFA 3TN0D 4P23B 3ZKMD 4OF0A 3ZMRA 5EBMA 2JB6A 3LDBC 1K8DB 2EIZB 1H8OA 1L0XA 5FHAH 3CK0L 3O4OB 1G7MB 4TNWK 2R23B 1WZ1L 4NZDA 3QQ4A 4X6DF 2O5XL 4PY8J 4NQTA 3L3KA 3BRFA 4APQC 2CRIA 1FFQA 5DJ8A 1S7WA 4U1IB 3BUYB 3QIUA 2VJXA 3VD4A 3AUVA 3T1FA 4Z18A 1NAKL 2DMBA 4N5UA 3WFEH 1WCQA 4RQQA 1FORL 3RBSA 1CDGA 4M7LL 4N90E 2MPAH 3WIHL 1UM5L 5D5MF 4HPOL 1RURH 3PQYA 2EXWD 4XNMA 1AHWA 2X4UA 4JPVL 4Z7QF 5CP3A 5DUBB 5HHME 4EDWH 3NAAL 4I2XB 4DVRH 1A3QA 1KOAA 4KI5E 5GZNC 5IFAH 5EDXA 2F5BL 1RHHB 3L3HA 3QUML 3QXDA 3KLAB 5C0RH 1IAIM 5B4MC 2DIJA 2PTTB 4PRAA 3U9UA 3DHMA 4J2XA 2BNRB 3W9EA 4MA1B 4MA7H 5C6PB 4CJ0A 4NDMB 1F8TL 2QHRL 4L9DA 1GPOH 4DKEL 3S5LG 1ZGLP 2OI9B 2I27N 4ELMA 4JFFB 3BPNC 3FRPA 5LG1A 3VFNB 1YEHH 1NMAH 4WTWA 5DTFB 1DP0A 2AGJL 2ITDA 3QQ4B 5HI5C 2JJSC 3D85B 1RIUL 3BH9A 4S11A 1S7WB 1Z5LA 3P9LA 4U1NA 4BK5A 3QIUB 3GMOA 5EO9A 1JPGA 3T1FB 4LASH 4N90D 4NO3A 1JK8B 1J05A 3QDMB 4RFOL 2Y23A 4L4TB 3FB8B 1X5AA 3O6KH 4RQQB 3QZWG 4I77H 3KJ4C 2FH8A 4ZYKB 1H3GA 3QWRA 2AEQH 5HHMD 1VA9A 1XF5A 1MFCH 3DMMB 1MLCA 4KU1A 4PUBL 2X4UB 4IDJH 3QEQB 3IAQA 4LCWE 3CZJA 2Y06H 5IB2B 1T0NB 4M3JA 2K7PA 3C8KA 2I5YH 1P5UA 4TSCL 1NAML 2YA0A 4PRBA 2H8PB 4TUOA 4WHTA 4LLAA 3RWIA 4PJAF 4FZEL 3U9UB 3W9EB 3M45A 3HMXL 5D7SL 3K80A 1QNZL 3UPRA 3P4LA 2HKHH 1SMAA 2YWYA 1T4KA 3B2VL 1JZ2A 5FM5O 3EAKA 2EECA 2F58L 1KJVA 1R3IH 5L0QB 4PRIB 2OTUA 4FFWD 4Z6AT 5K59E 1QRNA 1ZT7B 1XGPA 3QR2A 1T2QH 5T1KA 1I9IH 3ZDZE 1BQSA 3ARPA 4F7PA 3V7MA 2ITDB 1KACB 2VERN 3D2UB 3L3OB 4NZRL 3BH9B 3KPRD 2P24A 2KDGA 4AL8L 1F5WA 4FNLL 3U0WL 4XNXL 1T1WB 1FGVH 1JGDB 4KAQL 1J05B 3EOTH 2FX9H 3UROR 2CDFA 4QGTA 3PJSA 4LCWD 4PJHF 3LKQA 5CGTA 5CCKH 3GUTB 3Q6FA 4KXZI 1XF5B 4PGCA 5HYIA 4FMKA 3E6FA 5BV7C 4ONGL 1OAKL 3P0VL 1I8MB 2KKQA 2X10A 4X6EA 4GW5A 4RAHA 1A47A 5A2JH 3QWOB 1NUFA 2AJVH 3HLAA 4K8RL 2CIKB 3NCMA 1WICA 3O9WC 1FNSH 3LKOA 3OXSA 3ROLA 4A6YA 1FCGA 1T5XA 5F7EH 3RRQA 3UPRB 1NJ9A 1T4KB 1LE5A 1MQKL 4X6DE 4V1DB 4O58H 2C4FT 3TWCL 3ME0A 4J8RB 2DBLH 4FFYH 3RZCA 1A5FH 1ZKAA 2HFEB 2AI0H 1LQSR 3REVA 3T4AA 4EXKA 5EZOH 3TH4T 2CUHA 5C0CB 2NXYD 1HYRC 1NFKA 3MRIA 4OGYL 2P24B 1F11B 1S7QA 3MACH 4FRWA 2IH1B 4NNYB 5D5ME 4XPFH 2Q6WB 2M8XA 5C08E 3SKOB 1Z0NA 5C0AB 1MHHB 1JMXA 1NMBH 3W11C 4JM2A 5D7KE 2VUYA 3PJSB 1FC1A 4HS3B 1IM9A 3S36L 1G7JA 3LKQB 3DXAB 1DTUA 5TF1L 3HZKB 1MFBH 4R9HA 4H8WH 5J9PB 4QRPB 1QP1A 2BCKB 1DL7L 4PGCB 2HG5A 1OSZB 3MO1B 1QRKA 1CICA 4ZDHA 4NKIH 4F57L 4HXBL 4Z78A 4WWKB 1KYOJ 3ARRA 5F1IB 1GOFA 5FV1L 1ZA3B 3QFJE 1N3NA 3SQOL 1QBLH 4X6EB 3NCBB 3SCMC 4D3CH 4QRUB 4P2RE 2B2XL 2DL2A 1HQRB 4WW2A 4DQOL 3SO3C 3KPMA 4ODSL 1UA6L 1TIUA 2FJGB 1M71A 4LARL 1F4HA 1QFUH 3OXSB 3ARYA 3BKJH 3FFCA 4YHOL 4A6YB 1T5XB 1MAKA 2HFGH 4I8DA 5AZ2L 5BS0E 5EO1B 5T3XD 5IHZA 4BZ2H 3DBXB 4GRMA 3ULVL 2VQTA 3VXOB 2A74A 5GGVY 2KZWA 5FOBA 3KPQA 3REVB 4HWZA 4X6FB 1CVRA 3MA7B 2P5WA 3IYLW 1BQHA 4R90H 4UV4L 4KK6C 3BE1H 2OJZH 1MCCA 5DK2B 5D7KD 5DEGB 4PV8B 1TJGL 4K7PY 3R1GL 3DRTB 2AW2A 2CR3A 3IFLL 1T89C 1TQCC 5CJOL 3WNLA 1GOHA 3F58H 2E9BA 1AP2B 5SWQA 2PTUA 4EDXB 2DD8H 3UTQB 2FD6H 5DUMH 5HHXL 1G7JB 4LLDB 5I66A 5AYUH 4ELMF 2HLAA 3QFJD 4P5TA 2HG5B 2VSCA 1CICB 2XWBA 3NACH 4CNIA 1FP5A 4P2RD 3BEWA 5EULV 1RJLB 4MAYC 1H5BC 3M8OH 4Y5VC 1BPVA 4MQXD 3A67H 5E08H 3MCG1 2GK0B 2VXTH 1QFOA 1X7QA 5ACZB 1FIGL 5BS0D 1M71B 5BRZD 4KRLB 3B43A 2ZOLB 2MCG1 3S5LB 3C5SB 3DUSA 3O3UN 4HBCL 5CINL 2YMXL 4P57B 2FYYA 1E4JA 2DF3A 3UYPA 4GRMB 2FJHA 2IALB 3KPSE 1MSPA 5CEXB 3MJ7A 3MV9D 3AXLB 3CNKA 3FO1B 4HWZB 4WV1A 2P5WB 3KWWA 2DBJA 2FHFA 2DMCA 4D8PB 1OAQL 2MOVA 4ZPVB 4PBXA 1UKTA 1J87A 1KCVL 1KB5L 1B0GB 2VITB 4JFEA 3B4NA 4PJHE 3AS0A 1BZ7A 4XPGL 1CI5A 1CF8L 1DDHA 4S1SH 1DSFH 1R3HA 1IGIH 4N9GA 3X3GL 4LU5L 3EOYG 4KROB 1WLHA 4EZMA 3BGAA 1MELA 1U8IB 4EBQL 2UYLA 4X5XA 4P5TB 5B38A 4AENA 4APQD 4K94H 2XWBB 1D9KD 5L88H 4NM4L 3L5WA 4PG9B 2VXQH 3BEWB 4O00A 4E41E 1T2XA 2IBZX 4JRYE 4P4RA 5GQBA 3RWJA 4YHYC 4GRLB 3HC0B 4M02A 3EHBC 1K5NB 1ODAA 2R2CA 4G9FB 1N59A 3KYOB 5GSRA 1J8HD 3TZVA 3BX7C 3KPSD 4Y2DD 3BN9C 4TUJA 5TDOB 1GHFH 3O11A 4KKBC 4U3CA 4Y4FC 5GGRB 2FYYB 2BNUB 2XTJB 2FJHB 5GZND 1WV7T 4JFDA 1BIIB 5TE7H 1U92B 2ITCA 4FQQA 4CVXA 1D3CA 1NCCL 3T0BA 4WV1B 3KWWB 3MNZA 4ODVH 5BXFA 4G8EA 2PXYA 4OSUH 1VESA 1MHCB 2CLZA 2HKFH 4XNZC 4Z0BL 3RA7H 4OCRH 1J5OH 2Q20A 3QJHA 3L7FA 1OGAA 4YHNA 1NLDL 3U7WH 3UTZA 2VTFA 3BP7A 5I8OL 5IF0B 1DN0B 3G9VA 4NCC2 1N8ZB 3HNTL 1EMTL 1AFVH 4KPHL 2GJ6D 4N9GB 3CVIH 4NQCA 2RFXA 2QR0B 5CP7A 1A6VL 6CGTA 1Y0LB 4ZO9A 5HI5D 1PLGH 5B38B 1R3LB 2LAAA 4JRYD 5F3BA 2PCPA 4LPWA 3CMOH 3D3VA 3PWVA 3A6CH 3L3DB 3BYTA 3CXDL 4E9LA 1DUYB 1EHAA 2A6DA 4WI3A 3BI9X 1HSAA 2IANB 2YWZA 1XIWA 3ARGA 2ZUQB 3GI8L 3RWJB 5ALCL 5ESQA 2DQUH 1CLOL 2VISA 3WFZA 2FLRT 5DYOA 1QSFB 4P49A 5GSRB 1DBAL 3VG9C 1XCQA 4TUJB 4G7VL 4J3UA 1UENA 3O11B 4JM2F 4WUUB 4Y16A 2DYPD 2P47B 5T1LA 4ZOAA 5DEFA 5C09B 4NM8H 2DJSA 2HJFA 4QRSA 4YXHL 1CLYH 4RA0C 4I18A 1HKLL 3MV7E 1CXLA 4FQQB 2XZZA 4D9QE 2CSPA 3DARA 4N8CH 1OT1A 3W82A 1H0DA 3RNKA 1R5WA 1FL6A 3MQIA 1L6ZA 3CCHB 1J0YA 3V4PL 5BVPH 5J12C 1ONQA 4WW2F 1LO4H 5I1HH 4Y1AA 4ELME 4XVJH 3TCXA