3JXOA

Crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
NLYFQGMIPLEQGIEFLSVNVEEDSPVVGKKLKDLPLPRDSIIAAIVRGGVLVVPRGDTEILSGDKLYVIVSAEAKETVEETLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of an Octomeric Two-Subunit TrkA K+ Channel Ring Gating Assembly, TM1088A:TM1088B, from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Transport protein
molecule keywords TrkA-N domain protein
total genus 18
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 3jxoA00
4YS2A 1VCTA 2AEMA 3L4BC 4J9UE 2OGUA 4GVLA 4L73A 4G65A 2FY8A 4L74A 2BKOA 2BKPA 4EI2A 2AEJA 4RO0A 3RBXA 4J91A 4J9VA 4J90A 3JXOA 3KXDA 4XTTA 2AEFA 3RBZA 4J7CA 1LNQA 4L75A 2BKNA 4L76A
chains in the Genus database with same CATH superfamily
3ZZTA 1FRJA 4QWCA 2KFNA 5C25B 3U1MA 1H2VZ 1MMLA 4ATNA 2NS1B 2G0JA 5LMNJ 3NY0A 4UOCA 1QAIA 1NK7A 1V3SA 3AT1B 3BYRA 2JEIA 2O3DA 1XR7A 1C0TA 3LGHA 3H4DA 3PIOQ 4P72A 4DZDA 3MR2A 2B0GA 4DCOB 3TA1A 2OPSA 4OYBA 2JHEA 3POTB 1IKWB 1VLOA 2HGMA 4YEAA 4KH1B 2GNKA 4O44B 5E3QA 3CC2S 4B3RF 2MSTA 4DSIA 1OQ3A 1WACA 3NGKA 3PNIA 1VISA 2J0WA 1HBNA 2LEAA 4RW6A 5IM0A 1MNEA 4JI0J 4ZJLA 3R27A 3VAGA 4W90B 4IOBA 4F3OA 4NOHA 2GVDA 2H5IB 3SBMA 3CDWA 2YH0A 2R2TA 1CQNA 4ZHRA 4RJVA 3PW5A 2NPIA 4I56A 5IT4A 2RUSA 3X3UA 3WIVA 3DRSB 4LF8J 4DF8A 4C7QA 5BYSA 4JI5J 2GIRA 3WIUA 1S49A 4F8RA 1RT3A 5E7OB 4WKYA 4UT4A 1U1OA 3CE8A 2OGUA 3RG6A 3GFHA 2EKYA 4DG1A 5DQHA 3R8YA 3N6NA 3HHEA 2PMZD 1HBMA 3W9HA 1SH2A 3FUYA 3GIRA 3KK1A 1UVMA 2R42A 2GGPB 4PWUA 4CO0A 1ROFA 8AT1B 1FXLA 2ZZTA 2XI3A 3T6BA 4B9TA 3QGIA 1F9EB 2EFGA 1PG5B 2QZ8A 1ZM9A 2JVRA 4W92B 4HLBA 4EU0A 1IBKJ 1TAQA 1UWAA 2DJWA 1TFYA 2Y0BB 2BE7D 3OL7A 2J0SD 4NLGA 4PXEA 5AT1B 2RDJA 1V5VA 4Y00A 4K0KJ 2HYIB 1R6VA 2MQ8A 2RF2A 4RWWA 5KT3A 1DTTA 2HLTA 1Q0NA 1H2TZ 2M0GB 1N33F 2R9LA 1ZM4A 3MPDA 2XY6A 4X62J 4EK2A 3FKBA 2KXFA 3ICLA 5A2QY 4KFBA 4ED5A 2X1BA 3KJFB 3RAXA 3CD0A 2KYXA 2ZH9A 3TOQA 2ZITA 4AL5A 1JLQA 2BZ2A 3MPWA 3EGZA 5LMUF 1VK8A 2MMYA 2W7AA 1GX6A 2K2PA 2ILZA 1KEKA 4URSA 2Q1LA 1F2HA 3E01A 1IR1A 2QMUB 1NB7A 5AXLA 4LJMA 4TU8A 4DZ6A 3EMTA 3H4BA 2JRSA 5IS2A 2BXJA 3CNQP 1GEHA 4L3NA 4AXJA 5CZXA 4KV8B 2IRYA 1RTDB 4X65J 2W4CA 4FVMA 4TN2A 2I9SA 5JUMA 1R8CA 4TU9A 5CD4H 4HDGA 2ZBIA 2FHKA 5D0HA 1VS3A 3MOJB 1SJRA 4LVNP 4LR7A 2FUG9 1WC1A 1T9WA 3VR1A 4PG5A 1NJWA 2OI2A 3W64A 5E41A 3IAM9 3BGRA 4ZN1A 3N0VA 2MKJA 1NZAA 2ZFHA 1FJCA 3GE9A 2XSJB 1XK8A 2IIHA 4FXVA 3Q8SB 3NCQA 2OFGX 3QZ7A 4LSLA 4UOHA 3IS9B 3PM9A 1WEZA 2DH9A 1WHVA 2DD8S 2MY8A 2D74B 3ZTOA 2W4DA 2Z2MA 2DHGA 1K8AT 2EBGA 2V8HA 5I3UB 1HA1A 3NGTA 1EQ0A 1QAXA 2BANA 2RRNA 3TX0A 4F67A 3MURP 1JLAB 1UVNA 2M8HA 2GMJA 4M5DB 1M1GA 3QGGA 4PG6A 2B43A 5A0YB 3V6HA 2UXCF 1TK8A 2B5JA 3OL8A 3R7BB 3OXGA 1QSYA 2R7XA 2YWWA 2ZWOA 4AE5A 3I56S 2CDRB 1CVJA 3B6BA 4C8YA 2UU9J 1FVSA 2RDDA 3TQEA 4N5SA 2HZAA 4DS4A 5EX0A 1FVQA 2BKOA 2MPUA 1JLGA 4B3MF 2WBMA 5EWFA 1FJGF 4QU6A 2AYEA 4ILMA 1WKLA 2G0CA 1RWVB 2QL9B 1ZAVA 2Z30B 3RB6A 3KG4A 3S8SA 1Q5YA 5HVGA 1VC0A 1AUDA 2X3GA 1G4CA 3G6ES 2Y1JA 2LQJA 1RTDA 4LBIA 3O44A 3DGVA 3N01A 3CC7S 3IP0A 4F0MA 4B9VA 3K0JA 4DUZJ 3GR1A 3QQCD 2ZUGA 3HPOA 3LP2A 4ALZA 2F40A 3GFXA 2NLWA 4I2PB 4IOCQ 3MUVP 4R25A 2NPFA 4F36A 5HMWA 4CTAB 2OP5A 2BANB 4TY8B 3QPIA 1N5TA 2IJFA 4JI3F 1RWPB 4EWTA 2KXHA 3KLGA 4PQAA 2QLJB 5D0RA 3TJAA 5IWAJ 1I5OB 2HPUA 3W5ZA 3K59A 4TY9A 2X51A 3MECB 1S1TA 3DOKB 5GMEA 3SCKE 1F6TA 2P9CA 4DWIA 1SCJB 4DV1J 3MM8B 4ELVA 4LSLB 4FBTA 1IJEB 3D3CJ 1RBLA 1J5OB 1YJTA 2IRXA 3TUZC 4JI1J 3C15A 1WC5A 5A76A 1FJ7A 2AYMA 3UPFA 4WKRA 4WK1A 3UN2A 5DM7Q 5LL6d 3ZZ0A 2BKNA 3IRWP 3CJRA 3RBDA 1FDBA 3V6JA 3IBWA 4EYIB 2ASDA 4JYAF 3BGFA 4QPTA 4OX7A 2EFVA 1RHRB 4IO9Q 3T5KA 2FVSA 5DRKA 4HTIA 1U8SA 1H2UX 2N4DA 3EZOA 2J8AA 3SXLA 2N82B 3W9IA 1FKPA 5IC4B 1B4SA 4YB5A 2VG6A 1EKRA 3B4MA 2CJXB 2G13A 1OSDA 2K1RB 1RHMB 5KOWA 2GIFA 4RNHA 5J1NA 3M8SA 2P5VA 1YG0A 1XC9A 4WFZA 3UDCA 4YR2A 4J9RA 3SZ2A 2HHTA 3D3BJ 1MU2B 5KFCA 1UWBB 1RWKB 1Z2ZA 2PDAA 3A13A 5H1SV 3KLFA 3R6LB 1XR6A 2EFQA 2J8SA 4ZJOA 1AROP 2JJ4D 2CQ4A 3AOBA 5HVFA 3GV7B 1EP4B 1SBRA 2A1BA 1B0TA 1U2CA 2HLUA 4YDXA 4F4AA 4KE5A 2EFPA 4D3GA 2FZCB 1B0PA 4J9PA 2L9WA 3D1OA 4U7UD 2KHCA 4X4NA 1KDNA 3BQ1A 3OL9A 4BWJA 1N5QA 1G3OA 3KUGA 2EFOA 3CJKA 3BO3A 4P74A 2VPXB 3UE2A 3OFFA 2I5JA 1RABB 4OJ3A 3TR5A 4CNYA 2FLLA 3CMES 1TFWA 3IBFB 1NCLA 3FBEA 4QYRA 1BQNB 3ENVA 1IXKA 4NCAA 1S1WA 4CLSA 3CJQA 2HS4A 4FNHA 4USKA 3MUMP 3KDNA 1N88A 4PWWA 3QZ8A 3KLHB 1WC6A 4DR5F 3D0HE 1VHFA 4ICLA 2VG6B 2H3EB 2A3JA 2M88A 4F04B 1EQMA 2CPJA 3T5HA 2DGUA 3T1AA 2HHXA 1TKZB 2EXUA 3HFVA 7FDRA 2IBOA 5HMZA 1ULRA 2HRTA 4DV3F 1S4EA 5EWEA 1N52B 1UJ4A 2FJAB 1U4BA 2OTLS 4TYAA 4XIUA 2LA6A 4EGLA 4Q7AA 5KT5A 2V4JA 5DDQC 1YBUA 4C97A 3OR1A 1VOMA 2EG1A 1PAEX 2LQ5A 1WF1A 3JYTA 4DR7F 3FRZA 1F5AA 2Y0SD 2HSEB 3N5BA 3E8OA 1N56A 4KO0A 2F7VA 3NLCA 2O1PA 1HNIA 2RUGA 3BSCA 4KHRA 3MF5A 4DJBA 5L1LA 2Q66A 1ELOA 4I64A 2FJBB 3GYNA 4M5HA 2O66A 4A8YA 2R2RA 1X0PA 4HKQA 5DGBA 3RTVA 5F41A 2VF3A 1LOUA 4O4RA 1TL5A 2R4FA 2Z57B 4USIA 4RU2A 1RAJA 4OX6A 2VZ9A 4YB1P 3PV8A 3NNHA 3DC2A 4DN9A 4J9NA 1VJWA 4LUBA 2FC9A 4WP8A 1VQ8S 1RP5A 1Q8IA 1FXDA 2COLA 2W24A 3M7VA 5L9NA 1GMVA 4IR1A 1IBMJ 1OSCA 4XDCA 4JI5F 2XS5A 2QLXA 2ZNZA 2RQCA 2W2QP 3D68A 4YS2A 4I2PA 2HKEA 1U47A 3DLKA 4ZN3A 4OHWA 1HBNB 1TMJA 1RQ0A 2NXCA 4G1QB 3HDSA 1HR0F 4DSLA 2L08A 1ACMB 1JLGB 2HQIA 2WVFA 3FSYA 5GAGU 4U6PA 4QWEA 1F3FA 3MM9B 4G65A 1E6VB 1U09A 2JC1A 1U49A 2DNRA 2VG7A 5F3TA 4V1Ak 2CQBA 2CPDA 4CM0A 3M2VB 2RS2A 1DJ0A 2RB7A 4IDKB 4RW9B 4EEYA 1SV5A 1J5EF 1K73T 2IPOB 4DPTA 4KTQA 1S6QB 1X5SA 3GMGA 5T7LB 1FXRA 2XMTA 1KBRA 1ZOTA 2V6AA 1WELA 2BVZA 2C3UA 2MSSA 1F3VA 1JLEB 1U25A 2GC8A 4WBFA 5FD1A 6FDRA 2XZWA 2PMWA 1VQMS 3DOMA 2CPHA 1X7VA 3MECA 3PR4A 4JI1F 5A2QU 3M6UA 2CG4A 2QSWA 4BS2A 5C2CA 1REVB 2W2PP 2CPIA 1HBUB 1J2VA 1WI8A 4IFVA 1DZ5A 1ZPVA 4URQU 4OI6A 3J7ZT 2HZVA 2DRAA 2UXDF 1M1HA 3CJ3A 3IMQJ 4BHQA 4P2XA 3NGSA 1X4HA 2J7KA 4JI3J 4ZLJA 3R7SB 3DM2A 2IM2A 1JWWA 3PEJA 4RW4B 1JK9B 1CJUB 4PXDA 3HZGA 3VVTA 1KVKA 2UV8G 1QSLA 2F5GA 3CC4S 5D3GA 2YX1A 2DYAA 4LT6A 2GQQA 3K7RA 4DV4F 1R6YA 1VQOS 3VAMA 4M94A 2AYGA 3TZXA 1NU4A 1CC8A 3QIPA 3KWMA 2XHWA 3LP0A 3DCAA 3PDNA 4R0JA 4BCAA 2DR5A 1B99A 1XWLA 4RWXA 4NLRA 3LAMA 1O6XA 2V8DA 2E7XA 2WSCC 1C0UA 3CO0P 4OV6A 1QD1A 1ZM3A 2AMCB 3UNGC 4ZITA 2CNLB 1C1CB 3MM7A 3TUPA 2C1EB 3GSDA 4ER8A 4FYVB 4DSJA 2HAIA 1K9MT 2HURA 4BC9A 3R9LA 2UVRA 3HULA 3G82A 4HT7A 4BBYA 1VIXA 1R89A 4WFXA 1LV5A 2DRBA 2VDHA 2OAUA 4OYPA 2VU5A 2WONB 5CQGA 1YSJA 3N9UC 5AXNA 4MKAA 2HMIA 1WG1A 1NH8A 3AOCA 2H4WB 3DRPB 4PG4A 2UUAF 3UNYA 5KT4A 2AEFA 5KFWA 4KRWA 4OI0A 4FZVA 1HWKA 3FSXA 4J7CA 4O3SA 2DO4A 5IFMA 1A6LA 2KTQA 1UL3A 1AA1B 1S99A 2FVQA 1CLFA 1DQ9A 1FWPA 5C5JA 4RW4A 4PEOA 3CJ5A 4KSEB 3W62A 5KFNA 1WOPA 1CQMA 3UN5A 2J6SA 1FRLA 4MIBA 4A8SA 3QT6A 5LSOA 2VL1A 4KGVB 2C3OA 4GVBA 2ZD1A 4DR3J 4UY8T 2X1FA 4X2BA 1EETA 4URGA 2FY8A 1T9YA 2HFUA 4N56A 1DLOB 2YX4A 3GG1A 4PQUB 3MMCA 1F1BB 1JLFA 1X5OA 4A4JA 2HVIA 2CQCA 2J9CA 2UVWA 2ASLA 1F60B 2CQ1A 3R5AA 4NXMJ 3DKDA 3P49B 1BD6A 2ZDOA 2XSJA 1LWCA 5KFDA 4CRJA 4ETZA 4X4OA 4J37A 1T3NA 3HSZA 3A8KA 5HAOA 4LF5F 1HI1A 3OFGA 1RISA 2MLZA 2DCLA 5CYMB 1HW8A 1ZH5A 5KFEA 1MN9A 1KOOA 2FDNA 2GVZA 3CMQA 4I68A 4RW9A 5K8MA 3KLFB 3NMRA 4DL7A 4C9DA 5D3GB 4NMXA 3GIIA 1FRXA 2ZJQQ 4OZ5A 2MY7A 4NXMF 1FX2A 5EHHA 4ZDNA 1E6YB 3HX9A 5IT0A 5KFQA 3P6YC 1PJ7A 1HLWA 2PA3A 4TLQA 1U6FA 3UD5A 2QE5A 2EVZA 3NS6A 2YQ0A 1N5SA 2ZBRA 3VHQA 4C2MA 4NWBA 2KI2A 4LQ9A 2HVHA 4F25A 4H4MA 4WP3A 2LEPA 1N5VA 3W2WB 4F4XA 3ET6A 3CF5Q 3B4DA 3SEOA 2BE2B 1ZBTA 3DLKB 3GZ7A 3WQPA 4A8XA 3W8PA 2RF2B 3OSPA 3D6FB 3LTOA 1Y5NB 4I7FB 3HI9A 3KLVA 2QEXS 1TV6A 2NCKL 3BQ0A 3DLLQ 1I3OB 1FD8A 2AJ1A 3QT5A 4WJBA 4R5PB 1N33J 3ZTPA 3Q8UA 1L5UA 3NBPA 2DNYA 2HFSA 2GZOA 1SQEA 1RAEB 2IJRA 4AFFA 4LF9F 5HLFB 2VG7B 4HHJA 3C6UB 2P8IA 5KFGA 2DY9A 3HM9A 1HPZA 2J9DE 3D28A 1N4LA 2HIYA 1RU2A 1FNMA 1NSKL 2KT5A 1IBKF 3KMQA 3W3SA 4Q0BA 4DQRA 1R3NA 2PO4A 3IG1B 4CLPA 1HNZJ 2FLNA 1SQFA 2ZD1B 1Y4ZB 5T7LA 4KR0B 3G6XA 5A8KB 3VQTA 1IKYB 4A8WA 3FSIA 3TQ1A 2EFNA 1ZAWA 4USUA 1TK5A 1TL4A 2OEKA 3BF4A 2V8VA 1KLMB 4CDIA 3E3XA 4CT8A 3C2PA 1GTHA 1RE1B 3CCWA 2R8IA 1IKXB 3M30A 4JI7F 2W2NP 2VQEJ 3PW0A 1LWCB 3UDVA 1TZ0A 2E1RA 1WC3A 2CJ9A 2W8LA 1JQGA 4ZLNA 2GA7A 1UEVA 2FLPA 1AFJA 2DNZA 1VQ7S 5ETOA 1NK4A 4X66F 1S0OA 3L4BC 5JXSA 3PR5B 3GU0A 3VV2B 1HNXF 4ELUA 3T1YJ 1AT1B 1NDKA 2VG5A 1FI4A 5BR8J 1GMUA 3TI0A 3JAMU 3JSMB 2WB4A 5U47A 3TUIC 2J6UA 3BN4A 4DCJB 3MAAA 3PRBA 1T11A 4NRTA 4LVOP 3I4PA 4USMA 4PWDB 2ABYA 2FPHX 2YNFA 2UUBJ 2DITA 3GV5B 4LFCJ 3LAKA 1XQIA 2XMKA 1S6UA 3JTPA 2HHHF 2LLZA 3MTJA 3ILJA 1KFDA 3LP0B 4F2RA 5JJBA 4Q5VA 3CJSA 2V69A 1SI9A 1MWYA 2BRKA 2CXEA 1B7YB 3DMJA 2GAGC 4DUYJ 1HHQA 4DV7F 5J2MA 1KLNA 2XS7A 2YBVA 4ZIWA 5ITHA 3T9ZA 1N36F 1JXVA 2YXLA 4YHHJ 3D0IE 4FF1A 2GW8A 1RXOB 3I0RB 3M32B 4C6AA 1HBOB 3QFHA 2XYPB 4GRSA 4K59A 3SDEA 3KJVB 1RHJB 4LBHA 1QY7A 5JVGQ 3GTYX 1ZA1B 2HRYA 3LPEA 3OVAA 3LWLA 3KUEA 2BMBA 4L74A 5CCMA 3NOCA 2HHSA 4RNFA 2HRUA 2MLYA 1U0HA 5H9EJ 4DN0A 3GB0A 5F8JA 4IRKA 1FDNA 1WHXA 3CVKA 1G1XA 5E3CA 5DG8A 3CB4A 1TELA 3B54A 1N48A 2DEJA 2ZC3A 1HD0A 3MMAA 5K14B 3BQ2A 3AAWB 1KC8T 3ET6B 1VDHA 4DR6J 2PE8A 3QLHA 4F7VA 3UN3A 2FVRA 4I6AA 3FMWA 1S5ZA 4DR3F 2IC3A 3GLJA 4NLVA 2MQLA 1SC3B 2ZKUA 3GCXP 3GSIA 1VBXA 1S0VA 1LW2B 2XULA 3IA0A 4XPCA 1F2GA 3MR3A 3OLBA 1HIYA 2OELA 3LUYA 1RTHA 4ECUA 1JJ4A 1UVIA 1AZSA 1BQMA 3K5NA 4R8UA 2HHWA 1TAUA 4WF9Q 1UZHA 1UP1A 1M0SA 2MKKA 1QE1B 3OXLA 4L6V3 2VV5A 2WW4A 2UUAJ 1NNDA 4ZCLA 2BM1A 1UJ6A 1BHNA 2E9RX 1HWIA 4QWDA 2VOOA 1N36J 3LF0A 5IT9U 1T05B 4WFNQ 3R2CJ 3CCTA 3JSBA 3K8VA 1OS5A 1UTAA 4ZVFA 4O3PA 1G6BA 3RB3A 1P9YA 4KQZA 3V2UC 4WZMA 1LXNA 2QRRA 4J9OA 1ZAXA 4RW7A 5A6WA 2MKIA 4DFPA 2CIMA 1BUXA 4H54A 4IH5A 2A2DA 4HDHA 1EZZB 4LIWA 5GAEU 1EETB 4O0NA 4DR2J 3ENWA 1ZZNA 3HK2A 4KIAA 1C2PA 1UVJA 5ETSA 3DXSX 5HROB 2UUBF 1CEZA 2GMHA 3RW6A 3PX0A 1OPIA 1S9EB 4MFBB 1D9FA 3PX6A 2OJ3A 3SSSA 3JB9k 4KT0C 4ES3A 4NX9A 3EGWB 4PXBA 2IBKA 3IM8A 1FFGB 4H4OA 4DX8H 3T1YF 4IH7A 3PYFA 4IRDA 2B4PA 4CLLA 5BXIA 4UUXA 2MKSA 1E6VA 1PAUB 1LWEB 2QLBB 2QMWA 2DGTA 3AOAA 5DG7A 2BV3A 3M6WA 2D3UA 2HBZB 2WSFC 3KK1B 3EPGA 1VQ9S 4ED8A 4TY8A 3Q2SC 5THWA 3HF5A 1P1LA 5D0GA 1XMOJ 1QAJA 2QSFA 4OYOA 1VQ4S 2DXFA 4HI2A 4OI4A 3WDOA 4B9LA 1S77D 1NJYA 1YDLA 1ZZFA 2PFDA 3GIJA 3DRSA 5EWGA 1U6BA 3ZFVA 4EUVA 5FLXU 5B0GA 2W9AA 4NPOA 2B6AB 1FWLA 1UCNA 3MAHA 1HI0P 1RWNB 4AL7A 4UY85 2FHMA 2R7OA 1IN0A 2GX8A 3FVYA 2P6SA 3C6TB 4JI2J 4GO7X 1GXUA 1NDCA 3OXFA 4HHUA 2C3MA 1QUVA 2H65B 2ZWPA 3T9NA 3W60A 1IWGA 2GHVC 3PTWA 3QGHA 1JLAA 1RHUB 3NP5A 3E51A 2EI5A 9RUBA 1FEHA 3IR7B 2A2CA 1DARA 4C11B 1LWFB 1JJ2R 1N5YA 1SJQA 4B17A 1MSWD 1P8GA 5HI7A 2HHVA 1CBKA 5I3QA 2X1AA 3FQKA 2ZNYA 4Q2LA 3V81B 2LU2A 3JQJA 4DR1F 2MEWA 2RQ4A 2G4BA 2SXLA 1R0AA 2UXBJ 1NSAA 1TL7A 2BJ3A 2FLOA 3OFEA 4DV6J 1NHUA 2WOMA 4CT9A 1YJRA 7FD1A 4ZCMA 3GFZA 1BY9A 2NXUA 3VGTA 4RX6A 2IRUA 3MFHA 1VK3A 2CQDA 3K58A 3BGLA 1KS2A 2KT3A 2CQ3A 4ZP8A 5HBMA 3IRXB 5BJRA 4LR8A 2ZHBA 2V8GA 1LQ9A 3HZEA 1FK9B 4A8OA 4GKJF 2GJ2A 4O3NA 2D9OA 5HLFA 3DYAA 4QIWD 1AYEA 3J7YU 3SCLE 2VQEF 3HLUA 5SUHA 4NA3A 3DLGA 2HGLA 2LKZA 1RT5A 3BR8A 3UCUP 3I9V9 1TUVA 1V5IB 4P73A 2POKA 4G1QA 4PUOB 2OD6A 1RT2A 5ETQA 2BJDA 4DQQA 1OY8A 3AB4B 3ZTRA 1IKVB 1S1XB 1S1TB 3DOKA 3HHDA 2R8JA 4W4MA 1NK8A 1FE0A 2YKQA 2VBWA 5ETNA 2O67A 4M5JA 1Z1ZA 5KG6A 5K5MA 4Q8EA 4C8MA 4X84A 3G71S 1VQPS 2YNIA 2HQCA 5KG3A 3PJXA 3TNVA 3VALA 2E5LJ 1RB0A 2VKRA 2JL9A 4BC7A 4OZLA 4MMOA 4CH7A 2W8KA 1RT1A 3GR0A 1UPMB 2IMOA 2MGZA 3VAIA 4EO8A 5H9EK 4DDFA 2WRMA 3HP6A 3SI8A 2V2VA 2DR8A 3QBCA 2YNGA 3PHEA 4NLPA 2KFYA 1RZMA 2O01C 4CLFA 1SKUB 3QWUA 2QA1A 1O5JA 4E8UA 3KOAA 1NPPA 4OJGA 4TYBA 3BSOA 1T9UA 4KFBB 3HSDA 5E3PA 4NLDA 3ULHA 4QYZJ 4FKXA 2BOAA 2DGVA 3FZ2A 3LOUA 1G2EA 5DZ7A 1IQZA 3CEDA 5B0CA 1PBAA 4P2SA 2XCPA 1CS4A 1HQUB 2VUGA 2AX1A 2ZE2A 5H9FJ 1T9VA 3I0RA 5CAAA 4F26A 2LEBA 1TMMA 3ZTSA 1MROB 2ZVIA 5C25A 3G6VA 2AT1B 4DV2F 2QIFA 4W98A 3QT8A 3KLGB 2KJVA 3MEDB 1T8EA 3FDSA 1KTVA 2DK2A 3D1HA 3FCWA 4QW9A 2AJ0A 1TK0A 4DV4J 2CADA 4ED1A 1RYSA 4LIRA 4OYXA 2N3OA 4F4WA 3BM7A 3AQPA 2VJUA 2YNFB 5DS7A 3FEZA 1C1CA 2NSCA 3MM7B 5KFFA 1A7GE 5SZTA 1K1QA 2VC1A 3CCJS 2N7YA 1NJIT 3VCDA 3AB2B 3AQOA 3HKWA 3BGRB 4ECYA 3JTOA 2FY1A 3DRXA 2RSQA 4QR0A 3G6YA 3RB0A 2JLFA 2P6TA 5HJYA 1LFPA 1SKWA 5T41A 2E7VA 4ID8A 9ATCB 1MWQA 3DDNA 2QA4S 1APSA 1RTIA 5A8WB 2EWHA 3Q0AA 2HNYA 5AE3A 3KXDA 4WTOB 4USWA 2VQFJ 2MTLA 3FFIB 1T3OA 2QG9B 5KT7A 3MGJA 1QDUB 1RCXB 4JV5F 1I94F 3SDEB 1R31A 1CULB 2HWIA 4CO3A 5C7PA 4QYZK 1HQ2A 2MQOA 2GCFA 3V6DA 5A0YA 5CCLA 4J9UE 1SJFA 2HEKA 2YKPA 3N79A 2E29A 4QBUA 2YKOA 4M5LA 1RAFB 1Y00A 3KG1A 1CJVA 2WBRA 4P2FA 5ADZA 4KPYA 3TA0A 2ZKTA 4FN5A 1VHIA 1KHVA 3FBFA 1RSCA 3EVOA 3P45B 4IG3A 2WW8A 2EG2A 2MQPA 1HPZB 3BBFA 3IGVA 5DLGA 4Q0BB 2AJQA 4E0DA 1TL1B 3AA8A 3MI7X 3W66A 4DCPB 5HVHA 4DV0J 3Q83A 1QVFR 3NS5A 3ETMA 3OT9A 4KHMA 1IUJA 3H59A 4F3MA 2JH3A 2E5IA 3GYGA 2R2UA 4M95A 4XTTA 1KN6A 2MQQA 5FLXY 2DISA 1P1TA 1IM4A 2RHSB 2J9DA 2GS8A 3PYEA 4ZCIA 3KTQA 2KJWA 4U8YA 3CO9A 4EFAC 2KG0A 5EUHA 1S10A 4C4WA 2YKAA 3Q24A 4B02A 3BBBA 2V4RA 4LF6F 3QJJA 3IXQA 4IKAA 2B56A 1BLUA 1FF2A 5AXMA 4R8UB 2PEHA 3BR9A 2ZJRQ 1FWKA 2Z4PA 4P71A 5MAOA 4FKYA 2OUGA 2W9CB 2BE9B 4DR1J 1HARA 4LF4F 2LMIA 2PFFB 1QTMA 5C42B 1PGZA 3KHRA 3D1QA 1IJFB 4ZPVR 4NLYA 4B3TJ 1WTFA 3A4TA 4DR7J 3ZZPA 1OIAA 2DO0A 1WOOA 3DLEA 2RU9A 3JSYA 4U67Q 4FF4A 1XNQF 1A9NB 1DTQA 5KAKA 2KM8B 1S1UA 2DB1A 3MEEA 4C98A 2ZM6J 2DNKA 3PY8A 3LANA 2UUTA 3FEXB 3BN7A 4DV3J 4OHZA 1YRTA 4Z37A 2WHOA 1LEOA 3H2LA 3P4UB 5HANA 1FRMA 1YRUA 2XZTB 3CJ8A 2D41A 4FPIA 4AXIA 3M9MB 3K57A 1N8RT 5LOQA 1YI2S 2D3ZA 3FCHA 4DR5J 4A8QA 3RR7A 1D0EA 4PQUA 3B82A 1Q82T 2HS0A 1JLEA 3CCSS 3BDPA 2XGPA 3R5JB 3I31A 2FC8A 3O8WA 1HR0J 4QJVA 1CJVB 3OR1B 3JYTB 2HVEA 3U27A 1KFSA 2PEBA 4FS2A 1HNVA 3PFEA 4XDDA 3CSKA 4RPFA 2OPQB 3Q8QB 1RWWB 5IC6B 4ZMMA 3QRQA 1N0VC 3DI6B 3TARA 4B9SA 3OLAA 4QZVB 3AJDA 2YWHA 1VC5A 2RE1A 4PPDA 4C8ZA 1HBMB 4HH0A 1RA7A 1R0CB 1FCAA 4FNIA 1YBAA 3MOZA 2M70A 2V9WA 5HMXA 4LF4J 5J2NB 1IBCB 5HP1A 3EVMA 3O6QA 3IS9A 2LXFA 3I5CA 2XMVA 1SJ4P 1HNWJ 4I69A 3OTCA 2GMLA 2PMHA 4FYWB 1IQTA 2W2OP 3N6LA 5I3PA 4B3MJ 1TL3B 1JIHA 1JLBB 1R0BG 5I42B 2I5JB 3C66A 4RUHA 2IM0A 3LPYA 2ZC4A 3G8SA 5E33A 3KJQB 2JZ5A 2JOQA 4DX7A 3NGUA 4YFUA 1RI7A 2ZM6F 4ECRA 1S6PB 1KWMA 4I6WA 4FVCA 5KG1A 3QSYB 3RAQA 4QCLA 4YQWA 3QRPA 1P27B 4LRBA 4O4GA 3M6XA 3IAS9 4NEYA 4MKBA 2A18A 2HNDA 3CDBA 4WIIA 2OMLA 2I6WA 1RT6B 3RGIA 2CNKB 2XI2A 1VQSA 2RKIA 1HMVA 1U2RA 2CJQA 4CO5A 1YK9A 3H42A 4IFYB 3TVZA 2VIHA 3ILOA 1ZTTA 2KFZA 5L8RC 3CCMS 2K1RA 3LQVA 4WXOA 3QIDA 4CWBA 4B3OB 5KFYA 4TQRA 4LRFA 1YRXA 2C2MB 2K7JA 4NMLA 2RH3A 5LJ5Y 3HT3A 1P9QC 3GG0A 3M30B 4DSKA 1FJEB 1N54B 3OTBA 1NPKA 4X4QA 3BKFA 2CWXA 2C2KB 3HHNB 4K4WA 1TP7A 3X1LB 1Q7LB 1TU0B 4WZQA 4J90A 3NKYA 2XMAA 1FEEA 4I1TA 3HD2A 3TW0A 4NA1A 4NLQA 2MZTA 3W65A 1RAIB 1VRTA 2F4FA 4P6QA 3GILA 3PX4A 2XBPA 3HCXA 2U2FA 1YZ7A 2JC0A 4I4BA 4NZ6A 4ZCKA 4X65F 3IC1A 3J7A1 3KHLA 2H5EA 5B7WA 3CW2C 2LA4A 3A3NB 1VQYA 3HSJA 2BABA 1IR0A 2AZ1A 1RT6A 2HHPA 2LQBA 2QGFB 5DDOC 1GMWA 5E3RA 4C8NA 3D2WA 3NL0A 1H3DA 3PXGa 4M63A 2YKMA 2EW9A 2RMLA 2BUNA 2MYFA 5MLCV 2OHDA 1PYTA 3D9BA 3LW5C 4M5MA 3MD1A 4NCGB 5CH7B 2AWZA 4CTAA 3TVKA 4YUDA 1VBZA 2HS3A 4DX5A 3DOLA 3OJSA 5EDWA 3F44A 1F9HA 2LQ9A 4Q44A 2C2ZB 2QC3A 4GVBB 2XLJA 2NZCA 1T0TV 2B4OA 2V63A 4RU9A 4RUAA 3PEHA 1O51A 2GHPA 2R7QA 5HSPA 3KLEA 3V4IA 3JQKA 4C0OC 3RR8A 5IWAF 4N41A 1UVLA 2W2MP 5IQQA 3MEGA 5CYQB 2IM1A 3M6VA 1NLKL 4DSEA 4U96A 2K7KA 4HL9A 4NLOA 3AA9A 4NRUA 1D3WA 3TEGA 1VIOA 1X4BA 4Q45A 5KG4A 3J81j 4YOEA 2XHCA 1WKKA 5ETRA 3P5BP 3FGVA 4H4OB 3VVUA 2KDOA 4EI2A 4AL6A 2OPQA 4P2MA 4DS5A 3G2XA 4P7TA 3G8QA 3SIPB 3DNCA 1UFWA 4H4KC 2W9CA 1Q95G 2M4MA 3KDOA 2YWEA 1FTRA 4MK9A 3SSQA 5J1EB 1E6YA 2BQUA 2HBRB 2MDAA 2MKCA 1XMOF 2FVPA 1FRHA 2CZ4A 4LF8F 4TU7A 1Q53A 5KFJA 1F5BA 3OQ2A 2RQMA 5KFMA 1RAHB 2HFZA 2NXNA 1RT3B 3IGNA 3MEKA 4NL5A 1LXJA 5KFLA 4UZBA 1Y5LB 3QGPA 3KLHA 4PWDA 4AD6A 2IYIA 4MH8A 4IQMA 3OVSA 3ENQA 1H7XA 1TL3A 2F8EX 4DV0F 1NBEB 2CJKA 5GVQA 4LFBJ 2BA9A 1AB8A 1C0UB 3HVWA 4ZVGA 3KK2A 3CUNA 2FQQB 1WJ9A 3PJ9A 2PIIA 3M8QA 3PCOB 2E1AA 1C1BA 1YZ6A 1BQXA 1FESA 1T9TA 3MCSA 4XK8C 4NCGA 5DZ6A 1XN9A 2ZOFA 5CXTA 2I2YA 5HK4A 4ZIVA 2B51A 2KN4A 3MZIA 3N6MA 3RZAA 2EPIA 4DQPA 2IHR1 1YBTA 3W5YA 4LF7J 3PW4A 1X9SA 2IFXA 1XMBA 3ELHA 4O0IA 3ZXWA 3EUNA 5A8RB 3A1YG 4YY3F 4ZPCA 4J9KA 2KZZA 3D67A 1A0OB 1MROA 3UD3P 3J7Z5 1W26A 1NSQA 3PKMA 2N7CA 1BGXT 4QIVA 4JV2A 3EZUA 1D1UA 2KB2A 2U1AA 1NDLA 3VQSA 4KJIA 3A12A 3TP2A 4MAKA 4OIXA 2H48B 4TLRA 3TX8A 5KFKA 2HK2A 2W25A 4MTPA 3A3PB 3MTKA 4K7QA 2AJ4A 3H5UA 2EKNA 4QOTA 4CP5A 5L38A 2ZEJA 3C8YA 5L46A 2CPZA 1X4DA 1MWZA 3BH6B 1WSRA 3K89A 1NJXA 4JV1A 2CYYA 3UCZP 3FEYB 3ZNUA 3EGNA 1TKTB 3R5DA 4RW7B 1KQKA 4C3MA 1T03B 1LW0A 1Y7PA 5KFAA 1D9DA 4MYUA 3HVTA 3ISNC 2HQDA 2VPZB 3BH7B 1FE4A 3FCVA 4HI1A 4ZVRB 1HQEA 4ETXA 3TAPA 1UVKA 2ZOGA 1LNQA 3VAJA 2AHOB 3QO9A 4QIGA 2I8EA 2C3PA 4DPXA 2VFUA 5DETA 4X64J 1LFWA 4C8OA 3EYZA 1T94A 1PILA 1AZSB 1BQMB 1DHMA 5M2RA 2VASA 1CPZA 4GVLA 4G6VB 2ZH4A 4RR5A 3TAMB 1U1MA 1TKZA 5D4LA 3N5FA 4K5SA 1F9FA 1WDTA 5D6GA 3Q22A 2XCAA 2DNQA 2MGZB 3M8QB 2RJZA 4J9MA 1N34F 3QT7A 4HH1A 2XQCA 2H1YA 1V3RA 1FA0A 3DHXA 3N4WA 3Q2TC 5E2QA 4TVAB 4WK3A 3CJ2A 4ZVSB 4ANCA 1Y11A 4KO0B 2B6AA 1MMNA 1VI7A 1N32F 2HQ3A 3VZHA 3M1VB 1RT4B 5L9XA 4ZP6A 3TJ9A 3GV8B 1SIWB 1L3UA 1WTBA 2P9GA 5C24B 3ZNJ1 5E5NA 2QN6B 5KFUA 3VWSA 1Y5IB 1Q5VA 3QAUA 4LFAJ 3U1NA 3M2UB 2Y9HA 2RVJA 4OYIA 3KYLA 1W2IA 4XAKA 4EMDA 1PC4A 2V94A 2E44A 4OZ2A 1HWLA 2D1CA 2F8HA 1YHQS 1DTTB 4GC6A 1M5VC 1W7WA 1X4EA 3I96A 3C19A 3Q8VA 4DLGA 2XMMA 3R5CA 2B9XA 2BKPA 3RW7A 5RUBA 2ASJA 4DL2A 4ZJQA 1RLDA 5BR8F 3DDIA 3IM9A 1ZS6A 1SUQA 3QYYA 3S1TA 3T6JA 2XMUA 3J7AN 4X4TA 1S72S 1CSJA 3J80Y 4N7TA 1S9EA 1PC5A 2IAJB 1GXLA 4MFBA 3CJ0A 5LSRA 2CVEA 2QL5B 1S9FA 5B0AA 3K17A 4KH0B 3DLHA 1FFSB 3FJ2A 5DG9A 2UVVA 4BDPA 2VBXA 2ATCB 3I5BA 3DFEA 5ETLA 3R3TA 4I67A 5KFZA 4DOZA 1JX4A 3PRVA 3SFGA 4MJKA 1VR6A 4Y65A 4F4ZA 2AKWB 2ZBQA 3K5OA 4FYXB 4RNOA 4PG8A 3ZZYA 1QJHA 2H9ZA 5J2PA 4OLPA 1RTJB 2IA6A 2R7SA 3MMJA 4HVZA 4QIFA 1M5PC 1OY9A 3K5PA 1RWMB 2AU0A 4CM2A 1U1KA 2QL7B 4ZVHA 4C11A 1YGYA 3AODA 3FQLA 4NYOA 3V5RA 3M2UA 1PCAA 3RU0A 3M8PA 4ANEA 4PYAA 4WE1B 2F4VJ 2NSBA 1VMBA 3ISZA 1DURA 3MHYA 4QIEA 2F8MA 2RRAA 5GADI 2G2YA 2HQGA 1FX4A 1ZA2B 1VQ6S 1H72C 2VFTA 2IDEA 2HWHA 2IVMA 2QFIA 3NS7B 4I2QA 4OYMA 1NK5A 2XEXA 1RAGB 1CC7A 1UA1A 1KVIA 2VFRA 1IWAA 2MZJA 3DLEB 4ZPDA 2MKYA 4QW8A 2MXYA 4ECSA 4J5OA 1RT1B 2ALYB 5L1JA 2AEMA 4KHPF 1TUGB 2BACA 2BJ9A 3GWCA 2D9PA 2MQNA 1IKYA 3EPIA 4UW2A 1NPRA 3MWBA 1X4GA 3H98A 2Z2YB 5HL7Q 1OYEA 5AJ3F 2ROPA 2KVQE 1JLQB 1FO1A 2VD3A 3NOGA 4IG0A 2XNRA 4DR6F 2B3TB 1V9OA 5ETMA 1PIEA 1I6JA 3Q86A 2ROGA 2IVFB 2B8QA 4F50A 3LGNA 6AT1B 2LU1A 2L41A 4DL3A 5HBMB 5HJXA 3VAHA 1H0HB 4Q8FA 4IOAQ 1WEYA 2CNNB 4ZS6A 4IUFA 1GX5A 3H5XA 1S7HA 3L7UA 3P8BB 4OZNA 3DLGB 4UF4A 3OTOF 2J5AA 1S4FA 2QA2A 4KPCA 4UZCA 5L1KA 4F4KA 1F5CA 2HVZA 3W2WA 1URRA 1HNZF 5D4OA 2YNIB 5F0WA 3GIKA 2C2EA 2R3VA 3LA0A 2KT2A 2QA4G 1FT8A 2JLEA 2GGPA 3D6MB 3M1VA 1WKJA 2YNHB 1LWFA 4V19J 4PPZA 1LW2A 2DPIA 1EIYB 4RUCA 5KFHA 4K4XA 2KU7A 4YR3A 4XO0A 1XNRJ 1DY3A 5HQMA 5GAGI 2FJDB 4ZPAA 3G82B 4H4KA 4QQBA 1GNKA 1VQLS 1VJQA 5I42A 2CG8A 3US5A 2NXJA 3HKZD 3FC9A 3JXOA 4S0MA 5B09A 5A8RA 3QFWA 1RAOA 2QLFB 2RNEA 2YKNB 3VTIA 2MJUA 4IQXA 1NDPA 1YKWA 2B8PA 2VG5B 2DY1A 4OLOA 1H73A 2WTFA 4AQYF 5CA5A 3Q8RB 1JLFB 5DGAA 3R6GB 4X4SA 2RDIA 3LO3A 2F65A 2HZCA 3FBBA 1S9GA 4B08A 3MUTP 2F3JA 1GMWD 4J9QA 4MK8A 1N6QA 3HFKA 1FD2A 2XB2D 1ZETA 3O1LA 2E7WA 2QMXA 4Y2IA 4ID5A 2L48A 3IR6B 1XMQF 3NG8A 1RWOB 1HNVB 2FB0A 5I4MA 4NXNF 1JJHA 1LW0B 4IO1A 1HHSA 3PHTA 1RHKB 2FTRA 2RQKA 2YWKA 2I0XA 1EHWA 1SJ1A 3DLJA 1HQEB 2CPFA 2UVUA 1FKPB 1ZPWX 2JEFA 1HD1A 5HATA 3UI3A 1D8ZA 2KL8A 2ACYA 2PD1A 3C16A 4LBPA 4MYTA 1GK8A 2VBYA 1WF0A 2J0XA 1UFLA 3VGUA 3EDQB 2Q79A 4HYKA 2KVIA 3BJYA 1XR5A 2DNPA 1S1WB 1U26A 3UW1A 2UUCF 2XG8A 3D54A 3LP2B 4ED6A 3NNAA 2DKOB 4WWSA 1EX8A 3W7BA 3NNCA 5GMDA 3KKFA 2HWTA 2YKNA 2CJYB 1Z2LA 3M2RA 4LR9A 5CABA 1U48A 2JSXA 1OY6A 4Y34A 1SXLA 2FZGB 3TZZA 4YMEA 3VAFA 2X3DA 3UR3C 1VLYA 3DMJB 4N47A 1NKEA 2UXDJ 3GYXB 1Y9OA 2XSFA 3WHIA 4ILRA 3PW2A 2C42A 4B9NA 3HJVA 1U1PA 1YJWS 4RKUC 2C3YA 4CH1A 3QIPB 3WC0A 1S59A 1Y10A 4H4MB 1F0XA 4J91A 3MDFA 4LF1A 4ZPBA 4ID5B 3OVBA 2VPYB 4TXSA 1FRKA 1Q4RA 3JQMA 4IG0B 5LMNF 2C2RA 2EK1A 4YHHF 4GKKJ 2VH7A 4MKYA 3MM5A 1OMSA 5FDLA 4V19X 3HVRA 2F4VF 3IR5B 3ZTQA 3NAIA 2E66A 5KFSA 4JI2F 2AJFE 2Q6BA 2ZBCA 1HQUA 2ZE2B 4OI1A 2KYZA 4RLEA 3AY0A 2NREA 2OPRB 2LYVA 4FF2A 3W2VB 2G2OA 5B0EA 3MPVA 3RB4A 4F2SA 2HQFA 3GJRB 3HHLC 4U7CA 4B9UA 2H4YB 3J81Y 4CLKA 3HMJG 1K1SA 1O0PA 1MW7A 2V67A 3MM5B 3H5SA 4KBIA 3AJ1A 1JKHA 3KJNB 4OYZA 4F0KA 2AD9A 3EX7B 2ZH8A 3D5MA 1LWEA 1UPPA 4Y28C 1REGX 4ZLLA 2R2SA 2DRDA 1H6KX 4GMKA 3AH6A 2AGQA 2IVYA 2CPEA 1FK9A 3OD2A 3OUYA 4LREA 5KG7A 2UV8A 1SB6A 2JVOA 2VFVA 3EE3A 2W7OA 2A6OA 1C4CA 2PN6A 1WDDA 4GO5X 4WU2A 2OPSB 2CQHA 1YVFA 1HKAA 2DCUB 3H40A 5JMNA 2R8HA 1FJGJ 1NKCA 1S76D 1PJ6A 4WP9A 3G87A 2BR0A 4FXWA 3K2YA 3OPKA 3IFEA 4ZP9A 2ZH5A 2R8GA 1WF2A 1TKTA 1VCTA 2ZUAA 1T03A 2Q6CA 3ITHB 1SIZA 4DPWA 4ES2A 3PRDA 1S1VA 2HFNA 2G1HA 1HYSB 1R8HA 1RCOB 2M3DA 1SH0A 3EXYA 3PYDA 4LRDA 4M8LA 3Q23A 3IBCB 4A47A 1XMQJ 3PFOA 3EM1A 4KGMA 3RAMA 4WE1A 4NI2B 3W8GA 4USTA 4B3SF 1OYDA 1IR2A 3QJPA 4NE9C 3S6EA 1NRKA 1BQNA 2VA3A 2KXNB 4CCHA 1WORA 3RBXA 5E0OA 4Y2MA 4K2JA 3POTA 1HMVB 4LF9J 5B08A 1Y0HA 2Y8WA 2M52A 4CLWA 4J9LA 4OYWA 1U7LA 2MZSA 4Q2MA 3THPA 1N34J 4DUTA 3ZC4A 3SQOP 1OO0B 1JNZB 1KKHA 3R5BA 3MEGB 5CYQA 1X4FA 2YPZA 2FJEB 2Z0GA 3DGPA 4NLUA 3ZO7A 4ECQA 3IRXA 4FF3A 4LF5J 3DHWC 1QUPA 5KFTA 2RHQB 1BWVA 4I2QB 2NYIA 2HG4A 1M5SA 1D8YA 2XMJA 1FFWB 5KOXA 2CJBA 4K5RA 1GFWB 1O8BA 1R8PA 3ETOA 1YJ9S 4NCBA 1HL6A 4X4PA 3QLHB 1FDDA 5A6PA 3NCRA 1CJKA 3F0NA 2XZDB 3FZBA 2VONA 4NLWA 2XC9A 4FBUA 4BWMA 3OTDA 4Q43A 4ECZA 4F02A 4OHXA 2CPYA 1WC4A 2DGWA 4KGKA 4L76A 1WSVA 1X60A 2RU3A 3OTEA 2ZH2A 3PACA 1ZYQA 3BO2A 3O2IA 4ICLB 1JXLA 1B0VA 1FRIA 1SUQB 3W61A 3ZZZA 2YX7A 5B0BA 2HNZA 4L72B 2MZQA 4KAIA 2Y8YA 1PJ5A 3GCWP 3RRGA 4DMZA 2XO6A 2DH7A 2E5JA 1CJTA 1X4CA 2DNLA 3OR2B 1Q8KA 5F3ZA 1FKOB 1BMQB 1IM6A 3P3DA 3MM8A 4I0WA 4QR1A 1C4AA 2Z2ZA 5D4NA 3PZPA 2Z8QA 3CCES 2WVDA 4LF6J 4DV5J 1GXTA 2CUYA 3FNNA 4TNOA 2NXEA 4ZVPB 4FS1A 4K0KF 2YTCA 2PGCA 1VFJA 3I87A 1XNQJ 3CCLS 1OQ6A 4Y2CA 5IOLA 2WVBA 2YVSA 1U0SA 4L75A 1NSPA 4DFMA 3GJTB 2HAFA 4DXLA 5KG2A 3LWMA 4EBCA 4M5KA 4C8LA 2V34A 5F9LA 3PO5A 3M8PB 3PVXA 4N76A 5D77A 3A3OB 3DOLB 1WNEA 4JOUA 3SCIE 2FHJA 5GAEI 3MMAB 5K14A 2V2QA 2XYHB 3I32A 3FRYA 2GV1A 3CIMA 5IT9Y 1RT5B 3ADAC 3JAMY 1ZTWA 3HT0A 4MT1A 3RJMB 2KRBA 4KB7A 2WAQD 1NZ8A 1U6ZA 3DU5A 2CQGA 4Y2KA 4DR4J 4CLUA 2HNZB 3Q8YA 2RRBA 4RW6B 4JV0A 5IM0B 2ADCA 1KLMA 3BEGB 1RKJA 2OO4A 3GP9A 3M9NB 3P5TL 5CZVA 1VRTB 3CXCR 4OL8A 4JI7J 1KONA 3NAHA 1FKOA 2Z2LA 4P10A 4O23A 3T41A 2FJXA 1T7PA 4WFYA 4C0BA 4ZVEA 4LQ3A 4NLSA 3G96A 4NYZA 4Y0FA 1OPZA 2B4VA 3H25A 5A8KA 2EC2A 2P9EA 4U95A 2JLGA 3CTRA 1Q81T 1LK7A 3BSAA 4USHA 3HXMA 5J1PA 2BEFA 2B4UA 2IY5B 3DXBA 1KTQA 1VRUA 2IA0A 2MQMA 1UA0A 2VOPA 4IDKA 4X4VA 5M2UA 3SV3A 4QWBA 2B7BB 5T14A 2VQFF 7AT1B 2HHQA 3AD8C 3D7SB 2LP4A 3TYTA 4JBCA 5LXRA 1EARA 5G0RA 4DL6A 1M5KC 3UFCX 2OLWA 4DV1F 2LECA 4PRFA 1NO8A 4MK7A 1N32J 5ETPA 8ATCB 2IJNA 5IQ6A 2ZBPA 2Z58B 3CCVS 1IVZA 1UAWA 1IKWA 4OI3A 3MM6A 2DIUA 3NRBA 4GC7A 3HJFA 2W9BA 2JFKA 5CYMA 3Q89A 5G0RB 4CO4A 1S97A 1VQ5S 2R8KA 3WC2A 1JMTA 3FMBA 4EYHB 3S01A 2ACMA 4JP8A 4EBDA 2IMWP 4USJC 3NGDA 2V0NA 2VKZG 2D3OR 1V3ZA 4NZ7A 4WXWA 2J9EA 2C2OB 2V2KA 4WYLA 4LRAA 4RO0A 4K4TA 1X5TA 2V4JB 1YWXA 2DGSA 5ETTA 1SC4B 3G9CA 1RUSA 1KQFB 5D8HB 3TO8A 3VF0B 4MIAA 5DQIA 2CAJA 1RGVA 2CQPA 3IG1A 2XGQA 3NXZA 2OIHA 1HNWF 4ZP7A 3DDKA 3QATA 3OJUA 3Q8PB 2PC6A 4OX9J 3ISND 2DXEA 2IDLA 3TVYA 1UEUA 4DQSA 1KQSR 1L3TA 3D6TB 4QR2A 2D69A 1L3SA 4DU7A 1X31C 1VRQC 5KFVA 2K06A 2GJIA 1VQKS 2VB6A 5L1IA 3ENAA 5DQGA 2GJFA 3EGVA 1CJKB 1M5HA 3FFIA 3T3FA 2XY5A 4HACA 4X4UA 4OX8A 1TKXA 3PYGA 1UMJA 4RBUA 1QE1A 2H51B 3C14B 3M2VA 4ZA1A 1N6QB 3NMAA 2BJEA 1UFKA 3M8WA 3GJSB 4Z7YA 1XBWA 4ZVOB 5D0EA 1YJVA 1GQEA 1WG5A 4OJHA 3ZZRA 4RNMA 2XO7A 3V6KA 2M7SA 1FHTA 1SQGA 2IC3B 3G86A 4I7FA 1ITPA 3H90A 1U45A 2CPXA 2DR6A 1RTIB 2QLWA 5D4PA 2AGPA 2ZZMA 3BREA 2G9OA 3M8YA 2J0QD 3KFWX 4WPAA 1U02A 2FIUA 4ELTA 4CIOA 4OZ0A 1K0VA 1MG7A 4PXCA 2AYBA 1DRZA 3S7RA 5G4DA 1RK8A 3BSNA 3MR5A 1CULA 1HBUA 4IFVB 4LF2A 2RAQA 4ED2A 3KUHA 2UUWA 1DQAA 2OSQA 4DEZA 1M90T 4DUZF 4UTGA 5GAHU 4K4SA 3L09A 2CA9A 3DGPB 3L3CA 2ZDPA 1SC6A 1UETA 1V6HA 3H2UB 5AE1A 3MPYA 4KKOA 5J2QA 2OD4A 4IG3B 1NXIA 4KC5A 2NZ4A 3BKTA 4ES1A 1WD6A 1H98A 4DFKA 1IKXA 2MB0B 1BXNA 1TVRA 2AIRB 2CWKA 3L9ZA 4DI6A 2VHGA 1KNZA 1RWUA 4GKJJ 4K4VA 1U2FA 2HBQB 3EICA 3GJQB 1SVDA 3QWPA 4ITSA 2YY3A 3D66A 3KNGA 3OUYB 3VGSA 5LMUJ 1X9MA 1RJJA 2W1BA 3MMCB 2KHDA 2XLKA 4AT1B 3KG0A 2YPYA 1KQGB 4PYDA 1X9WA 5D78A 2ZHAA 4A8FA 4Y2AA 5K8NA 3TANA 2QJ3A 2ASYA 1S6QA 2EEYA 4LRCA 4ZPTR 2WONA 4Y6IA 1RWXB 3ZZOA 5KG5A 1I1GA 3ITHA 3MFIA 3I82A 2J76E 4CLZA 4DX6A 1NUEA 3TRGA 4DPUA 1JNRB 3CJ4A 4JYAJ 2WVCA 1JKHB 3TA2A 1YLXA 2AZ3A 4ECWA 2DHXA 3A8EA 3UWTA 2DT9A 2E9TA 1DBDA 3DRRA 5F9NA 2X7IA 4ECVA 3MM9A 4B3TF 2AQ4A 4KYZA 5L39A 1Q79A 4P9SA 1K44A 3K5LA 3KHGA 2VPWB 2OH2A 2PSZA 2QV6A 4HT5A 4RZRA 3V4IB 1I51B 4JI6J 4YP3A 1GT8A 2HBYB 3MEDA 4MIWA 5ETVA 4ZVUB 4NLXA 3I0SB 2A0FB 2OMOA 1X0FA 2ZH6A 3CDAA 5DDRC 3CD5A 5CD4A 5KFBA 1CJUA 1NJZA 2YNGB 5F8IA 2Y3YA 3CCRS 2JFDA 3CPWR 2RIJA 1C0TB 1HWUA 2V8PA 2AEJA 2W4PA 4A46A 3F73A 1M5OC 3OV7A 2B5JB 1Y3JA 5F8MA 5EX3A 2GO9A 1RYRA 2DVIA 1OJ4A 4PKDB 3THTA 1IBMF 3MPUB 4CYUB 3KMSA 4FP9A 4CLTA 5KFRA 3OSNA 2VJVA 2VODA 2B7CB 3C16B 1REVA 3OL6A 1EP4A 4LMZA 1U1RA 2BYCA 3H5YA 1XEZA 2LXIA 2BW2A 2DTJA 1FERA 4K4UA 3H0PA 3EZ5A 3BYPA 3DI6A 4YB6A 6FD1A 1YIJS 3IWNC 4P7VA 3QJLA 4B3RJ 1VBKA 1IKVA 1S1XA 1H7WA 3LGMA 4RBVA 3BDEA 3HHKA 3KLIA 3M9OB 3SYZA 4O3RA 2DXDA 2AP6A 2AX0A 4WU3A 3CULA 3IN5A 5M2PA 3P96A 4NLTA 2OFHX 4HACB 4M5NA 4NZ0A 4E2FB 1LKZA 1RACB 2CQ0A 3FBCA 4DL4A 5HN0A 4OI2A 2KM8C 4X62F 3V6DB 2LVWA 2XS2A 1WWHA 2E1MC 2E1PA 3NEKA 4UOGA 2R7UA 3CCZA 3EJMA 1WC0A 5LXYA 1FDAA 4JV5J 1DAXA 2ROEA 3KLIB 5C42A 2V4QA 3CCUS 1WHWA 2Q43A 1Q7YT 5BYQA 1WI6A 2FHOB 3BPSP 2KRRA 5FDLB 2UXCJ 3AXKA 2HNYB 5KFIA 2GO8A 2C28A 1S1UB 2XWYA 3MEEB 2OPPA 3O5TB 1S6PA 3ILLA 4OFZA 2CRLA 3BGOP 3SCJE 1YJ7A 3MMBB 4C3LA 5LT5A 2OPRA 4X4RA 4CYUA 3W2VA 2KH9A 2B9WA 1JLCB 3OFHA 4CO2A 2DNGA 5HQ8A 2QFJA 2H54B 1S48A 2Y1IA 4LSNB 3BB5A 2I38A 2XTJP 4DV5F 3GFYA 2QYGA 4F4YA 1NK6A 2YWGA 1PBUA 3AXMA 4UOFA 3PO4A 4ZK7M 1S0NA 3HHLB 3H7HB 2BJ1A 5EN1A 1KHWA 4OZ1A 5F8GA 4N77A 4USVA 1U1QA 2F1FA 4C3KA 2JWNA 3D0GE 5HO4A 1RT2B 4RW8B 1GH8A 1HW9A 4ZPWR 5GADU 3E01B 4DV2J 1AXQA 3EVWA 4G1PA 2NYHA 1X8DA 2L9DA 4IH6A 5FJ4A 3DM2B 1AW0A 3M2RB 5AE2A 2F63A 2IM3A 3DYAB 4ZKAA 1MN7A 3B8HA 4JI4F 5F8NA 1CS4B 2DNNA 1J27A 2FJWA 4B9MA 1H74A 2QO3A 2OPPB 1BC6A 3DU6A 2CDQA 1FNXH 2Q3PA 4DL5A 5I3UA 3I6PA 3O3LA 4KGZB 4CQ1A 1NK9A 3TAMA 3PKYA 1VYAA 3GONA 3C15B 5AJ3J 4DSFA 2FGOA 3NWRA 4A48A 2WOMB 2QT7A 4ERDA 1EAYC 2GHWA 2QX0A 3I4HX 4OQJA 3A8JA 3KHHA 3R5GA 4TKTA 4DV6F 2PI4A 4ZOSA 3HSGA 1T05A 1Q8BA 3H20A 3OBIA 3C3LA 1CG2A 2RD5C 2BRLA 1N5YB 1S9GB 2AV5A 4D3HA 3PW7A 2ZH7A 2E5LF 2W9BB 3HD1A 2VC0A 3GQCA 2WCXA 1L3VA 3MMBA 2OEMA 3UVJB 5C24A 1R8AA 3GIMA 3VAKA 4O44A 1HHTP 1W25A 4DFJA 1U1LA 4PABA 3CIZA 4QPXA 2KZMA 3J81U 4ED3A 1PYOB 4CNZA 5A8WA 5H9FK 2JX2A 2AW0A 1MU2A 3HHLD 3RYLA 2HFVA 3QMQA 3DRYA 3OW2R 1TTHB 3F41A 2EC0A 4EZ6A 1YQHA 1S12A 3I5AA 4BLGA 5KTQA 2H5JB 4EBEA 1HFEL 3L95X 4O3QA 2KG1A 1UJ5A 3MD3A 2BOPA 2XMWA 5KFOA 3D6HB 5DM6Q 1W2BR 2GQ2A 3JSRA 3CMAS 3T5LA 3T1HF 1NK0A 3T1HJ 2NR0A 4IR9A 1VRUB 2MZ1A 1URNA 5B0DA 2YNHA 1NB2A 2YKMB 2FYXA 2UUCJ 1S1VB 4TQSA 4WFAQ 1U1NA 1PSDA 4ANDA 1Q1KA 2Y1LB 1NHKL 2J7UA 3EXCX 5GMKa 4PUOA 3UO0A 2UU9F 3GPAA 1MMDA 3C14A 2CZVC 4N8NA 3OR2A 4C0HA 4R5PA 2W7PA 2HHUA 2DR7A 1T95A 1FKAF 1TVRB 2KO1A 4ED7A 2WZ1A 1R0AB 1RT7A 5ETKA 2VICA 3LALA 1TUWA 4P52A 4DR2F 5EGYA 3PIPQ 4A8MP 4G3IA 2D3O1 2A10A 1WUUA 2JNJA 1JXEA 5J2MB 1OWXA 2PI5A 1WEXA 2X1GA 2ZHOA 5IV4A 2LQ8A 2BQ3A 4K2XA 4QU7A 3AD7C 3MAAB 3SMZA 2CKWA 4N8OA 5AXKA 5BYRA 2E5GA 2Z56B 4Y3CA 3WX4A 4DG1B 2XLIA 1I94J 1B3TA 1YX2A 3KJVA 2M5YA 5DLFA 1XNRF 4FYDA 1TL7B 3AJ2A 4NA2A 2CJAA 1RDRA 2YH1A 4CI0B 2NQPA 3C6TA 2BM0A 3BKUA 1B7FA 1R8BA 3DRRB 1BE4A 1RU1A 5CHCB 3R1HA 2YQ3A 2ALZA 1EB0A 4A8KA 1IBLJ 2FHJD 2HIQA 4XPEA 1R7IA 5D15A 4O4GB 2E9ZA 1K0TA 2DNHA 4KV8A 4ED4A 2FVCA 1KP6A 2DHAA 4RW8A 2B9YA 3U1LA 4UQGA 4ECXA 4CO1A 2J6TA 3W63A 1GTEA 2MLXA 1VGYA 4ZVQB 5K9FA 4DQIA 1Q86T 3ZZUA 4ZLPA 4F3QA 2ADBA 2WK4A 2CQIA 3IWXA 4K4ZA 4X64F 1YTYA 4OHVA 2IYGA 4ECTA 1S6OA 1T02A 2MKHA 1Y3KA 2D7SA 1N0UA 3W5XA 5LJ3Y 1RLCL 2XNQA 4DF4A 1UKUA 4DPYA 2GVDB 2V5HG 3EDRB 5K8OA 1JJCB 2BBEA 2RS8A 3CWJA 3PG9A 2FJVA 2WB1D 3BBCA 3M8ZA 4IYQA 3TWZA 4NI2A 2LFVA 3LH2S 4ENOA 1NKBA 1EJ7L 4NXNJ 2W01A 4KHPJ 1YITS 1S57A 1RKIA 2IAJA 2XYGB 1NHVA 1TQLA 1SKSA 1TR0A 2XWXA 2HFOA 4Z2XA 3M32A 4DHVA 1SL1A 2ILYA 3R1LA 1RT7B 2L3MA 5F0UA 3UDEA 3CJTA 2DR9A 1TKXB 4RUBA 1Q78A 2VFSA 3W1YC 1T9XA 1TV6B 4JI8J 1NEEA 1Z4UA 2DGXA 2JDJA 3RBZA 3UQSA 3HO1A 4DUYF 1QM9A 4DV7J 3DLBA 5JVHQ 4HTJA 4B3SJ 4DBQA 3K5MA 4PAAA 2M8DB 4KKOB 1QAYA 5FIIA 5J2QB 3BGUA 1NMEB 3C6UA 3QNWB 2GQCA 5K20B 2OEJA 1DFDA 1RBAA 3ONQA 1U24A 4U7UK 4K8RA 1RT4A 1VBYA 3HHLA 2V9KA 3G8TA 1S0MA 5KT2A 2FGCA 3MR6A 5DJBA 2VDIA 4LFCF 4ILLA 2UZAA 2ATLA 3MCMA 4L3KA 4LSZB 2PA8D 2XY7A 3QAEA 1R43A 1JLCA 2K8GA 2LDIA 3QSIA 2A6MA 3TAQA 5KG0A 2FZKB 1R27B 2C2NA 2N4CA 1AUSL 1B64A 3KK2B 4X66J 4P75A 5DDPC 3EWGA 3I0SA 5J2PB 1NH7A 1MLAA 3HVTB 3OTOJ 4CZCA 4JI0F 5F8HA 1YJNS 5J1EA 2WSEC 2E1CA 3E2EA 4YDDB 3L7OA 2R7RA 3T19A 1UEKA 1BWEA 3UD4P 2BW7A 1XTZA 2YQ1A 2CFXA 2I1RA 3TZWA 2EK6A 1X5PA 4EO6A 1QTNB 2RILA 1LWXA 1IBLF 1DQ8A 4WCEQ 2MJNA 1SKRA 3MXHP 4DPOA 2EBEA 3UCGA 1PO6A 4EZ9A 3HFZB 4RNNA 4LFAF 2OKQA 4DR4F 3KK3B 4E98A 3H2VE 4KGXB 1J5OA 1H38A 3I55S 4ZVTB 2J7WA 1M1KT 2JEGA 3QRRA 2V2ZA 5E3AA 3R7NB 1D09B 5CYJA 4M5DA 2HK3A 3CDEA 4IFYA 2AF6A 2LXUA 3DOMB 3CD6S 2V68A 4WYWA 4K4YA 3UDLA 1RTHB 2AJ2A 3V81A 4JI8F 5HROA 3NBPB 3L7PA 4J9VA 4GKKF 2UXBF 1J5EJ 4FDFA 2HVDA 4OYAA 2HHHJ 3CT9A 3FK4A 4OZJA 3KK3A 1VC6A 3MM6B 4AQYJ 4NEZA 2DNMA 5B0FA 2B9EA 2PT0A 3RRHA 2LDYA 3NWGA 4PCQA 2DBBA 5DO2A 3SFUA 2OTJS 1SL2A 5KT6A 3TZYA 5HQLA 1RA6A 4YB7A 2KKHA 1KD1T 2G2ZA 3LP1A 3SSRA 5C2GA 4UQTA 4O3OA 3THVA 1HNXJ 2HNDB 5IXUA 3RUBL 4PG7A 4DLEA 5LSLA 2G1DA 2GFFA 1WOSA 2NUHA 2P2CB 2WVEA 3KNAA 4UUWA 4WTYA 2M9KA 2AGOA 2DHSA 1WG4A 3UVJA 4HEA9 1GAOA 4NYPA 1KR4A 3RRKA 4AYBD 1DLOA 1FNOA 2R7VA 3BPDA 4JI4J 2HW3A 4WFBQ 1RTJA 1RBOB 2DIVA 3I9ZA 4AUKA 3CGIA 3SV4A 3C46A 5HMYA 3M4XA 4M5IA 3W9JA 1VQNS 2MZRA 3CD7A 2BQRA 4C48A 2DPJA 2OSRA 1QVGR 3N28A 4PZVA 3BZQA 3JTNA 4Z7CA 2C2DA 1SJ3P 1HWJA 2GAHC 4CLYA 1TL1A 1G7CB 3G4SS 2FD2A 2QTWA 3M8RA 4M1KA 4FXDA 2DHHA 2APOA 3PJWA 2ERRA 1D9AA 4F0HA 4QWAA 3NCPA 3T5JA 3R2DJ 1KVJA 4OZ3A 2ZH3A 3KLEB 2DH8A 3MCNA 4KY3A 4RBTA 8RUCA 3RBEA 3BV8A 3K8WA 3QO9B 2LCWA 1ICEB 1XJWB 2C22A 1U8WA 4LF7F 3U7JA 4HR2A 2HGNA 3JSMA 3TEHB 5KFPA 2R7TA 3CCQS 4C8KA 2NUUG 3R97A 2DNOA 4DL0C 3SQGB 3AD9C 1XERA 1NAQA 1RADB 1XIQA 4JUZA 3H8YA 2BE2A 3CJKB 5K8PA 5LM7E 2G0IA 2HMIB 1UZDA 2XM3A 2O5DA 2F9DA 3TUJC 1QSSA 1EKSA 2RKIB 4M5GA 2Y1RI 3TJ8A 3BS9A 1SL0A 2MHEA 2ZZNA 4LFBF 3IWLA 4HHHA 4ED0A 3WBZA 2MHNA 4RL1A 3UR0A 1NM2A 4DU8A 5GAHI 3DN9A 1Q8LA 3LP1B 4B3OA 1LK5A 3VGVA 1DTQB 4LSNA 1SC1B 4FPRA 4OJ1A 4OX9F 3WX8A 5IZHA 2K3IA 2GVZB 2VBZA 1Q16B 1S7IA 2DGOA 1PYSB 3AFGA 4U8VA 2BJ7A 1YJUA 2CNOB 3WZ0A 4ZHRB 3OHBA 4YR0A 2BJ8A 1JB0C 2N3LA 2YWFA 4NASA 5F8LA 3D4JA 3JS9A 3MAQA 2ZJPQ 3V4MA 2L9NA 2JEJA 2UP1A 3AHPA 1UWBA 2F9JA 1K47A 1RTZA 1U0HB 1UW4A 2QYCA 2CZ9A 3B78A 4R0EA 1C1BB 2CQ2A 1KRPA 3OHAA 3IO1A 4U9RA 1SPBP 1KOHA 2BX6A 1ZM2A 2E5HA 1B70B 4G1IA 1HI8A 3HVAA 3SQGA 2R7WA 4PR6A 1KSPA 2V50A 1JLBA 4MKVA 4L73A 2ZVSA 3ILIA 3U02A 4CH0S 3BO4A 2VA2A 1CJTB 4WIQA 3J7YI 1SV5B 3F56A 3M05A 3MR7A 3J80U 3VZIA 2ZH1A 1HYSA 1WHYA 4I6YA 5IV3A 2DEIA 1L3KA 1UW9A 2M2BA 4OMFG 1RHQB 5KFXA 4JB8B 1X4AA 2RT3A 2GIQA 4FYYB 4JI6F 5J2NA 4OV1A 2CVIA 2DGQA 1FTCA 3NGRA 5HP1B 4OHYA 1AFIA 2K3KA 1RAAB 2ZOMA 4YN3B 3CDUA 1TKDA 3DRPA 1P6TA 3A8IA 2BDPA 1S79A 1HNIB 4IRCA 1QLNA 4YY3J 4J9SA 4K50A 1HBOA 1PKUA 3MCOA 1SH3A
chains in the Genus database with same CATH topology
4YS2A 1VCTA 2AEMA 3L4BC 4J9UE 2OGUA 4GVLA 4L73A 4G65A 2FY8A 4L74A 2BKOA 2BKPA 4EI2A 2AEJA 4RO0A 3RBXA 4J91A 4J9VA 4J90A 3JXOA 3KXDA 4XTTA 2AEFA 3RBZA 4J7CA 1LNQA 4L75A 2BKNA 4L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YS2 A;  1VCT A;  2AEM A;  3L4B C;  4J9U E;  2OGU A;  4GVL A;  4L73 A;  4G65 A;  2FY8 A;  4L74 A;  2BKO A;  2BKP A;  4EI2 A;  2AEJ A;  4RO0 A;  3RBX A;  4J91 A;  4J9V A;  4J90 A;  3JXO A;  3KXD A;  4XTT A;  2AEF A;  3RBZ A;  4J7C A;  1LNQ A;  4L75 A;  2BKN A;  4L76 A; 
#chains in the Genus database with same CATH topology
 3ZZT A;  1FRJ A;  4QWC A;  2KFN A;  5C25 B;  3U1M A;  1H2V Z;  1MML A;  4ATN A;  2NS1 B;  2G0J A;  5LMN J;  3NY0 A;  4UOC A;  1QAI A;  1NK7 A;  1V3S A;  3AT1 B;  3BYR A;  2JEI A;  2O3D A;  1XR7 A;  1C0T A;  3LGH A;  3H4D A;  3PIO Q;  4P72 A;  4DZD A;  3MR2 A;  2B0G A;  4DCO B;  3TA1 A;  2OPS A;  4OYB A;  2JHE A;  3POT B;  1IKW B;  1VLO A;  2HGM A;  4YEA A;  4KH1 B;  2GNK A;  4O44 B;  5E3Q A;  3CC2 S;  4B3R F;  2MST A;  4DSI A;  1OQ3 A;  1WAC A;  3NGK A;  3PNI A;  1VIS A;  2J0W A;  1HBN A;  2LEA A;  4RW6 A;  5IM0 A;  1MNE A;  4JI0 J;  4ZJL A;  3R27 A;  3VAG A;  4W90 B;  4IOB A;  4F3O A;  4NOH A;  2GVD A;  2H5I B;  3SBM A;  3CDW A;  2YH0 A;  2R2T A;  1CQN A;  4ZHR A;  4RJV A;  3PW5 A;  2NPI A;  4I56 A;  5IT4 A;  2RUS A;  3X3U A;  3WIV A;  3DRS B;  4LF8 J;  4DF8 A;  4C7Q A;  5BYS A;  4JI5 J;  2GIR A;  3WIU A;  1S49 A;  4F8R A;  1RT3 A;  5E7O B;  4WKY A;  4UT4 A;  1U1O A;  3CE8 A;  2OGU A;  3RG6 A;  3GFH A;  2EKY A;  4DG1 A;  5DQH A;  3R8Y A;  3N6N A;  3HHE A;  2PMZ D;  1HBM A;  3W9H A;  1SH2 A;  3FUY A;  3GIR A;  3KK1 A;  1UVM A;  2R42 A;  2GGP B;  4PWU A;  4CO0 A;  1ROF A;  8AT1 B;  1FXL A;  2ZZT A;  2XI3 A;  3T6B A;  4B9T A;  3QGI A;  1F9E B;  2EFG A;  1PG5 B;  2QZ8 A;  1ZM9 A;  2JVR A;  4W92 B;  4HLB A;  4EU0 A;  1IBK J;  1TAQ A;  1UWA A;  2DJW A;  1TFY A;  2Y0B B;  2BE7 D;  3OL7 A;  2J0S D;  4NLG A;  4PXE A;  5AT1 B;  2RDJ A;  1V5V A;  4Y00 A;  4K0K J;  2HYI B;  1R6V A;  2MQ8 A;  2RF2 A;  4RWW A;  5KT3 A;  1DTT A;  2HLT A;  1Q0N A;  1H2T Z;  2M0G B;  1N33 F;  2R9L A;  1ZM4 A;  3MPD A;  2XY6 A;  4X62 J;  4EK2 A;  3FKB A;  2KXF A;  3ICL A;  5A2Q Y;  4KFB A;  4ED5 A;  2X1B A;  3KJF B;  3RAX A;  3CD0 A;  2KYX A;  2ZH9 A;  3TOQ A;  2ZIT A;  4AL5 A;  1JLQ A;  2BZ2 A;  3MPW A;  3EGZ A;  5LMU F;  1VK8 A;  2MMY A;  2W7A A;  1GX6 A;  2K2P A;  2ILZ A;  1KEK A;  4URS A;  2Q1L A;  1F2H A;  3E01 A;  1IR1 A;  2QMU B;  1NB7 A;  5AXL A;  4LJM A;  4TU8 A;  4DZ6 A;  3EMT A;  3H4B A;  2JRS A;  5IS2 A;  2BXJ A;  3CNQ P;  1GEH A;  4L3N A;  4AXJ A;  5CZX A;  4KV8 B;  2IRY A;  1RTD B;  4X65 J;  2W4C A;  4FVM A;  4TN2 A;  2I9S A;  5JUM A;  1R8C A;  4TU9 A;  5CD4 H;  4HDG A;  2ZBI A;  2FHK A;  5D0H A;  1VS3 A;  3MOJ B;  1SJR A;  4LVN P;  4LR7 A;  2FUG 9;  1WC1 A;  1T9W A;  3VR1 A;  4PG5 A;  1NJW A;  2OI2 A;  3W64 A;  5E41 A;  3IAM 9;  3BGR A;  4ZN1 A;  3N0V A;  2MKJ A;  1NZA A;  2ZFH A;  1FJC A;  3GE9 A;  2XSJ B;  1XK8 A;  2IIH A;  4FXV A;  3Q8S B;  3NCQ A;  2OFG X;  3QZ7 A;  4LSL A;  4UOH A;  3IS9 B;  3PM9 A;  1WEZ A;  2DH9 A;  1WHV A;  2DD8 S;  2MY8 A;  2D74 B;  3ZTO A;  2W4D A;  2Z2M A;  2DHG A;  1K8A T;  2EBG A;  2V8H A;  5I3U B;  1HA1 A;  3NGT A;  1EQ0 A;  1QAX A;  2BAN A;  2RRN A;  3TX0 A;  4F67 A;  3MUR P;  1JLA B;  1UVN A;  2M8H A;  2GMJ A;  4M5D B;  1M1G A;  3QGG A;  4PG6 A;  2B43 A;  5A0Y B;  3V6H A;  2UXC F;  1TK8 A;  2B5J A;  3OL8 A;  3R7B B;  3OXG A;  1QSY A;  2R7X A;  2YWW A;  2ZWO A;  4AE5 A;  3I56 S;  2CDR B;  1CVJ A;  3B6B A;  4C8Y A;  2UU9 J;  1FVS A;  2RDD A;  3TQE A;  4N5S A;  2HZA A;  4DS4 A;  5EX0 A;  1FVQ A;  2BKO A;  2MPU A;  1JLG A;  4B3M F;  2WBM A;  5EWF A;  1FJG F;  4QU6 A;  2AYE A;  4ILM A;  1WKL A;  2G0C A;  1RWV B;  2QL9 B;  1ZAV A;  2Z30 B;  3RB6 A;  3KG4 A;  3S8S A;  1Q5Y A;  5HVG A;  1VC0 A;  1AUD A;  2X3G A;  1G4C A;  3G6E S;  2Y1J A;  2LQJ A;  1RTD A;  4LBI A;  3O44 A;  3DGV A;  3N01 A;  3CC7 S;  3IP0 A;  4F0M A;  4B9V A;  3K0J A;  4DUZ J;  3GR1 A;  3QQC D;  2ZUG A;  3HPO A;  3LP2 A;  4ALZ A;  2F40 A;  3GFX A;  2NLW A;  4I2P B;  4IOC Q;  3MUV P;  4R25 A;  2NPF A;  4F36 A;  5HMW A;  4CTA B;  2OP5 A;  2BAN B;  4TY8 B;  3QPI A;  1N5T A;  2IJF A;  4JI3 F;  1RWP B;  4EWT A;  2KXH A;  3KLG A;  4PQA A;  2QLJ B;  5D0R A;  3TJA A;  5IWA J;  1I5O B;  2HPU A;  3W5Z A;  3K59 A;  4TY9 A;  2X51 A;  3MEC B;  1S1T A;  3DOK B;  5GME A;  3SCK E;  1F6T A;  2P9C A;  4DWI A;  1SCJ B;  4DV1 J;  3MM8 B;  4ELV A;  4LSL B;  4FBT A;  1IJE B;  3D3C J;  1RBL A;  1J5O B;  1YJT A;  2IRX A;  3TUZ C;  4JI1 J;  3C15 A;  1WC5 A;  5A76 A;  1FJ7 A;  2AYM A;  3UPF A;  4WKR A;  4WK1 A;  3UN2 A;  5DM7 Q;  5LL6 d;  3ZZ0 A;  2BKN A;  3IRW P;  3CJR A;  3RBD A;  1FDB A;  3V6J A;  3IBW A;  4EYI B;  2ASD A;  4JYA F;  3BGF A;  4QPT A;  4OX7 A;  2EFV A;  1RHR B;  4IO9 Q;  3T5K A;  2FVS A;  5DRK A;  4HTI A;  1U8S A;  1H2U X;  2N4D A;  3EZO A;  2J8A A;  3SXL A;  2N82 B;  3W9I A;  1FKP A;  5IC4 B;  1B4S A;  4YB5 A;  2VG6 A;  1EKR A;  3B4M A;  2CJX B;  2G13 A;  1OSD A;  2K1R B;  1RHM B;  5KOW A;  2GIF A;  4RNH A;  5J1N A;  3M8S A;  2P5V A;  1YG0 A;  1XC9 A;  4WFZ A;  3UDC A;  4YR2 A;  4J9R A;  3SZ2 A;  2HHT A;  3D3B J;  1MU2 B;  5KFC A;  1UWB B;  1RWK B;  1Z2Z A;  2PDA A;  3A13 A;  5H1S V;  3KLF A;  3R6L B;  1XR6 A;  2EFQ A;  2J8S A;  4ZJO A;  1ARO P;  2JJ4 D;  2CQ4 A;  3AOB A;  5HVF A;  3GV7 B;  1EP4 B;  1SBR A;  2A1B A;  1B0T A;  1U2C A;  2HLU A;  4YDX A;  4F4A A;  4KE5 A;  2EFP A;  4D3G A;  2FZC B;  1B0P A;  4J9P A;  2L9W A;  3D1O A;  4U7U D;  2KHC A;  4X4N A;  1KDN A;  3BQ1 A;  3OL9 A;  4BWJ A;  1N5Q A;  1G3O A;  3KUG A;  2EFO A;  3CJK A;  3BO3 A;  4P74 A;  2VPX B;  3UE2 A;  3OFF A;  2I5J A;  1RAB B;  4OJ3 A;  3TR5 A;  4CNY A;  2FLL A;  3CME S;  1TFW A;  3IBF B;  1NCL A;  3FBE A;  4QYR A;  1BQN B;  3ENV A;  1IXK A;  4NCA A;  1S1W A;  4CLS A;  3CJQ A;  2HS4 A;  4FNH A;  4USK A;  3MUM P;  3KDN A;  1N88 A;  4PWW A;  3QZ8 A;  3KLH B;  1WC6 A;  4DR5 F;  3D0H E;  1VHF A;  4ICL A;  2VG6 B;  2H3E B;  2A3J A;  2M88 A;  4F04 B;  1EQM A;  2CPJ A;  3T5H A;  2DGU A;  3T1A A;  2HHX A;  1TKZ B;  2EXU A;  3HFV A;  7FDR A;  2IBO A;  5HMZ A;  1ULR A;  2HRT A;  4DV3 F;  1S4E A;  5EWE A;  1N52 B;  1UJ4 A;  2FJA B;  1U4B A;  2OTL S;  4TYA A;  4XIU A;  2LA6 A;  4EGL A;  4Q7A A;  5KT5 A;  2V4J A;  5DDQ C;  1YBU A;  4C97 A;  3OR1 A;  1VOM A;  2EG1 A;  1PAE X;  2LQ5 A;  1WF1 A;  3JYT A;  4DR7 F;  3FRZ A;  1F5A A;  2Y0S D;  2HSE B;  3N5B A;  3E8O A;  1N56 A;  4KO0 A;  2F7V A;  3NLC A;  2O1P A;  1HNI A;  2RUG A;  3BSC A;  4KHR A;  3MF5 A;  4DJB A;  5L1L A;  2Q66 A;  1ELO A;  4I64 A;  2FJB B;  3GYN A;  4M5H A;  2O66 A;  4A8Y A;  2R2R A;  1X0P A;  4HKQ A;  5DGB A;  3RTV A;  5F41 A;  2VF3 A;  1LOU A;  4O4R A;  1TL5 A;  2R4F A;  2Z57 B;  4USI A;  4RU2 A;  1RAJ A;  4OX6 A;  2VZ9 A;  4YB1 P;  3PV8 A;  3NNH A;  3DC2 A;  4DN9 A;  4J9N A;  1VJW A;  4LUB A;  2FC9 A;  4WP8 A;  1VQ8 S;  1RP5 A;  1Q8I A;  1FXD A;  2COL A;  2W24 A;  3M7V A;  5L9N A;  1GMV A;  4IR1 A;  1IBM J;  1OSC A;  4XDC A;  4JI5 F;  2XS5 A;  2QLX A;  2ZNZ A;  2RQC A;  2W2Q P;  3D68 A;  4YS2 A;  4I2P A;  2HKE A;  1U47 A;  3DLK A;  4ZN3 A;  4OHW A;  1HBN B;  1TMJ A;  1RQ0 A;  2NXC A;  4G1Q B;  3HDS A;  1HR0 F;  4DSL A;  2L08 A;  1ACM B;  1JLG B;  2HQI A;  2WVF A;  3FSY A;  5GAG U;  4U6P A;  4QWE A;  1F3F A;  3MM9 B;  4G65 A;  1E6V B;  1U09 A;  2JC1 A;  1U49 A;  2DNR A;  2VG7 A;  5F3T A;  4V1A k;  2CQB A;  2CPD A;  4CM0 A;  3M2V B;  2RS2 A;  1DJ0 A;  2RB7 A;  4IDK B;  4RW9 B;  4EEY A;  1SV5 A;  1J5E F;  1K73 T;  2IPO B;  4DPT A;  4KTQ A;  1S6Q B;  1X5S A;  3GMG A;  5T7L B;  1FXR A;  2XMT A;  1KBR A;  1ZOT A;  2V6A A;  1WEL A;  2BVZ A;  2C3U A;  2MSS A;  1F3V A;  1JLE B;  1U25 A;  2GC8 A;  4WBF A;  5FD1 A;  6FDR A;  2XZW A;  2PMW A;  1VQM S;  3DOM A;  2CPH A;  1X7V A;  3MEC A;  3PR4 A;  4JI1 F;  5A2Q U;  3M6U A;  2CG4 A;  2QSW A;  4BS2 A;  5C2C A;  1REV B;  2W2P P;  2CPI A;  1HBU B;  1J2V A;  1WI8 A;  4IFV A;  1DZ5 A;  1ZPV A;  4URQ U;  4OI6 A;  3J7Z T;  2HZV A;  2DRA A;  2UXD F;  1M1H A;  3CJ3 A;  3IMQ J;  4BHQ A;  4P2X A;  3NGS A;  1X4H A;  2J7K A;  4JI3 J;  4ZLJ A;  3R7S B;  3DM2 A;  2IM2 A;  1JWW A;  3PEJ A;  4RW4 B;  1JK9 B;  1CJU B;  4PXD A;  3HZG A;  3VVT A;  1KVK A;  2UV8 G;  1QSL A;  2F5G A;  3CC4 S;  5D3G A;  2YX1 A;  2DYA A;  4LT6 A;  2GQQ A;  3K7R A;  4DV4 F;  1R6Y A;  1VQO S;  3VAM A;  4M94 A;  2AYG A;  3TZX A;  1NU4 A;  1CC8 A;  3QIP A;  3KWM A;  2XHW A;  3LP0 A;  3DCA A;  3PDN A;  4R0J A;  4BCA A;  2DR5 A;  1B99 A;  1XWL A;  4RWX A;  4NLR A;  3LAM A;  1O6X A;  2V8D A;  2E7X A;  2WSC C;  1C0U A;  3CO0 P;  4OV6 A;  1QD1 A;  1ZM3 A;  2AMC B;  3UNG C;  4ZIT A;  2CNL B;  1C1C B;  3MM7 A;  3TUP A;  2C1E B;  3GSD A;  4ER8 A;  4FYV B;  4DSJ A;  2HAI A;  1K9M T;  2HUR A;  4BC9 A;  3R9L A;  2UVR A;  3HUL A;  3G82 A;  4HT7 A;  4BBY A;  1VIX A;  1R89 A;  4WFX A;  1LV5 A;  2DRB A;  2VDH A;  2OAU A;  4OYP A;  2VU5 A;  2WON B;  5CQG A;  1YSJ A;  3N9U C;  5AXN A;  4MKA A;  2HMI A;  1WG1 A;  1NH8 A;  3AOC A;  2H4W B;  3DRP B;  4PG4 A;  2UUA F;  3UNY A;  5KT4 A;  2AEF A;  5KFW A;  4KRW A;  4OI0 A;  4FZV A;  1HWK A;  3FSX A;  4J7C A;  4O3S A;  2DO4 A;  5IFM A;  1A6L A;  2KTQ A;  1UL3 A;  1AA1 B;  1S99 A;  2FVQ A;  1CLF A;  1DQ9 A;  1FWP A;  5C5J A;  4RW4 A;  4PEO A;  3CJ5 A;  4KSE B;  3W62 A;  5KFN A;  1WOP A;  1CQM A;  3UN5 A;  2J6S A;  1FRL A;  4MIB A;  4A8S A;  3QT6 A;  5LSO A;  2VL1 A;  4KGV B;  2C3O A;  4GVB A;  2ZD1 A;  4DR3 J;  4UY8 T;  2X1F A;  4X2B A;  1EET A;  4URG A;  2FY8 A;  1T9Y A;  2HFU A;  4N56 A;  1DLO B;  2YX4 A;  3GG1 A;  4PQU B;  3MMC A;  1F1B B;  1JLF A;  1X5O A;  4A4J A;  2HVI A;  2CQC A;  2J9C A;  2UVW A;  2ASL A;  1F60 B;  2CQ1 A;  3R5A A;  4NXM J;  3DKD A;  3P49 B;  1BD6 A;  2ZDO A;  2XSJ A;  1LWC A;  5KFD A;  4CRJ A;  4ETZ A;  4X4O A;  4J37 A;  1T3N A;  3HSZ A;  3A8K A;  5HAO A;  4LF5 F;  1HI1 A;  3OFG A;  1RIS A;  2MLZ A;  2DCL A;  5CYM B;  1HW8 A;  1ZH5 A;  5KFE A;  1MN9 A;  1KOO A;  2FDN A;  2GVZ A;  3CMQ A;  4I68 A;  4RW9 A;  5K8M A;  3KLF B;  3NMR A;  4DL7 A;  4C9D A;  5D3G B;  4NMX A;  3GII A;  1FRX A;  2ZJQ Q;  4OZ5 A;  2MY7 A;  4NXM F;  1FX2 A;  5EHH A;  4ZDN A;  1E6Y B;  3HX9 A;  5IT0 A;  5KFQ A;  3P6Y C;  1PJ7 A;  1HLW A;  2PA3 A;  4TLQ A;  1U6F A;  3UD5 A;  2QE5 A;  2EVZ A;  3NS6 A;  2YQ0 A;  1N5S A;  2ZBR A;  3VHQ A;  4C2M A;  4NWB A;  2KI2 A;  4LQ9 A;  2HVH A;  4F25 A;  4H4M A;  4WP3 A;  2LEP A;  1N5V A;  3W2W B;  4F4X A;  3ET6 A;  3CF5 Q;  3B4D A;  3SEO A;  2BE2 B;  1ZBT A;  3DLK B;  3GZ7 A;  3WQP A;  4A8X A;  3W8P A;  2RF2 B;  3OSP A;  3D6F B;  3LTO A;  1Y5N B;  4I7F B;  3HI9 A;  3KLV A;  2QEX S;  1TV6 A;  2NCK L;  3BQ0 A;  3DLL Q;  1I3O B;  1FD8 A;  2AJ1 A;  3QT5 A;  4WJB A;  4R5P B;  1N33 J;  3ZTP A;  3Q8U A;  1L5U A;  3NBP A;  2DNY A;  2HFS A;  2GZO A;  1SQE A;  1RAE B;  2IJR A;  4AFF A;  4LF9 F;  5HLF B;  2VG7 B;  4HHJ A;  3C6U B;  2P8I A;  5KFG A;  2DY9 A;  3HM9 A;  1HPZ A;  2J9D E;  3D28 A;  1N4L A;  2HIY A;  1RU2 A;  1FNM A;  1NSK L;  2KT5 A;  1IBK F;  3KMQ A;  3W3S A;  4Q0B A;  4DQR A;  1R3N A;  2PO4 A;  3IG1 B;  4CLP A;  1HNZ J;  2FLN A;  1SQF A;  2ZD1 B;  1Y4Z B;  5T7L A;  4KR0 B;  3G6X A;  5A8K B;  3VQT A;  1IKY B;  4A8W A;  3FSI A;  3TQ1 A;  2EFN A;  1ZAW A;  4USU A;  1TK5 A;  1TL4 A;  2OEK A;  3BF4 A;  2V8V A;  1KLM B;  4CDI A;  3E3X A;  4CT8 A;  3C2P A;  1GTH A;  1RE1 B;  3CCW A;  2R8I A;  1IKX B;  3M30 A;  4JI7 F;  2W2N P;  2VQE J;  3PW0 A;  1LWC B;  3UDV A;  1TZ0 A;  2E1R A;  1WC3 A;  2CJ9 A;  2W8L A;  1JQG A;  4ZLN A;  2GA7 A;  1UEV A;  2FLP A;  1AFJ A;  2DNZ A;  1VQ7 S;  5ETO A;  1NK4 A;  4X66 F;  1S0O A;  3L4B C;  5JXS A;  3PR5 B;  3GU0 A;  3VV2 B;  1HNX F;  4ELU A;  3T1Y J;  1AT1 B;  1NDK A;  2VG5 A;  1FI4 A;  5BR8 J;  1GMU A;  3TI0 A;  3JAM U;  3JSM B;  2WB4 A;  5U47 A;  3TUI C;  2J6U A;  3BN4 A;  4DCJ B;  3MAA A;  3PRB A;  1T11 A;  4NRT A;  4LVO P;  3I4P A;  4USM A;  4PWD B;  2ABY A;  2FPH X;  2YNF A;  2UUB J;  2DIT A;  3GV5 B;  4LFC J;  3LAK A;  1XQI A;  2XMK A;  1S6U A;  3JTP A;  2HHH F;  2LLZ A;  3MTJ A;  3ILJ A;  1KFD A;  3LP0 B;  4F2R A;  5JJB A;  4Q5V A;  3CJS A;  2V69 A;  1SI9 A;  1MWY A;  2BRK A;  2CXE A;  1B7Y B;  3DMJ A;  2GAG C;  4DUY J;  1HHQ A;  4DV7 F;  5J2M A;  1KLN A;  2XS7 A;  2YBV A;  4ZIW A;  5ITH A;  3T9Z A;  1N36 F;  1JXV A;  2YXL A;  4YHH J;  3D0I E;  4FF1 A;  2GW8 A;  1RXO B;  3I0R B;  3M32 B;  4C6A A;  1HBO B;  3QFH A;  2XYP B;  4GRS A;  4K59 A;  3SDE A;  3KJV B;  1RHJ B;  4LBH A;  1QY7 A;  5JVG Q;  3GTY X;  1ZA1 B;  2HRY A;  3LPE A;  3OVA A;  3LWL A;  3KUE A;  2BMB A;  4L74 A;  5CCM A;  3NOC A;  2HHS A;  4RNF A;  2HRU A;  2MLY A;  1U0H A;  5H9E J;  4DN0 A;  3GB0 A;  5F8J A;  4IRK A;  1FDN A;  1WHX A;  3CVK A;  1G1X A;  5E3C A;  5DG8 A;  3CB4 A;  1TEL A;  3B54 A;  1N48 A;  2DEJ A;  2ZC3 A;  1HD0 A;  3MMA A;  5K14 B;  3BQ2 A;  3AAW B;  1KC8 T;  3ET6 B;  1VDH A;  4DR6 J;  2PE8 A;  3QLH A;  4F7V A;  3UN3 A;  2FVR A;  4I6A A;  3FMW A;  1S5Z A;  4DR3 F;  2IC3 A;  3GLJ A;  4NLV A;  2MQL A;  1SC3 B;  2ZKU A;  3GCX P;  3GSI A;  1VBX A;  1S0V A;  1LW2 B;  2XUL A;  3IA0 A;  4XPC A;  1F2G A;  3MR3 A;  3OLB A;  1HIY A;  2OEL A;  3LUY A;  1RTH A;  4ECU A;  1JJ4 A;  1UVI A;  1AZS A;  1BQM A;  3K5N A;  4R8U A;  2HHW A;  1TAU A;  4WF9 Q;  1UZH A;  1UP1 A;  1M0S A;  2MKK A;  1QE1 B;  3OXL A;  4L6V 3;  2VV5 A;  2WW4 A;  2UUA J;  1NND A;  4ZCL A;  2BM1 A;  1UJ6 A;  1BHN A;  2E9R X;  1HWI A;  4QWD A;  2VOO A;  1N36 J;  3LF0 A;  5IT9 U;  1T05 B;  4WFN Q;  3R2C J;  3CCT A;  3JSB A;  3K8V A;  1OS5 A;  1UTA A;  4ZVF A;  4O3P A;  1G6B A;  3RB3 A;  1P9Y A;  4KQZ A;  3V2U C;  4WZM A;  1LXN A;  2QRR A;  4J9O A;  1ZAX A;  4RW7 A;  5A6W A;  2MKI A;  4DFP A;  2CIM A;  1BUX A;  4H54 A;  4IH5 A;  2A2D A;  4HDH A;  1EZZ B;  4LIW A;  5GAE U;  1EET B;  4O0N A;  4DR2 J;  3ENW A;  1ZZN A;  3HK2 A;  4KIA A;  1C2P A;  1UVJ A;  5ETS A;  3DXS X;  5HRO B;  2UUB F;  1CEZ A;  2GMH A;  3RW6 A;  3PX0 A;  1OPI A;  1S9E B;  4MFB B;  1D9F A;  3PX6 A;  2OJ3 A;  3SSS A;  3JB9 k;  4KT0 C;  4ES3 A;  4NX9 A;  3EGW B;  4PXB A;  2IBK A;  3IM8 A;  1FFG B;  4H4O A;  4DX8 H;  3T1Y F;  4IH7 A;  3PYF A;  4IRD A;  2B4P A;  4CLL A;  5BXI A;  4UUX A;  2MKS A;  1E6V A;  1PAU B;  1LWE B;  2QLB B;  2QMW A;  2DGT A;  3AOA A;  5DG7 A;  2BV3 A;  3M6W A;  2D3U A;  2HBZ B;  2WSF C;  3KK1 B;  3EPG A;  1VQ9 S;  4ED8 A;  4TY8 A;  3Q2S C;  5THW A;  3HF5 A;  1P1L A;  5D0G A;  1XMO J;  1QAJ A;  2QSF A;  4OYO A;  1VQ4 S;  2DXF A;  4HI2 A;  4OI4 A;  3WDO A;  4B9L A;  1S77 D;  1NJY A;  1YDL A;  1ZZF A;  2PFD A;  3GIJ A;  3DRS A;  5EWG A;  1U6B A;  3ZFV A;  4EUV A;  5FLX U;  5B0G A;  2W9A A;  4NPO A;  2B6A B;  1FWL A;  1UCN A;  3MAH A;  1HI0 P;  1RWN B;  4AL7 A;  4UY8 5;  2FHM A;  2R7O A;  1IN0 A;  2GX8 A;  3FVY A;  2P6S A;  3C6T B;  4JI2 J;  4GO7 X;  1GXU A;  1NDC A;  3OXF A;  4HHU A;  2C3M A;  1QUV A;  2H65 B;  2ZWP A;  3T9N A;  3W60 A;  1IWG A;  2GHV C;  3PTW A;  3QGH A;  1JLA A;  1RHU B;  3NP5 A;  3E51 A;  2EI5 A;  9RUB A;  1FEH A;  3IR7 B;  2A2C A;  1DAR A;  4C11 B;  1LWF B;  1JJ2 R;  1N5Y A;  1SJQ A;  4B17 A;  1MSW D;  1P8G A;  5HI7 A;  2HHV A;  1CBK A;  5I3Q A;  2X1A A;  3FQK A;  2ZNY A;  4Q2L A;  3V81 B;  2LU2 A;  3JQJ A;  4DR1 F;  2MEW A;  2RQ4 A;  2G4B A;  2SXL A;  1R0A A;  2UXB J;  1NSA A;  1TL7 A;  2BJ3 A;  2FLO A;  3OFE A;  4DV6 J;  1NHU A;  2WOM A;  4CT9 A;  1YJR A;  7FD1 A;  4ZCM A;  3GFZ A;  1BY9 A;  2NXU A;  3VGT A;  4RX6 A;  2IRU A;  3MFH A;  1VK3 A;  2CQD A;  3K58 A;  3BGL A;  1KS2 A;  2KT3 A;  2CQ3 A;  4ZP8 A;  5HBM A;  3IRX B;  5BJR A;  4LR8 A;  2ZHB A;  2V8G A;  1LQ9 A;  3HZE A;  1FK9 B;  4A8O A;  4GKJ F;  2GJ2 A;  4O3N A;  2D9O A;  5HLF A;  3DYA A;  4QIW D;  1AYE A;  3J7Y U;  3SCL E;  2VQE F;  3HLU A;  5SUH A;  4NA3 A;  3DLG A;  2HGL A;  2LKZ A;  1RT5 A;  3BR8 A;  3UCU P;  3I9V 9;  1TUV A;  1V5I B;  4P73 A;  2POK A;  4G1Q A;  4PUO B;  2OD6 A;  1RT2 A;  5ETQ A;  2BJD A;  4DQQ A;  1OY8 A;  3AB4 B;  3ZTR A;  1IKV B;  1S1X B;  1S1T B;  3DOK A;  3HHD A;  2R8J A;  4W4M A;  1NK8 A;  1FE0 A;  2YKQ A;  2VBW A;  5ETN A;  2O67 A;  4M5J A;  1Z1Z A;  5KG6 A;  5K5M A;  4Q8E A;  4C8M A;  4X84 A;  3G71 S;  1VQP S;  2YNI A;  2HQC A;  5KG3 A;  3PJX A;  3TNV A;  3VAL A;  2E5L J;  1RB0 A;  2VKR A;  2JL9 A;  4BC7 A;  4OZL A;  4MMO A;  4CH7 A;  2W8K A;  1RT1 A;  3GR0 A;  1UPM B;  2IMO A;  2MGZ A;  3VAI A;  4EO8 A;  5H9E K;  4DDF A;  2WRM A;  3HP6 A;  3SI8 A;  2V2V A;  2DR8 A;  3QBC A;  2YNG A;  3PHE A;  4NLP A;  2KFY A;  1RZM A;  2O01 C;  4CLF A;  1SKU B;  3QWU A;  2QA1 A;  1O5J A;  4E8U A;  3KOA A;  1NPP A;  4OJG A;  4TYB A;  3BSO A;  1T9U A;  4KFB B;  3HSD A;  5E3P A;  4NLD A;  3ULH A;  4QYZ J;  4FKX A;  2BOA A;  2DGV A;  3FZ2 A;  3LOU A;  1G2E A;  5DZ7 A;  1IQZ A;  3CED A;  5B0C A;  1PBA A;  4P2S A;  2XCP A;  1CS4 A;  1HQU B;  2VUG A;  2AX1 A;  2ZE2 A;  5H9F J;  1T9V A;  3I0R A;  5CAA A;  4F26 A;  2LEB A;  1TMM A;  3ZTS A;  1MRO B;  2ZVI A;  5C25 A;  3G6V A;  2AT1 B;  4DV2 F;  2QIF A;  4W98 A;  3QT8 A;  3KLG B;  2KJV A;  3MED B;  1T8E A;  3FDS A;  1KTV A;  2DK2 A;  3D1H A;  3FCW A;  4QW9 A;  2AJ0 A;  1TK0 A;  4DV4 J;  2CAD A;  4ED1 A;  1RYS A;  4LIR A;  4OYX A;  2N3O A;  4F4W A;  3BM7 A;  3AQP A;  2VJU A;  2YNF B;  5DS7 A;  3FEZ A;  1C1C A;  2NSC A;  3MM7 B;  5KFF A;  1A7G E;  5SZT A;  1K1Q A;  2VC1 A;  3CCJ S;  2N7Y A;  1NJI T;  3VCD A;  3AB2 B;  3AQO A;  3HKW A;  3BGR B;  4ECY A;  3JTO A;  2FY1 A;  3DRX A;  2RSQ A;  4QR0 A;  3G6Y A;  3RB0 A;  2JLF A;  2P6T A;  5HJY A;  1LFP A;  1SKW A;  5T41 A;  2E7V A;  4ID8 A;  9ATC B;  1MWQ A;  3DDN A;  2QA4 S;  1APS A;  1RTI A;  5A8W B;  2EWH A;  3Q0A A;  2HNY A;  5AE3 A;  3KXD A;  4WTO B;  4USW A;  2VQF J;  2MTL A;  3FFI B;  1T3O A;  2QG9 B;  5KT7 A;  3MGJ A;  1QDU B;  1RCX B;  4JV5 F;  1I94 F;  3SDE B;  1R31 A;  1CUL B;  2HWI A;  4CO3 A;  5C7P A;  4QYZ K;  1HQ2 A;  2MQO A;  2GCF A;  3V6D A;  5A0Y A;  5CCL A;  4J9U E;  1SJF A;  2HEK A;  2YKP A;  3N79 A;  2E29 A;  4QBU A;  2YKO A;  4M5L A;  1RAF B;  1Y00 A;  3KG1 A;  1CJV A;  2WBR A;  4P2F A;  5ADZ A;  4KPY A;  3TA0 A;  2ZKT A;  4FN5 A;  1VHI A;  1KHV A;  3FBF A;  1RSC A;  3EVO A;  3P45 B;  4IG3 A;  2WW8 A;  2EG2 A;  2MQP A;  1HPZ B;  3BBF A;  3IGV A;  5DLG A;  4Q0B B;  2AJQ A;  4E0D A;  1TL1 B;  3AA8 A;  3MI7 X;  3W66 A;  4DCP B;  5HVH A;  4DV0 J;  3Q83 A;  1QVF R;  3NS5 A;  3ETM A;  3OT9 A;  4KHM A;  1IUJ A;  3H59 A;  4F3M A;  2JH3 A;  2E5I A;  3GYG A;  2R2U A;  4M95 A;  4XTT A;  1KN6 A;  2MQQ A;  5FLX Y;  2DIS A;  1P1T A;  1IM4 A;  2RHS B;  2J9D A;  2GS8 A;  3PYE A;  4ZCI A;  3KTQ A;  2KJW A;  4U8Y A;  3CO9 A;  4EFA C;  2KG0 A;  5EUH A;  1S10 A;  4C4W A;  2YKA A;  3Q24 A;  4B02 A;  3BBB A;  2V4R A;  4LF6 F;  3QJJ A;  3IXQ A;  4IKA A;  2B56 A;  1BLU A;  1FF2 A;  5AXM A;  4R8U B;  2PEH A;  3BR9 A;  2ZJR Q;  1FWK A;  2Z4P A;  4P71 A;  5MAO A;  4FKY A;  2OUG A;  2W9C B;  2BE9 B;  4DR1 J;  1HAR A;  4LF4 F;  2LMI A;  2PFF B;  1QTM A;  5C42 B;  1PGZ A;  3KHR A;  3D1Q A;  1IJF B;  4ZPV R;  4NLY A;  4B3T J;  1WTF A;  3A4T A;  4DR7 J;  3ZZP A;  1OIA A;  2DO0 A;  1WOO A;  3DLE A;  2RU9 A;  3JSY A;  4U67 Q;  4FF4 A;  1XNQ F;  1A9N B;  1DTQ A;  5KAK A;  2KM8 B;  1S1U A;  2DB1 A;  3MEE A;  4C98 A;  2ZM6 J;  2DNK A;  3PY8 A;  3LAN A;  2UUT A;  3FEX B;  3BN7 A;  4DV3 J;  4OHZ A;  1YRT A;  4Z37 A;  2WHO A;  1LEO A;  3H2L A;  3P4U B;  5HAN A;  1FRM A;  1YRU A;  2XZT B;  3CJ8 A;  2D41 A;  4FPI A;  4AXI A;  3M9M B;  3K57 A;  1N8R T;  5LOQ A;  1YI2 S;  2D3Z A;  3FCH A;  4DR5 J;  4A8Q A;  3RR7 A;  1D0E A;  4PQU A;  3B82 A;  1Q82 T;  2HS0 A;  1JLE A;  3CCS S;  3BDP A;  2XGP A;  3R5J B;  3I31 A;  2FC8 A;  3O8W A;  1HR0 J;  4QJV A;  1CJV B;  3OR1 B;  3JYT B;  2HVE A;  3U27 A;  1KFS A;  2PEB A;  4FS2 A;  1HNV A;  3PFE A;  4XDD A;  3CSK A;  4RPF A;  2OPQ B;  3Q8Q B;  1RWW B;  5IC6 B;  4ZMM A;  3QRQ A;  1N0V C;  3DI6 B;  3TAR A;  4B9S A;  3OLA A;  4QZV B;  3AJD A;  2YWH A;  1VC5 A;  2RE1 A;  4PPD A;  4C8Z A;  1HBM B;  4HH0 A;  1RA7 A;  1R0C B;  1FCA A;  4FNI A;  1YBA A;  3MOZ A;  2M70 A;  2V9W A;  5HMX A;  4LF4 J;  5J2N B;  1IBC B;  5HP1 A;  3EVM A;  3O6Q A;  3IS9 A;  2LXF A;  3I5C A;  2XMV A;  1SJ4 P;  1HNW J;  4I69 A;  3OTC A;  2GML A;  2PMH A;  4FYW B;  1IQT A;  2W2O P;  3N6L A;  5I3P A;  4B3M J;  1TL3 B;  1JIH A;  1JLB B;  1R0B G;  5I42 B;  2I5J B;  3C66 A;  4RUH A;  2IM0 A;  3LPY A;  2ZC4 A;  3G8S A;  5E33 A;  3KJQ B;  2JZ5 A;  2JOQ A;  4DX7 A;  3NGU A;  4YFU A;  1RI7 A;  2ZM6 F;  4ECR A;  1S6P B;  1KWM A;  4I6W A;  4FVC A;  5KG1 A;  3QSY B;  3RAQ A;  4QCL A;  4YQW A;  3QRP A;  1P27 B;  4LRB A;  4O4G A;  3M6X A;  3IAS 9;  4NEY A;  4MKB A;  2A18 A;  2HND A;  3CDB A;  4WII A;  2OML A;  2I6W A;  1RT6 B;  3RGI A;  2CNK B;  2XI2 A;  1VQS A;  2RKI A;  1HMV A;  1U2R A;  2CJQ A;  4CO5 A;  1YK9 A;  3H42 A;  4IFY B;  3TVZ A;  2VIH A;  3ILO A;  1ZTT A;  2KFZ A;  5L8R C;  3CCM S;  2K1R A;  3LQV A;  4WXO A;  3QID A;  4CWB A;  4B3O B;  5KFY A;  4TQR A;  4LRF A;  1YRX A;  2C2M B;  2K7J A;  4NML A;  2RH3 A;  5LJ5 Y;  3HT3 A;  1P9Q C;  3GG0 A;  3M30 B;  4DSK A;  1FJE B;  1N54 B;  3OTB A;  1NPK A;  4X4Q A;  3BKF A;  2CWX A;  2C2K B;  3HHN B;  4K4W A;  1TP7 A;  3X1L B;  1Q7L B;  1TU0 B;  4WZQ A;  4J90 A;  3NKY A;  2XMA A;  1FEE A;  4I1T A;  3HD2 A;  3TW0 A;  4NA1 A;  4NLQ A;  2MZT A;  3W65 A;  1RAI B;  1VRT A;  2F4F A;  4P6Q A;  3GIL A;  3PX4 A;  2XBP A;  3HCX A;  2U2F A;  1YZ7 A;  2JC0 A;  4I4B A;  4NZ6 A;  4ZCK A;  4X65 F;  3IC1 A;  3J7A 1;  3KHL A;  2H5E A;  5B7W A;  3CW2 C;  2LA4 A;  3A3N B;  1VQY A;  3HSJ A;  2BAB A;  1IR0 A;  2AZ1 A;  1RT6 A;  2HHP A;  2LQB A;  2QGF B;  5DDO C;  1GMW A;  5E3R A;  4C8N A;  3D2W A;  3NL0 A;  1H3D A;  3PXG a;  4M63 A;  2YKM A;  2EW9 A;  2RML A;  2BUN A;  2MYF A;  5MLC V;  2OHD A;  1PYT A;  3D9B A;  3LW5 C;  4M5M A;  3MD1 A;  4NCG B;  5CH7 B;  2AWZ A;  4CTA A;  3TVK A;  4YUD A;  1VBZ A;  2HS3 A;  4DX5 A;  3DOL A;  3OJS A;  5EDW A;  3F44 A;  1F9H A;  2LQ9 A;  4Q44 A;  2C2Z B;  2QC3 A;  4GVB B;  2XLJ A;  2NZC A;  1T0T V;  2B4O A;  2V63 A;  4RU9 A;  4RUA A;  3PEH A;  1O51 A;  2GHP A;  2R7Q A;  5HSP A;  3KLE A;  3V4I A;  3JQK A;  4C0O C;  3RR8 A;  5IWA F;  4N41 A;  1UVL A;  2W2M P;  5IQQ A;  3MEG A;  5CYQ B;  2IM1 A;  3M6V A;  1NLK L;  4DSE A;  4U96 A;  2K7K A;  4HL9 A;  4NLO A;  3AA9 A;  4NRU A;  1D3W A;  3TEG A;  1VIO A;  1X4B A;  4Q45 A;  5KG4 A;  3J81 j;  4YOE A;  2XHC A;  1WKK A;  5ETR A;  3P5B P;  3FGV A;  4H4O B;  3VVU A;  2KDO A;  4EI2 A;  4AL6 A;  2OPQ A;  4P2M A;  4DS5 A;  3G2X A;  4P7T A;  3G8Q A;  3SIP B;  3DNC A;  1UFW A;  4H4K C;  2W9C A;  1Q95 G;  2M4M A;  3KDO A;  2YWE A;  1FTR A;  4MK9 A;  3SSQ A;  5J1E B;  1E6Y A;  2BQU A;  2HBR B;  2MDA A;  2MKC A;  1XMO F;  2FVP A;  1FRH A;  2CZ4 A;  4LF8 F;  4TU7 A;  1Q53 A;  5KFJ A;  1F5B A;  3OQ2 A;  2RQM A;  5KFM A;  1RAH B;  2HFZ A;  2NXN A;  1RT3 B;  3IGN A;  3MEK A;  4NL5 A;  1LXJ A;  5KFL A;  4UZB A;  1Y5L B;  3QGP A;  3KLH A;  4PWD A;  4AD6 A;  2IYI A;  4MH8 A;  4IQM A;  3OVS A;  3ENQ A;  1H7X A;  1TL3 A;  2F8E X;  4DV0 F;  1NBE B;  2CJK A;  5GVQ A;  4LFB J;  2BA9 A;  1AB8 A;  1C0U B;  3HVW A;  4ZVG A;  3KK2 A;  3CUN A;  2FQQ B;  1WJ9 A;  3PJ9 A;  2PII A;  3M8Q A;  3PCO B;  2E1A A;  1C1B A;  1YZ6 A;  1BQX A;  1FES A;  1T9T A;  3MCS A;  4XK8 C;  4NCG A;  5DZ6 A;  1XN9 A;  2ZOF A;  5CXT A;  2I2Y A;  5HK4 A;  4ZIV A;  2B51 A;  2KN4 A;  3MZI A;  3N6M A;  3RZA A;  2EPI A;  4DQP A;  2IHR 1;  1YBT A;  3W5Y A;  4LF7 J;  3PW4 A;  1X9S A;  2IFX A;  1XMB A;  3ELH A;  4O0I A;  3ZXW A;  3EUN A;  5A8R B;  3A1Y G;  4YY3 F;  4ZPC A;  4J9K A;  2KZZ A;  3D67 A;  1A0O B;  1MRO A;  3UD3 P;  3J7Z 5;  1W26 A;  1NSQ A;  3PKM A;  2N7C A;  1BGX T;  4QIV A;  4JV2 A;  3EZU A;  1D1U A;  2KB2 A;  2U1A A;  1NDL A;  3VQS A;  4KJI A;  3A12 A;  3TP2 A;  4MAK A;  4OIX A;  2H48 B;  4TLR A;  3TX8 A;  5KFK A;  2HK2 A;  2W25 A;  4MTP A;  3A3P B;  3MTK A;  4K7Q A;  2AJ4 A;  3H5U A;  2EKN A;  4QOT A;  4CP5 A;  5L38 A;  2ZEJ A;  3C8Y A;  5L46 A;  2CPZ A;  1X4D A;  1MWZ A;  3BH6 B;  1WSR A;  3K89 A;  1NJX A;  4JV1 A;  2CYY A;  3UCZ P;  3FEY B;  3ZNU A;  3EGN A;  1TKT B;  3R5D A;  4RW7 B;  1KQK A;  4C3M A;  1T03 B;  1LW0 A;  1Y7P A;  5KFA A;  1D9D A;  4MYU A;  3HVT A;  3ISN C;  2HQD A;  2VPZ B;  3BH7 B;  1FE4 A;  3FCV A;  4HI1 A;  4ZVR B;  1HQE A;  4ETX A;  3TAP A;  1UVK A;  2ZOG A;  1LNQ A;  3VAJ A;  2AHO B;  3QO9 A;  4QIG A;  2I8E A;  2C3P A;  4DPX A;  2VFU A;  5DET A;  4X64 J;  1LFW A;  4C8O A;  3EYZ A;  1T94 A;  1PIL A;  1AZS B;  1BQM B;  1DHM A;  5M2R A;  2VAS A;  1CPZ A;  4GVL A;  4G6V B;  2ZH4 A;  4RR5 A;  3TAM B;  1U1M A;  1TKZ A;  5D4L A;  3N5F A;  4K5S A;  1F9F A;  1WDT A;  5D6G A;  3Q22 A;  2XCA A;  2DNQ A;  2MGZ B;  3M8Q B;  2RJZ A;  4J9M A;  1N34 F;  3QT7 A;  4HH1 A;  2XQC A;  2H1Y A;  1V3R A;  1FA0 A;  3DHX A;  3N4W A;  3Q2T C;  5E2Q A;  4TVA B;  4WK3 A;  3CJ2 A;  4ZVS B;  4ANC A;  1Y11 A;  4KO0 B;  2B6A A;  1MMN A;  1VI7 A;  1N32 F;  2HQ3 A;  3VZH A;  3M1V B;  1RT4 B;  5L9X A;  4ZP6 A;  3TJ9 A;  3GV8 B;  1SIW B;  1L3U A;  1WTB A;  2P9G A;  5C24 B;  3ZNJ 1;  5E5N A;  2QN6 B;  5KFU A;  3VWS A;  1Y5I B;  1Q5V A;  3QAU A;  4LFA J;  3U1N A;  3M2U B;  2Y9H A;  2RVJ A;  4OYI A;  3KYL A;  1W2I A;  4XAK A;  4EMD A;  1PC4 A;  2V94 A;  2E44 A;  4OZ2 A;  1HWL A;  2D1C A;  2F8H A;  1YHQ S;  1DTT B;  4GC6 A;  1M5V C;  1W7W A;  1X4E A;  3I96 A;  3C19 A;  3Q8V A;  4DLG A;  2XMM A;  3R5C A;  2B9X A;  2BKP A;  3RW7 A;  5RUB A;  2ASJ A;  4DL2 A;  4ZJQ A;  1RLD A;  5BR8 F;  3DDI A;  3IM9 A;  1ZS6 A;  1SUQ A;  3QYY A;  3S1T A;  3T6J A;  2XMU A;  3J7A N;  4X4T A;  1S72 S;  1CSJ A;  3J80 Y;  4N7T A;  1S9E A;  1PC5 A;  2IAJ B;  1GXL A;  4MFB A;  3CJ0 A;  5LSR A;  2CVE A;  2QL5 B;  1S9F A;  5B0A A;  3K17 A;  4KH0 B;  3DLH A;  1FFS B;  3FJ2 A;  5DG9 A;  2UVV A;  4BDP A;  2VBX A;  2ATC B;  3I5B A;  3DFE A;  5ETL A;  3R3T A;  4I67 A;  5KFZ A;  4DOZ A;  1JX4 A;  3PRV A;  3SFG A;  4MJK A;  1VR6 A;  4Y65 A;  4F4Z A;  2AKW B;  2ZBQ A;  3K5O A;  4FYX B;  4RNO A;  4PG8 A;  3ZZY A;  1QJH A;  2H9Z A;  5J2P A;  4OLP A;  1RTJ B;  2IA6 A;  2R7S A;  3MMJ A;  4HVZ A;  4QIF A;  1M5P C;  1OY9 A;  3K5P A;  1RWM B;  2AU0 A;  4CM2 A;  1U1K A;  2QL7 B;  4ZVH A;  4C11 A;  1YGY A;  3AOD A;  3FQL A;  4NYO A;  3V5R A;  3M2U A;  1PCA A;  3RU0 A;  3M8P A;  4ANE A;  4PYA A;  4WE1 B;  2F4V J;  2NSB A;  1VMB A;  3ISZ A;  1DUR A;  3MHY A;  4QIE A;  2F8M A;  2RRA A;  5GAD I;  2G2Y A;  2HQG A;  1FX4 A;  1ZA2 B;  1VQ6 S;  1H72 C;  2VFT A;  2IDE A;  2HWH A;  2IVM A;  2QFI A;  3NS7 B;  4I2Q A;  4OYM A;  1NK5 A;  2XEX A;  1RAG B;  1CC7 A;  1UA1 A;  1KVI A;  2VFR A;  1IWA A;  2MZJ A;  3DLE B;  4ZPD A;  2MKY A;  4QW8 A;  2MXY A;  4ECS A;  4J5O A;  1RT1 B;  2ALY B;  5L1J A;  2AEM A;  4KHP F;  1TUG B;  2BAC A;  2BJ9 A;  3GWC A;  2D9P A;  2MQN A;  1IKY A;  3EPI A;  4UW2 A;  1NPR A;  3MWB A;  1X4G A;  3H98 A;  2Z2Y B;  5HL7 Q;  1OYE A;  5AJ3 F;  2ROP A;  2KVQ E;  1JLQ B;  1FO1 A;  2VD3 A;  3NOG A;  4IG0 A;  2XNR A;  4DR6 F;  2B3T B;  1V9O A;  5ETM A;  1PIE A;  1I6J A;  3Q86 A;  2ROG A;  2IVF B;  2B8Q A;  4F50 A;  3LGN A;  6AT1 B;  2LU1 A;  2L41 A;  4DL3 A;  5HBM B;  5HJX A;  3VAH A;  1H0H B;  4Q8F A;  4IOA Q;  1WEY A;  2CNN B;  4ZS6 A;  4IUF A;  1GX5 A;  3H5X A;  1S7H A;  3L7U A;  3P8B B;  4OZN A;  3DLG B;  4UF4 A;  3OTO F;  2J5A A;  1S4F A;  2QA2 A;  4KPC A;  4UZC A;  5L1K A;  4F4K A;  1F5C A;  2HVZ A;  3W2W A;  1URR A;  1HNZ F;  5D4O A;  2YNI B;  5F0W A;  3GIK A;  2C2E A;  2R3V A;  3LA0 A;  2KT2 A;  2QA4 G;  1FT8 A;  2JLE A;  2GGP A;  3D6M B;  3M1V A;  1WKJ A;  2YNH B;  1LWF A;  4V19 J;  4PPZ A;  1LW2 A;  2DPI A;  1EIY B;  4RUC A;  5KFH A;  4K4X A;  2KU7 A;  4YR3 A;  4XO0 A;  1XNR J;  1DY3 A;  5HQM A;  5GAG I;  2FJD B;  4ZPA A;  3G82 B;  4H4K A;  4QQB A;  1GNK A;  1VQL S;  1VJQ A;  5I42 A;  2CG8 A;  3US5 A;  2NXJ A;  3HKZ D;  3FC9 A;  3JXO A;  4S0M A;  5B09 A;  5A8R A;  3QFW A;  1RAO A;  2QLF B;  2RNE A;  2YKN B;  3VTI A;  2MJU A;  4IQX A;  1NDP A;  1YKW A;  2B8P A;  2VG5 B;  2DY1 A;  4OLO A;  1H73 A;  2WTF A;  4AQY F;  5CA5 A;  3Q8R B;  1JLF B;  5DGA A;  3R6G B;  4X4S A;  2RDI A;  3LO3 A;  2F65 A;  2HZC A;  3FBB A;  1S9G A;  4B08 A;  3MUT P;  2F3J A;  1GMW D;  4J9Q A;  4MK8 A;  1N6Q A;  3HFK A;  1FD2 A;  2XB2 D;  1ZET A;  3O1L A;  2E7W A;  2QMX A;  4Y2I A;  4ID5 A;  2L48 A;  3IR6 B;  1XMQ F;  3NG8 A;  1RWO B;  1HNV B;  2FB0 A;  5I4M A;  4NXN F;  1JJH A;  1LW0 B;  4IO1 A;  1HHS A;  3PHT A;  1RHK B;  2FTR A;  2RQK A;  2YWK A;  2I0X A;  1EHW A;  1SJ1 A;  3DLJ A;  1HQE B;  2CPF A;  2UVU A;  1FKP B;  1ZPW X;  2JEF A;  1HD1 A;  5HAT A;  3UI3 A;  1D8Z A;  2KL8 A;  2ACY A;  2PD1 A;  3C16 A;  4LBP A;  4MYT A;  1GK8 A;  2VBY A;  1WF0 A;  2J0X A;  1UFL A;  3VGU A;  3EDQ B;  2Q79 A;  4HYK A;  2KVI A;  3BJY A;  1XR5 A;  2DNP A;  1S1W B;  1U26 A;  3UW1 A;  2UUC F;  2XG8 A;  3D54 A;  3LP2 B;  4ED6 A;  3NNA A;  2DKO B;  4WWS A;  1EX8 A;  3W7B A;  3NNC A;  5GMD A;  3KKF A;  2HWT A;  2YKN A;  2CJY B;  1Z2L A;  3M2R A;  4LR9 A;  5CAB A;  1U48 A;  2JSX A;  1OY6 A;  4Y34 A;  1SXL A;  2FZG B;  3TZZ A;  4YME A;  3VAF A;  2X3D A;  3UR3 C;  1VLY A;  3DMJ B;  4N47 A;  1NKE A;  2UXD J;  3GYX B;  1Y9O A;  2XSF A;  3WHI A;  4ILR A;  3PW2 A;  2C42 A;  4B9N A;  3HJV A;  1U1P A;  1YJW S;  4RKU C;  2C3Y A;  4CH1 A;  3QIP B;  3WC0 A;  1S59 A;  1Y10 A;  4H4M B;  1F0X A;  4J91 A;  3MDF A;  4LF1 A;  4ZPB A;  4ID5 B;  3OVB A;  2VPY B;  4TXS A;  1FRK A;  1Q4R A;  3JQM A;  4IG0 B;  5LMN F;  2C2R A;  2EK1 A;  4YHH F;  4GKK J;  2VH7 A;  4MKY A;  3MM5 A;  1OMS A;  5FDL A;  4V19 X;  3HVR A;  2F4V F;  3IR5 B;  3ZTQ A;  3NAI A;  2E66 A;  5KFS A;  4JI2 F;  2AJF E;  2Q6B A;  2ZBC A;  1HQU A;  2ZE2 B;  4OI1 A;  2KYZ A;  4RLE A;  3AY0 A;  2NRE A;  2OPR B;  2LYV A;  4FF2 A;  3W2V B;  2G2O A;  5B0E A;  3MPV A;  3RB4 A;  4F2S A;  2HQF A;  3GJR B;  3HHL C;  4U7C A;  4B9U A;  2H4Y B;  3J81 Y;  4CLK A;  3HMJ G;  1K1S A;  1O0P A;  1MW7 A;  2V67 A;  3MM5 B;  3H5S A;  4KBI A;  3AJ1 A;  1JKH A;  3KJN B;  4OYZ A;  4F0K A;  2AD9 A;  3EX7 B;  2ZH8 A;  3D5M A;  1LWE A;  1UPP A;  4Y28 C;  1REG X;  4ZLL A;  2R2S A;  2DRD A;  1H6K X;  4GMK A;  3AH6 A;  2AGQ A;  2IVY A;  2CPE A;  1FK9 A;  3OD2 A;  3OUY A;  4LRE A;  5KG7 A;  2UV8 A;  1SB6 A;  2JVO A;  2VFV A;  3EE3 A;  2W7O A;  2A6O A;  1C4C A;  2PN6 A;  1WDD A;  4GO5 X;  4WU2 A;  2OPS B;  2CQH A;  1YVF A;  1HKA A;  2DCU B;  3H40 A;  5JMN A;  2R8H A;  1FJG J;  1NKC A;  1S76 D;  1PJ6 A;  4WP9 A;  3G87 A;  2BR0 A;  4FXW A;  3K2Y A;  3OPK A;  3IFE A;  4ZP9 A;  2ZH5 A;  2R8G A;  1WF2 A;  1TKT A;  1VCT A;  2ZUA A;  1T03 A;  2Q6C A;  3ITH B;  1SIZ A;  4DPW A;  4ES2 A;  3PRD A;  1S1V A;  2HFN A;  2G1H A;  1HYS B;  1R8H A;  1RCO B;  2M3D A;  1SH0 A;  3EXY A;  3PYD A;  4LRD A;  4M8L A;  3Q23 A;  3IBC B;  4A47 A;  1XMQ J;  3PFO A;  3EM1 A;  4KGM A;  3RAM A;  4WE1 A;  4NI2 B;  3W8G A;  4UST A;  4B3S F;  1OYD A;  1IR2 A;  3QJP A;  4NE9 C;  3S6E A;  1NRK A;  1BQN A;  2VA3 A;  2KXN B;  4CCH A;  1WOR A;  3RBX A;  5E0O A;  4Y2M A;  4K2J A;  3POT A;  1HMV B;  4LF9 J;  5B08 A;  1Y0H A;  2Y8W A;  2M52 A;  4CLW A;  4J9L A;  4OYW A;  1U7L A;  2MZS A;  4Q2M A;  3THP A;  1N34 J;  4DUT A;  3ZC4 A;  3SQO P;  1OO0 B;  1JNZ B;  1KKH A;  3R5B A;  3MEG B;  5CYQ A;  1X4F A;  2YPZ A;  2FJE B;  2Z0G A;  3DGP A;  4NLU A;  3ZO7 A;  4ECQ A;  3IRX A;  4FF3 A;  4LF5 J;  3DHW C;  1QUP A;  5KFT A;  2RHQ B;  1BWV A;  4I2Q B;  2NYI A;  2HG4 A;  1M5S A;  1D8Y A;  2XMJ A;  1FFW B;  5KOX A;  2CJB A;  4K5R A;  1GFW B;  1O8B A;  1R8P A;  3ETO A;  1YJ9 S;  4NCB A;  1HL6 A;  4X4P A;  3QLH B;  1FDD A;  5A6P A;  3NCR A;  1CJK A;  3F0N A;  2XZD B;  3FZB A;  2VON A;  4NLW A;  2XC9 A;  4FBU A;  4BWM A;  3OTD A;  4Q43 A;  4ECZ A;  4F02 A;  4OHX A;  2CPY A;  1WC4 A;  2DGW A;  4KGK A;  4L76 A;  1WSV A;  1X60 A;  2RU3 A;  3OTE A;  2ZH2 A;  3PAC A;  1ZYQ A;  3BO2 A;  3O2I A;  4ICL B;  1JXL A;  1B0V A;  1FRI A;  1SUQ B;  3W61 A;  3ZZZ A;  2YX7 A;  5B0B A;  2HNZ A;  4L72 B;  2MZQ A;  4KAI A;  2Y8Y A;  1PJ5 A;  3GCW P;  3RRG A;  4DMZ A;  2XO6 A;  2DH7 A;  2E5J A;  1CJT A;  1X4C A;  2DNL A;  3OR2 B;  1Q8K A;  5F3Z A;  1FKO B;  1BMQ B;  1IM6 A;  3P3D A;  3MM8 A;  4I0W A;  4QR1 A;  1C4A A;  2Z2Z A;  5D4N A;  3PZP A;  2Z8Q A;  3CCE S;  2WVD A;  4LF6 J;  4DV5 J;  1GXT A;  2CUY A;  3FNN A;  4TNO A;  2NXE A;  4ZVP B;  4FS1 A;  4K0K F;  2YTC A;  2PGC A;  1VFJ A;  3I87 A;  1XNQ J;  3CCL S;  1OQ6 A;  4Y2C A;  5IOL A;  2WVB A;  2YVS A;  1U0S A;  4L75 A;  1NSP A;  4DFM A;  3GJT B;  2HAF A;  4DXL A;  5KG2 A;  3LWM A;  4EBC A;  4M5K A;  4C8L A;  2V34 A;  5F9L A;  3PO5 A;  3M8P B;  3PVX A;  4N76 A;  5D77 A;  3A3O B;  3DOL B;  1WNE A;  4JOU A;  3SCI E;  2FHJ A;  5GAE I;  3MMA B;  5K14 A;  2V2Q A;  2XYH B;  3I32 A;  3FRY A;  2GV1 A;  3CIM A;  5IT9 Y;  1RT5 B;  3ADA C;  3JAM Y;  1ZTW A;  3HT0 A;  4MT1 A;  3RJM B;  2KRB A;  4KB7 A;  2WAQ D;  1NZ8 A;  1U6Z A;  3DU5 A;  2CQG A;  4Y2K A;  4DR4 J;  4CLU A;  2HNZ B;  3Q8Y A;  2RRB A;  4RW6 B;  4JV0 A;  5IM0 B;  2ADC A;  1KLM A;  3BEG B;  1RKJ A;  2OO4 A;  3GP9 A;  3M9N B;  3P5T L;  5CZV A;  1VRT B;  3CXC R;  4OL8 A;  4JI7 J;  1KON A;  3NAH A;  1FKO A;  2Z2L A;  4P10 A;  4O23 A;  3T41 A;  2FJX A;  1T7P A;  4WFY A;  4C0B A;  4ZVE A;  4LQ3 A;  4NLS A;  3G96 A;  4NYZ A;  4Y0F A;  1OPZ A;  2B4V A;  3H25 A;  5A8K A;  2EC2 A;  2P9E A;  4U95 A;  2JLG A;  3CTR A;  1Q81 T;  1LK7 A;  3BSA A;  4USH A;  3HXM A;  5J1P A;  2BEF A;  2B4U A;  2IY5 B;  3DXB A;  1KTQ A;  1VRU A;  2IA0 A;  2MQM A;  1UA0 A;  2VOP A;  4IDK A;  4X4V A;  5M2U A;  3SV3 A;  4QWB A;  2B7B B;  5T14 A;  2VQF F;  7AT1 B;  2HHQ A;  3AD8 C;  3D7S B;  2LP4 A;  3TYT A;  4JBC A;  5LXR A;  1EAR A;  5G0R A;  4DL6 A;  1M5K C;  3UFC X;  2OLW A;  4DV1 F;  2LEC A;  4PRF A;  1NO8 A;  4MK7 A;  1N32 J;  5ETP A;  8ATC B;  2IJN A;  5IQ6 A;  2ZBP A;  2Z58 B;  3CCV S;  1IVZ A;  1UAW A;  1IKW A;  4OI3 A;  3MM6 A;  2DIU A;  3NRB A;  4GC7 A;  3HJF A;  2W9B A;  2JFK A;  5CYM A;  3Q89 A;  5G0R B;  4CO4 A;  1S97 A;  1VQ5 S;  2R8K A;  3WC2 A;  1JMT A;  3FMB A;  4EYH B;  3S01 A;  2ACM A;  4JP8 A;  4EBD A;  2IMW P;  4USJ C;  3NGD A;  2V0N A;  2VKZ G;  2D3O R;  1V3Z A;  4NZ7 A;  4WXW A;  2J9E A;  2C2O B;  2V2K A;  4WYL A;  4LRA A;  4RO0 A;  4K4T A;  1X5T A;  2V4J B;  1YWX A;  2DGS A;  5ETT A;  1SC4 B;  3G9C A;  1RUS A;  1KQF B;  5D8H B;  3TO8 A;  3VF0 B;  4MIA A;  5DQI A;  2CAJ A;  1RGV A;  2CQP A;  3IG1 A;  2XGQ A;  3NXZ A;  2OIH A;  1HNW F;  4ZP7 A;  3DDK A;  3QAT A;  3OJU A;  3Q8P B;  2PC6 A;  4OX9 J;  3ISN D;  2DXE A;  2IDL A;  3TVY A;  1UEU A;  4DQS A;  1KQS R;  1L3T A;  3D6T B;  4QR2 A;  2D69 A;  1L3S A;  4DU7 A;  1X31 C;  1VRQ C;  5KFV A;  2K06 A;  2GJI A;  1VQK S;  2VB6 A;  5L1I A;  3ENA A;  5DQG A;  2GJF A;  3EGV A;  1CJK B;  1M5H A;  3FFI A;  3T3F A;  2XY5 A;  4HAC A;  4X4U A;  4OX8 A;  1TKX A;  3PYG A;  1UMJ A;  4RBU A;  1QE1 A;  2H51 B;  3C14 B;  3M2V A;  4ZA1 A;  1N6Q B;  3NMA A;  2BJE A;  1UFK A;  3M8W A;  3GJS B;  4Z7Y A;  1XBW A;  4ZVO B;  5D0E A;  1YJV A;  1GQE A;  1WG5 A;  4OJH A;  3ZZR A;  4RNM A;  2XO7 A;  3V6K A;  2M7S A;  1FHT A;  1SQG A;  2IC3 B;  3G86 A;  4I7F A;  1ITP A;  3H90 A;  1U45 A;  2CPX A;  2DR6 A;  1RTI B;  2QLW A;  5D4P A;  2AGP A;  2ZZM A;  3BRE A;  2G9O A;  3M8Y A;  2J0Q D;  3KFW X;  4WPA A;  1U02 A;  2FIU A;  4ELT A;  4CIO A;  4OZ0 A;  1K0V A;  1MG7 A;  4PXC A;  2AYB A;  1DRZ A;  3S7R A;  5G4D A;  1RK8 A;  3BSN A;  3MR5 A;  1CUL A;  1HBU A;  4IFV B;  4LF2 A;  2RAQ A;  4ED2 A;  3KUH A;  2UUW A;  1DQA A;  2OSQ A;  4DEZ A;  1M90 T;  4DUZ F;  4UTG A;  5GAH U;  4K4S A;  3L09 A;  2CA9 A;  3DGP B;  3L3C A;  2ZDP A;  1SC6 A;  1UET A;  1V6H A;  3H2U B;  5AE1 A;  3MPY A;  4KKO A;  5J2Q A;  2OD4 A;  4IG3 B;  1NXI A;  4KC5 A;  2NZ4 A;  3BKT A;  4ES1 A;  1WD6 A;  1H98 A;  4DFK A;  1IKX A;  2MB0 B;  1BXN A;  1TVR A;  2AIR B;  2CWK A;  3L9Z A;  4DI6 A;  2VHG A;  1KNZ A;  1RWU A;  4GKJ J;  4K4V A;  1U2F A;  2HBQ B;  3EIC A;  3GJQ B;  1SVD A;  3QWP A;  4ITS A;  2YY3 A;  3D66 A;  3KNG A;  3OUY B;  3VGS A;  5LMU J;  1X9M A;  1RJJ A;  2W1B A;  3MMC B;  2KHD A;  2XLK A;  4AT1 B;  3KG0 A;  2YPY A;  1KQG B;  4PYD A;  1X9W A;  5D78 A;  2ZHA A;  4A8F A;  4Y2A A;  5K8N A;  3TAN A;  2QJ3 A;  2ASY A;  1S6Q A;  2EEY A;  4LRC A;  4ZPT R;  2WON A;  4Y6I A;  1RWX B;  3ZZO A;  5KG5 A;  1I1G A;  3ITH A;  3MFI A;  3I82 A;  2J76 E;  4CLZ A;  4DX6 A;  1NUE A;  3TRG A;  4DPU A;  1JNR B;  3CJ4 A;  4JYA J;  2WVC A;  1JKH B;  3TA2 A;  1YLX A;  2AZ3 A;  4ECW A;  2DHX A;  3A8E A;  3UWT A;  2DT9 A;  2E9T A;  1DBD A;  3DRR A;  5F9N A;  2X7I A;  4ECV A;  3MM9 A;  4B3T F;  2AQ4 A;  4KYZ A;  5L39 A;  1Q79 A;  4P9S A;  1K44 A;  3K5L A;  3KHG A;  2VPW B;  2OH2 A;  2PSZ A;  2QV6 A;  4HT5 A;  4RZR A;  3V4I B;  1I51 B;  4JI6 J;  4YP3 A;  1GT8 A;  2HBY B;  3MED A;  4MIW A;  5ETV A;  4ZVU B;  4NLX A;  3I0S B;  2A0F B;  2OMO A;  1X0F A;  2ZH6 A;  3CDA A;  5DDR C;  3CD5 A;  5CD4 A;  5KFB A;  1CJU A;  1NJZ A;  2YNG B;  5F8I A;  2Y3Y A;  3CCR S;  2JFD A;  3CPW R;  2RIJ A;  1C0T B;  1HWU A;  2V8P A;  2AEJ A;  2W4P A;  4A46 A;  3F73 A;  1M5O C;  3OV7 A;  2B5J B;  1Y3J A;  5F8M A;  5EX3 A;  2GO9 A;  1RYR A;  2DVI A;  1OJ4 A;  4PKD B;  3THT A;  1IBM F;  3MPU B;  4CYU B;  3KMS A;  4FP9 A;  4CLT A;  5KFR A;  3OSN A;  2VJV A;  2VOD A;  2B7C B;  3C16 B;  1REV A;  3OL6 A;  1EP4 A;  4LMZ A;  1U1R A;  2BYC A;  3H5Y A;  1XEZ A;  2LXI A;  2BW2 A;  2DTJ A;  1FER A;  4K4U A;  3H0P A;  3EZ5 A;  3BYP A;  3DI6 A;  4YB6 A;  6FD1 A;  1YIJ S;  3IWN C;  4P7V A;  3QJL A;  4B3R J;  1VBK A;  1IKV A;  1S1X A;  1H7W A;  3LGM A;  4RBV A;  3BDE A;  3HHK A;  3KLI A;  3M9O B;  3SYZ A;  4O3R A;  2DXD A;  2AP6 A;  2AX0 A;  4WU3 A;  3CUL A;  3IN5 A;  5M2P A;  3P96 A;  4NLT A;  2OFH X;  4HAC B;  4M5N A;  4NZ0 A;  4E2F B;  1LKZ A;  1RAC B;  2CQ0 A;  3FBC A;  4DL4 A;  5HN0 A;  4OI2 A;  2KM8 C;  4X62 F;  3V6D B;  2LVW A;  2XS2 A;  1WWH A;  2E1M C;  2E1P A;  3NEK A;  4UOG A;  2R7U A;  3CCZ A;  3EJM A;  1WC0 A;  5LXY A;  1FDA A;  4JV5 J;  1DAX A;  2ROE A;  3KLI B;  5C42 A;  2V4Q A;  3CCU S;  1WHW A;  2Q43 A;  1Q7Y T;  5BYQ A;  1WI6 A;  2FHO B;  3BPS P;  2KRR A;  5FDL B;  2UXC J;  3AXK A;  2HNY B;  5KFI A;  2GO8 A;  2C28 A;  1S1U B;  2XWY A;  3MEE B;  2OPP A;  3O5T B;  1S6P A;  3ILL A;  4OFZ A;  2CRL A;  3BGO P;  3SCJ E;  1YJ7 A;  3MMB B;  4C3L A;  5LT5 A;  2OPR A;  4X4R A;  4CYU A;  3W2V A;  2KH9 A;  2B9W A;  1JLC B;  3OFH A;  4CO2 A;  2DNG A;  5HQ8 A;  2QFJ A;  2H54 B;  1S48 A;  2Y1I A;  4LSN B;  3BB5 A;  2I38 A;  2XTJ P;  4DV5 F;  3GFY A;  2QYG A;  4F4Y A;  1NK6 A;  2YWG A;  1PBU A;  3AXM A;  4UOF A;  3PO4 A;  4ZK7 M;  1S0N A;  3HHL B;  3H7H B;  2BJ1 A;  5EN1 A;  1KHW A;  4OZ1 A;  5F8G A;  4N77 A;  4USV A;  1U1Q A;  2F1F A;  4C3K A;  2JWN A;  3D0G E;  5HO4 A;  1RT2 B;  4RW8 B;  1GH8 A;  1HW9 A;  4ZPW R;  5GAD U;  3E01 B;  4DV2 J;  1AXQ A;  3EVW A;  4G1P A;  2NYH A;  1X8D A;  2L9D A;  4IH6 A;  5FJ4 A;  3DM2 B;  1AW0 A;  3M2R B;  5AE2 A;  2F63 A;  2IM3 A;  3DYA B;  4ZKA A;  1MN7 A;  3B8H A;  4JI4 F;  5F8N A;  1CS4 B;  2DNN A;  1J27 A;  2FJW A;  4B9M A;  1H74 A;  2QO3 A;  2OPP B;  1BC6 A;  3DU6 A;  2CDQ A;  1FNX H;  2Q3P A;  4DL5 A;  5I3U A;  3I6P A;  3O3L A;  4KGZ B;  4CQ1 A;  1NK9 A;  3TAM A;  3PKY A;  1VYA A;  3GON A;  3C15 B;  5AJ3 J;  4DSF A;  2FGO A;  3NWR A;  4A48 A;  2WOM B;  2QT7 A;  4ERD A;  1EAY C;  2GHW A;  2QX0 A;  3I4H X;  4OQJ A;  3A8J A;  3KHH A;  3R5G A;  4TKT A;  4DV6 F;  2PI4 A;  4ZOS A;  3HSG A;  1T05 A;  1Q8B A;  3H20 A;  3OBI A;  3C3L A;  1CG2 A;  2RD5 C;  2BRL A;  1N5Y B;  1S9G B;  2AV5 A;  4D3H A;  3PW7 A;  2ZH7 A;  2E5L F;  2W9B B;  3HD1 A;  2VC0 A;  3GQC A;  2WCX A;  1L3V A;  3MMB A;  2OEM A;  3UVJ B;  5C24 A;  1R8A A;  3GIM A;  3VAK A;  4O44 A;  1HHT P;  1W25 A;  4DFJ A;  1U1L A;  4PAB A;  3CIZ A;  4QPX A;  2KZM A;  3J81 U;  4ED3 A;  1PYO B;  4CNZ A;  5A8W A;  5H9F K;  2JX2 A;  2AW0 A;  1MU2 A;  3HHL D;  3RYL A;  2HFV A;  3QMQ A;  3DRY A;  3OW2 R;  1TTH B;  3F41 A;  2EC0 A;  4EZ6 A;  1YQH A;  1S12 A;  3I5A A;  4BLG A;  5KTQ A;  2H5J B;  4EBE A;  1HFE L;  3L95 X;  4O3Q A;  2KG1 A;  1UJ5 A;  3MD3 A;  2BOP A;  2XMW A;  5KFO A;  3D6H B;  5DM6 Q;  1W2B R;  2GQ2 A;  3JSR A;  3CMA S;  3T5L A;  3T1H F;  1NK0 A;  3T1H J;  2NR0 A;  4IR9 A;  1VRU B;  2MZ1 A;  1URN A;  5B0D A;  2YNH A;  1NB2 A;  2YKM B;  2FYX A;  2UUC J;  1S1V B;  4TQS A;  4WFA Q;  1U1N A;  1PSD A;  4AND A;  1Q1K A;  2Y1L B;  1NHK L;  2J7U A;  3EXC X;  5GMK a;  4PUO A;  3UO0 A;  2UU9 F;  3GPA A;  1MMD A;  3C14 A;  2CZV C;  4N8N A;  3OR2 A;  4C0H A;  4R5P A;  2W7P A;  2HHU A;  2DR7 A;  1T95 A;  1FKA F;  1TVR B;  2KO1 A;  4ED7 A;  2WZ1 A;  1R0A B;  1RT7 A;  5ETK A;  2VIC A;  3LAL A;  1TUW A;  4P52 A;  4DR2 F;  5EGY A;  3PIP Q;  4A8M P;  4G3I A;  2D3O 1;  2A10 A;  1WUU A;  2JNJ A;  1JXE A;  5J2M B;  1OWX A;  2PI5 A;  1WEX A;  2X1G A;  2ZHO A;  5IV4 A;  2LQ8 A;  2BQ3 A;  4K2X A;  4QU7 A;  3AD7 C;  3MAA B;  3SMZ A;  2CKW A;  4N8O A;  5AXK A;  5BYR A;  2E5G A;  2Z56 B;  4Y3C A;  3WX4 A;  4DG1 B;  2XLI A;  1I94 J;  1B3T A;  1YX2 A;  3KJV A;  2M5Y A;  5DLF A;  1XNR F;  4FYD A;  1TL7 B;  3AJ2 A;  4NA2 A;  2CJA A;  1RDR A;  2YH1 A;  4CI0 B;  2NQP A;  3C6T A;  2BM0 A;  3BKU A;  1B7F A;  1R8B A;  3DRR B;  1BE4 A;  1RU1 A;  5CHC B;  3R1H A;  2YQ3 A;  2ALZ A;  1EB0 A;  4A8K A;  1IBL J;  2FHJ D;  2HIQ A;  4XPE A;  1R7I A;  5D15 A;  4O4G B;  2E9Z A;  1K0T A;  2DNH A;  4KV8 A;  4ED4 A;  2FVC A;  1KP6 A;  2DHA A;  4RW8 A;  2B9Y A;  3U1L A;  4UQG A;  4ECX A;  4CO1 A;  2J6T A;  3W63 A;  1GTE A;  2MLX A;  1VGY A;  4ZVQ B;  5K9F A;  4DQI A;  1Q86 T;  3ZZU A;  4ZLP A;  4F3Q A;  2ADB A;  2WK4 A;  2CQI A;  3IWX A;  4K4Z A;  4X64 F;  1YTY A;  4OHV A;  2IYG A;  4ECT A;  1S6O A;  1T02 A;  2MKH A;  1Y3K A;  2D7S A;  1N0U A;  3W5X A;  5LJ3 Y;  1RLC L;  2XNQ A;  4DF4 A;  1UKU A;  4DPY A;  2GVD B;  2V5H G;  3EDR B;  5K8O A;  1JJC B;  2BBE A;  2RS8 A;  3CWJ A;  3PG9 A;  2FJV A;  2WB1 D;  3BBC A;  3M8Z A;  4IYQ A;  3TWZ A;  4NI2 A;  2LFV A;  3LH2 S;  4ENO A;  1NKB A;  1EJ7 L;  4NXN J;  2W01 A;  4KHP J;  1YIT S;  1S57 A;  1RKI A;  2IAJ A;  2XYG B;  1NHV A;  1TQL A;  1SKS A;  1TR0 A;  2XWX A;  2HFO A;  4Z2X A;  3M32 A;  4DHV A;  1SL1 A;  2ILY A;  3R1L A;  1RT7 B;  2L3M A;  5F0U A;  3UDE A;  3CJT A;  2DR9 A;  1TKX B;  4RUB A;  1Q78 A;  2VFS A;  3W1Y C;  1T9X A;  1TV6 B;  4JI8 J;  1NEE A;  1Z4U A;  2DGX A;  2JDJ A;  3RBZ A;  3UQS A;  3HO1 A;  4DUY F;  1QM9 A;  4DV7 J;  3DLB A;  5JVH Q;  4HTJ A;  4B3S J;  4DBQ A;  3K5M A;  4PAA A;  2M8D B;  4KKO B;  1QAY A;  5FII A;  5J2Q B;  3BGU A;  1NME B;  3C6U A;  3QNW B;  2GQC A;  5K20 B;  2OEJ A;  1DFD A;  1RBA A;  3ONQ A;  1U24 A;  4U7U K;  4K8R A;  1RT4 A;  1VBY A;  3HHL A;  2V9K A;  3G8T A;  1S0M A;  5KT2 A;  2FGC A;  3MR6 A;  5DJB A;  2VDI A;  4LFC F;  4ILL A;  2UZA A;  2ATL A;  3MCM A;  4L3K A;  4LSZ B;  2PA8 D;  2XY7 A;  3QAE A;  1R43 A;  1JLC A;  2K8G A;  2LDI A;  3QSI A;  2A6M A;  3TAQ A;  5KG0 A;  2FZK B;  1R27 B;  2C2N A;  2N4C A;  1AUS L;  1B64 A;  3KK2 B;  4X66 J;  4P75 A;  5DDP C;  3EWG A;  3I0S A;  5J2P B;  1NH7 A;  1MLA A;  3HVT B;  3OTO J;  4CZC A;  4JI0 F;  5F8H A;  1YJN S;  5J1E A;  2WSE C;  2E1C A;  3E2E A;  4YDD B;  3L7O A;  2R7R A;  3T19 A;  1UEK A;  1BWE A;  3UD4 P;  2BW7 A;  1XTZ A;  2YQ1 A;  2CFX A;  2I1R A;  3TZW A;  2EK6 A;  1X5P A;  4EO6 A;  1QTN B;  2RIL A;  1LWX A;  1IBL F;  1DQ8 A;  4WCE Q;  2MJN A;  1SKR A;  3MXH P;  4DPO A;  2EBE A;  3UCG A;  1PO6 A;  4EZ9 A;  3HFZ B;  4RNN A;  4LFA F;  2OKQ A;  4DR4 F;  3KK3 B;  4E98 A;  3H2V E;  4KGX B;  1J5O A;  1H38 A;  3I55 S;  4ZVT B;  2J7W A;  1M1K T;  2JEG A;  3QRR A;  2V2Z A;  5E3A A;  3R7N B;  1D09 B;  5CYJ A;  4M5D A;  2HK3 A;  3CDE A;  4IFY A;  2AF6 A;  2LXU A;  3DOM B;  3CD6 S;  2V68 A;  4WYW A;  4K4Y A;  3UDL A;  1RTH B;  2AJ2 A;  3V81 A;  4JI8 F;  5HRO A;  3NBP B;  3L7P A;  4J9V A;  4GKK F;  2UXB F;  1J5E J;  4FDF A;  2HVD A;  4OYA A;  2HHH J;  3CT9 A;  3FK4 A;  4OZJ A;  3KK3 A;  1VC6 A;  3MM6 B;  4AQY J;  4NEZ A;  2DNM A;  5B0F A;  2B9E A;  2PT0 A;  3RRH A;  2LDY A;  3NWG A;  4PCQ A;  2DBB A;  5DO2 A;  3SFU A;  2OTJ S;  1SL2 A;  5KT6 A;  3TZY A;  5HQL A;  1RA6 A;  4YB7 A;  2KKH A;  1KD1 T;  2G2Z A;  3LP1 A;  3SSR A;  5C2G A;  4UQT A;  4O3O A;  3THV A;  1HNX J;  2HND B;  5IXU A;  3RUB L;  4PG7 A;  4DLE A;  5LSL A;  2G1D A;  2GFF A;  1WOS A;  2NUH A;  2P2C B;  2WVE A;  3KNA A;  4UUW A;  4WTY A;  2M9K A;  2AGO A;  2DHS A;  1WG4 A;  3UVJ A;  4HEA 9;  1GAO A;  4NYP A;  1KR4 A;  3RRK A;  4AYB D;  1DLO A;  1FNO A;  2R7V A;  3BPD A;  4JI4 J;  2HW3 A;  4WFB Q;  1RTJ A;  1RBO B;  2DIV A;  3I9Z A;  4AUK A;  3CGI A;  3SV4 A;  3C46 A;  5HMY A;  3M4X A;  4M5I A;  3W9J A;  1VQN S;  2MZR A;  3CD7 A;  2BQR A;  4C48 A;  2DPJ A;  2OSR A;  1QVG R;  3N28 A;  4PZV A;  3BZQ A;  3JTN A;  4Z7C A;  2C2D A;  1SJ3 P;  1HWJ A;  2GAH C;  4CLY A;  1TL1 A;  1G7C B;  3G4S S;  2FD2 A;  2QTW A;  3M8R A;  4M1K A;  4FXD A;  2DHH A;  2APO A;  3PJW A;  2ERR A;  1D9A A;  4F0H A;  4QWA A;  3NCP A;  3T5J A;  3R2D J;  1KVJ A;  4OZ3 A;  2ZH3 A;  3KLE B;  2DH8 A;  3MCN A;  4KY3 A;  4RBT A;  8RUC A;  3RBE A;  3BV8 A;  3K8W A;  3QO9 B;  2LCW A;  1ICE B;  1XJW B;  2C22 A;  1U8W A;  4LF7 F;  3U7J A;  4HR2 A;  2HGN A;  3JSM A;  3TEH B;  5KFP A;  2R7T A;  3CCQ S;  4C8K A;  2NUU G;  3R97 A;  2DNO A;  4DL0 C;  3SQG B;  3AD9 C;  1XER A;  1NAQ A;  1RAD B;  1XIQ A;  4JUZ A;  3H8Y A;  2BE2 A;  3CJK B;  5K8P A;  5LM7 E;  2G0I A;  2HMI B;  1UZD A;  2XM3 A;  2O5D A;  2F9D A;  3TUJ C;  1QSS A;  1EKS A;  2RKI B;  4M5G A;  2Y1R I;  3TJ8 A;  3BS9 A;  1SL0 A;  2MHE A;  2ZZN A;  4LFB F;  3IWL A;  4HHH A;  4ED0 A;  3WBZ A;  2MHN A;  4RL1 A;  3UR0 A;  1NM2 A;  4DU8 A;  5GAH I;  3DN9 A;  1Q8L A;  3LP1 B;  4B3O A;  1LK5 A;  3VGV A;  1DTQ B;  4LSN A;  1SC1 B;  4FPR A;  4OJ1 A;  4OX9 F;  3WX8 A;  5IZH A;  2K3I A;  2GVZ B;  2VBZ A;  1Q16 B;  1S7I A;  2DGO A;  1PYS B;  3AFG A;  4U8V A;  2BJ7 A;  1YJU A;  2CNO B;  3WZ0 A;  4ZHR B;  3OHB A;  4YR0 A;  2BJ8 A;  1JB0 C;  2N3L A;  2YWF A;  4NAS A;  5F8L A;  3D4J A;  3JS9 A;  3MAQ A;  2ZJP Q;  3V4M A;  2L9N A;  2JEJ A;  2UP1 A;  3AHP A;  1UWB A;  2F9J A;  1K47 A;  1RTZ A;  1U0H B;  1UW4 A;  2QYC A;  2CZ9 A;  3B78 A;  4R0E A;  1C1B B;  2CQ2 A;  1KRP A;  3OHA A;  3IO1 A;  4U9R A;  1SPB P;  1KOH A;  2BX6 A;  1ZM2 A;  2E5H A;  1B70 B;  4G1I A;  1HI8 A;  3HVA A;  3SQG A;  2R7W A;  4PR6 A;  1KSP A;  2V50 A;  1JLB A;  4MKV A;  4L73 A;  2ZVS A;  3ILI A;  3U02 A;  4CH0 S;  3BO4 A;  2VA2 A;  1CJT B;  4WIQ A;  3J7Y I;  1SV5 B;  3F56 A;  3M05 A;  3MR7 A;  3J80 U;  3VZI A;  2ZH1 A;  1HYS A;  1WHY A;  4I6Y A;  5IV3 A;  2DEI A;  1L3K A;  1UW9 A;  2M2B A;  4OMF G;  1RHQ B;  5KFX A;  4JB8 B;  1X4A A;  2RT3 A;  2GIQ A;  4FYY B;  4JI6 F;  5J2N A;  4OV1 A;  2CVI A;  2DGQ A;  1FTC A;  3NGR A;  5HP1 B;  4OHY A;  1AFI A;  2K3K A;  1RAA B;  2ZOM A;  4YN3 B;  3CDU A;  1TKD A;  3DRP A;  1P6T A;  3A8I A;  2BDP A;  1S79 A;  1HNI B;  4IRC A;  1QLN A;  4YY3 J;  4J9S A;  4K50 A;  1HBO A;  1PKU A;  3MCO A;  1SH3 A; 
#chains in the Genus database with same CATH homology
 4YS2 A;  1VCT A;  2AEM A;  3L4B C;  4J9U E;  2OGU A;  4GVL A;  4L73 A;  4G65 A;  2FY8 A;  4L74 A;  2BKO A;  2BKP A;  4EI2 A;  2AEJ A;  4RO0 A;  3RBX A;  4J91 A;  4J9V A;  4J90 A;  3JXO A;  3KXD A;  4XTT A;  2AEF A;  3RBZ A;  4J7C A;  1LNQ A;  4L75 A;  2BKN A;  4L76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...