3JXCL

Crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence Recognition of DNA by Protein-Induced Conformational Transitions.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Transcription regulator
molecule keywords 5'-D(*CP*AP*TP*TP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*AP*AP*
total genus 21
structure length 66
sequence length 66
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3jxcL00
3PXPA 3JXBC 1POUA 2KPJA 3KZ3A 3G5GA 1NERA 3SCGA 2LCVA 1ZZCA 2FJRA 3OP9A 1RZSA 2LYRA 3QF3A 3KXAA 2D5VA 2AW6A 4PU7A 1LQCA 1ZZ6A 3KJXA 3BDNA 2PE5A 2CSFA 2EBYA 3F51A 4FN3A 4PU3C 1YSEA 1HF0A 2L49A 2PUBA 2CROA 3OQOA 4J1WA 1ZAYA 1WIZA 2BNNA 4X4GA 1RZRA 4X4EA 4I6RA 1Y7YA 4YG7B 2ICPA 2O38A 3FYMA 2PPXA 2GZUA 3OMTA 3VK0A 1LMB3 1QP0A 5K98B 1ADRA 3FYAA 4FBIA 4X4DA 2EWTA 1BDHA 2PUFA 4I6TA 3DNVB 2LYLA 1PRUA 2BNOA 1CJGA 2HSGA 3S8QA 3GN5A 4IWRA 1R63A 1VPWA 4I8TA 1ZPQA 2XSDC 4Y42A 1PNRA 3SCFA 4O8BA 1ZZ9A 1WETA 3TRBA 2JCGA 4I6UA 3G7DA 2KEKA 3U3WA 3B7HA 2LYPA 3QWGA 2XCJA 2PUGA 2MQKA 1S7EA 1WH8A 4YG1A 1LCDA 4X4BA 3LISA 2OFYA 1PRVA 3JXCL 3F52A 2A6CA 3UFDA 1LLIA 3LFPA 1DWKA 2LYKA 2EF8A 3QQ6A 2GRMA 1JWLA 1ZS4A 1QP4A 2LYJA 4PU4C 3F6WA 1RIOA 2PUAA 1SQ8A 1WH6A 1QQBA 1LCCA 1UXCA 1GT0C 1EFAA 4Z58A 2L8NA 1JFTA 2H8RA 2IVQA 3CLCA 2BNMA 3EUSA 2KEJA 1NEQA 1PRAA 2OR1L 3BS3A 3SCHA 1IC8A 1QPZA 3R1FA 2LYQA 1R69A 3FMYA 2BJCA 3JXDL 1JFSA 2IVGA 4X4IA 1ZZ8A 3D1NI 4YBAA 2GRLA 2AXZA 3BD1A 4F8DA 3L1PA 1JH9A 2WUSR 1BDIA 2XI8A 2XIUA 3GN5B 2JVLA 2HINA 4X4CA 2XJ3A 2O4AA 2AXUA 4X4HA 3MLFA 3ZHIA 3HZIB 1OSLA 4PU8A 1AU7A 4J1XA 4GHJA 1ZZ7A 2O49A 4JQDA 1QP7A 1XWRA 3OQMA 2AUWA 2KZ8A 3RZZA 1UTXA 1Y9QA 4OB4A 3ZHMA 1X2LA 2PUDA 2IU7A 3ZKCA 4IA8A 1ZVVA 1UXDA 4GQMA 4Z59A 2AWIA 4MCTA 4Z5CA 4X4FA 4Z5HA 3O9XA 1CQTA 2MEZA 4MCXA 1QQAA 4Z5DA 3IVPA 2IVBA 2R63A 1DW9A 2PUEA 3CECA 4IVZA 2IUOA 2R1JL 2KEIA 4JCXA 3GBFA 5A7LA 4YG4A 2ICTA 1X57A 3QYXA 1O4XA 1PERL 1B0NA 2PUCA 2B5AA 1E3OC 3OQNA 2PIJA 3H5TA 4YARA 1OCTC 1RZRD 1ZZBA 4JCYA 2LYSA 2WIUB 4NDWA 1L1MA 3CROL 1RPEL 2AXVA 1ZUGA 2IV1A
chains in the Genus database with same CATH superfamily
3JXBC 1POUA 2KPJA 1NERA 4DE9A 2FJRA 3KL4A 1HF0A 2CROA 3OQOA 1RZRA 4X4EA 1Y7YA 3FYMA 2EWTA 1PRUA 2J7UA 1VPWA 2XSDC 4Y42A 2XXAA 1PNRA 4ER7A 2JCGA 4I6UA 3G7DA 3B7HA 2MQKA 4YG1A 1WH8A 3UWPA 3LISA 1PRVA 2PXFA 2A6CA 3LFPA 1DWKA 5DTQA 3R09A 2LYJA 4PU4C 2M4HA 1RIOA 1QQBA 4Z58A 2L8NA 2JQEA 2H8RA 2MXDA 2PXLA 3GZDC 3SCHA 3R1FA 3NZLA 2BJCA 3JXDL 1JFSA 2IVGA 4X4IA 1ZZ8A 3D1NI 4F8DA 3TEPA 1BDIA 3L1PA 2PXPA 2XI8A 2O4AA 2AXUA 3HZIB 3ZHIA 4PU8A 1AU7A 1ZZ7A 1QP7A 3RZZA 3ZHMA 3ZKCA 1UXDA 2AWIA 4Z5CA 4X4FA 2XXQA 2MEZA 4EKIA 4Z5DA 2IVBA 5JUWA 3CECA 4IVZA 2KEIA 3QYXA 2ICTA 2YBDA 2PUCA 2LYSA 2WIUB 1L1MA 3NXHA 1WETA 3SX0A 2PXBA 3G5GA 3OP9A 3QF3A 3QFIA 2D5VA 4PU7A 3KJXA 4FN3A 1ZAYA 3QOWA 2BNNA 2O38A 2GZUA 2J7WA 3OMTA 3VK0A 4FBIA 1CJGA 3GN5A 1ZPQA 3DM5A 4O8BA 2LYPA 3QWGA 2XCJA 4ER3A 1LCDA 3JXCL 3UFDA 2XXPA 2EF8A 2GRMA 5DTMA 2HCSA 2PUAA 1SQ8A 1UXCA 1EFAA 1MFQC 3CLCA 3EUSA 2KEJA 1NEQA 1PRAA 3BS3A 5DTRA 1QPZA 3A9XA 3FMYA 4EQZA 5DSXA 2XIUA 3OKZA 2PXQA 1QB2A 4J1XA 2V3CC 2PXVA 4JQDA 2AUWA 1ZVVA 2LLWA 3G0TA 4GQMA 4MCTA 4MCXA 3IVPA 4EZIA 3GUUA 2R63A 2PUEA 2IUOA 3PE5A 4YG4A 1PERL 1B0NA 2L1PA 3OQNA 2PIJA 3H5TA 1ZZBA 4JCYA 3A9ZA 1RPEL 4GHJA 2AXVA 4ER5A 3PXPA 1QZXA 3KZ3A 3SCGA 3GZCA 2LCVA 1ZZCA 1RZSA 2LYRA 3KXAA 2AW6A 1LQCA 1ZZ6A 3BDNA 2CSFA 4EKGA 3F51A 4PU3C 2PUBA 2L49A 4J1WA 4Q2JA 4YG7B 3QOXA 5DRYA 1LMB3 5K98B 1ADRA 3OWQA 4X4DA 3ZPXA 2PUFA 3DNVB 2BNOA 2HSGA 4IWRA 1R63A 4I8TA 1ZZ9A 3TRBA 3U3WA 5DRTA 1S7EA 2OFYA 3F52A 1LLIA 1JWLA 1ZS4A 2FFHA 2HFZA 3F6WA 1LCCA 1GT0C 1HQ1A 3A9YA 3M9LA 4ER6A 1DULA 2IVQA 2BNMA 2HCNA 1IC8A 1R69A 3MEJA 4YBAA 2AXZA 2PXKA 2WUSR 2JVLA 4X4CA 3MLFA 3TFLA 2O49A 3OQMA 2KZ8A 4OB4A 1X2LA 4Z59A 3O9XA 1CQTA 1QQAA 2PXUA 2R1JL 1X57A 1O4XA 4WVLA 3GZDA 1RZRD 4NDWA 3CROL 1ZUGA 3NROA 2IV1A 4HRAA 3ME5A 3VWSA 2PE5A 2EBYA 1YSEA 2LNMA 1WIZA 4X4GA 4I6RA 2ICPA 2PPXA 1QP0A 3FYAA 1BDHA 4I6TA 2LYLA 3S8QA 5GAHi 3SCFA 2KEKA 2PXTA 2PUGA 4X4BA 2PXEA 4ER0A 2LYKA 3QQ6A 1QP4A 1WH6A 1NW3A 1JFTA 2OR1L 2LYQA 3LQXA 1JH9A 2GRLA 3BD1A 3NDBB 3GN5B 2HINA 2XJ3A 2LLVA 4EK9A 4X4HA 1OSLA 5DT2A 4OBMA 5GAGi 1XWRA 2ODRD 1UTXA 1Y9QA 2PUDA 2IU7A 4IA8A 2PXDA 4Z5HA 3TELA 1DW9A 4JCXA 3GBFA 5A7LA 2B5AA 1E3OC 4DE8A 4YARA 1OCTC 1U2ZA 2VEOA 3SR4A
chains in the Genus database with same CATH topology
3PXPA 3JXBC 1POUA 2KPJA 3KZ3A 3G5GA 1NERA 3SCGA 2LCVA 1ZZCA 2FJRA 3OP9A 1RZSA 2LYRA 3QF3A 3KXAA 2D5VA 2AW6A 4PU7A 1LQCA 1ZZ6A 3KJXA 3BDNA 2PE5A 2CSFA 2EBYA 3F51A 4FN3A 4PU3C 1YSEA 1HF0A 2L49A 2PUBA 2CROA 3OQOA 4J1WA 1ZAYA 1WIZA 2BNNA 4X4GA 1RZRA 4X4EA 4I6RA 1Y7YA 4YG7B 2ICPA 2O38A 3FYMA 2PPXA 2GZUA 3OMTA 3VK0A 1LMB3 1QP0A 5K98B 1ADRA 3FYAA 4FBIA 4X4DA 2EWTA 1BDHA 2PUFA 4I6TA 3DNVB 2LYLA 1PRUA 2BNOA 1CJGA 2HSGA 3S8QA 3GN5A 4IWRA 1R63A 1VPWA 4I8TA 1ZPQA 2XSDC 4Y42A 1PNRA 3SCFA 4O8BA 1ZZ9A 1WETA 3TRBA 2JCGA 4I6UA 3G7DA 2KEKA 3U3WA 3B7HA 2LYPA 3QWGA 2XCJA 2PUGA 2MQKA 1S7EA 1WH8A 4YG1A 1LCDA 4X4BA 3LISA 2OFYA 1PRVA 3JXCL 3F52A 2A6CA 3UFDA 1LLIA 3LFPA 1DWKA 2LYKA 2EF8A 3QQ6A 2GRMA 1JWLA 1ZS4A 1QP4A 2LYJA 4PU4C 3F6WA 1RIOA 2PUAA 1SQ8A 1WH6A 1QQBA 1LCCA 1UXCA 1GT0C 1EFAA 4Z58A 2L8NA 1JFTA 2H8RA 2IVQA 3CLCA 2BNMA 3EUSA 2KEJA 1NEQA 1PRAA 2OR1L 3BS3A 3SCHA 1IC8A 1QPZA 3R1FA 2LYQA 1R69A 3FMYA 2BJCA 3JXDL 1JFSA 2IVGA 4X4IA 1ZZ8A 3D1NI 4YBAA 2GRLA 2AXZA 3BD1A 4F8DA 3L1PA 1JH9A 2WUSR 1BDIA 2XI8A 2XIUA 3GN5B 2JVLA 2HINA 4X4CA 2XJ3A 2O4AA 2AXUA 4X4HA 3MLFA 3ZHIA 3HZIB 1OSLA 4PU8A 1AU7A 4J1XA 4GHJA 1ZZ7A 2O49A 4JQDA 1QP7A 1XWRA 3OQMA 2AUWA 2KZ8A 3RZZA 1UTXA 1Y9QA 4OB4A 3ZHMA 1X2LA 2PUDA 2IU7A 3ZKCA 4IA8A 1ZVVA 1UXDA 4GQMA 4Z59A 2AWIA 4MCTA 4Z5CA 4X4FA 4Z5HA 3O9XA 1CQTA 2MEZA 4MCXA 1QQAA 4Z5DA 3IVPA 2IVBA 2R63A 1DW9A 2PUEA 3CECA 4IVZA 2IUOA 2R1JL 2KEIA 4JCXA 3GBFA 5A7LA 4YG4A 2ICTA 1X57A 3QYXA 1O4XA 1PERL 1B0NA 2PUCA 2B5AA 1E3OC 3OQNA 2PIJA 3H5TA 4YARA 1OCTC 1RZRD 1ZZBA 4JCYA 2LYSA 2WIUB 4NDWA 1L1MA 3CROL 1RPEL 2AXVA 1ZUGA 2IV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXP A;  3JXB C;  1POU A;  2KPJ A;  3KZ3 A;  3G5G A;  1NER A;  3SCG A;  2LCV A;  1ZZC A;  2FJR A;  3OP9 A;  1RZS A;  2LYR A;  3QF3 A;  3KXA A;  2D5V A;  2AW6 A;  4PU7 A;  1LQC A;  1ZZ6 A;  3KJX A;  3BDN A;  2PE5 A;  2CSF A;  2EBY A;  3F51 A;  4FN3 A;  4PU3 C;  1YSE A;  1HF0 A;  2L49 A;  2PUB A;  2CRO A;  3OQO A;  4J1W A;  1ZAY A;  1WIZ A;  2BNN A;  4X4G A;  1RZR A;  4X4E A;  4I6R A;  1Y7Y A;  4YG7 B;  2ICP A;  2O38 A;  3FYM A;  2PPX A;  2GZU A;  3OMT A;  3VK0 A;  1LMB 3;  1QP0 A;  5K98 B;  1ADR A;  3FYA A;  4FBI A;  4X4D A;  2EWT A;  1BDH A;  2PUF A;  4I6T A;  3DNV B;  2LYL A;  1PRU A;  2BNO A;  1CJG A;  2HSG A;  3S8Q A;  3GN5 A;  4IWR A;  1R63 A;  1VPW A;  4I8T A;  1ZPQ A;  2XSD C;  4Y42 A;  1PNR A;  3SCF A;  4O8B A;  1ZZ9 A;  1WET A;  3TRB A;  2JCG A;  4I6U A;  3G7D A;  2KEK A;  3U3W A;  3B7H A;  2LYP A;  3QWG A;  2XCJ A;  2PUG A;  2MQK A;  1S7E A;  1WH8 A;  4YG1 A;  1LCD A;  4X4B A;  3LIS A;  2OFY A;  1PRV A;  3JXC L;  3F52 A;  2A6C A;  3UFD A;  1LLI A;  3LFP A;  1DWK A;  2LYK A;  2EF8 A;  3QQ6 A;  2GRM A;  1JWL A;  1ZS4 A;  1QP4 A;  2LYJ A;  4PU4 C;  3F6W A;  1RIO A;  2PUA A;  1SQ8 A;  1WH6 A;  1QQB A;  1LCC A;  1UXC A;  1GT0 C;  1EFA A;  4Z58 A;  2L8N A;  1JFT A;  2H8R A;  2IVQ A;  3CLC A;  2BNM A;  3EUS A;  2KEJ A;  1NEQ A;  1PRA A;  2OR1 L;  3BS3 A;  3SCH A;  1IC8 A;  1QPZ A;  3R1F A;  2LYQ A;  1R69 A;  3FMY A;  2BJC A;  3JXD L;  1JFS A;  2IVG A;  4X4I A;  1ZZ8 A;  3D1N I;  4YBA A;  2GRL A;  2AXZ A;  3BD1 A;  4F8D A;  3L1P A;  1JH9 A;  2WUS R;  1BDI A;  2XI8 A;  2XIU A;  3GN5 B;  2JVL A;  2HIN A;  4X4C A;  2XJ3 A;  2O4A A;  2AXU A;  4X4H A;  3MLF A;  3ZHI A;  3HZI B;  1OSL A;  4PU8 A;  1AU7 A;  4J1X A;  4GHJ A;  1ZZ7 A;  2O49 A;  4JQD A;  1QP7 A;  1XWR A;  3OQM A;  2AUW A;  2KZ8 A;  3RZZ A;  1UTX A;  1Y9Q A;  4OB4 A;  3ZHM A;  1X2L A;  2PUD A;  2IU7 A;  3ZKC A;  4IA8 A;  1ZVV A;  1UXD A;  4GQM A;  4Z59 A;  2AWI A;  4MCT A;  4Z5C A;  4X4F A;  4Z5H A;  3O9X A;  1CQT A;  2MEZ A;  4MCX A;  1QQA A;  4Z5D A;  3IVP A;  2IVB A;  2R63 A;  1DW9 A;  2PUE A;  3CEC A;  4IVZ A;  2IUO A;  2R1J L;  2KEI A;  4JCX A;  3GBF A;  5A7L A;  4YG4 A;  2ICT A;  1X57 A;  3QYX A;  1O4X A;  1PER L;  1B0N A;  2PUC A;  2B5A A;  1E3O C;  3OQN A;  2PIJ A;  3H5T A;  4YAR A;  1OCT C;  1RZR D;  1ZZB A;  4JCY A;  2LYS A;  2WIU B;  4NDW A;  1L1M A;  3CRO L;  1RPE L;  2AXV A;  1ZUG A;  2IV1 A; 
#chains in the Genus database with same CATH topology
 3JXB C;  1POU A;  2KPJ A;  1NER A;  4DE9 A;  2FJR A;  3KL4 A;  1HF0 A;  2CRO A;  3OQO A;  1RZR A;  4X4E A;  1Y7Y A;  3FYM A;  2EWT A;  1PRU A;  2J7U A;  1VPW A;  2XSD C;  4Y42 A;  2XXA A;  1PNR A;  4ER7 A;  2JCG A;  4I6U A;  3G7D A;  3B7H A;  2MQK A;  4YG1 A;  1WH8 A;  3UWP A;  3LIS A;  1PRV A;  2PXF A;  2A6C A;  3LFP A;  1DWK A;  5DTQ A;  3R09 A;  2LYJ A;  4PU4 C;  2M4H A;  1RIO A;  1QQB A;  4Z58 A;  2L8N A;  2JQE A;  2H8R A;  2MXD A;  2PXL A;  3GZD C;  3SCH A;  3R1F A;  3NZL A;  2BJC A;  3JXD L;  1JFS A;  2IVG A;  4X4I A;  1ZZ8 A;  3D1N I;  4F8D A;  3TEP A;  1BDI A;  3L1P A;  2PXP A;  2XI8 A;  2O4A A;  2AXU A;  3HZI B;  3ZHI A;  4PU8 A;  1AU7 A;  1ZZ7 A;  1QP7 A;  3RZZ A;  3ZHM A;  3ZKC A;  1UXD A;  2AWI A;  4Z5C A;  4X4F A;  2XXQ A;  2MEZ A;  4EKI A;  4Z5D A;  2IVB A;  5JUW A;  3CEC A;  4IVZ A;  2KEI A;  3QYX A;  2ICT A;  2YBD A;  2PUC A;  2LYS A;  2WIU B;  1L1M A;  3NXH A;  1WET A;  3SX0 A;  2PXB A;  3G5G A;  3OP9 A;  3QF3 A;  3QFI A;  2D5V A;  4PU7 A;  3KJX A;  4FN3 A;  1ZAY A;  3QOW A;  2BNN A;  2O38 A;  2GZU A;  2J7W A;  3OMT A;  3VK0 A;  4FBI A;  1CJG A;  3GN5 A;  1ZPQ A;  3DM5 A;  4O8B A;  2LYP A;  3QWG A;  2XCJ A;  4ER3 A;  1LCD A;  3JXC L;  3UFD A;  2XXP A;  2EF8 A;  2GRM A;  5DTM A;  2HCS A;  2PUA A;  1SQ8 A;  1UXC A;  1EFA A;  1MFQ C;  3CLC A;  3EUS A;  2KEJ A;  1NEQ A;  1PRA A;  3BS3 A;  5DTR A;  1QPZ A;  3A9X A;  3FMY A;  4EQZ A;  5DSX A;  2XIU A;  3OKZ A;  2PXQ A;  1QB2 A;  4J1X A;  2V3C C;  2PXV A;  4JQD A;  2AUW A;  1ZVV A;  2LLW A;  3G0T A;  4GQM A;  4MCT A;  4MCX A;  3IVP A;  4EZI A;  3GUU A;  2R63 A;  2PUE A;  2IUO A;  3PE5 A;  4YG4 A;  1PER L;  1B0N A;  2L1P A;  3OQN A;  2PIJ A;  3H5T A;  1ZZB A;  4JCY A;  3A9Z A;  1RPE L;  4GHJ A;  2AXV A;  4ER5 A;  3PXP A;  1QZX A;  3KZ3 A;  3SCG A;  3GZC A;  2LCV A;  1ZZC A;  1RZS A;  2LYR A;  3KXA A;  2AW6 A;  1LQC A;  1ZZ6 A;  3BDN A;  2CSF A;  4EKG A;  3F51 A;  4PU3 C;  2PUB A;  2L49 A;  4J1W A;  4Q2J A;  4YG7 B;  3QOX A;  5DRY A;  1LMB 3;  5K98 B;  1ADR A;  3OWQ A;  4X4D A;  3ZPX A;  2PUF A;  3DNV B;  2BNO A;  2HSG A;  4IWR A;  1R63 A;  4I8T A;  1ZZ9 A;  3TRB A;  3U3W A;  5DRT A;  1S7E A;  2OFY A;  3F52 A;  1LLI A;  1JWL A;  1ZS4 A;  2FFH A;  2HFZ A;  3F6W A;  1LCC A;  1GT0 C;  1HQ1 A;  3A9Y A;  3M9L A;  4ER6 A;  1DUL A;  2IVQ A;  2BNM A;  2HCN A;  1IC8 A;  1R69 A;  3MEJ A;  4YBA A;  2AXZ A;  2PXK A;  2WUS R;  2JVL A;  4X4C A;  3MLF A;  3TFL A;  2O49 A;  3OQM A;  2KZ8 A;  4OB4 A;  1X2L A;  4Z59 A;  3O9X A;  1CQT A;  1QQA A;  2PXU A;  2R1J L;  1X57 A;  1O4X A;  4WVL A;  3GZD A;  1RZR D;  4NDW A;  3CRO L;  1ZUG A;  3NRO A;  2IV1 A;  4HRA A;  3ME5 A;  3VWS A;  2PE5 A;  2EBY A;  1YSE A;  2LNM A;  1WIZ A;  4X4G A;  4I6R A;  2ICP A;  2PPX A;  1QP0 A;  3FYA A;  1BDH A;  4I6T A;  2LYL A;  3S8Q A;  5GAH i;  3SCF A;  2KEK A;  2PXT A;  2PUG A;  4X4B A;  2PXE A;  4ER0 A;  2LYK A;  3QQ6 A;  1QP4 A;  1WH6 A;  1NW3 A;  1JFT A;  2OR1 L;  2LYQ A;  3LQX A;  1JH9 A;  2GRL A;  3BD1 A;  3NDB B;  3GN5 B;  2HIN A;  2XJ3 A;  2LLV A;  4EK9 A;  4X4H A;  1OSL A;  5DT2 A;  4OBM A;  5GAG i;  1XWR A;  2ODR D;  1UTX A;  1Y9Q A;  2PUD A;  2IU7 A;  4IA8 A;  2PXD A;  4Z5H A;  3TEL A;  1DW9 A;  4JCX A;  3GBF A;  5A7L A;  2B5A A;  1E3O C;  4DE8 A;  4YAR A;  1OCT C;  1U2Z A;  2VEO A;  3SR4 A; 
#chains in the Genus database with same CATH homology
 3PXP A;  3JXB C;  1POU A;  2KPJ A;  3KZ3 A;  3G5G A;  1NER A;  3SCG A;  2LCV A;  1ZZC A;  2FJR A;  3OP9 A;  1RZS A;  2LYR A;  3QF3 A;  3KXA A;  2D5V A;  2AW6 A;  4PU7 A;  1LQC A;  1ZZ6 A;  3KJX A;  3BDN A;  2PE5 A;  2CSF A;  2EBY A;  3F51 A;  4FN3 A;  4PU3 C;  1YSE A;  1HF0 A;  2L49 A;  2PUB A;  2CRO A;  3OQO A;  4J1W A;  1ZAY A;  1WIZ A;  2BNN A;  4X4G A;  1RZR A;  4X4E A;  4I6R A;  1Y7Y A;  4YG7 B;  2ICP A;  2O38 A;  3FYM A;  2PPX A;  2GZU A;  3OMT A;  3VK0 A;  1LMB 3;  1QP0 A;  5K98 B;  1ADR A;  3FYA A;  4FBI A;  4X4D A;  2EWT A;  1BDH A;  2PUF A;  4I6T A;  3DNV B;  2LYL A;  1PRU A;  2BNO A;  1CJG A;  2HSG A;  3S8Q A;  3GN5 A;  4IWR A;  1R63 A;  1VPW A;  4I8T A;  1ZPQ A;  2XSD C;  4Y42 A;  1PNR A;  3SCF A;  4O8B A;  1ZZ9 A;  1WET A;  3TRB A;  2JCG A;  4I6U A;  3G7D A;  2KEK A;  3U3W A;  3B7H A;  2LYP A;  3QWG A;  2XCJ A;  2PUG A;  2MQK A;  1S7E A;  1WH8 A;  4YG1 A;  1LCD A;  4X4B A;  3LIS A;  2OFY A;  1PRV A;  3JXC L;  3F52 A;  2A6C A;  3UFD A;  1LLI A;  3LFP A;  1DWK A;  2LYK A;  2EF8 A;  3QQ6 A;  2GRM A;  1JWL A;  1ZS4 A;  1QP4 A;  2LYJ A;  4PU4 C;  3F6W A;  1RIO A;  2PUA A;  1SQ8 A;  1WH6 A;  1QQB A;  1LCC A;  1UXC A;  1GT0 C;  1EFA A;  4Z58 A;  2L8N A;  1JFT A;  2H8R A;  2IVQ A;  3CLC A;  2BNM A;  3EUS A;  2KEJ A;  1NEQ A;  1PRA A;  2OR1 L;  3BS3 A;  3SCH A;  1IC8 A;  1QPZ A;  3R1F A;  2LYQ A;  1R69 A;  3FMY A;  2BJC A;  3JXD L;  1JFS A;  2IVG A;  4X4I A;  1ZZ8 A;  3D1N I;  4YBA A;  2GRL A;  2AXZ A;  3BD1 A;  4F8D A;  3L1P A;  1JH9 A;  2WUS R;  1BDI A;  2XI8 A;  2XIU A;  3GN5 B;  2JVL A;  2HIN A;  4X4C A;  2XJ3 A;  2O4A A;  2AXU A;  4X4H A;  3MLF A;  3ZHI A;  3HZI B;  1OSL A;  4PU8 A;  1AU7 A;  4J1X A;  4GHJ A;  1ZZ7 A;  2O49 A;  4JQD A;  1QP7 A;  1XWR A;  3OQM A;  2AUW A;  2KZ8 A;  3RZZ A;  1UTX A;  1Y9Q A;  4OB4 A;  3ZHM A;  1X2L A;  2PUD A;  2IU7 A;  3ZKC A;  4IA8 A;  1ZVV A;  1UXD A;  4GQM A;  4Z59 A;  2AWI A;  4MCT A;  4Z5C A;  4X4F A;  4Z5H A;  3O9X A;  1CQT A;  2MEZ A;  4MCX A;  1QQA A;  4Z5D A;  3IVP A;  2IVB A;  2R63 A;  1DW9 A;  2PUE A;  3CEC A;  4IVZ A;  2IUO A;  2R1J L;  2KEI A;  4JCX A;  3GBF A;  5A7L A;  4YG4 A;  2ICT A;  1X57 A;  3QYX A;  1O4X A;  1PER L;  1B0N A;  2PUC A;  2B5A A;  1E3O C;  3OQN A;  2PIJ A;  3H5T A;  4YAR A;  1OCT C;  1RZR D;  1ZZB A;  4JCY A;  2LYS A;  2WIU B;  4NDW A;  1L1M A;  3CRO L;  1RPE L;  2AXV A;  1ZUG A;  2IV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...