3JXOA

Crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
NLYFQGMIPLEQGIEFLSVNVEEDSPVVGKKLKDLPLPRDSIIAAIVRGGVLVVPRGDTEILSGDKLYVIVSAEAKETVEETLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of an Octomeric Two-Subunit TrkA K+ Channel Ring Gating Assembly, TM1088A:TM1088B, from Thermotoga maritima
rcsb
source organism Thermotoga sp.
molecule tags Transport protein
molecule keywords TrkA-N domain protein
total genus 18
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 3jxoA00
4J91A 4YS2A 3RBZA 2AEJA 2OGUA 2BKOA 3L4BC 4XTTA 4L75A 4J7CA 4EI2A 2AEFA 3JXOA 3KXDA 4G65A 1VCTA 2BKNA 4L76A 4RO0A 4GVLA 4L73A 1LNQA 2FY8A 2BKPA 4J9UE 4L74A 3RBXA 4J9VA 4J90A 2AEMA
chains in the Genus database with same CATH superfamily
5L9NA 4ZMMA 4ED3A 3R1LA 2G13A 2DR6A 4ID5B 3KUGA 1XEZA 4NPOA 3MMBA 4HYKA 3DRPB 1IBCB 2A6MA 4H4OA 1GMVA 2FJAB 2UP1A 4WKRA 4FYYB 1NNDA 1MWQA 2R4FA 2WB4A 4J37A 1URRA 1FF2A 1UFKA 3LP2B 3Q22A 4PEOA 2WK4A 4P2MA 2OPSB 3CD0A 5JVHQ 2DO4A 4LFCF 3T41A 2POKA 4C8NA 1AZSA 4PXCA 4Z7CA 2DIVA 3FQLA 4KKOA 1RHQB 3VVTA 1FFWB 4J9NA 5DDQC 5HROA 2IDEA 4JV1A 2R7XA 3FCHA 4N8NA 4AUKA 3M9NB 2YBVA 4NLOA 1WC1A 1CJKB 2K3IA 4B9NA 2V68A 2VBZA 1HQEB 2DNPA 1M0SA 2CUYA 3D1OA 4OYZA 4A8YA 3V4IA 3QGGA 2IDLA 4PYAA 2F8MA 5HL7Q 1AUSL 4URGA 3FDSA 2X1BA 3MFIA 2DJWA 1HW8A 2J7WA 1VR6A 2PA8D 3I55S 1NEEA 3MHYA 2XI3A 3MMAA 1IUJA 4IG0A 3M8PA 3RUBL 4AL6A 3IWLA 2WVEA 3D3BJ 3C16A 3LGNA 2P9GA 1KFDA 2BR0A 3DLEB 5C2GA 2Q6CA 2YY3A 5DZ6A 4DSJA 1JQGA 1S48A 2JEGA 2RKIA 3K8VA 1OJ4A 3O44A 4KHRA 4ZVSB 5HVHA 3H4BA 3MAQA 3I0SA 3IA0A 5CXTA 3MEEA 4Y2AA 1TZ0A 2DBBA 1R6YA 2VASA 5AJ3J 3AOCA 4OHZA 3HHLD 2BQ3A 3C6TB 3W5YA 4G3IA 2HRYA 2KJVA 3U27A 1X4AA 4IFYB 3OLAA 3SI8A 2FB0A 1VBZA 3H7HB 3N6LA 4M5KA 4OV6A 1NXIA 3MM6B 3G82B 4B3SF 5HP1B 2R2TA 4E98A 3AH6A 4H54A 4ED6A 2IRYA 1TKXA 1YZ6A 2JLGA 3KYLA 1B3TA 3C3LA 1S0VA 1Q1KA 4RW8B 3KJVB 4TN2A 5KG3A 2PGCA 2KFYA 1SC1B 3BO3A 1N0VC 4L76A 2RE1A 3TUJC 2WAQD 2KDOA 2HBQB 1S6OA 5KFPA 4DV4F 1S57A 1FKOA 1HLWA 1FK9A 3AJ2A 2V0NA 5GVQA 4OI6A 2R42A 3UN2A 1FKAF 1EQ0A 1LXNA 4P52A 3BGOP 1WG4A 3D0GE 4C3MA 1RHUB 3TVYA 1VFJA 4A4JA 2GVDB 1FVSA 1UZHA 3PKYA 4M5HA 3RTVA 3D7SB 1IM4A 4B9MA 4P74A 4USTA 2IFXA 2GIRA 4YB6A 1HWIA 2MTLA 3G8QA 2V8VA 3DRSB 4UOCA 3TR5A 3DRYA 2P9EA 3R27A 2B43A 5B09A 5MAOA 4NA1A 2RS2A 4PUOA 2C22A 4F2RA 1PG5B 4H4MB 4IUFA 5T7LB 5ETQA 2CDRB 2D74B 2WVFA 2YWKA 4EBCA 2I0XA 3M7VA 1U47A 1VQ8S 2ZBRA 4PQUA 2M8HA 2WSEC 2GS8A 3BREA 4GVLA 4DV6J 1HKAA 1NLKL 2JRSA 5IT4A 2E1AA 9RUBA 3MMCB 5M2PA 1X4FA 1OY8A 2L48A 1U02A 2KXNB 4DR6F 1F5AA 1HQEA 3ITHA 4IH6A 2LEPA 4DV2F 1UJ6A 2CNLB 3AA8A 4QWAA 2IM0A 1OQ6A 4WE1B 1Q5YA 1WC0A 4NZ6A 3JAMY 3M8SA 1SJ4P 1VK3A 1CVJA 1RHJB 1NM2A 5EUHA 1H7XA 2ACYA 3C66A 5D4OA 2HBYB 2SXLA 2I6WA 1TAUA 2FLLA 2QX0A 1T11A 2KT3A 1HBMA 3M32A 2RF2A 5HAOA 4EGLA 3N0VA 2DNKA 5KFFA 2DY1A 1W26A 3FBCA 1VISA 2V5HG 2V69A 3S7RA 4DS4A 2Q1LA 1L3VA 1UL3A 5KFAA 4V1Ak 3DLEA 4FBUA 1UW4A 2E5HA 1RWNB 2XULA 3NY0A 5ETRA 2ZHAA 3D9BA 2KKHA 2R8HA 2WONB 2C2MB 2IYIA 3D3CJ 4GVBB 1WHYA 2XYPB 3CE8A 1NK6A 3M30A 3G71S 1ACMB 4IG0B 4MTPA 3KJVA 1IKYA 1JLEA 3PW7A 1I94F 1WC6A 4NEZA 3M2VB 2YVSA 1TVRA 3HULA 2RQ4A 2BJ7A 2AP6A 3HT3A 2P9CA 3AJ1A 3BN4A 4EWTA 4ZPCA 2IBOA 2LDYA 5H9EJ 1SQFA 2D3UA 5HN0A 3KUHA 2ERRA 1V5VA 1I1GA 3L7UA 4QCLA 1WDDA 2CPDA 3DOKA 1HMVB 4RPFA 4DL5A 3CD5A 3M2RB 1B0VA 2K1RA 1LK5A 1S9EA 3R3TA 4WIIA 5CYJA 2EC2A 5JUMA 1JJ4A 4IRDA 2NUUG 4ZCLA 3J80U 2VPWB 5DZ7A 1VQNS 2XO7A 2EBGA 5L1IA 4LRBA 4Z37A 1GNKA 1RE1B 2UVUA 4RW9A 1S6QA 3HHKA 4CLWA 1QE1B 1SH2A 3EVMA 3FEYB 1NSPA 5F8LA 4F0HA 4I2QA 2DXEA 5ETMA 5KFEA 4C2MA 5J2NB 1PC4A 3FMBA 4LMZA 3TI0A 2EKNA 3KHLA 3SIPB 4BBYA 3CCMS 5BJRA 3JYTA 4ITSA 1UEUA 4MIAA 2YH0A 3V6KA 2KFNA 4NZ0A 3NCPA 3DOLB 4EFAC 4GKJJ 1Q8KA 1RT3B 2XBPA 3OJSA 1QAJA 3AHPA 2ZOFA 3N79A 3RBZA 4OX6A 5IM0B 1IR2A 1YJ7A 2YWGA 5LMUJ 2ILYA 1RT3A 1SL0A 1VRQC 2HHHF 5A8WB 1B7YB 2RNEA 3F44A 2OI2A 2M4MA 3KXDA 2NPFA 1FX4A 1WUUA 3GJSB 4PQUB 2FHOB 2OLWA 4C0HA 3T1AA 3B54A 3ILIA 2LQ5A 4NI2B 3AB2B 5LM7E 4C0OC 4X65J 4WZMA 4EYHB 4C11B 5AE2A 5K20B 1TR0A 4X4OA 4ECZA 1YJNS 1H2VZ 2AGQA 4G6VB 2RU3A 3K5OA 3PRBA 3ZZRA 3MPWA 4DZDA 1C4CA 1YSJA 2CADA 1N54B 1Q8IA 2FJBB 4K4ZA 2FZGB 3HSDA 3MR6A 1KFSA 2XLIA 3ZTRA 1SQGA 4OI2A 1JLBB 5F3TA 4XPCA 1KLMA 1Y0HA 1RXOB 5B0EA 3V6HA 1YVFA 1X4GA 3PRVA 1M5SA 1Z2LA 2J6UA 3G87A 2AHOB 1M1HA 3GTYX 2PE8A 5FDLB 2BRLA 4PKDB 2O01C 3VALA 5L1JA 3BF4A 4TU9A 4PAAA 5KFBA 1TKDA 3G9CA 4KTQA 1P1TA 2V6AA 2HGLA 1S6PB 2HHXA 4MK9A 4P75A 4N56A 4QR0A 3PZPA 2J6SA 4WFYA 2IVMA 1K1SA 3QBCA 4KO0B 1SUQB 1ZA2B 4LREA 4J9UE 2K2PA 2WVDA 4RBTA 3OTBA 1IJEB 1R31A 1S9GB 1R8CA 2PFDA 3HHLB 3MM5A 3P45B 3QFHA 4TLQA 4X4SA 5GAHU 2BJ1A 1FESA 1NH8A 1S49A 3MUVP 3R8YA 3HVRA 3CCJS 3PVXA 1NK5A 2DY9A 3OL6A 1T9TA 3HVAA 3LGHA 3KNGA 2G9OA 4I7FB 4KV8B 4YMEA 4N77A 4P6QA 2FJVA 1XMQF 4RW6B 2WTFA 3OPKA 4IG3B 3ZXWA 5J1PA 3W3SA 1RT5B 1X4BA 3TYTA 1F60B 4DJBA 5C24A 4FF2A 4NCAA 4B17A 4UTGA 4IG3A 3NBPB 5J1EB 3OR2A 2MQ8A 2E5JA 3R6GB 5LOQA 4A8QA 4DSKA 4K4UA 3D67A 4X84A 3DOLA 3MCSA 1WSRA 4JP8A 4ZCIA 2CG8A 5D77A 2KYZA 1DTTB 2X3DA 4DFKA 3QPIA 2E29A 3V81B 3RBDA 3X3UA 4B3TF 3QRQA 2EFOA 2YNGA 4RU9A 1BQMA 4UY85 4MIWA 1UVLA 3SYZA 1VQ6S 4A8FA 2W25A 3OBIA 4KPYA 3NL0A 1CS4B 2KJWA 3I4HX 1C0TB 2VQFJ 1ULRA 3CO0P 2OFGX 5CH7B 4TLRA 2BJDA 2MDAA 2X7IA 5D6GA 4R8UA 2QA4G 2MLXA 4JI8J 3QJPA 4C0BA 2P6SA 4DV5F 1UVIA 2MKYA 1WWHA 4B9TA 3DN9A 4FS2A 2KZZA 5ETTA 1S1WA 2CQCA 4DFJA 1HR0F 1YRUA 1FERA 2KRBA 3E51A 1X31C 2KL8A 2ZWOA 2IVYA 3KDNA 4QIFA 1YJUA 3Q2TC 2VFRA 1KC8T 1OY6A 1FRKA 1MG7A 2CJ9A 3AD8C 4M95A 1UP1A 2W01A 3MGJA 3MM9A 4QU7A 1YZ7A 2XMUA 2DHAA 4ES1A 4F4AA 4XK8C 2KTQA 2YQ0A 2O67A 3EE3A 4K4WA 3W63A 5E3RA 5IQQA 4NRUA 1RHKB 2FZCB 2VDHA 1SH3A 2RQKA 3AQPA 1R8BA 4J9LA 1S9EB 4PXDA 2XLKA 3G6YA 1ZOTA 5F41A 3JSYA 2WRMA 3FUYA 4B3OA 3ZTQA 3AXMA 4EO8A 2BANB 2UVVA 1T02A 3T6JA 4Y2CA 4N5SA 2ZEJA 4CO5A 2XMAA 2V2ZA 4A46A 1NK8A 4G1PA 1SVDA 1E6VA 4CLUA 1XNRF 4DEZA 2AKWB 2YWWA 1KOHA 3NCQA 2ZD1A 3FSXA 2DGXA 2DNZA 3IM9A 6FDRA 2MY8A 5IV4A 3M8QA 4IFVA 3K17A 1X4DA 3L3CA 4IH7A 2MKJA 2AJ1A 3J7ZT 4O44B 2KM8B 4B3RF 1JLCB 2E7VA 2F5GA 2HHPA 3P49B 3SCKE 4O0IA 1FJCA 2ZH2A 3ULHA 1NDPA 2IM2A 4YDDB 4MKAA 3BPDA 3DLGB 2WCXA 1Q4RA 2GQ2A 3IRXA 2E5IA 4K8RA 1SJ3P 3CJ2A 3DRSA 5DJBA 2XC9A 3OLBA 3P5BP 4B9UA 3LH2S 1V3ZA 4QIVA 1V3RA 2QLXA 2VH7A 1S1UB 2HKEA 1KQKA 2RRAA 1NJYA 1F9FA 3HSJA 4C8OA 4LF7F 3CJ3A 5BYSA 1HYSB 2LFVA 3WX4A 2OEMA 1SKRA 3A3NB 4ICLA 2EFQA 4DV1F 2WBMA 2DGSA 1FT8A 4P2SA 4X62F 4J90A 1DTTA 2J6TA 2C2ZB 1NK7A 3O2IA 2E44A 3ZTSA 4F3QA 2KB2A 4KC5A 1TP7A 3BGFA 4OX8A 2VONA 2CJQA 2RU9A 2GGPB 2GAGC 3T9ZA 2VUGA 4DBQA 3BH6B 5D0HA 2M7SA 4C4WA 4RW4B 1FHTA 1LW2A 3MZIA 4J9PA 3PTWA 3W5ZA 2UV8G 2V8PA 1EJ7L 2B7CB 2OPPB 1RTDA 1UFWA 4M63A 2MQOA 3GCWP 2AWZA 2CG4A 1S12A 4L73A 1K47A 5HMYA 5T14A 5LMNF 3SV4A 3KLFB 2UU9J 2NCKL 4ZVHA 1JLGB 2OPQA 4C6AA 2ZOMA 4BWMA 4QBUA 2W2PP 3GU0A 3ZTOA 4ZPVR 4WF9Q 1BWVA 3DRXA 5SZTA 2GIFA 4YB7A 2FVSA 4GKKJ 5KFHA 1C2PA 2KHDA 4F36A 1YJWS 2DR7A 4KE5A 1R7IA 2GO8A 2V4JB 1J27A 2EG2A 3TX8A 1GX5A 3ZFVA 3MEKA 3KG1A 5L46A 2IMWP 3QO9A 1FXLA 1N6QB 4J9OA 4CZCA 3I0RA 3GQCA 2XG8A 3GPAA 3MR2A 2HWHA 3H40A 1YRTA 4YR0A 1YJVA 3G96A 2PO4A 1JLEB 3WIVA 2ASLA 2C3YA 5K8MA 3WQPA 4BWJA 1VMBA 3TRGA 1O5JA 4DR1F 4LF6J 5HANA 4F0MA 1U6BA 2HK2A 1TKTA 1OS5A 1LWCA 1HNVB 3FFIA 2ZC4A 1TUWA 5E41A 2J8SA 1V6HA 4C8ZA 3PYEA 5JJBA 4BLGA 2FY8A 1BD6A 3CCRS 1K1QA 3MM7A 2AU0A 5THWA 2A3JA 4ZP9A 1U48A 3CCQS 4JOUA 2VPZB 5CCMA 1S0NA 2AGOA 3DLLQ 5F8GA 4B9VA 2R7VA 2F63A 1NKBA 4CLPA 2BACA 1R8AA 3K5MA 3CT9A 4XIUA 3IAS9 3EUNA 2PI5A 5HK4A 4P9SA 2P6TA 4CO3A 3G8TA 1QVGR 1EB0A 4QWCA 2CQHA 3K5LA 3MAAB 1QUPA 2QE5A 2ZH7A 4XPEA 4O3RA 4GO5X 4OYMA 3W66A 3DLKA 4DG1B 5HMWA 1DQ8A 3P4UB 4DDFA 2FC8A 1N34F 3TJAA 3FCWA 2XTJP 2ZM6J 2IJRA 4A48A 3FZ2A 3NS6A 4OYPA 3DC2A 4N47A 2CA9A 4B3TJ 3MR7A 3HK2A 1XK8A 2VPYB 3FRZA 3TVZA 5KG4A 1F5CA 2LCWA 2A2CA 4ZVUB 5D15A 4ECQA 4J9VA 1NH7A 4RL1A 1ROFA 1RT2B 3Q8VA 2APOA 4K5SA 4OQJA 2HRTA 4OIXA 4F4KA 4WXOA 1WOOA 2YNFB 4MIBA 3U1NA 1J2VA 3CCUS 2ZOGA 4DPTA 2FD2A 3RU0A 1MN9A 2ZM6F 4IRCA 3C2PA 4LF6F 3I82A 3V5RA 4OZ3A 5A76A 1JB0C 4DI6A 2F8EX 2QV6A 2Q43A 2YNFA 3J7YU 3D68A 3DRRA 1U1OA 2XWYA 4HVZA 2FYXA 4NZ7A 3UCGA 2XHWA 1F3VA 2C3OA 3MMAB 3ZZOA 2VL1A 5K5MA 4Y0FA 4NLTA 1HNXF 1XNQF 3P3DA 4ALZA 4PRFA 2A10A 2BJ9A 2HFNA 3DXBA 3S8SA 5AJ3F 1W25A 2XMKA 3T19A 3W65A 4K4TA 3V4IB 1TK8A 4NEYA 3NGTA 3FBBA 2OFHX 3SQGA 2HNDA 4LR9A 2R8KA 5J2PB 4S0MA 2ATLA 2ZBQA 2HVZA 4JI2F 1O6XA 1GXUA 3MDFA 3W2WB 1F1BB 1ZPWX 5IT0A 4DV0J 1MW7A 1SKWA 4JI3J 2BDPA 4CIOA 2FVPA 3OFHA 5DG9A 3NRBA 1SIZA 3B6BA 1IBKF 5FLXU 5I42A 3DDKA 2I9SA 3TO8A 1QSLA 3Q2SC 3IR6B 2G0IA 3VR1A 1Y5IB 3RR7A 3J81j 2ADBA 1J5EJ 2NS1B 3QJLA 1U8SA 2IA0A 2XY5A 3W2VA 5AXKA 4X64F 1H2UX 5KT7A 2BQRA 1K73T 4AXJA 4IOCQ 5AE3A 1S7HA 1SUQA 2OSQA 5HQLA 3OTOJ 1L3TA 4EK2A 3V6DB 4DQPA 3E2EA 2XMMA 4EO6A 5F8MA 2U1AA 4PWUA 3BSAA 2IYGA 2FHJD 1ZS6A 3L95X 4RR5A 3LF0A 3MUMP 2DGUA 2VDIA 1S0MA 4BDPA 2C42A 2C2RA 1FRXA 1NJWA 4OL8A 2HVHA 1MNEA 3D54A 3WX8A 3JTNA 4ZVFA 4WFAQ 3CJ0A 4IQMA 1VLYA 2DNHA 2UXCJ 2E1RA 2AEJA 1R8HA 4KBIA 4OHYA 3M2UB 4X4RA 2HLTA 1ZAVA 1B4SA 2YKMA 3DLKB 3HZEA 4DG1A 2XO6A 1LKZA 3RW6A 2PC6A 2QA4S 2YKNB 1HBNA 1AYEA 3O3LA 4USVA 4CH7A 5LSRA 4DQRA 3CD7A 4KV8A 4DS5A 5G4DA 4C9DA 3HHEA 4MKVA 4UZCA 2M3DA 3UDEA 1C0TA 2ZHBA 4HTJA 4Q44A 4IRKA 4C8MA 4Y2KA 2G4BA 1UVJA 4X66J 4I67A 5E3PA 2CRLA 2X1GA 2VA3A 5HLFA 2RUGA 2MKCA 1X0FA 3Q89A 3T5HA 1C0UA 3CDUA 3CJ4A 4NI2A 1H74A 2NXEA 4ZLNA 1OY9A 2GHVC 3MURP 2Y9HA 4EZ6A 3C6UB 2DNGA 1QVFR 2LLZA 1FK9B 4USWA 1PAEX 2RUSA 2MJUA 2HSEB 1YDLA 4IOBA 3F0NA 3NKYA 2MB0B 1GTHA 2BJEA 3E3XA 4DSIA 3OFGA 2IRXA 5K14A 4ZHRB 1RWUA 2KO1A 3BB5A 5B0GA 1MWZA 3RGIA 5C2CA 2YH1A 2JLFA 2N7CA 1J5EF 4Y2MA 1YBAA 1ZAXA 4N41A 2GW8A 4KB7A 2AGPA 4LSLB 1QAYA 3BQ1A 2YNIA 1O0PA 2HRUA 1N4LA 1VCTA 2CNKB 1B0PA 5D3GA 4KGKA 1N48A 3UO0A 2R7OA 1K0VA 4DZ6A 4ILLA 2V2KA 1X5PA 4C7QA 1N36J 2J9CA 5KFGA 4LBIA 4FKYA 4AD6A 3UD3P 1HWKA 1PYSB 4FPRA 2ZZMA 1FRHA 1YJRA 3C6TA 2B4VA 1TU0B 2UUAJ 3LP1A 3HF5A 4P7VA 1X4EA 1OSCA 3UCUP 2R7UA 2QC3A 3H59A 1FA0A 1ZZNA 4JI7F 5DO2A 3TUPA 3DGPB 3DYAB 1Q16B 3I6PA 3O6QA 1GX6A 5ETLA 1S59A 4X4TA 1VJQA 3LAKA 2IJFA 3BGUA 4DPWA 4O3OA 1KDNA 3NG8A 4JV2A 3CIMA 2PDAA 1YX2A 2B7BB 3QIPB 3BYPA 4UF4A 2MQQA 1N52B 3SEOA 3W2WA 1LWCB 3IAM9 2VODA 3WZ0A 1JXVA 1IKWB 1O51A 3WC0A 4ZPBA 2FLOA 4W4MA 1NHUA 3M2VA 3HVTB 2CYYA 3CJKB 3HLUA 1RT5A 3EZOA 3NOCA 2QIFA 1UPPA 2GQQA 2XMTA 1XMOJ 4LBHA 2IAJA 3C46A 3KK2A 3GV5B 2HNZB 3Q8UA 4DQSA 2EWHA 5EN1A 4FF4A 4OJ1A 2OKQA 3A8JA 4KH1B 3V6DA 4NLYA 5KFKA 4P2FA 3TJ9A 3GILA 3SXLA 4JI5F 1HYSA 4QR2A 2QSFA 4ECRA 2OTJS 3GLJA 3GFHA 4OFZA 4LFBJ 4TKTA 2ZUGA 1NJIT 3ILJA 4X4PA 1RT7A 5A8RA 2ZVSA 3Q23A 2J9EA 2GIQA 5LXYA 1XMBA 1OSDA 4G1IA 1KN6A 4LR7A 4KSEB 4O4RA 4G1QB 4ZVPB 4HT5A 2ZJQQ 4HHHA 2B8QA 1OO0B 5KG5A 2C2OB 2DGOA 2DGTA 5A8WA 3ITHB 5BR8J 4C3KA 4JBCA 4RNFA 3I56S 4KQZA 1NSAA 1Q8LA 3I87A 4FZVA 1U0SA 3B8HA 1G2EA 2B0GA 1KTQA 1NJZA 2QLFB 5D3GB 2CNNB 3FBFA 3LO3A 5DETA 2ABYA 3A13A 2GMJA 4ZS6A 5H1SV 2K7KA 2MY7A 4PUOB 4FVCA 3OL9A 3V4MA 4WU3A 2LA4A 2RS8A 1Q53A 5E3QA 1SL1A 1MMDA 3FVYA 1M90T 2XWXA 4HDGA 4AE5A 4KGVB 5F8IA 3CGIA 1UVKA 5C5JA 2RKIB 3HSGA 1UWBA 2DH9A 2RDDA 1UA0A 4DR2J 5KT5A 3HSZA 2R2UA 1T95A 4MK7A 1VQ5S 3RR8A 2W8KA 1VBKA 1DFDA 2VFUA 4OYXA 1FNOA 1LWEB 3LPEA 4WP8A 2DCLA 3CC2S 1UJ4A 5DDRC 3NMAA 4M5DA 1T05B 4J5OA 4P2XA 1TKTB 5ETOA 5CA5A 3GJQB 1XR5A 5EGYA 3R9LA 1X5OA 2R8JA 1HHQA 2C2NA 1UKUA 2VG6A 4MKBA 1K8AT 4OZ2A 1GFWB 1LQ9A 1RABB 1XR7A 2RAQA 1C4AA 4I0WA 4LF2A 4YY3F 1VOMA 1TL1A 3GIMA 1T7PA 1REVB 4IDKB 1VQ7S 4NLGA 3M9MB 4K4XA 3R2DJ 2LXFA 2MJNA 1OWXA 4ILRA 1U1RA 5JXSA 4M1KA 1RWOB 4FP9A 1Y3JA 3ET6B 3Q8QB 3M6WA 2FJXA 4FF1A 1S76D 4W92B 3IC1A 2F9JA 2J0SD 4ZPTR 2F8HA 2F9DA 1CJVB 1HPZA 1GXTA 2BYCA 3D0HE 3R7SB 4EU0A 5HMZA 3A12A 2UUBJ 2PT0A 1UVNA 1U24A 3OTDA 1EETB 3PY8A 1M5KC 4JYAF 2EFVA 1WOPA 1U6FA 4M5JA 4TY9A 1PAUB 4I4BA 2MQMA 3N28A 1XNRJ 3HP6A 2D9OA 2FY1A 1KSPA 2EFPA 4DU8A 3MMBB 2KU7A 3MCMA 2CVIA 5KFXA 4LF1A 2E1MC 3K0JA 2DK2A 3M8QB 4LBPA 4JUZA 2VF3A 2FLNA 4I6YA 1J5OA 4DSLA 5IT9U 4RW7B 4O3PA 3PHEA 4HACA 1NHVA 2FHKA 4I1TA 4QIWD 1CULB 4O0NA 3T3FA 4RNOA 2IIHA 3C15B 1Y10A 4RW6A 3IRWP 1FO1A 3J81U 1VQ4S 1HBUB 4ZVRB 1FCAA 2I8EA 4PG7A 2DO0A 2ASDA 4QQBA 2ZH6A 4CQ1A 3OW2R 3D5MA 2XYHB 1SC3B 3HPOA 4B3RJ 4X4VA 4X2BA 5L1LA 2CJYB 2AD9A 3I9ZA 2D3ZA 3EGZA 4ZA1A 2KZMA 1VI7A 5BXIA 1D3WA 2DRAA 1U1MA 5G0RB 1NSKL 1AA1B 3BQ0A 3B78A 4Y6IA 1DTQB 2W1BA 3CJRA 3DRPA 4H4OB 4DV1J 1TL7B 4FN5A 4NCGA 1U2RA 1SXLA 4QWBA 2V2VA 3R97A 4K5RA 3SSSA 5AE1A 4ETXA 4DMZA 6AT1B 3MM9B 1PILA 4LVOP 1BQXA 5DLGA 4DV4J 2XS7A 1KQSR 2EK6A 2IMOA 3HZGA 5KFWA 1ZTWA 1WF0A 3A8KA 4YUDA 4A8XA 1FXDA 1L3SA 3NWRA 1F9EB 5B0FA 4DR5F 4JV5F 3M1VA 3TVKA 4Y28C 2H5IB 3M6VA 4K2XA 1JLBA 2WBRA 1FJGF 2GJIA 3QMQA 2UXDJ 1HD0A 2B5JA 2E5LF 2B9EA 3CTRA 3CMES 2VKRA 3QRPA 2AX0A 3J7Z5 2A18A 3VF0B 2RD5C 2NXCA 4WZQA 1AXQA 2B6AB 1RGVA 3H8YA 5A6WA 4USUA 1CLFA 5ETPA 2W9CA 5J1NA 2DGWA 3B4DA 1RAAB 5DRKA 3IG1A 3KFWX 5KG6A 2FJWA 1DAXA 2GFFA 4USIA 1WD6A 3AODA 3OVAA 3EDRB 4ES2A 5AXNA 3HFZB 3C19A 4QYZK 4YR3A 4LT6A 3OUYA 2OTLS 3RJMB 3OHBA 4DL3A 5IQ6A 3KJFB 2GQCA 4DV3J 1RA7A 1WELA 4DFMA 3SCIE 5EDWA 2HS4A 2E1CA 2HBZB 3R6LB 3KK2B 3GJRB 2YKMB 5B08A 4LF5J 2H4WB 1RCXB 4ECXA 1KHWA 2YKQA 1WG5A 2BQUA 1IM6A 2NSBA 2HAIA 4WK1A 4UZBA 1U4BA 3DXSX 4WU2A 3SCJE 1U1PA 2H48B 4C8YA 4GC6A 5C24B 4ZDNA 1V9OA 3TZZA 4P72A 4IFYA 3Q8RB 1VHFA 1D8YA 3ZZUA 3MWBA 1EIYB 4RKUC 5CABA 2AMCB 2NXUA 3PDNA 3RZAA 3BGLA 4Q0BB 1IQTA 3L4BC 5CYMB 3TANA 2H1YA 3KWMA 4DR4J 1QE1A 2EEYA 2DRDA 1PYTA 2M9KA 4CWBA 2RQCA 3BYRA 3Q8SB 1WORA 2DNYA 4QIGA 1DQAA 1N5VA 4QZVB 1N56A 4B9LA 4F8RA 3A4TA 1WF1A 5CYMA 4Q0BA 4EEYA 1QSSA 5B7WA 2LVWA 3OR1A 4USJC 2WSFC 2YKNA 1RCOB 1Y9OA 3A1YG 3PW2A 2VJVA 1XWLA 2KT2A 1T9YA 1WOSA 3L09A 1HBOA 5FIIA 3PIPQ 2XCPA 4M5DB 3BR9A 2CPJA 3B4MA 4GKKF 2J0WA 2B5JB 4Z2XA 2D3OR 1RWPB 3OL7A 1KS2A 3NWGA 4JV0A 1PO6A 4EMDA 3ZZPA 4LR8A 3G2XA 2GGPA 2PN6A 1YGYA 3E01A 2CWXA 1W7WA 5EWEA 2F65A 3H90A 2FDNA 3CCSS 1U6ZA 1H73A 1YWXA 1JLAB 1S1XB 4UUWA 2BA9A 1PJ5A 3GV8B 3TAPA 1EP4A 3GJTB 4NCGB 2QO3A 4NYOA 4DR1J 1RYSA 2C3PA 3SFGA 1RA6A 3KG0A 4AYBD 4DCOB 3OUYB 3T1HF 4NLPA 4LFCJ 4WTYA 4HHUA 1IKVA 1DURA 1FD8A 1FX2A 1MROA 1SI9A 2EBEA 1ICEB 5B0DA 1TKZB 4J9QA 1RTIB 2C2EA 1SKSA 1KP6A 3M8YA 1E6YA 5ITHA 3KLGA 4NLSA 2YQ1A 3GE9A 4RUHA 3VGTA 3THTA 5KFZA 2NREA 3MEDA 4MAKA 1LW0A 1HMVA 2HFSA 2PMHA 2XSFA 3GYGA 2K06A 3MTJA 3M2RA 4UW2A 5FD1A 1Y4ZB 2CJXB 3G4SS 5F8HA 4F4YA 2DR8A 3OQ2A 2ZBPA 2DHSA 2J76E 9ATCB 3KLIB 4IR9A 4QPTA 5GAGU 2NSCA 2C2KB 3P5TL 3WBZA 2QMWA 2B9WA 2DNNA 4CLKA 2IPOB 4I6AA 5KG1A 1NKCA 2HVIA 4NA2A 2IC3A 3O8WA 4Y2IA 3TZYA 5CD4A 2QMXA 3CDEA 1NPPA 3ZZYA 2HPUA 4NWBA 4I7FA 1N6QA 1FWPA 4FKXA 4AL7A 3TQ1A 3I0RB 1EKRA 5L38A 5F8NA 4LUBA 1XMQJ 5IOLA 2DYAA 3TZXA 2HGNA 1HA1A 4ELVA 1R8PA 3SCLE 2X1FA 2E1PA 2DH8A 2DGVA 1FXRA 4JI2J 2QEXS 1HQUA 1VRUB 2A2DA 4QW8A 4L74A 2M8DB 3R5AA 4XAKA 2K1RB 3R5CA 1KVJA 2QN6B 3TWZA 1L3KA 3HXMA 1U1KA 2LDIA 2BUNA 3H5SA 2BOAA 4RJVA 3UVJA 4ZLLA 2J0XA 2D41A 1BY9A 4LRCA 2OGUA 2WB1D 4ZOSA 3RYLA 5KT3A 3QLHB 2AYBA 3N6NA 3ISNC 2VJUA 1GMWA 3LAMA 4YHHF 1DARA 1F2HA 2V94A 3A3OB 3DU5A 2LQBA 3LP0B 2V4QA 3P6YC 1HI1A 2CQ4A 2GJFA 2W7AA 2HQFA 2XSJA 3L9ZA 3W5XA 4F25A 5J2MB 3JAMU 2R2RA 2HW3A 1JK9B 2GHWA 1I5OB 4FXDA 3MR5A 2DHXA 2QA2A 1DZ5A 3BM7A 2XQCA 2VG7A 2IBKA 1G6BA 3BZQA 3C8YA 3UWTA 1JNRB 2JNJA 3HVWA 4DWIA 1Z1ZA 1S79A 4KHMA 5GAEU 4NXNJ 2R8GA 1N32J 1DY3A 1HI8A 2VV5A 1H38A 3BO2A 4DV0F 4JI6J 1VQPS 1TL5A 3GV7B 4DU7A 2K3KA 4A8WA 3WHIA 3PR5B 4KHPF 2L9DA 2MKHA 3PG9A 4GKJF 2PSZA 5DQGA 1Q0NA 2N4CA 5L9XA 1VQMS 4GO7X 1YK9A 2B4OA 1I94J 4Y34A 3ZC4A 4E0DA 3LP2A 1S72S 3BDPA 3OXGA 4O23A 1U45A 3PNIA 3T1YF 4LFAF 2VC0A 1VIOA 4HR2A 4Q7AA 2YX7A 2Z58B 1T94A 1LOUA 1X4CA 4A8SA 1AFIA 1BWEA 1FRMA 3JQKA 1TL3B 3MMCA 3SMZA 4BHQA 4IDKA 1JLAA 1S1XA 2KHCA 3EGVA 2JVOA 1Z4UA 2LU1A 4NLQA 3UR3C 5DGAA 2QYCA 3Q86A 2YKOA 4DL2A 3QGIA 7AT1B 4I69A 4LSLA 3GFZA 3NEKA 3HKWA 3PYFA 2VICA 4K4YA 1S1VB 3IGNA 3RAMA 3L7PA 4C48A 4BCAA 3QO9B 5EWGA 4ZK7M 3QZ8A 4H4KA 3CJTA 4X62J 1NB2A 4OV1A 3IWXA 4F2SA 1LW0B 4R0JA 3UDVA 2CZ4A 4NA3A 2DNLA 2W4PA 3EMTA 3K89A 3IS9B 1Q86T 3CNQP 1SIWB 2GO9A 3DHWC 4L6V3 4TU8A 1FRJA 4KAIA 4DF8A 1Y7PA 3UPFA 1X5TA 2AV5A 1IWAA 3VAHA 3EXCX 5KT2A 4UY8T 2AJQA 2YQ3A 4J9MA 3F73A 3ENVA 1RZMA 5K9FA 5E0OA 5HATA 1GMUA 1RT1B 3KK3B 1LWFA 3H2VE 4CRJA 3D4JA 3T9NA 2ALYB 4ZPDA 4YR2A 3K59A 3TEGA 2RHSB 1FVQA 1RWVB 2BM0A 1T3OA 3GFXA 4UOFA 4RUAA 1GXLA 2D1CA 4RX6A 4DHVA 2ZDPA 2MZ1A 5KFOA 1JJ2R 5ETKA 3IFEA 5D0RA 4X4QA 5J1EA 2Z4PA 1P9QC 1YBUA 3RBXA 4TVAB 1FD2A 3M6UA 3CDWA 2VIHA 3G82A 2KVQE 4DR3F 1AUDA 1FE4A 5RUBA 1N5YA 5KFMA 1NBEB 5T7LA 1FKPA 2YNHA 3POTA 2MLZA 3CO9A 4ICLB 4ED1A 3RG6A 1AW0A 4K4VA 3AQOA 4F4ZA 4ECYA 2EG1A 1KBRA 5DM7Q 1IKXA 3HI9A 2GC8A 3PYDA 2R9LA 2R8IA 2ASYA 1BE4A 3AT1B 3D1QA 1M1KT 3ZO7A 2GA7A 3RRKA 4LF8J 1TELA 3D6TB 2BVZA 5IWAJ 4DL4A 4OYOA 3RB4A 4JI4F 1QUVA 2COLA 3AJDA 5EHHA 3OL8A 2KXFA 3T5JA 2B4UA 2RRNA 3AD9C 4YP3A 1RBOB 2FTRA 2O3DA 3GFYA 2BE2A 1NK9A 3BDEA 3J7AN 2XI2A 3T5LA 3EYZA 2CQ0A 4RBVA 4YDXA 3CJSA 5KFRA 4WFBQ 1ZH5A 1F6TA 2PI4A 1A9NB 3R5JB 4CO4A 4NCBA 5HVGA 2VC1A 3SQGB 4C98A 5KG2A 1K44A 2Y1LB 4LF8F 1CEZA 5CZVA 1F0XA 4DQQA 4ZCMA 1XJWB 2DKOB 1RK8A 2GVZA 3NGRA 1RAOA 4A47A 1QSYA 2LMIA 3CPWR 4NMXA 2D3O1 4DUZJ 2I1RA 1OIAA 4JI8F 3MEDB 1ZAWA 2EPIA 1WC4A 2QGFB 3IP0A 4Y65A 2FUG9 4KRWA 1M5OC 3HFKA 4OYAA 4UT4A 3PYGA 3HHLC 1F3FA 3AAWB 3TW0A 3KLVA 2FVQA 3N01A 4USKA 1S9GA 3UW1A 3W2VB 2JHEA 4ZPAA 1MROB 1Y11A 1P6TA 3O5TB 4I64A 2J7UA 3OV7A 2Y8YA 4DPUA 1UWAA 1QJHA 3W62A 2XGQA 1D1UA 1RWWB 4PZVA 5LT5A 5HMXA 3R7BB 2OHDA 4RZRA 1S1VA 2JC0A 3R5GA 2UVRA 3DNCA 2DNMA 4DV6F 3GCXP 3O1LA 4DR2F 4XTTA 1RSCA 4DXLA 2XYGB 3C14A 3H2UB 3SDEA 3VZHA 3BO4A 4RU2A 4F4WA 3H4DA 2M5YA 1KTVA 5HQMA 4YOEA 2OMLA 2VPXB 4ELUA 1YRXA 2BOPA 3A3PB 3BGRA 3BKUA 3EZUA 3QYYA 2VQEJ 2BMBA 4DSEA 2NR0A 3C14B 3EGNA 1GEHA 2QA1A 5I3QA 4B3MJ 4K0KJ 5D4PA 2AJ4A 3MEGA 2EXUA 2GAHC 3M6XA 4DSFA 3CEDA 3W1YC 2AYGA 2L41A 3VVUA 4KJIA 5F3ZA 3JSRA 5C25A 2HNYA 4MT1A 4TQRA 1T03B 2Z2LA 1ZM9A 3PW5A 2BKPA 2LA6A 2MGZA 4DL6A 3CF5Q 4V19X 2DTJA 2EVZA 1WEXA 4KFBB 5F8JA 5F0UA 1MU2A 1BQNA 2A1BA 2ZUAA 2JDJA 2MLYA 3UI3A 1NDLA 3M8RA 2X3GA 2CPHA 4P73A 2XNRA 4OJHA 4K0KF 1FRIA 1YKWA 2N3LA 4HDHA 4MH8A 4DUZF 1NKEA 3OR2B 2C3UA 2L3MA 2KH9A 2AQ4A 1EHWA 5J2QB 3I31A 4X64J 3VAGA 3QQCD 2CQIA 4KIAA 1WHWA 2GVZB 3DOMB 3HCXA 2P2CB 4HACB 4CLSA 2HEKA 2PIIA 5DG8A 2JEJA 3PW4A 3M1VB 4DUYJ 1FJEB 4ID8A 2AJ0A 4DFPA 2FVRA 4ZP6A 4QOTA 1HNWF 3GR0A 4ECWA 1WKLA 5IT9Y 4DV7F 4F02A 3BSNA 1ZZFA 3IWNC 4DL7A 2FIUA 1NPKA 3H2LA 2Y1IA 2VB6A 2KYXA 2Z30B 4MYUA 3UQSA 4DR6J 4UQTA 1WKKA 3T6BA 1VRTA 2AX1A 2OP5A 1VQOS 3HO1A 1HD1A 4HI1A 5DQIA 1D09B 5DS7A 1HR0J 3NNHA 4I56A 2AEFA 2V8DA 4CCHA 2CPEA 2U2FA 2OIHA 3CMQA 5F0WA 4Q8EA 2ZE2A 4DR5J 5CZXA 1BGXT 4ZLPA 3RRHA 1QM9A 3UR0A 5EWFA 1FI4A 4PG6A 1IBKJ 1QTNB 3D6MB 2LXUA 1U1QA 1SV5A 5GMKa 2HNDB 4ECSA 3BGRB 5J2PA 5HI7A 2ADCA 4FXVA 2I5JB 3FEZA 3PFEA 4LRAA 2XZTB 4JI6F 4CO1A 4Y3CA 1T9XA 2HFUA 4NLVA 1NB7A 3TP2A 4W98A 4KHPJ 2CQDA 1FNXH 1ZA1B 3GZ7A 1S97A 1WG1A 1U1NA 1NJXA 4WPAA 3HHLA 1N33J 2K7JA 2FQQB 2W4DA 4LSNA 3QGPA 4F3MA 2ZITA 2NYHA 5HLFB 1A0OB 4MMOA 1HWUA 2DEIA 2GMHA 1NDCA 2RQMA 3GWCA 3V81A 3MM7B 3ZZTA 4OZ1A 1S7IA 1Q95G 1JKHA 2YPZA 5D0EA 4PCQA 3C15A 4JI5J 4HLBA 4FDFA 1ZM3A 5I3UB 4XO0A 3QIDA 3CSKA 2CQ2A 3NBPA 4U67Q 1URNA 3CCWA 3H5XA 3RAXA 2VG7B 4YEAA 1MWYA 5IM0A 3FRYA 5KFTA 2W8LA 4F4XA 1R0AA 2H65B 2QTWA 1F9HA 4LSZB 3MFHA 3J7YI 1JLFA 1HNIA 5LMNJ 1UEVA 2PFFB 1VYAA 1F2GA 2BE2B 3CWJA 4I2PA 3KK1B 2R3VA 4NL5A 5BR8F 3OR1B 3VAKA 1P9YA 1TL7A 3S6EA 3ETMA 3KJNB 4B02A 2R7WA 2W2MP 4PPDA 2NZCA 3MECB 1IJFB 5DGBA 3MTKA 2JOQA 3K8WA 4KKOB 2CPZA 1UW9A 3UN3A 4AQYF 3V6JA 1RTJB 3I96A 1XQIA 3EPIA 4CI0B 2R7RA 5KFLA 4U6PA 3HDSA 4ES3A 4K2JA 2YX4A 2R7SA 3H0PA 3R7NB 1FDDA 2YWFA 4A8OA 2D9PA 4PWDB 2OSRA 1WI6A 1SB6A 3QATA 1SKUB 1EX8A 3QFWA 3V2UC 3OVSA 4JI0J 1S4EA 3DLHA 4KY3A 1FNMA 4YS2A 1CSJA 3HJVA 3IXQA 4URQU 3K57A 4OX9J 1S1TB 2I2YA 4WFNQ 2QFIA 3E8OA 3KHHA 1EQMA 1ELOA 3IMQJ 1D9FA 1GAOA 2JZ5A 4NOHA 5GAHI 3GG0A 3CW2C 1IBLJ 1TMJA 3DI6B 1T05A 2G1DA 3VGUA 4L3NA 3DLBA 2HHHJ 1SC4B 3ENAA 5KOXA 2E9RX 4N7TA 2NUHA 1HI0P 3N5FA 3QWUA 5K8NA 1IXKA 2JC1A 4GRSA 3DYAA 1CJVA 1HPZB 2QG9B 4TQSA 2KG1A 3PX0A 1VIXA 4OHVA 1UAWA 2WW4A 3IS9A 1RKJA 4AL5A 3FJ2A 1GQEA 1X60A 1FKOB 4EBEA 2VFVA 4DN9A 3DCAA 1B99A 2J8AA 2YWHA 3FNNA 2XS2A 1JJHA 3ZZZA 3PR4A 1Y00A 2HZAA 4OI3A 1YJ9S 2HS3A 4R25A 2QL7B 2NYIA 4HHJA 4EI2A 3GIIA 2ZDOA 3CVKA 5DG7A 1T3NA 1N5YB 5KFSA 3QZ7A 1S0OA 2D7SA 3W64A 3KK1A 3P8BB 4ZPWR 3BN7A 5HP1A 1JWWA 3PO4A 5JMNA 2MQPA 1GH8A 2XEXA 1YJTA 4DQIA 4H4KC 1H6KX 1NZAA 4OMFG 3BSOA 1DLOB 1G7CB 3CIZA 4ED2A 1PGZA 3Q0AA 2PEBA 1CC7A 4I2QB 2YX1A 4F04B 1JKHB 3FBEA 2VKZG 2ZH3A 3KMSA 1S1UA 4CLYA 3W9JA 5DLFA 4MKYA 1IR1A 2CVEA 3OTCA 4U95A 3MMJA 2C28A 1KLNA 2UXBF 5KG0A 1TUGB 4ZVQB 3N5BA 3OD2A 3I9V9 4CM2A 1IKXB 2JJ4D 2GV1A 4FNIA 1OYEA 2YKPA 4KR0B 2Z57B 3FSIA 1B64A 4KH0B 4DV5J 3BR8A 1OMSA 2QYGA 3QT7A 2XZWA 2OPPA 4NLRA 3K5NA 3T1HJ 3A8EA 1FE0A 3QT5A 1FKPB 1N5QA 2YNHB 3GG1A 3POTB 2EFNA 1EAYC 1UCNA 4PXBA 1ZM4A 2OH2A 3QAUA 1A6LA 2VBWA 4TNOA 5CAAA 1UVMA 5IV3A 2BW7A 3EICA 2VQFF 1RT4B 3NLCA 1X9WA 2DPIA 2J9DA 2M70A 2YNIB 4N8OA 1R3NA 3UDCA 1N0UA 1V3SA 2Z8QA 2L9NA 2JEIA 1JIHA 2MZRA 2R2SA 1SV5B 1TTHB 2CPXA 4DF4A 3PHTA 4NXNF 2Z56B 3NP5A 1FFSB 5LXRA 1N32F 2B3TB 1HBOB 2HQIA 1C1CB 4NXMF 5HROB 1P8GA 1WEYA 1WACA 2ZBCA 3SQOP 4DUTA 4U9RA 5A6PA 4Q2MA 3X1LB 2ZNZA 5T41A 5GAEI 3BBFA 2PEHA 4YB1P 1UWBB 1LV5A 1YBTA 3MM5B 4J7CA 4WFZA 4FF3A 1ZM2A 1FJGJ 2UXDF 2R7TA 1BUXA 2DCUB 2QSWA 4Q43A 3KLEA 3HD1A 4ECUA 3AXKA 1WC3A 1NUEA 1XBWA 3QSIA 4RNHA 5AXLA 4J9RA 1RP5A 3QNWB 1HNZF 4JI1J 3UNGC 1EP4B 1VGYA 1WTFA 2H51B 3UD4P 5LJ5Y 2HGMA 2ZH4A 3PJ9A 3ILOA 3DDIA 1LNQA 1MN7A 1VJWA 5KFDA 1VC0A 4LIWA 4JI3F 2BRKA 4Q8FA 3W60A 2MSSA 2YWEA 3CJKA 2M88A 3TA1A 3NS5A 2CFXA 2XHCA 4I68A 5HSPA 1XIQA 1CJUB 3MM6A 3W9IA 1MMLA 1CBKA 1RAEB 1NMEB 3PACA 1KOOA 1VLOA 3M8ZA 4R0EA 2NPIA 5KFYA 3VGVA 8ATCB 1Q7YT 3UFCX 1Q5VA 4NMLA 5KT4A 1JXLA 5D4NA 4W90B 3VCDA 1BQNB 4RNMA 2PD1A 1C1BB 1RAFB 1H0HB 2DITA 3VQTA 1NK0A 4F3OA 2M2BA 3GSIA 4TY8A 2F1FA 1QDUB 1CPZA 5ETNA 6FD1A 4OYWA 2DHHA 1D8ZA 3BBBA 4QYZJ 2MGZB 2OEKA 3IRXB 4TYBA 4WYWA 5EX0A 5KFUA 3MECA 4WWSA 2YNGB 2HAFA 2J0QD 1APSA 1T9WA 3ISND 4UOGA 1W2BR 5GAGI 4U96A 3J80Y 2OD6A 4HT7A 1S9FA 3GYXB 5FJ4A 3IO1A 3PX4A 1YITS 4LQ3A 2GCFA 2DD8S 2AW0A 1FFGB 1BC6A 2EFGA 4FVMA 1NCLA 3PO5A 3CC7S 4MK8A 4EBDA 1EZZB 1FDBA 1Q81T 4JYAJ 4RNNA 1PJ7A 4XDDA 2JH3A 4C8KA 2M0GB 3BKTA 1FWKA 1V5IB 4AFFA 1PIEA 2Q66A 8AT1B 1JNZB 4AQYJ 1VC6A 1T8EA 1RT4A 1B0TA 2RILA 2RDIA 3CJQA 3RAQA 2QL5B 2FZKB 4C3LA 3PV8A 1U0HA 1Y3KA 3OSNA 2Q6BA 3AB4B 1BXNA 3DRRB 1Q82T 3PCOB 3NS7B 1JLQA 2CQ1A 3ZZ0A 4CTAA 4WK3A 1IKVB 5LMUF 1CJTB 3MAHA 3OXFA 1U0HB 1KEKA 1G4CA 1UPMB 3LOUA 3PJXA 1KRPA 2HQCA 2V50A 4DR7F 5DQHA 1VHIA 1M5PC 3MI7X 2MSTA 2KM8C 3U1LA 3LPYA 2CPFA 2YTCA 4LRDA 4WE1A 5FDLA 4P71A 1N36F 4ZIVA 4K4SA 2HZCA 4DX6A 2V9KA 2WOMB 3DI6A 5GMEA 1IBLF 1FTCA 1WI8A 3HVTA 5KFVA 4J9KA 4HH1A 2WVCA 1R0CB 2HIYA 3SDEB 2ZNYA 3QIPA 3DHXA 1WTBA 2G1HA 4L72B 4WJBA 4URSA 5A8KB 4ECVA 1RBAA 1U2FA 2V63A 1X0PA 2YPYA 1SL2A 1QY7A 4DR7J 4PWWA 1WHXA 2MKKA 4LF9F 4GVBA 1RQ0A 2HBRB 1YLXA 1LWFB 1I51B 3KDOA 1Q8BA 4M5MA 3W8GA 2ZH5A 2MHNA 5J2NA 3QJJA 4D3HA 1TV6B 3THVA 3MAAA 3MOJB 2E66A 5E5NA 4MFBB 1PBAA 2W9AA 2HMIA 2DT9A 2JEFA 1UJ5A 4B9SA 4M94A 1A7GE 2JFKA 2K8GA 2ZFHA 3B82A 2XS5A 2ILZA 2IHR1 3VAJA 4KYZA 1C1BA 2Q3PA 2UU9F 4FYXB 3F56A 1XTZA 5E7OB 2XM3A 3CDAA 5KTQA 1GTEA 4ERDA 2QLWA 3DOKB 2XNQA 2EC0A 3MEGB 1HBUA 2Y0SD 3NOGA 4GMKA 2IJNA 5GMDA 1IBMF 1QAIA 4IQXA 1Z2ZA 1DHMA 1RWMB 4PPZA 4LJMA 3QAEA 2HG4A 3AD7C 3R5DA 2EKYA 3PW0A 3PX6A 4ZP8A 3OVBA 5D4LA 4U8VA 2LKZA 2H9ZA 5A0YB 3MR3A 5J2QA 2DEJA 2RB7A 4YN3B 2HLUA 4QWDA 4CNZA 3SZ2A 2RRBA 4E8UA 3G6ES 3EM1A 1EARA 1QLNA 5K8PA 4I6WA 3DMJA 3CMAS 2Y3YA 1WJ9A 1U1LA 3CCLS 1X9MA 3RB6A 3QLHA 2UUWA 5BYRA 5M2RA 2BM1A 1RACB 3JTOA 3NGUA 2XMJA 2AIRB 1D9DA 1UEKA 3FZBA 5H9FK 2HS0A 3WC2A 4LIRA 5A2QU 4IO9Q 5AT1B 3KHRA 2E9ZA 3OSPA 3NAHA 1HBMB 2YKAA 3M32B 4TXSA 2XMWA 7FD1A 2HVEA 1ZBTA 2VBXA 3TAMA 2IM1A 4BC7A 5KG7A 3EZ5A 2LECA 4OHWA 3R2CJ 3SFUA 4CO2A 2CWKA 2ZKUA 3TUIC 4RW4A 3M05A 2IRUA 1LW2B 2HFVA 3CDBA 4CNYA 1RYRA 4ZP7A 4PXEA 4FPIA 3IR7B 3D2WA 2IA6A 2C3MA 2VG6B 2D69A 2VFSA 4IO1A 4RBUA 5E3AA 4WKYA 3DFEA 2VBYA 3HX9A 2W4CA 3H25A 2UUBF 1IKYB 1REGX 2Q79A 2DISA 2WW8A 3OJUA 3NAIA 4NASA 1UA1A 4YQWA 1TUVA 4M5GA 2UXBJ 2I5JA 2CXEA 1RKIA 3JB9k 4ZVTB 5C42B 2EI5A 4OJGA 3PRDA 2MZJA 4NRTA 1TL3A 2BE9B 4WXWA 2HQDA 2CJBA 3BJYA 4C8LA 3PJWA 3HJFA 1RT1A 3KK3A 1AT1B 4Q5VA 1RJJA 2V67A 1B7FA 4DN0A 3PKMA 4ZVEA 3THPA 2G2ZA 2JFDA 1YHQS 1U2CA 3ADAC 1EETA 4DL0C 3KLGB 4B3SJ 4LF4F 1U8WA 2CDQA 3DM2A 2KVIA 3RB3A 3W8PA 1HQUB 1VRUA 2AZ1A 2V2QA 4ENOA 5DM6Q 3PXGa 3IGVA 4FS1A 3M9OB 1YI2S 1TQLA 1P1LA 4ZVOB 5C7PA 1CQNA 3ET6A 1FDNA 1PKUA 4CYUA 3ILLA 4TYAA 5D0GA 4DX7A 3G6XA 2HURA 2E5GA 3NXZA 1WC5A 2H54B 1KQFB 3G8SA 1KD1T 2FJEB 1YQHA 3FFIB 4LQ9A 4MYTA 3MCOA 3OXLA 5ETSA 1R27B 1N5SA 4L3KA 4O3NA 4NYZA 3FKBA 4WP9A 4F7VA 1IN0A 2IC3B 4ZN3A 4R5PB 1TKXB 2DNOA 4O3QA 3I5CA 4WP3A 4LF7J 4RW8A 2V8HA 4X65F 4IR1A 3F41A 2BKOA 2CQPA 4P7TA 2B9YA 3VAIA 3IBCB 4CM0A 4X66F 1NDKA 2O5DA 3N9UC 5BYQA 3W7BA 3KLHB 2QLJB 3TAQA 1L5UA 2W2OP 5LJ3Y 5KFIA 1M5VC 2QL9B 4ZJOA 4DX5A 2HWIA 1KKHA 3U02A 2LU2A 2ZJRQ 4DV3F 2V8GA 1R89A 2HHQA 1TAQA 4G1QA 1VQSA 4ZKAA 4K59A 1VQLS 3JQJA 1P27B 3NCRA 2PMZD 1JX4A 1VQKS 4JI7J 5E2QA 3TNVA 4OZNA 3SV3A 4ECTA 4NLUA 1RTJA 1SJQA 1RTDB 3BV8A 3DGVA 2A0FB 3D6FB 3TA0A 2CZ9A 1RADB 1T9VA 2N82B 4QW9A 1T03A 1HHSA 5L8RC 3DMJB 2VU5A 3FMWA 3M8PB 1RUSA 2OPRA 4NLDA 2MMYA 2ZZNA 1Y5LB 5K8OA 1Y5NB 5B0AA 2HIQA 3QSYB 1KNZA 4V19J 3EGWB 1HNIB 3Q8PB 4QYRA 1AFJA 5I3PA 3MXHP 1VBXA 2B9XA 4EZ9A 2WOMA 4H4MA 2BV3A 3JSMA 4M5IA 4OJ3A 1T9UA 3TAMB 1HQ2A 2BJ8A 2ZBIA 4R8UB 4OYBA 4Q45A 2B56A 3MPDA 5I4MA 3PEHA 3DGPA 1WNEA 1LFPA 1WKJA 2GJ2A 3AFGA 1S77D 3LW5C 2LEBA 1B70B 4MJKA 1Q78A 1SC6A 1TL4A 3UDLA 2W7PA 3KLFA 3TARA 3KOAA 2CPIA 3GMGA 4CTAB 2E7XA 3LP1B 4KO0A 3GR1A 2FLPA 2LQ9A 2ZHOA 3C16B 3KHGA 1ZTTA 4ZIWA 1RHMB 2RSQA 4O44A 5C42A 2JL9A 5A8KA 3D0IE 1JLCA 4K7QA 4ANCA 4CLLA 2Y0BB 3M2UA 5KAKA 1XERA 1WHVA 2HHWA 4WBFA 1DBDA 2UUCJ 1AROP 2ZD1B 2H5JB 2ZC3A 2ACMA 2EK1A 1RB0A 2FGCA 5DDPC 1PSDA 5AXMA 2RMLA 1VQYA 3HD2A 3IBWA 3UVJB 1SJ1A 4B3OB 2HHSA 1M1GA 2ATCB 2NLWA 2X51A 1MLAA 3ENWA 4NYPA 3S1TA 5HJYA 3OTEA 3FEXB 3SSQA 2BX6A 2HWTA 2WVBA 1KVIA 2QT7A 5L39A 2H5EA 3MF5A 5U47A 1ZYQA 2V9WA 4USHA 2DIUA 2OPSA 1BQMB 2CQBA 4ZCKA 2UUCF 1L3UA 4ZN1A 3K58A 4QIEA 1RAJA 4WFXA 4DPOA 1F5BA 3OT9A 5ADZA 2MQLA 1I6JA 2DPJA 1NO8A 1K0TA 3D1HA 4ID5A 4ZLJA 4EUVA 4ED7A 2MZQA 4WIQA 4X4NA 4CLTA 2HNYB 1BLUA 4ED0A 1NZ8A 3MOZA 3MD3A 1FEEA 5IFMA 1HHTP 1HBNB 1U7LA 1RU2A 2BXJA 5IC6B 4CO0A 4DLGA 2LEAA 2XSJB 5J2MA 1U26A 2HYIB 1HIYA 1TK5A 3DOMA 4NE9C 4RLEA 2P8IA 1T0TV 2VOPA 2JWNA 3LGMA 1OQ3A 1S1WB 2XB2D 1XR6A 1NU4A 2H4YB 3IBFB 1M5HA 2XZDB 3NGKA 2DH7A 3IR5B 5E3CA 3JYTB 3GIRA 1HNXJ 4PWDA 5A2QY 2LYVA 3G6VA 2F7VA 4CH1A 2AJ2A 2ZE2B 2F3JA 2AYMA 2J9DE 1HW9A 1G1XA 4BC9A 2O66A 3QWPA 1TKZA 3VZIA 1VRTB 2W9BA 5D78A 4C11A 3ONQA 2VQEF 1WDTA 4EYIB 3BQ2A 1EKSA 1JLQB 2HFOA 1HARA 1PJ6A 3I5AA 2IY5B 2JSXA 1WSVA 2LQ8A 2VA2A 2AYEA 4LFBF 4Z7YA 1FRLA 1ITPA 3TOQA 1AB8A 3PM9A 4OLOA 3N4WA 3ELHA 1FJ7A 3HFVA 3ISZA 1RI7A 2BBEA 1S4FA 3EPGA 1RT6A 3M8WA 2XMVA 4OZJA 4OZ0A 1RAGB 3K2YA 1SJRA 5CYQA 1S10A 1H7WA 1PYOB 2E9TA 4LRFA 3NNAA 4ED5A 4U7UD 2F4VJ 2DRBA 2NQPA 1KLMB 1E6VB 5GADU 1N5TA 1W2IA 1I3OB 2GX8A 1RHRB 1YG0A 3BPSP 3GYNA 1UFLA 1SPBP 4OZLA 1NSQA 3TX0A 3W9HA 5KFNA 2Y1JA 3I32A 2BZ2A 1XNQJ 3OHAA 3I5BA 1CQMA 1UETA 2V4RA 3LTOA 4IOAQ 4WCEQ 1IWGA 4D3GA 3QT6A 2BKNA 2CQ3A 3BH7B 4OX7A 2MKIA 2JLEA 4WTOB 4LSNB 2M52A 3CJ5A 2FHMA 3S01A 5JVGQ 1UTAA 2XY7A 1TV6A 1BHNA 5EX3A 1ZETA 1BMQB 2RH3A 3BSCA 2VHGA 5FLXY 2DB1A 1NHKL 3CJ8A 5HBMA 4DV7J 3GIKA 2B8PA 1H72C 2I38A 2UUTA 1Q79A 2CAJA 4NLWA 3KG4A 1HL6A 4LVNP 5CHCB 2KN4A 1MMNA 2FPHX 4K50A 4J91A 3MM8A 3KLHA 2FGOA 3PFOA 4N76A 1KR4A 3HMJG 3LA0A 2LP4A 2LXIA 2ZVIA 1CULA 1CJUA 4OZ5A 3OTOF 4DV2J 1GT8A 1HNZJ 4U8YA 4JI1F 5D8HB 2Y8WA 5IZHA 3TUZC 3MM8B 1HWJA 2CPYA 5ETVA 1MSWD 3TJ8A 2AJFE 4LF4J 2OPRB 3CULA 3GSDA 5E33A 2QRRA 2LQJA 5LL6d 2VD3A 1OYDA 4PYDA 1H3DA 4CT8A 1N33F 4LFAJ 3BBCA 4F50A 2VFTA 3H5YA 2HHVA 2RVJA 5G0RA 3US5A 2CJAA 4KFBA 1DTQA 1D0EA 2GZOA 1KQGB 2QMUB 2XCAA 5CQGA 2OUGA 2DNRA 3BKFA 2RF2B 4Q2LA 4RWXA 2IVFB 4ZJQA 3CUNA 5F9NA 2G2YA 4DX8H 1JLGA 2OPQB 2AEMA 3VWSA 1FTRA 2HFZA 2B51A 3EDQB 4AXIA 2J5AA 3MUTP 3KJQB 4KPCA 3GIJA 5KFCA 3CCVS 2HHTA 3KUEA 2UUAF 1C1CA 2E7WA 3LWLA 4A8MP 3NGSA 3JSMB 4B08A 4NLXA 4G65A 2BE7D 4IH5A 4F67A 3RB0A 2WSCC 3KNAA 4ER8A 3J81Y 1S1TA 2BW2A 2RHQB 1RT6B 2ROGA 4WYLA 5CCLA 1KVKA 4JV5J 2H3EB 3MPUB 3NMRA 3Q24A 1IKWA 1CJKA 1UZDA 3M4XA 3MPVA 3CCZA 3M30B 2AZ3A 2V4JA 1LXJA 3UE2A 3LWMA 1KWMA 3QT8A 4QR1A 5IXUA 3VAFA 2BANA 1IVZA 1SBRA 3FQKA 1LWEA 3H42A 1U09A 2XY6A 2L08A 2MKSA 4PABA 2KG0A 1NAQA 1GK8A 3NNCA 4DUYF 1XN9A 2V34A 2Z2ZA 4ANDA 4LF5F 3MD1A 4IYQA 4MFBA 2P5VA 3MPYA 2OELA 5B0CA 2HZVA 2HMIB 2F40A 3DLJA 3UNYA 2JVRA 1VDHA 1DQ9A 2F4FA 4ED8A 4UOHA 2CQGA 4DCPB 5KT6A 1REVA 5GADI 1DLOA 3FK4A 4U7UK 1KONA 2KT5A 3HHDA 4O4GA 1ZPVA 1TVRB 2G0CA 2RT3A 4PQAA 4PG4A 2ZH9A 2OAUA 3ZTPA 2B4PA 3PEJA 5IC4B 3VV2B 4OHXA 3JSBA 1PCAA 2FJDB 2GNKA 3AOBA 4HEA9 3JS9A 2KRRA 2ZJPQ 1HWLA 2ZWPA 1PBUA 2ROPA 2UZAA 3KLIA 2HHUA 4HH0A 4PR6A 4JI0F 4CP5A 1WEZA 5I3UA 3K5PA 2FHJA 2DXFA 4LF9J 1NK4A 3CC4S 1X7VA 4QWEA 1NRKA 4UUXA 3TA2A 4E2FB 3UD5A 3CXCR 2ZH1A 2UV8A 3C6UA 2VZ9A 4FNHA 4RW9B 2DNQA 2GVDA 3VTIA 4USMA 1XMOF 1N34J 4QPXA 3MCNA 2RDJA 2OD4A 2HVDA 2W7OA 1RT7B 4IKAA 5A8RB 1C0UB 3NGDA 1IBMJ 3D28A 4DR4F 3LANA 4RO0A 1X8DA 3UN5A 3AA9A 4XDCA 2N7YA 3DLGA 2PA3A 3IN5A 4CDIA 3U7JA 1QAXA 2DR5A 3EXYA 1FWLA 4ATNA 2XLJA 2ROEA 3H5UA 1RU1A 4I2PB 3PIOQ 5IS2A 3SSRA 1SJFA 1FDAA 2KI2A 4OI0A 3L7OA 1RWKB 1UMJA 3LP0A 2KFZA 2W2QP 5CYQB 2RJZA 2ZZTA 2HQGA 4DLEA 1TK0A 2WONA 3FCVA 1DRZA 1RLDA 5CD4H 3UCZP 5MLCV 5KOWA 2C1EB 2A6OA 2MZSA 1U49A 3HHNB 1HFEL 2DHGA 3TZWA 1R6VA 1AZSB 2C2DA 2WZ1A 4PG5A 1E6YB 2YXLA 3A8IA 1RWXB 2N4DA 3JQMA 2NZ4A 3I0SB 4NX9A 5SUHA 1IR0A 1OPZA 2MZTA 5M2UA 4KT0C 4YY3J 5IWAF 1VK8A 4UQGA 2XGPA 1Q7LB 3LQVA 2ZH8A 4M8LA 4P10A 4ILMA 3CB4A 1OPIA 4NXMJ 3KMQA 4KGMA 3QRRA 1HNVA 4ZITA 5KFQA 4ZJLA 1RBLA 4YFUA 1HNWJ 1SQEA 1TL1B 3GONA 2IAJB 4FYWB 4DPXA 3ETOA 1RAHB 3ICLA 4ED4A 2HNZA 2B6AA 4ANEA 4U7CA 3AY0A 1RISA 3ENQA 1YTYA 2DXDA 1O8BA 2O1PA 3VQSA 2W24A 4DCJB 3HM9A 1D9AA 1FEHA 2G2OA 1PC5A 1H2TZ 3FSYA 4IFVB 1VBYA 3EVOA 4BS2A 1X5SA 4ELTA 4O4GB 4O3SA 2FC9A 5L1KA 1RTHA 1R0AB 2QFJA 3RW7A 4OI4A 4HTIA 4CYUB 2CZVC 5HBMB 5F9LA 3MEEB 4PG8A 4HI2A 3TQEA 3D66A 2BJ3A 1VS3A 2QZ8A 4OX9F 3DM2B 1SH0A 4M5NA 2PMWA 5H9FJ 4KGZB 2W9CB 3DDNA 1LK7A 2UXCF 3ZNUA 4X4UA 2VG5B 3W61A 4FYDA 2QJ3A 2OMOA 1KHVA 4GC7A 2F4VF 3AOAA 4JB8B 1LWXA 3CCES 1LFWA 4B3MF 3IM8A 2MPUA 7FDRA 2ZKTA 1JXEA 3G86A 2Z0GA 3E01B 4R5PA 1JLFB 1RTZA 1TMMA 4OLPA 2BEFA 2DVIA 3EVWA 5A0YA 1N88A 2R7QA 1S6UA 3JTPA 3H20A 1JMTA 3U1MA 5K14B 4ZHRA 5HO4A 1QTMA 2UVWA 3K7RA 1GMWD 2NXNA 2CNOB 4RW7A 4CLFA 1VC5A 1VQ9S 2N3OA 4YHHJ 2CIMA 2CJKA 4FBTA 1XC9A 1H98A 1S5ZA 3R5BA 4OI1A 8RUCA 4CT9A 1RAIB 2Z2YB 4DOZA 4A8KA 4RUCA 3VGSA 2EW9A 1JJCB 1MU2B 1RTIA 1QD1A 3GP9A 4M5LA 2OJ3A 2ASJA 1CS4A 2MEWA 2X1AA 1LEOA 2KXHA 5LSLA 3WIUA 2CKWA 2RIJA 1CJTA 3HKZD 4F26A 5KFJA 2W2NP 2W9BB 2OEJA 2MHEA 2NXJA 3EX7B 1RDRA 4CLZA 3N6MA 4L75A 5HVFA 3LUYA 3IG1B 2AF6A 4DPYA 3J7A1 2DR9A 1RT2A 2Z2MA 3EJMA 4ZVGA 3CCTA 1TFWA 3HT0A 3T5KA 3H98A 4C97A 3EWGA 4RUBA 3VAMA 4YB5A 2MQNA 2HK3A 4TU7A 1S99A 2MXYA 4KGXB 3GB0A 4RWWA 4CH0S 3KKFA 2HQ3A 2ALZA 1R0BG 1RLCL 3OFFA 3P96A 3TEHB 1TFYA 1WF2A 3SBMA 2QLBB 3QGHA 3OFEA 3WDOA 2FVCA 4QJVA 4F0KA 3DU6A 4HL9A 2WHOA 2Y1RI 2OO4A 5H9EK 2BABA 4FYVB 4HKQA 3Q8YA 2VG5A 1N8RT 3KLEB 1NPRA 3ZNJ1 1X4HA 3R1HA 2E5LJ 1S6QB 4JI4J 4J9SA 4TY8B 2MYFA 3JXOA 5B0BA 3RRGA 1U25A 1S6PA 3I4PA 5LSOA 2IM3A 3VHQA 3DKDA 5HQ8A 4AT1B 2J7KA 5C25B 3KTQA 3BEGB 5I42B 3CD6S 4QU6A 4ETZA 2JX2A 2DGQA 2G0JA 3Q83A 1RTHB 2GMLA 3D6HB 3FC9A 4FXWA 3BS9A 1CC8A 1SCJB 5DDOC 4DR3J 3T1YJ 3LALA 1YIJS 1R43A 1CG2A 1X9SA 4OYIA 3RBEA 5HJXA 3FGVA 1IQZA 1K9MT 4Y00A 1G3OA 2GHPA 2L9WA 2VOOA 1J5OB 2AT1B 1DJ0A
chains in the Genus database with same CATH topology
4J91A 4YS2A 3RBZA 2AEJA 2OGUA 2BKOA 3L4BC 4XTTA 4L75A 4J7CA 4EI2A 2AEFA 3JXOA 3KXDA 4G65A 1VCTA 2BKNA 4L76A 4RO0A 4GVLA 4L73A 1LNQA 2FY8A 2BKPA 4J9UE 4L74A 3RBXA 4J9VA 4J90A 2AEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J91 A;  4YS2 A;  3RBZ A;  2AEJ A;  2OGU A;  2BKO A;  3L4B C;  4XTT A;  4L75 A;  4J7C A;  4EI2 A;  2AEF A;  3JXO A;  3KXD A;  4G65 A;  1VCT A;  2BKN A;  4L76 A;  4RO0 A;  4GVL A;  4L73 A;  1LNQ A;  2FY8 A;  2BKP A;  4J9U E;  4L74 A;  3RBX A;  4J9V A;  4J90 A;  2AEM A; 
#chains in the Genus database with same CATH topology
 5L9N A;  4ZMM A;  4ED3 A;  3R1L A;  2G13 A;  2DR6 A;  4ID5 B;  3KUG A;  1XEZ A;  4NPO A;  3MMB A;  4HYK A;  3DRP B;  1IBC B;  2A6M A;  4H4O A;  1GMV A;  2FJA B;  2UP1 A;  4WKR A;  4FYY B;  1NND A;  1MWQ A;  2R4F A;  2WB4 A;  4J37 A;  1URR A;  1FF2 A;  1UFK A;  3LP2 B;  3Q22 A;  4PEO A;  2WK4 A;  4P2M A;  2OPS B;  3CD0 A;  5JVH Q;  2DO4 A;  4LFC F;  3T41 A;  2POK A;  4C8N A;  1AZS A;  4PXC A;  4Z7C A;  2DIV A;  3FQL A;  4KKO A;  1RHQ B;  3VVT A;  1FFW B;  4J9N A;  5DDQ C;  5HRO A;  2IDE A;  4JV1 A;  2R7X A;  3FCH A;  4N8N A;  4AUK A;  3M9N B;  2YBV A;  4NLO A;  1WC1 A;  1CJK B;  2K3I A;  4B9N A;  2V68 A;  2VBZ A;  1HQE B;  2DNP A;  1M0S A;  2CUY A;  3D1O A;  4OYZ A;  4A8Y A;  3V4I A;  3QGG A;  2IDL A;  4PYA A;  2F8M A;  5HL7 Q;  1AUS L;  4URG A;  3FDS A;  2X1B A;  3MFI A;  2DJW A;  1HW8 A;  2J7W A;  1VR6 A;  2PA8 D;  3I55 S;  1NEE A;  3MHY A;  2XI3 A;  3MMA A;  1IUJ A;  4IG0 A;  3M8P A;  3RUB L;  4AL6 A;  3IWL A;  2WVE A;  3D3B J;  3C16 A;  3LGN A;  2P9G A;  1KFD A;  2BR0 A;  3DLE B;  5C2G A;  2Q6C A;  2YY3 A;  5DZ6 A;  4DSJ A;  1JQG A;  1S48 A;  2JEG A;  2RKI A;  3K8V A;  1OJ4 A;  3O44 A;  4KHR A;  4ZVS B;  5HVH A;  3H4B A;  3MAQ A;  3I0S A;  3IA0 A;  5CXT A;  3MEE A;  4Y2A A;  1TZ0 A;  2DBB A;  1R6Y A;  2VAS A;  5AJ3 J;  3AOC A;  4OHZ A;  3HHL D;  2BQ3 A;  3C6T B;  3W5Y A;  4G3I A;  2HRY A;  2KJV A;  3U27 A;  1X4A A;  4IFY B;  3OLA A;  3SI8 A;  2FB0 A;  1VBZ A;  3H7H B;  3N6L A;  4M5K A;  4OV6 A;  1NXI A;  3MM6 B;  3G82 B;  4B3S F;  5HP1 B;  2R2T A;  4E98 A;  3AH6 A;  4H54 A;  4ED6 A;  2IRY A;  1TKX A;  1YZ6 A;  2JLG A;  3KYL A;  1B3T A;  3C3L A;  1S0V A;  1Q1K A;  4RW8 B;  3KJV B;  4TN2 A;  5KG3 A;  2PGC A;  2KFY A;  1SC1 B;  3BO3 A;  1N0V C;  4L76 A;  2RE1 A;  3TUJ C;  2WAQ D;  2KDO A;  2HBQ B;  1S6O A;  5KFP A;  4DV4 F;  1S57 A;  1FKO A;  1HLW A;  1FK9 A;  3AJ2 A;  2V0N A;  5GVQ A;  4OI6 A;  2R42 A;  3UN2 A;  1FKA F;  1EQ0 A;  1LXN A;  4P52 A;  3BGO P;  1WG4 A;  3D0G E;  4C3M A;  1RHU B;  3TVY A;  1VFJ A;  4A4J A;  2GVD B;  1FVS A;  1UZH A;  3PKY A;  4M5H A;  3RTV A;  3D7S B;  1IM4 A;  4B9M A;  4P74 A;  4UST A;  2IFX A;  2GIR A;  4YB6 A;  1HWI A;  2MTL A;  3G8Q A;  2V8V A;  3DRS B;  4UOC A;  3TR5 A;  3DRY A;  2P9E A;  3R27 A;  2B43 A;  5B09 A;  5MAO A;  4NA1 A;  2RS2 A;  4PUO A;  2C22 A;  4F2R A;  1PG5 B;  4H4M B;  4IUF A;  5T7L B;  5ETQ A;  2CDR B;  2D74 B;  2WVF A;  2YWK A;  4EBC A;  2I0X A;  3M7V A;  1U47 A;  1VQ8 S;  2ZBR A;  4PQU A;  2M8H A;  2WSE C;  2GS8 A;  3BRE A;  4GVL A;  4DV6 J;  1HKA A;  1NLK L;  2JRS A;  5IT4 A;  2E1A A;  9RUB A;  3MMC B;  5M2P A;  1X4F A;  1OY8 A;  2L48 A;  1U02 A;  2KXN B;  4DR6 F;  1F5A A;  1HQE A;  3ITH A;  4IH6 A;  2LEP A;  4DV2 F;  1UJ6 A;  2CNL B;  3AA8 A;  4QWA A;  2IM0 A;  1OQ6 A;  4WE1 B;  1Q5Y A;  1WC0 A;  4NZ6 A;  3JAM Y;  3M8S A;  1SJ4 P;  1VK3 A;  1CVJ A;  1RHJ B;  1NM2 A;  5EUH A;  1H7X A;  2ACY A;  3C66 A;  5D4O A;  2HBY B;  2SXL A;  2I6W A;  1TAU A;  2FLL A;  2QX0 A;  1T11 A;  2KT3 A;  1HBM A;  3M32 A;  2RF2 A;  5HAO A;  4EGL A;  3N0V A;  2DNK A;  5KFF A;  2DY1 A;  1W26 A;  3FBC A;  1VIS A;  2V5H G;  2V69 A;  3S7R A;  4DS4 A;  2Q1L A;  1L3V A;  1UL3 A;  5KFA A;  4V1A k;  3DLE A;  4FBU A;  1UW4 A;  2E5H A;  1RWN B;  2XUL A;  3NY0 A;  5ETR A;  2ZHA A;  3D9B A;  2KKH A;  2R8H A;  2WON B;  2C2M B;  2IYI A;  3D3C J;  4GVB B;  1WHY A;  2XYP B;  3CE8 A;  1NK6 A;  3M30 A;  3G71 S;  1ACM B;  4IG0 B;  4MTP A;  3KJV A;  1IKY A;  1JLE A;  3PW7 A;  1I94 F;  1WC6 A;  4NEZ A;  3M2V B;  2YVS A;  1TVR A;  3HUL A;  2RQ4 A;  2BJ7 A;  2AP6 A;  3HT3 A;  2P9C A;  3AJ1 A;  3BN4 A;  4EWT A;  4ZPC A;  2IBO A;  2LDY A;  5H9E J;  1SQF A;  2D3U A;  5HN0 A;  3KUH A;  2ERR A;  1V5V A;  1I1G A;  3L7U A;  4QCL A;  1WDD A;  2CPD A;  3DOK A;  1HMV B;  4RPF A;  4DL5 A;  3CD5 A;  3M2R B;  1B0V A;  2K1R A;  1LK5 A;  1S9E A;  3R3T A;  4WII A;  5CYJ A;  2EC2 A;  5JUM A;  1JJ4 A;  4IRD A;  2NUU G;  4ZCL A;  3J80 U;  2VPW B;  5DZ7 A;  1VQN S;  2XO7 A;  2EBG A;  5L1I A;  4LRB A;  4Z37 A;  1GNK A;  1RE1 B;  2UVU A;  4RW9 A;  1S6Q A;  3HHK A;  4CLW A;  1QE1 B;  1SH2 A;  3EVM A;  3FEY B;  1NSP A;  5F8L A;  4F0H A;  4I2Q A;  2DXE A;  5ETM A;  5KFE A;  4C2M A;  5J2N B;  1PC4 A;  3FMB A;  4LMZ A;  3TI0 A;  2EKN A;  3KHL A;  3SIP B;  4BBY A;  3CCM S;  5BJR A;  3JYT A;  4ITS A;  1UEU A;  4MIA A;  2YH0 A;  3V6K A;  2KFN A;  4NZ0 A;  3NCP A;  3DOL B;  4EFA C;  4GKJ J;  1Q8K A;  1RT3 B;  2XBP A;  3OJS A;  1QAJ A;  3AHP A;  2ZOF A;  3N79 A;  3RBZ A;  4OX6 A;  5IM0 B;  1IR2 A;  1YJ7 A;  2YWG A;  5LMU J;  2ILY A;  1RT3 A;  1SL0 A;  1VRQ C;  2HHH F;  5A8W B;  1B7Y B;  2RNE A;  3F44 A;  2OI2 A;  2M4M A;  3KXD A;  2NPF A;  1FX4 A;  1WUU A;  3GJS B;  4PQU B;  2FHO B;  2OLW A;  4C0H A;  3T1A A;  3B54 A;  3ILI A;  2LQ5 A;  4NI2 B;  3AB2 B;  5LM7 E;  4C0O C;  4X65 J;  4WZM A;  4EYH B;  4C11 B;  5AE2 A;  5K20 B;  1TR0 A;  4X4O A;  4ECZ A;  1YJN S;  1H2V Z;  2AGQ A;  4G6V B;  2RU3 A;  3K5O A;  3PRB A;  3ZZR A;  3MPW A;  4DZD A;  1C4C A;  1YSJ A;  2CAD A;  1N54 B;  1Q8I A;  2FJB B;  4K4Z A;  2FZG B;  3HSD A;  3MR6 A;  1KFS A;  2XLI A;  3ZTR A;  1SQG A;  4OI2 A;  1JLB B;  5F3T A;  4XPC A;  1KLM A;  1Y0H A;  1RXO B;  5B0E A;  3V6H A;  1YVF A;  1X4G A;  3PRV A;  1M5S A;  1Z2L A;  2J6U A;  3G87 A;  2AHO B;  1M1H A;  3GTY X;  2PE8 A;  5FDL B;  2BRL A;  4PKD B;  2O01 C;  3VAL A;  5L1J A;  3BF4 A;  4TU9 A;  4PAA A;  5KFB A;  1TKD A;  3G9C A;  4KTQ A;  1P1T A;  2V6A A;  2HGL A;  1S6P B;  2HHX A;  4MK9 A;  4P75 A;  4N56 A;  4QR0 A;  3PZP A;  2J6S A;  4WFY A;  2IVM A;  1K1S A;  3QBC A;  4KO0 B;  1SUQ B;  1ZA2 B;  4LRE A;  4J9U E;  2K2P A;  2WVD A;  4RBT A;  3OTB A;  1IJE B;  1R31 A;  1S9G B;  1R8C A;  2PFD A;  3HHL B;  3MM5 A;  3P45 B;  3QFH A;  4TLQ A;  4X4S A;  5GAH U;  2BJ1 A;  1FES A;  1NH8 A;  1S49 A;  3MUV P;  3R8Y A;  3HVR A;  3CCJ S;  3PVX A;  1NK5 A;  2DY9 A;  3OL6 A;  1T9T A;  3HVA A;  3LGH A;  3KNG A;  2G9O A;  4I7F B;  4KV8 B;  4YME A;  4N77 A;  4P6Q A;  2FJV A;  1XMQ F;  4RW6 B;  2WTF A;  3OPK A;  4IG3 B;  3ZXW A;  5J1P A;  3W3S A;  1RT5 B;  1X4B A;  3TYT A;  1F60 B;  4DJB A;  5C24 A;  4FF2 A;  4NCA A;  4B17 A;  4UTG A;  4IG3 A;  3NBP B;  5J1E B;  3OR2 A;  2MQ8 A;  2E5J A;  3R6G B;  5LOQ A;  4A8Q A;  4DSK A;  4K4U A;  3D67 A;  4X84 A;  3DOL A;  3MCS A;  1WSR A;  4JP8 A;  4ZCI A;  2CG8 A;  5D77 A;  2KYZ A;  1DTT B;  2X3D A;  4DFK A;  3QPI A;  2E29 A;  3V81 B;  3RBD A;  3X3U A;  4B3T F;  3QRQ A;  2EFO A;  2YNG A;  4RU9 A;  1BQM A;  4UY8 5;  4MIW A;  1UVL A;  3SYZ A;  1VQ6 S;  4A8F A;  2W25 A;  3OBI A;  4KPY A;  3NL0 A;  1CS4 B;  2KJW A;  3I4H X;  1C0T B;  2VQF J;  1ULR A;  3CO0 P;  2OFG X;  5CH7 B;  4TLR A;  2BJD A;  2MDA A;  2X7I A;  5D6G A;  4R8U A;  2QA4 G;  2MLX A;  4JI8 J;  3QJP A;  4C0B A;  2P6S A;  4DV5 F;  1UVI A;  2MKY A;  1WWH A;  4B9T A;  3DN9 A;  4FS2 A;  2KZZ A;  5ETT A;  1S1W A;  2CQC A;  4DFJ A;  1HR0 F;  1YRU A;  1FER A;  2KRB A;  3E51 A;  1X31 C;  2KL8 A;  2ZWO A;  2IVY A;  3KDN A;  4QIF A;  1YJU A;  3Q2T C;  2VFR A;  1KC8 T;  1OY6 A;  1FRK A;  1MG7 A;  2CJ9 A;  3AD8 C;  4M95 A;  1UP1 A;  2W01 A;  3MGJ A;  3MM9 A;  4QU7 A;  1YZ7 A;  2XMU A;  2DHA A;  4ES1 A;  4F4A A;  4XK8 C;  2KTQ A;  2YQ0 A;  2O67 A;  3EE3 A;  4K4W A;  3W63 A;  5E3R A;  5IQQ A;  4NRU A;  1RHK B;  2FZC B;  2VDH A;  1SH3 A;  2RQK A;  3AQP A;  1R8B A;  4J9L A;  1S9E B;  4PXD A;  2XLK A;  3G6Y A;  1ZOT A;  5F41 A;  3JSY A;  2WRM A;  3FUY A;  4B3O A;  3ZTQ A;  3AXM A;  4EO8 A;  2BAN B;  2UVV A;  1T02 A;  3T6J A;  4Y2C A;  4N5S A;  2ZEJ A;  4CO5 A;  2XMA A;  2V2Z A;  4A46 A;  1NK8 A;  4G1P A;  1SVD A;  1E6V A;  4CLU A;  1XNR F;  4DEZ A;  2AKW B;  2YWW A;  1KOH A;  3NCQ A;  2ZD1 A;  3FSX A;  2DGX A;  2DNZ A;  3IM9 A;  6FDR A;  2MY8 A;  5IV4 A;  3M8Q A;  4IFV A;  3K17 A;  1X4D A;  3L3C A;  4IH7 A;  2MKJ A;  2AJ1 A;  3J7Z T;  4O44 B;  2KM8 B;  4B3R F;  1JLC B;  2E7V A;  2F5G A;  2HHP A;  3P49 B;  3SCK E;  4O0I A;  1FJC A;  2ZH2 A;  3ULH A;  1NDP A;  2IM2 A;  4YDD B;  4MKA A;  3BPD A;  3DLG B;  2WCX A;  1Q4R A;  2GQ2 A;  3IRX A;  2E5I A;  4K8R A;  1SJ3 P;  3CJ2 A;  3DRS A;  5DJB A;  2XC9 A;  3OLB A;  3P5B P;  4B9U A;  3LH2 S;  1V3Z A;  4QIV A;  1V3R A;  2QLX A;  2VH7 A;  1S1U B;  2HKE A;  1KQK A;  2RRA A;  1NJY A;  1F9F A;  3HSJ A;  4C8O A;  4LF7 F;  3CJ3 A;  5BYS A;  1HYS B;  2LFV A;  3WX4 A;  2OEM A;  1SKR A;  3A3N B;  4ICL A;  2EFQ A;  4DV1 F;  2WBM A;  2DGS A;  1FT8 A;  4P2S A;  4X62 F;  4J90 A;  1DTT A;  2J6T A;  2C2Z B;  1NK7 A;  3O2I A;  2E44 A;  3ZTS A;  4F3Q A;  2KB2 A;  4KC5 A;  1TP7 A;  3BGF A;  4OX8 A;  2VON A;  2CJQ A;  2RU9 A;  2GGP B;  2GAG C;  3T9Z A;  2VUG A;  4DBQ A;  3BH6 B;  5D0H A;  2M7S A;  4C4W A;  4RW4 B;  1FHT A;  1LW2 A;  3MZI A;  4J9P A;  3PTW A;  3W5Z A;  2UV8 G;  2V8P A;  1EJ7 L;  2B7C B;  2OPP B;  1RTD A;  1UFW A;  4M63 A;  2MQO A;  3GCW P;  2AWZ A;  2CG4 A;  1S12 A;  4L73 A;  1K47 A;  5HMY A;  5T14 A;  5LMN F;  3SV4 A;  3KLF B;  2UU9 J;  2NCK L;  4ZVH A;  1JLG B;  2OPQ A;  4C6A A;  2ZOM A;  4BWM A;  4QBU A;  2W2P P;  3GU0 A;  3ZTO A;  4ZPV R;  4WF9 Q;  1BWV A;  3DRX A;  5SZT A;  2GIF A;  4YB7 A;  2FVS A;  4GKK J;  5KFH A;  1C2P A;  2KHD A;  4F36 A;  1YJW S;  2DR7 A;  4KE5 A;  1R7I A;  2GO8 A;  2V4J B;  1J27 A;  2EG2 A;  3TX8 A;  1GX5 A;  3ZFV A;  3MEK A;  3KG1 A;  5L46 A;  2IMW P;  3QO9 A;  1FXL A;  1N6Q B;  4J9O A;  4CZC A;  3I0R A;  3GQC A;  2XG8 A;  3GPA A;  3MR2 A;  2HWH A;  3H40 A;  1YRT A;  4YR0 A;  1YJV A;  3G96 A;  2PO4 A;  1JLE B;  3WIV A;  2ASL A;  2C3Y A;  5K8M A;  3WQP A;  4BWJ A;  1VMB A;  3TRG A;  1O5J A;  4DR1 F;  4LF6 J;  5HAN A;  4F0M A;  1U6B A;  2HK2 A;  1TKT A;  1OS5 A;  1LWC A;  1HNV B;  3FFI A;  2ZC4 A;  1TUW A;  5E41 A;  2J8S A;  1V6H A;  4C8Z A;  3PYE A;  5JJB A;  4BLG A;  2FY8 A;  1BD6 A;  3CCR S;  1K1Q A;  3MM7 A;  2AU0 A;  5THW A;  2A3J A;  4ZP9 A;  1U48 A;  3CCQ S;  4JOU A;  2VPZ B;  5CCM A;  1S0N A;  2AGO A;  3DLL Q;  5F8G A;  4B9V A;  2R7V A;  2F63 A;  1NKB A;  4CLP A;  2BAC A;  1R8A A;  3K5M A;  3CT9 A;  4XIU A;  3IAS 9;  3EUN A;  2PI5 A;  5HK4 A;  4P9S A;  2P6T A;  4CO3 A;  3G8T A;  1QVG R;  1EB0 A;  4QWC A;  2CQH A;  3K5L A;  3MAA B;  1QUP A;  2QE5 A;  2ZH7 A;  4XPE A;  4O3R A;  4GO5 X;  4OYM A;  3W66 A;  3DLK A;  4DG1 B;  5HMW A;  1DQ8 A;  3P4U B;  4DDF A;  2FC8 A;  1N34 F;  3TJA A;  3FCW A;  2XTJ P;  2ZM6 J;  2IJR A;  4A48 A;  3FZ2 A;  3NS6 A;  4OYP A;  3DC2 A;  4N47 A;  2CA9 A;  4B3T J;  3MR7 A;  3HK2 A;  1XK8 A;  2VPY B;  3FRZ A;  3TVZ A;  5KG4 A;  1F5C A;  2LCW A;  2A2C A;  4ZVU B;  5D15 A;  4ECQ A;  4J9V A;  1NH7 A;  4RL1 A;  1ROF A;  1RT2 B;  3Q8V A;  2APO A;  4K5S A;  4OQJ A;  2HRT A;  4OIX A;  4F4K A;  4WXO A;  1WOO A;  2YNF B;  4MIB A;  3U1N A;  1J2V A;  3CCU S;  2ZOG A;  4DPT A;  2FD2 A;  3RU0 A;  1MN9 A;  2ZM6 F;  4IRC A;  3C2P A;  4LF6 F;  3I82 A;  3V5R A;  4OZ3 A;  5A76 A;  1JB0 C;  4DI6 A;  2F8E X;  2QV6 A;  2Q43 A;  2YNF A;  3J7Y U;  3D68 A;  3DRR A;  1U1O A;  2XWY A;  4HVZ A;  2FYX A;  4NZ7 A;  3UCG A;  2XHW A;  1F3V A;  2C3O A;  3MMA B;  3ZZO A;  2VL1 A;  5K5M A;  4Y0F A;  4NLT A;  1HNX F;  1XNQ F;  3P3D A;  4ALZ A;  4PRF A;  2A10 A;  2BJ9 A;  2HFN A;  3DXB A;  3S8S A;  5AJ3 F;  1W25 A;  2XMK A;  3T19 A;  3W65 A;  4K4T A;  3V4I B;  1TK8 A;  4NEY A;  3NGT A;  3FBB A;  2OFH X;  3SQG A;  2HND A;  4LR9 A;  2R8K A;  5J2P B;  4S0M A;  2ATL A;  2ZBQ A;  2HVZ A;  4JI2 F;  1O6X A;  1GXU A;  3MDF A;  3W2W B;  1F1B B;  1ZPW X;  5IT0 A;  4DV0 J;  1MW7 A;  1SKW A;  4JI3 J;  2BDP A;  4CIO A;  2FVP A;  3OFH A;  5DG9 A;  3NRB A;  1SIZ A;  3B6B A;  1IBK F;  5FLX U;  5I42 A;  3DDK A;  2I9S A;  3TO8 A;  1QSL A;  3Q2S C;  3IR6 B;  2G0I A;  3VR1 A;  1Y5I B;  3RR7 A;  3J81 j;  2ADB A;  1J5E J;  2NS1 B;  3QJL A;  1U8S A;  2IA0 A;  2XY5 A;  3W2V A;  5AXK A;  4X64 F;  1H2U X;  5KT7 A;  2BQR A;  1K73 T;  4AXJ A;  4IOC Q;  5AE3 A;  1S7H A;  1SUQ A;  2OSQ A;  5HQL A;  3OTO J;  1L3T A;  4EK2 A;  3V6D B;  4DQP A;  3E2E A;  2XMM A;  4EO6 A;  5F8M A;  2U1A A;  4PWU A;  3BSA A;  2IYG A;  2FHJ D;  1ZS6 A;  3L95 X;  4RR5 A;  3LF0 A;  3MUM P;  2DGU A;  2VDI A;  1S0M A;  4BDP A;  2C42 A;  2C2R A;  1FRX A;  1NJW A;  4OL8 A;  2HVH A;  1MNE A;  3D54 A;  3WX8 A;  3JTN A;  4ZVF A;  4WFA Q;  3CJ0 A;  4IQM A;  1VLY A;  2DNH A;  2UXC J;  2E1R A;  2AEJ A;  1R8H A;  4KBI A;  4OHY A;  3M2U B;  4X4R A;  2HLT A;  1ZAV A;  1B4S A;  2YKM A;  3DLK B;  3HZE A;  4DG1 A;  2XO6 A;  1LKZ A;  3RW6 A;  2PC6 A;  2QA4 S;  2YKN B;  1HBN A;  1AYE A;  3O3L A;  4USV A;  4CH7 A;  5LSR A;  4DQR A;  3CD7 A;  4KV8 A;  4DS5 A;  5G4D A;  4C9D A;  3HHE A;  4MKV A;  4UZC A;  2M3D A;  3UDE A;  1C0T A;  2ZHB A;  4HTJ A;  4Q44 A;  4IRK A;  4C8M A;  4Y2K A;  2G4B A;  1UVJ A;  4X66 J;  4I67 A;  5E3P A;  2CRL A;  2X1G A;  2VA3 A;  5HLF A;  2RUG A;  2MKC A;  1X0F A;  3Q89 A;  3T5H A;  1C0U A;  3CDU A;  3CJ4 A;  4NI2 A;  1H74 A;  2NXE A;  4ZLN A;  1OY9 A;  2GHV C;  3MUR P;  2Y9H A;  4EZ6 A;  3C6U B;  2DNG A;  1QVF R;  2LLZ A;  1FK9 B;  4USW A;  1PAE X;  2RUS A;  2MJU A;  2HSE B;  1YDL A;  4IOB A;  3F0N A;  3NKY A;  2MB0 B;  1GTH A;  2BJE A;  3E3X A;  4DSI A;  3OFG A;  2IRX A;  5K14 A;  4ZHR B;  1RWU A;  2KO1 A;  3BB5 A;  5B0G A;  1MWZ A;  3RGI A;  5C2C A;  2YH1 A;  2JLF A;  2N7C A;  1J5E F;  4Y2M A;  1YBA A;  1ZAX A;  4N41 A;  2GW8 A;  4KB7 A;  2AGP A;  4LSL B;  1QAY A;  3BQ1 A;  2YNI A;  1O0P A;  2HRU A;  1N4L A;  1VCT A;  2CNK B;  1B0P A;  5D3G A;  4KGK A;  1N48 A;  3UO0 A;  2R7O A;  1K0V A;  4DZ6 A;  4ILL A;  2V2K A;  1X5P A;  4C7Q A;  1N36 J;  2J9C A;  5KFG A;  4LBI A;  4FKY A;  4AD6 A;  3UD3 P;  1HWK A;  1PYS B;  4FPR A;  2ZZM A;  1FRH A;  1YJR A;  3C6T A;  2B4V A;  1TU0 B;  2UUA J;  3LP1 A;  3HF5 A;  4P7V A;  1X4E A;  1OSC A;  3UCU P;  2R7U A;  2QC3 A;  3H59 A;  1FA0 A;  1ZZN A;  4JI7 F;  5DO2 A;  3TUP A;  3DGP B;  3DYA B;  1Q16 B;  3I6P A;  3O6Q A;  1GX6 A;  5ETL A;  1S59 A;  4X4T A;  1VJQ A;  3LAK A;  2IJF A;  3BGU A;  4DPW A;  4O3O A;  1KDN A;  3NG8 A;  4JV2 A;  3CIM A;  2PDA A;  1YX2 A;  2B7B B;  3QIP B;  3BYP A;  4UF4 A;  2MQQ A;  1N52 B;  3SEO A;  3W2W A;  1LWC B;  3IAM 9;  2VOD A;  3WZ0 A;  1JXV A;  1IKW B;  1O51 A;  3WC0 A;  4ZPB A;  2FLO A;  4W4M A;  1NHU A;  3M2V A;  3HVT B;  2CYY A;  3CJK B;  3HLU A;  1RT5 A;  3EZO A;  3NOC A;  2QIF A;  1UPP A;  2GQQ A;  2XMT A;  1XMO J;  4LBH A;  2IAJ A;  3C46 A;  3KK2 A;  3GV5 B;  2HNZ B;  3Q8U A;  4DQS A;  2EWH A;  5EN1 A;  4FF4 A;  4OJ1 A;  2OKQ A;  3A8J A;  4KH1 B;  3V6D A;  4NLY A;  5KFK A;  4P2F A;  3TJ9 A;  3GIL A;  3SXL A;  4JI5 F;  1HYS A;  4QR2 A;  2QSF A;  4ECR A;  2OTJ S;  3GLJ A;  3GFH A;  4OFZ A;  4LFB J;  4TKT A;  2ZUG A;  1NJI T;  3ILJ A;  4X4P A;  1RT7 A;  5A8R A;  2ZVS A;  3Q23 A;  2J9E A;  2GIQ A;  5LXY A;  1XMB A;  1OSD A;  4G1I A;  1KN6 A;  4LR7 A;  4KSE B;  4O4R A;  4G1Q B;  4ZVP B;  4HT5 A;  2ZJQ Q;  4HHH A;  2B8Q A;  1OO0 B;  5KG5 A;  2C2O B;  2DGO A;  2DGT A;  5A8W A;  3ITH B;  5BR8 J;  4C3K A;  4JBC A;  4RNF A;  3I56 S;  4KQZ A;  1NSA A;  1Q8L A;  3I87 A;  4FZV A;  1U0S A;  3B8H A;  1G2E A;  2B0G A;  1KTQ A;  1NJZ A;  2QLF B;  5D3G B;  2CNN B;  3FBF A;  3LO3 A;  5DET A;  2ABY A;  3A13 A;  2GMJ A;  4ZS6 A;  5H1S V;  2K7K A;  2MY7 A;  4PUO B;  4FVC A;  3OL9 A;  3V4M A;  4WU3 A;  2LA4 A;  2RS8 A;  1Q53 A;  5E3Q A;  1SL1 A;  1MMD A;  3FVY A;  1M90 T;  2XWX A;  4HDG A;  4AE5 A;  4KGV B;  5F8I A;  3CGI A;  1UVK A;  5C5J A;  2RKI B;  3HSG A;  1UWB A;  2DH9 A;  2RDD A;  1UA0 A;  4DR2 J;  5KT5 A;  3HSZ A;  2R2U A;  1T95 A;  4MK7 A;  1VQ5 S;  3RR8 A;  2W8K A;  1VBK A;  1DFD A;  2VFU A;  4OYX A;  1FNO A;  1LWE B;  3LPE A;  4WP8 A;  2DCL A;  3CC2 S;  1UJ4 A;  5DDR C;  3NMA A;  4M5D A;  1T05 B;  4J5O A;  4P2X A;  1TKT B;  5ETO A;  5CA5 A;  3GJQ B;  1XR5 A;  5EGY A;  3R9L A;  1X5O A;  2R8J A;  1HHQ A;  2C2N A;  1UKU A;  2VG6 A;  4MKB A;  1K8A T;  4OZ2 A;  1GFW B;  1LQ9 A;  1RAB B;  1XR7 A;  2RAQ A;  1C4A A;  4I0W A;  4LF2 A;  4YY3 F;  1VOM A;  1TL1 A;  3GIM A;  1T7P A;  1REV B;  4IDK B;  1VQ7 S;  4NLG A;  3M9M B;  4K4X A;  3R2D J;  2LXF A;  2MJN A;  1OWX A;  4ILR A;  1U1R A;  5JXS A;  4M1K A;  1RWO B;  4FP9 A;  1Y3J A;  3ET6 B;  3Q8Q B;  3M6W A;  2FJX A;  4FF1 A;  1S76 D;  4W92 B;  3IC1 A;  2F9J A;  2J0S D;  4ZPT R;  2F8H A;  2F9D A;  1CJV B;  1HPZ A;  1GXT A;  2BYC A;  3D0H E;  3R7S B;  4EU0 A;  5HMZ A;  3A12 A;  2UUB J;  2PT0 A;  1UVN A;  1U24 A;  3OTD A;  1EET B;  3PY8 A;  1M5K C;  4JYA F;  2EFV A;  1WOP A;  1U6F A;  4M5J A;  4TY9 A;  1PAU B;  4I4B A;  2MQM A;  3N28 A;  1XNR J;  3HP6 A;  2D9O A;  2FY1 A;  1KSP A;  2EFP A;  4DU8 A;  3MMB B;  2KU7 A;  3MCM A;  2CVI A;  5KFX A;  4LF1 A;  2E1M C;  3K0J A;  2DK2 A;  3M8Q B;  4LBP A;  4JUZ A;  2VF3 A;  2FLN A;  4I6Y A;  1J5O A;  4DSL A;  5IT9 U;  4RW7 B;  4O3P A;  3PHE A;  4HAC A;  1NHV A;  2FHK A;  4I1T A;  4QIW D;  1CUL B;  4O0N A;  3T3F A;  4RNO A;  2IIH A;  3C15 B;  1Y10 A;  4RW6 A;  3IRW P;  1FO1 A;  3J81 U;  1VQ4 S;  1HBU B;  4ZVR B;  1FCA A;  2I8E A;  4PG7 A;  2DO0 A;  2ASD A;  4QQB A;  2ZH6 A;  4CQ1 A;  3OW2 R;  3D5M A;  2XYH B;  1SC3 B;  3HPO A;  4B3R J;  4X4V A;  4X2B A;  5L1L A;  2CJY B;  2AD9 A;  3I9Z A;  2D3Z A;  3EGZ A;  4ZA1 A;  2KZM A;  1VI7 A;  5BXI A;  1D3W A;  2DRA A;  1U1M A;  5G0R B;  1NSK L;  1AA1 B;  3BQ0 A;  3B78 A;  4Y6I A;  1DTQ B;  2W1B A;  3CJR A;  3DRP A;  4H4O B;  4DV1 J;  1TL7 B;  4FN5 A;  4NCG A;  1U2R A;  1SXL A;  4QWB A;  2V2V A;  3R97 A;  4K5R A;  3SSS A;  5AE1 A;  4ETX A;  4DMZ A;  6AT1 B;  3MM9 B;  1PIL A;  4LVO P;  1BQX A;  5DLG A;  4DV4 J;  2XS7 A;  1KQS R;  2EK6 A;  2IMO A;  3HZG A;  5KFW A;  1ZTW A;  1WF0 A;  3A8K A;  4YUD A;  4A8X A;  1FXD A;  1L3S A;  3NWR A;  1F9E B;  5B0F A;  4DR5 F;  4JV5 F;  3M1V A;  3TVK A;  4Y28 C;  2H5I B;  3M6V A;  4K2X A;  1JLB A;  2WBR A;  1FJG F;  2GJI A;  3QMQ A;  2UXD J;  1HD0 A;  2B5J A;  2E5L F;  2B9E A;  3CTR A;  3CME S;  2VKR A;  3QRP A;  2AX0 A;  3J7Z 5;  2A18 A;  3VF0 B;  2RD5 C;  2NXC A;  4WZQ A;  1AXQ A;  2B6A B;  1RGV A;  3H8Y A;  5A6W A;  4USU A;  1CLF A;  5ETP A;  2W9C A;  5J1N A;  2DGW A;  3B4D A;  1RAA B;  5DRK A;  3IG1 A;  3KFW X;  5KG6 A;  2FJW A;  1DAX A;  2GFF A;  4USI A;  1WD6 A;  3AOD A;  3OVA A;  3EDR B;  4ES2 A;  5AXN A;  3HFZ B;  3C19 A;  4QYZ K;  4YR3 A;  4LT6 A;  3OUY A;  2OTL S;  3RJM B;  3OHB A;  4DL3 A;  5IQ6 A;  3KJF B;  2GQC A;  4DV3 J;  1RA7 A;  1WEL A;  4DFM A;  3SCI E;  5EDW A;  2HS4 A;  2E1C A;  2HBZ B;  3R6L B;  3KK2 B;  3GJR B;  2YKM B;  5B08 A;  4LF5 J;  2H4W B;  1RCX B;  4ECX A;  1KHW A;  2YKQ A;  1WG5 A;  2BQU A;  1IM6 A;  2NSB A;  2HAI A;  4WK1 A;  4UZB A;  1U4B A;  3DXS X;  4WU2 A;  3SCJ E;  1U1P A;  2H48 B;  4C8Y A;  4GC6 A;  5C24 B;  4ZDN A;  1V9O A;  3TZZ A;  4P72 A;  4IFY A;  3Q8R B;  1VHF A;  1D8Y A;  3ZZU A;  3MWB A;  1EIY B;  4RKU C;  5CAB A;  2AMC B;  2NXU A;  3PDN A;  3RZA A;  3BGL A;  4Q0B B;  1IQT A;  3L4B C;  5CYM B;  3TAN A;  2H1Y A;  3KWM A;  4DR4 J;  1QE1 A;  2EEY A;  2DRD A;  1PYT A;  2M9K A;  4CWB A;  2RQC A;  3BYR A;  3Q8S B;  1WOR A;  2DNY A;  4QIG A;  1DQA A;  1N5V A;  4QZV B;  1N56 A;  4B9L A;  4F8R A;  3A4T A;  1WF1 A;  5CYM A;  4Q0B A;  4EEY A;  1QSS A;  5B7W A;  2LVW A;  3OR1 A;  4USJ C;  2WSF C;  2YKN A;  1RCO B;  1Y9O A;  3A1Y G;  3PW2 A;  2VJV A;  1XWL A;  2KT2 A;  1T9Y A;  1WOS A;  3L09 A;  1HBO A;  5FII A;  3PIP Q;  2XCP A;  4M5D B;  3BR9 A;  2CPJ A;  3B4M A;  4GKK F;  2J0W A;  2B5J B;  4Z2X A;  2D3O R;  1RWP B;  3OL7 A;  1KS2 A;  3NWG A;  4JV0 A;  1PO6 A;  4EMD A;  3ZZP A;  4LR8 A;  3G2X A;  2GGP A;  2PN6 A;  1YGY A;  3E01 A;  2CWX A;  1W7W A;  5EWE A;  2F65 A;  3H90 A;  2FDN A;  3CCS S;  1U6Z A;  1H73 A;  1YWX A;  1JLA B;  1S1X B;  4UUW A;  2BA9 A;  1PJ5 A;  3GV8 B;  3TAP A;  1EP4 A;  3GJT B;  4NCG B;  2QO3 A;  4NYO A;  4DR1 J;  1RYS A;  2C3P A;  3SFG A;  1RA6 A;  3KG0 A;  4AYB D;  4DCO B;  3OUY B;  3T1H F;  4NLP A;  4LFC J;  4WTY A;  4HHU A;  1IKV A;  1DUR A;  1FD8 A;  1FX2 A;  1MRO A;  1SI9 A;  2EBE A;  1ICE B;  5B0D A;  1TKZ B;  4J9Q A;  1RTI B;  2C2E A;  1SKS A;  1KP6 A;  3M8Y A;  1E6Y A;  5ITH A;  3KLG A;  4NLS A;  2YQ1 A;  3GE9 A;  4RUH A;  3VGT A;  3THT A;  5KFZ A;  2NRE A;  3MED A;  4MAK A;  1LW0 A;  1HMV A;  2HFS A;  2PMH A;  2XSF A;  3GYG A;  2K06 A;  3MTJ A;  3M2R A;  4UW2 A;  5FD1 A;  1Y4Z B;  2CJX B;  3G4S S;  5F8H A;  4F4Y A;  2DR8 A;  3OQ2 A;  2ZBP A;  2DHS A;  2J76 E;  9ATC B;  3KLI B;  4IR9 A;  4QPT A;  5GAG U;  2NSC A;  2C2K B;  3P5T L;  3WBZ A;  2QMW A;  2B9W A;  2DNN A;  4CLK A;  2IPO B;  4I6A A;  5KG1 A;  1NKC A;  2HVI A;  4NA2 A;  2IC3 A;  3O8W A;  4Y2I A;  3TZY A;  5CD4 A;  2QMX A;  3CDE A;  1NPP A;  3ZZY A;  2HPU A;  4NWB A;  4I7F A;  1N6Q A;  1FWP A;  4FKX A;  4AL7 A;  3TQ1 A;  3I0R B;  1EKR A;  5L38 A;  5F8N A;  4LUB A;  1XMQ J;  5IOL A;  2DYA A;  3TZX A;  2HGN A;  1HA1 A;  4ELV A;  1R8P A;  3SCL E;  2X1F A;  2E1P A;  2DH8 A;  2DGV A;  1FXR A;  4JI2 J;  2QEX S;  1HQU A;  1VRU B;  2A2D A;  4QW8 A;  4L74 A;  2M8D B;  3R5A A;  4XAK A;  2K1R B;  3R5C A;  1KVJ A;  2QN6 B;  3TWZ A;  1L3K A;  3HXM A;  1U1K A;  2LDI A;  2BUN A;  3H5S A;  2BOA A;  4RJV A;  3UVJ A;  4ZLL A;  2J0X A;  2D41 A;  1BY9 A;  4LRC A;  2OGU A;  2WB1 D;  4ZOS A;  3RYL A;  5KT3 A;  3QLH B;  2AYB A;  3N6N A;  3ISN C;  2VJU A;  1GMW A;  3LAM A;  4YHH F;  1DAR A;  1F2H A;  2V94 A;  3A3O B;  3DU5 A;  2LQB A;  3LP0 B;  2V4Q A;  3P6Y C;  1HI1 A;  2CQ4 A;  2GJF A;  2W7A A;  2HQF A;  2XSJ A;  3L9Z A;  3W5X A;  4F25 A;  5J2M B;  3JAM U;  2R2R A;  2HW3 A;  1JK9 B;  2GHW A;  1I5O B;  4FXD A;  3MR5 A;  2DHX A;  2QA2 A;  1DZ5 A;  3BM7 A;  2XQC A;  2VG7 A;  2IBK A;  1G6B A;  3BZQ A;  3C8Y A;  3UWT A;  1JNR B;  2JNJ A;  3HVW A;  4DWI A;  1Z1Z A;  1S79 A;  4KHM A;  5GAE U;  4NXN J;  2R8G A;  1N32 J;  1DY3 A;  1HI8 A;  2VV5 A;  1H38 A;  3BO2 A;  4DV0 F;  4JI6 J;  1VQP S;  1TL5 A;  3GV7 B;  4DU7 A;  2K3K A;  4A8W A;  3WHI A;  3PR5 B;  4KHP F;  2L9D A;  2MKH A;  3PG9 A;  4GKJ F;  2PSZ A;  5DQG A;  1Q0N A;  2N4C A;  5L9X A;  1VQM S;  4GO7 X;  1YK9 A;  2B4O A;  1I94 J;  4Y34 A;  3ZC4 A;  4E0D A;  3LP2 A;  1S72 S;  3BDP A;  3OXG A;  4O23 A;  1U45 A;  3PNI A;  3T1Y F;  4LFA F;  2VC0 A;  1VIO A;  4HR2 A;  4Q7A A;  2YX7 A;  2Z58 B;  1T94 A;  1LOU A;  1X4C A;  4A8S A;  1AFI A;  1BWE A;  1FRM A;  3JQK A;  1TL3 B;  3MMC A;  3SMZ A;  4BHQ A;  4IDK A;  1JLA A;  1S1X A;  2KHC A;  3EGV A;  2JVO A;  1Z4U A;  2LU1 A;  4NLQ A;  3UR3 C;  5DGA A;  2QYC A;  3Q86 A;  2YKO A;  4DL2 A;  3QGI A;  7AT1 B;  4I69 A;  4LSL A;  3GFZ A;  3NEK A;  3HKW A;  3PYF A;  2VIC A;  4K4Y A;  1S1V B;  3IGN A;  3RAM A;  3L7P A;  4C48 A;  4BCA A;  3QO9 B;  5EWG A;  4ZK7 M;  3QZ8 A;  4H4K A;  3CJT A;  4X62 J;  1NB2 A;  4OV1 A;  3IWX A;  4F2S A;  1LW0 B;  4R0J A;  3UDV A;  2CZ4 A;  4NA3 A;  2DNL A;  2W4P A;  3EMT A;  3K89 A;  3IS9 B;  1Q86 T;  3CNQ P;  1SIW B;  2GO9 A;  3DHW C;  4L6V 3;  4TU8 A;  1FRJ A;  4KAI A;  4DF8 A;  1Y7P A;  3UPF A;  1X5T A;  2AV5 A;  1IWA A;  3VAH A;  3EXC X;  5KT2 A;  4UY8 T;  2AJQ A;  2YQ3 A;  4J9M A;  3F73 A;  3ENV A;  1RZM A;  5K9F A;  5E0O A;  5HAT A;  1GMU A;  1RT1 B;  3KK3 B;  1LWF A;  3H2V E;  4CRJ A;  3D4J A;  3T9N A;  2ALY B;  4ZPD A;  4YR2 A;  3K59 A;  3TEG A;  2RHS B;  1FVQ A;  1RWV B;  2BM0 A;  1T3O A;  3GFX A;  4UOF A;  4RUA A;  1GXL A;  2D1C A;  4RX6 A;  4DHV A;  2ZDP A;  2MZ1 A;  5KFO A;  1JJ2 R;  5ETK A;  3IFE A;  5D0R A;  4X4Q A;  5J1E A;  2Z4P A;  1P9Q C;  1YBU A;  3RBX A;  4TVA B;  1FD2 A;  3M6U A;  3CDW A;  2VIH A;  3G82 A;  2KVQ E;  4DR3 F;  1AUD A;  1FE4 A;  5RUB A;  1N5Y A;  5KFM A;  1NBE B;  5T7L A;  1FKP A;  2YNH A;  3POT A;  2MLZ A;  3CO9 A;  4ICL B;  4ED1 A;  3RG6 A;  1AW0 A;  4K4V A;  3AQO A;  4F4Z A;  4ECY A;  2EG1 A;  1KBR A;  5DM7 Q;  1IKX A;  3HI9 A;  2GC8 A;  3PYD A;  2R9L A;  2R8I A;  2ASY A;  1BE4 A;  3AT1 B;  3D1Q A;  1M1K T;  3ZO7 A;  2GA7 A;  3RRK A;  4LF8 J;  1TEL A;  3D6T B;  2BVZ A;  5IWA J;  4DL4 A;  4OYO A;  3RB4 A;  4JI4 F;  1QUV A;  2COL A;  3AJD A;  5EHH A;  3OL8 A;  2KXF A;  3T5J A;  2B4U A;  2RRN A;  3AD9 C;  4YP3 A;  1RBO B;  2FTR A;  2O3D A;  3GFY A;  2BE2 A;  1NK9 A;  3BDE A;  3J7A N;  2XI2 A;  3T5L A;  3EYZ A;  2CQ0 A;  4RBV A;  4YDX A;  3CJS A;  5KFR A;  4WFB Q;  1ZH5 A;  1F6T A;  2PI4 A;  1A9N B;  3R5J B;  4CO4 A;  4NCB A;  5HVG A;  2VC1 A;  3SQG B;  4C98 A;  5KG2 A;  1K44 A;  2Y1L B;  4LF8 F;  1CEZ A;  5CZV A;  1F0X A;  4DQQ A;  4ZCM A;  1XJW B;  2DKO B;  1RK8 A;  2GVZ A;  3NGR A;  1RAO A;  4A47 A;  1QSY A;  2LMI A;  3CPW R;  4NMX A;  2D3O 1;  4DUZ J;  2I1R A;  1OIA A;  4JI8 F;  3MED B;  1ZAW A;  2EPI A;  1WC4 A;  2QGF B;  3IP0 A;  4Y65 A;  2FUG 9;  4KRW A;  1M5O C;  3HFK A;  4OYA A;  4UT4 A;  3PYG A;  3HHL C;  1F3F A;  3AAW B;  3TW0 A;  3KLV A;  2FVQ A;  3N01 A;  4USK A;  1S9G A;  3UW1 A;  3W2V B;  2JHE A;  4ZPA A;  1MRO B;  1Y11 A;  1P6T A;  3O5T B;  4I64 A;  2J7U A;  3OV7 A;  2Y8Y A;  4DPU A;  1UWA A;  1QJH A;  3W62 A;  2XGQ A;  1D1U A;  1RWW B;  4PZV A;  5LT5 A;  5HMX A;  3R7B B;  2OHD A;  4RZR A;  1S1V A;  2JC0 A;  3R5G A;  2UVR A;  3DNC A;  2DNM A;  4DV6 F;  3GCX P;  3O1L A;  4DR2 F;  4XTT A;  1RSC A;  4DXL A;  2XYG B;  3C14 A;  3H2U B;  3SDE A;  3VZH A;  3BO4 A;  4RU2 A;  4F4W A;  3H4D A;  2M5Y A;  1KTV A;  5HQM A;  4YOE A;  2OML A;  2VPX B;  4ELU A;  1YRX A;  2BOP A;  3A3P B;  3BGR A;  3BKU A;  3EZU A;  3QYY A;  2VQE J;  2BMB A;  4DSE A;  2NR0 A;  3C14 B;  3EGN A;  1GEH A;  2QA1 A;  5I3Q A;  4B3M J;  4K0K J;  5D4P A;  2AJ4 A;  3MEG A;  2EXU A;  2GAH C;  3M6X A;  4DSF A;  3CED A;  3W1Y C;  2AYG A;  2L41 A;  3VVU A;  4KJI A;  5F3Z A;  3JSR A;  5C25 A;  2HNY A;  4MT1 A;  4TQR A;  1T03 B;  2Z2L A;  1ZM9 A;  3PW5 A;  2BKP A;  2LA6 A;  2MGZ A;  4DL6 A;  3CF5 Q;  4V19 X;  2DTJ A;  2EVZ A;  1WEX A;  4KFB B;  5F8J A;  5F0U A;  1MU2 A;  1BQN A;  2A1B A;  2ZUA A;  2JDJ A;  2MLY A;  3UI3 A;  1NDL A;  3M8R A;  2X3G A;  2CPH A;  4P73 A;  2XNR A;  4OJH A;  4K0K F;  1FRI A;  1YKW A;  2N3L A;  4HDH A;  4MH8 A;  4DUZ F;  1NKE A;  3OR2 B;  2C3U A;  2L3M A;  2KH9 A;  2AQ4 A;  1EHW A;  5J2Q B;  3I31 A;  4X64 J;  3VAG A;  3QQC D;  2CQI A;  4KIA A;  1WHW A;  2GVZ B;  3DOM B;  3HCX A;  2P2C B;  4HAC B;  4CLS A;  2HEK A;  2PII A;  5DG8 A;  2JEJ A;  3PW4 A;  3M1V B;  4DUY J;  1FJE B;  4ID8 A;  2AJ0 A;  4DFP A;  2FVR A;  4ZP6 A;  4QOT A;  1HNW F;  3GR0 A;  4ECW A;  1WKL A;  5IT9 Y;  4DV7 F;  4F02 A;  3BSN A;  1ZZF A;  3IWN C;  4DL7 A;  2FIU A;  1NPK A;  3H2L A;  2Y1I A;  2VB6 A;  2KYX A;  2Z30 B;  4MYU A;  3UQS A;  4DR6 J;  4UQT A;  1WKK A;  3T6B A;  1VRT A;  2AX1 A;  2OP5 A;  1VQO S;  3HO1 A;  1HD1 A;  4HI1 A;  5DQI A;  1D09 B;  5DS7 A;  1HR0 J;  3NNH A;  4I56 A;  2AEF A;  2V8D A;  4CCH A;  2CPE A;  2U2F A;  2OIH A;  3CMQ A;  5F0W A;  4Q8E A;  2ZE2 A;  4DR5 J;  5CZX A;  1BGX T;  4ZLP A;  3RRH A;  1QM9 A;  3UR0 A;  5EWF A;  1FI4 A;  4PG6 A;  1IBK J;  1QTN B;  3D6M B;  2LXU A;  1U1Q A;  1SV5 A;  5GMK a;  2HND B;  4ECS A;  3BGR B;  5J2P A;  5HI7 A;  2ADC A;  4FXV A;  2I5J B;  3FEZ A;  3PFE A;  4LRA A;  2XZT B;  4JI6 F;  4CO1 A;  4Y3C A;  1T9X A;  2HFU A;  4NLV A;  1NB7 A;  3TP2 A;  4W98 A;  4KHP J;  2CQD A;  1FNX H;  1ZA1 B;  3GZ7 A;  1S97 A;  1WG1 A;  1U1N A;  1NJX A;  4WPA A;  3HHL A;  1N33 J;  2K7J A;  2FQQ B;  2W4D A;  4LSN A;  3QGP A;  4F3M A;  2ZIT A;  2NYH A;  5HLF B;  1A0O B;  4MMO A;  1HWU A;  2DEI A;  2GMH A;  1NDC A;  2RQM A;  3GWC A;  3V81 A;  3MM7 B;  3ZZT A;  4OZ1 A;  1S7I A;  1Q95 G;  1JKH A;  2YPZ A;  5D0E A;  4PCQ A;  3C15 A;  4JI5 J;  4HLB A;  4FDF A;  1ZM3 A;  5I3U B;  4XO0 A;  3QID A;  3CSK A;  2CQ2 A;  3NBP A;  4U67 Q;  1URN A;  3CCW A;  3H5X A;  3RAX A;  2VG7 B;  4YEA A;  1MWY A;  5IM0 A;  3FRY A;  5KFT A;  2W8L A;  4F4X A;  1R0A A;  2H65 B;  2QTW A;  1F9H A;  4LSZ B;  3MFH A;  3J7Y I;  1JLF A;  1HNI A;  5LMN J;  1UEV A;  2PFF B;  1VYA A;  1F2G A;  2BE2 B;  3CWJ A;  4I2P A;  3KK1 B;  2R3V A;  4NL5 A;  5BR8 F;  3OR1 B;  3VAK A;  1P9Y A;  1TL7 A;  3S6E A;  3ETM A;  3KJN B;  4B02 A;  2R7W A;  2W2M P;  4PPD A;  2NZC A;  3MEC B;  1IJF B;  5DGB A;  3MTK A;  2JOQ A;  3K8W A;  4KKO B;  2CPZ A;  1UW9 A;  3UN3 A;  4AQY F;  3V6J A;  1RTJ B;  3I96 A;  1XQI A;  3EPI A;  4CI0 B;  2R7R A;  5KFL A;  4U6P A;  3HDS A;  4ES3 A;  4K2J A;  2YX4 A;  2R7S A;  3H0P A;  3R7N B;  1FDD A;  2YWF A;  4A8O A;  2D9P A;  4PWD B;  2OSR A;  1WI6 A;  1SB6 A;  3QAT A;  1SKU B;  1EX8 A;  3QFW A;  3V2U C;  3OVS A;  4JI0 J;  1S4E A;  3DLH A;  4KY3 A;  1FNM A;  4YS2 A;  1CSJ A;  3HJV A;  3IXQ A;  4URQ U;  3K57 A;  4OX9 J;  1S1T B;  2I2Y A;  4WFN Q;  2QFI A;  3E8O A;  3KHH A;  1EQM A;  1ELO A;  3IMQ J;  1D9F A;  1GAO A;  2JZ5 A;  4NOH A;  5GAH I;  3GG0 A;  3CW2 C;  1IBL J;  1TMJ A;  3DI6 B;  1T05 A;  2G1D A;  3VGU A;  4L3N A;  3DLB A;  2HHH J;  1SC4 B;  3ENA A;  5KOX A;  2E9R X;  4N7T A;  2NUH A;  1HI0 P;  3N5F A;  3QWU A;  5K8N A;  1IXK A;  2JC1 A;  4GRS A;  3DYA A;  1CJV A;  1HPZ B;  2QG9 B;  4TQS A;  2KG1 A;  3PX0 A;  1VIX A;  4OHV A;  1UAW A;  2WW4 A;  3IS9 A;  1RKJ A;  4AL5 A;  3FJ2 A;  1GQE A;  1X60 A;  1FKO B;  4EBE A;  2VFV A;  4DN9 A;  3DCA A;  1B99 A;  2J8A A;  2YWH A;  3FNN A;  2XS2 A;  1JJH A;  3ZZZ A;  3PR4 A;  1Y00 A;  2HZA A;  4OI3 A;  1YJ9 S;  2HS3 A;  4R25 A;  2QL7 B;  2NYI A;  4HHJ A;  4EI2 A;  3GII A;  2ZDO A;  3CVK A;  5DG7 A;  1T3N A;  1N5Y B;  5KFS A;  3QZ7 A;  1S0O A;  2D7S A;  3W64 A;  3KK1 A;  3P8B B;  4ZPW R;  3BN7 A;  5HP1 A;  1JWW A;  3PO4 A;  5JMN A;  2MQP A;  1GH8 A;  2XEX A;  1YJT A;  4DQI A;  4H4K C;  1H6K X;  1NZA A;  4OMF G;  3BSO A;  1DLO B;  1G7C B;  3CIZ A;  4ED2 A;  1PGZ A;  3Q0A A;  2PEB A;  1CC7 A;  4I2Q B;  2YX1 A;  4F04 B;  1JKH B;  3FBE A;  2VKZ G;  2ZH3 A;  3KMS A;  1S1U A;  4CLY A;  3W9J A;  5DLF A;  4MKY A;  1IR1 A;  2CVE A;  3OTC A;  4U95 A;  3MMJ A;  2C28 A;  1KLN A;  2UXB F;  5KG0 A;  1TUG B;  4ZVQ B;  3N5B A;  3OD2 A;  3I9V 9;  4CM2 A;  1IKX B;  2JJ4 D;  2GV1 A;  4FNI A;  1OYE A;  2YKP A;  4KR0 B;  2Z57 B;  3FSI A;  1B64 A;  4KH0 B;  4DV5 J;  3BR8 A;  1OMS A;  2QYG A;  3QT7 A;  2XZW A;  2OPP A;  4NLR A;  3K5N A;  3T1H J;  3A8E A;  1FE0 A;  3QT5 A;  1FKP B;  1N5Q A;  2YNH B;  3GG1 A;  3POT B;  2EFN A;  1EAY C;  1UCN A;  4PXB A;  1ZM4 A;  2OH2 A;  3QAU A;  1A6L A;  2VBW A;  4TNO A;  5CAA A;  1UVM A;  5IV3 A;  2BW7 A;  3EIC A;  2VQF F;  1RT4 B;  3NLC A;  1X9W A;  2DPI A;  2J9D A;  2M70 A;  2YNI B;  4N8O A;  1R3N A;  3UDC A;  1N0U A;  1V3S A;  2Z8Q A;  2L9N A;  2JEI A;  1JIH A;  2MZR A;  2R2S A;  1SV5 B;  1TTH B;  2CPX A;  4DF4 A;  3PHT A;  4NXN F;  2Z56 B;  3NP5 A;  1FFS B;  5LXR A;  1N32 F;  2B3T B;  1HBO B;  2HQI A;  1C1C B;  4NXM F;  5HRO B;  1P8G A;  1WEY A;  1WAC A;  2ZBC A;  3SQO P;  4DUT A;  4U9R A;  5A6P A;  4Q2M A;  3X1L B;  2ZNZ A;  5T41 A;  5GAE I;  3BBF A;  2PEH A;  4YB1 P;  1UWB B;  1LV5 A;  1YBT A;  3MM5 B;  4J7C A;  4WFZ A;  4FF3 A;  1ZM2 A;  1FJG J;  2UXD F;  2R7T A;  1BUX A;  2DCU B;  2QSW A;  4Q43 A;  3KLE A;  3HD1 A;  4ECU A;  3AXK A;  1WC3 A;  1NUE A;  1XBW A;  3QSI A;  4RNH A;  5AXL A;  4J9R A;  1RP5 A;  3QNW B;  1HNZ F;  4JI1 J;  3UNG C;  1EP4 B;  1VGY A;  1WTF A;  2H51 B;  3UD4 P;  5LJ5 Y;  2HGM A;  2ZH4 A;  3PJ9 A;  3ILO A;  3DDI A;  1LNQ A;  1MN7 A;  1VJW A;  5KFD A;  1VC0 A;  4LIW A;  4JI3 F;  2BRK A;  4Q8F A;  3W60 A;  2MSS A;  2YWE A;  3CJK A;  2M88 A;  3TA1 A;  3NS5 A;  2CFX A;  2XHC A;  4I68 A;  5HSP A;  1XIQ A;  1CJU B;  3MM6 A;  3W9I A;  1MML A;  1CBK A;  1RAE B;  1NME B;  3PAC A;  1KOO A;  1VLO A;  3M8Z A;  4R0E A;  2NPI A;  5KFY A;  3VGV A;  8ATC B;  1Q7Y T;  3UFC X;  1Q5V A;  4NML A;  5KT4 A;  1JXL A;  5D4N A;  4W90 B;  3VCD A;  1BQN B;  4RNM A;  2PD1 A;  1C1B B;  1RAF B;  1H0H B;  2DIT A;  3VQT A;  1NK0 A;  4F3O A;  2M2B A;  3GSI A;  4TY8 A;  2F1F A;  1QDU B;  1CPZ A;  5ETN A;  6FD1 A;  4OYW A;  2DHH A;  1D8Z A;  3BBB A;  4QYZ J;  2MGZ B;  2OEK A;  3IRX B;  4TYB A;  4WYW A;  5EX0 A;  5KFU A;  3MEC A;  4WWS A;  2YNG B;  2HAF A;  2J0Q D;  1APS A;  1T9W A;  3ISN D;  4UOG A;  1W2B R;  5GAG I;  4U96 A;  3J80 Y;  2OD6 A;  4HT7 A;  1S9F A;  3GYX B;  5FJ4 A;  3IO1 A;  3PX4 A;  1YIT S;  4LQ3 A;  2GCF A;  2DD8 S;  2AW0 A;  1FFG B;  1BC6 A;  2EFG A;  4FVM A;  1NCL A;  3PO5 A;  3CC7 S;  4MK8 A;  4EBD A;  1EZZ B;  1FDB A;  1Q81 T;  4JYA J;  4RNN A;  1PJ7 A;  4XDD A;  2JH3 A;  4C8K A;  2M0G B;  3BKT A;  1FWK A;  1V5I B;  4AFF A;  1PIE A;  2Q66 A;  8AT1 B;  1JNZ B;  4AQY J;  1VC6 A;  1T8E A;  1RT4 A;  1B0T A;  2RIL A;  2RDI A;  3CJQ A;  3RAQ A;  2QL5 B;  2FZK B;  4C3L A;  3PV8 A;  1U0H A;  1Y3K A;  3OSN A;  2Q6B A;  3AB4 B;  1BXN A;  3DRR B;  1Q82 T;  3PCO B;  3NS7 B;  1JLQ A;  2CQ1 A;  3ZZ0 A;  4CTA A;  4WK3 A;  1IKV B;  5LMU F;  1CJT B;  3MAH A;  3OXF A;  1U0H B;  1KEK A;  1G4C A;  1UPM B;  3LOU A;  3PJX A;  1KRP A;  2HQC A;  2V50 A;  4DR7 F;  5DQH A;  1VHI A;  1M5P C;  3MI7 X;  2MST A;  2KM8 C;  3U1L A;  3LPY A;  2CPF A;  2YTC A;  4LRD A;  4WE1 A;  5FDL A;  4P71 A;  1N36 F;  4ZIV A;  4K4S A;  2HZC A;  4DX6 A;  2V9K A;  2WOM B;  3DI6 A;  5GME A;  1IBL F;  1FTC A;  1WI8 A;  3HVT A;  5KFV A;  4J9K A;  4HH1 A;  2WVC A;  1R0C B;  2HIY A;  3SDE B;  2ZNY A;  3QIP A;  3DHX A;  1WTB A;  2G1H A;  4L72 B;  4WJB A;  4URS A;  5A8K B;  4ECV A;  1RBA A;  1U2F A;  2V63 A;  1X0P A;  2YPY A;  1SL2 A;  1QY7 A;  4DR7 J;  4PWW A;  1WHX A;  2MKK A;  4LF9 F;  4GVB A;  1RQ0 A;  2HBR B;  1YLX A;  1LWF B;  1I51 B;  3KDO A;  1Q8B A;  4M5M A;  3W8G A;  2ZH5 A;  2MHN A;  5J2N A;  3QJJ A;  4D3H A;  1TV6 B;  3THV A;  3MAA A;  3MOJ B;  2E66 A;  5E5N A;  4MFB B;  1PBA A;  2W9A A;  2HMI A;  2DT9 A;  2JEF A;  1UJ5 A;  4B9S A;  4M94 A;  1A7G E;  2JFK A;  2K8G A;  2ZFH A;  3B82 A;  2XS5 A;  2ILZ A;  2IHR 1;  3VAJ A;  4KYZ A;  1C1B A;  2Q3P A;  2UU9 F;  4FYX B;  3F56 A;  1XTZ A;  5E7O B;  2XM3 A;  3CDA A;  5KTQ A;  1GTE A;  4ERD A;  2QLW A;  3DOK B;  2XNQ A;  2EC0 A;  3MEG B;  1HBU A;  2Y0S D;  3NOG A;  4GMK A;  2IJN A;  5GMD A;  1IBM F;  1QAI A;  4IQX A;  1Z2Z A;  1DHM A;  1RWM B;  4PPZ A;  4LJM A;  3QAE A;  2HG4 A;  3AD7 C;  3R5D A;  2EKY A;  3PW0 A;  3PX6 A;  4ZP8 A;  3OVB A;  5D4L A;  4U8V A;  2LKZ A;  2H9Z A;  5A0Y B;  3MR3 A;  5J2Q A;  2DEJ A;  2RB7 A;  4YN3 B;  2HLU A;  4QWD A;  4CNZ A;  3SZ2 A;  2RRB A;  4E8U A;  3G6E S;  3EM1 A;  1EAR A;  1QLN A;  5K8P A;  4I6W A;  3DMJ A;  3CMA S;  2Y3Y A;  1WJ9 A;  1U1L A;  3CCL S;  1X9M A;  3RB6 A;  3QLH A;  2UUW A;  5BYR A;  5M2R A;  2BM1 A;  1RAC B;  3JTO A;  3NGU A;  2XMJ A;  2AIR B;  1D9D A;  1UEK A;  3FZB A;  5H9F K;  2HS0 A;  3WC2 A;  4LIR A;  5A2Q U;  4IO9 Q;  5AT1 B;  3KHR A;  2E9Z A;  3OSP A;  3NAH A;  1HBM B;  2YKA A;  3M32 B;  4TXS A;  2XMW A;  7FD1 A;  2HVE A;  1ZBT A;  2VBX A;  3TAM A;  2IM1 A;  4BC7 A;  5KG7 A;  3EZ5 A;  2LEC A;  4OHW A;  3R2C J;  3SFU A;  4CO2 A;  2CWK A;  2ZKU A;  3TUI C;  4RW4 A;  3M05 A;  2IRU A;  1LW2 B;  2HFV A;  3CDB A;  4CNY A;  1RYR A;  4ZP7 A;  4PXE A;  4FPI A;  3IR7 B;  3D2W A;  2IA6 A;  2C3M A;  2VG6 B;  2D69 A;  2VFS A;  4IO1 A;  4RBU A;  5E3A A;  4WKY A;  3DFE A;  2VBY A;  3HX9 A;  2W4C A;  3H25 A;  2UUB F;  1IKY B;  1REG X;  2Q79 A;  2DIS A;  2WW8 A;  3OJU A;  3NAI A;  4NAS A;  1UA1 A;  4YQW A;  1TUV A;  4M5G A;  2UXB J;  2I5J A;  2CXE A;  1RKI A;  3JB9 k;  4ZVT B;  5C42 B;  2EI5 A;  4OJG A;  3PRD A;  2MZJ A;  4NRT A;  1TL3 A;  2BE9 B;  4WXW A;  2HQD A;  2CJB A;  3BJY A;  4C8L A;  3PJW A;  3HJF A;  1RT1 A;  3KK3 A;  1AT1 B;  4Q5V A;  1RJJ A;  2V67 A;  1B7F A;  4DN0 A;  3PKM A;  4ZVE A;  3THP A;  2G2Z A;  2JFD A;  1YHQ S;  1U2C A;  3ADA C;  1EET A;  4DL0 C;  3KLG B;  4B3S J;  4LF4 F;  1U8W A;  2CDQ A;  3DM2 A;  2KVI A;  3RB3 A;  3W8P A;  1HQU B;  1VRU A;  2AZ1 A;  2V2Q A;  4ENO A;  5DM6 Q;  3PXG a;  3IGV A;  4FS1 A;  3M9O B;  1YI2 S;  1TQL A;  1P1L A;  4ZVO B;  5C7P A;  1CQN A;  3ET6 A;  1FDN A;  1PKU A;  4CYU A;  3ILL A;  4TYA A;  5D0G A;  4DX7 A;  3G6X A;  2HUR A;  2E5G A;  3NXZ A;  1WC5 A;  2H54 B;  1KQF B;  3G8S A;  1KD1 T;  2FJE B;  1YQH A;  3FFI B;  4LQ9 A;  4MYT A;  3MCO A;  3OXL A;  5ETS A;  1R27 B;  1N5S A;  4L3K A;  4O3N A;  4NYZ A;  3FKB A;  4WP9 A;  4F7V A;  1IN0 A;  2IC3 B;  4ZN3 A;  4R5P B;  1TKX B;  2DNO A;  4O3Q A;  3I5C A;  4WP3 A;  4LF7 J;  4RW8 A;  2V8H A;  4X65 F;  4IR1 A;  3F41 A;  2BKO A;  2CQP A;  4P7T A;  2B9Y A;  3VAI A;  3IBC B;  4CM0 A;  4X66 F;  1NDK A;  2O5D A;  3N9U C;  5BYQ A;  3W7B A;  3KLH B;  2QLJ B;  3TAQ A;  1L5U A;  2W2O P;  5LJ3 Y;  5KFI A;  1M5V C;  2QL9 B;  4ZJO A;  4DX5 A;  2HWI A;  1KKH A;  3U02 A;  2LU2 A;  2ZJR Q;  4DV3 F;  2V8G A;  1R89 A;  2HHQ A;  1TAQ A;  4G1Q A;  1VQS A;  4ZKA A;  4K59 A;  1VQL S;  3JQJ A;  1P27 B;  3NCR A;  2PMZ D;  1JX4 A;  1VQK S;  4JI7 J;  5E2Q A;  3TNV A;  4OZN A;  3SV3 A;  4ECT A;  4NLU A;  1RTJ A;  1SJQ A;  1RTD B;  3BV8 A;  3DGV A;  2A0F B;  3D6F B;  3TA0 A;  2CZ9 A;  1RAD B;  1T9V A;  2N82 B;  4QW9 A;  1T03 A;  1HHS A;  5L8R C;  3DMJ B;  2VU5 A;  3FMW A;  3M8P B;  1RUS A;  2OPR A;  4NLD A;  2MMY A;  2ZZN A;  1Y5L B;  5K8O A;  1Y5N B;  5B0A A;  2HIQ A;  3QSY B;  1KNZ A;  4V19 J;  3EGW B;  1HNI B;  3Q8P B;  4QYR A;  1AFJ A;  5I3P A;  3MXH P;  1VBX A;  2B9X A;  4EZ9 A;  2WOM A;  4H4M A;  2BV3 A;  3JSM A;  4M5I A;  4OJ3 A;  1T9U A;  3TAM B;  1HQ2 A;  2BJ8 A;  2ZBI A;  4R8U B;  4OYB A;  4Q45 A;  2B56 A;  3MPD A;  5I4M A;  3PEH A;  3DGP A;  1WNE A;  1LFP A;  1WKJ A;  2GJ2 A;  3AFG A;  1S77 D;  3LW5 C;  2LEB A;  1B70 B;  4MJK A;  1Q78 A;  1SC6 A;  1TL4 A;  3UDL A;  2W7P A;  3KLF A;  3TAR A;  3KOA A;  2CPI A;  3GMG A;  4CTA B;  2E7X A;  3LP1 B;  4KO0 A;  3GR1 A;  2FLP A;  2LQ9 A;  2ZHO A;  3C16 B;  3KHG A;  1ZTT A;  4ZIW A;  1RHM B;  2RSQ A;  4O44 A;  5C42 A;  2JL9 A;  5A8K A;  3D0I E;  1JLC A;  4K7Q A;  4ANC A;  4CLL A;  2Y0B B;  3M2U A;  5KAK A;  1XER A;  1WHV A;  2HHW A;  4WBF A;  1DBD A;  2UUC J;  1ARO P;  2ZD1 B;  2H5J B;  2ZC3 A;  2ACM A;  2EK1 A;  1RB0 A;  2FGC A;  5DDP C;  1PSD A;  5AXM A;  2RML A;  1VQY A;  3HD2 A;  3IBW A;  3UVJ B;  1SJ1 A;  4B3O B;  2HHS A;  1M1G A;  2ATC B;  2NLW A;  2X51 A;  1MLA A;  3ENW A;  4NYP A;  3S1T A;  5HJY A;  3OTE A;  3FEX B;  3SSQ A;  2BX6 A;  2HWT A;  2WVB A;  1KVI A;  2QT7 A;  5L39 A;  2H5E A;  3MF5 A;  5U47 A;  1ZYQ A;  2V9W A;  4USH A;  2DIU A;  2OPS A;  1BQM B;  2CQB A;  4ZCK A;  2UUC F;  1L3U A;  4ZN1 A;  3K58 A;  4QIE A;  1RAJ A;  4WFX A;  4DPO A;  1F5B A;  3OT9 A;  5ADZ A;  2MQL A;  1I6J A;  2DPJ A;  1NO8 A;  1K0T A;  3D1H A;  4ID5 A;  4ZLJ A;  4EUV A;  4ED7 A;  2MZQ A;  4WIQ A;  4X4N A;  4CLT A;  2HNY B;  1BLU A;  4ED0 A;  1NZ8 A;  3MOZ A;  3MD3 A;  1FEE A;  5IFM A;  1HHT P;  1HBN B;  1U7L A;  1RU2 A;  2BXJ A;  5IC6 B;  4CO0 A;  4DLG A;  2LEA A;  2XSJ B;  5J2M A;  1U26 A;  2HYI B;  1HIY A;  1TK5 A;  3DOM A;  4NE9 C;  4RLE A;  2P8I A;  1T0T V;  2VOP A;  2JWN A;  3LGM A;  1OQ3 A;  1S1W B;  2XB2 D;  1XR6 A;  1NU4 A;  2H4Y B;  3IBF B;  1M5H A;  2XZD B;  3NGK A;  2DH7 A;  3IR5 B;  5E3C A;  3JYT B;  3GIR A;  1HNX J;  4PWD A;  5A2Q Y;  2LYV A;  3G6V A;  2F7V A;  4CH1 A;  2AJ2 A;  2ZE2 B;  2F3J A;  2AYM A;  2J9D E;  1HW9 A;  1G1X A;  4BC9 A;  2O66 A;  3QWP A;  1TKZ A;  3VZI A;  1VRT B;  2W9B A;  5D78 A;  4C11 A;  3ONQ A;  2VQE F;  1WDT A;  4EYI B;  3BQ2 A;  1EKS A;  1JLQ B;  2HFO A;  1HAR A;  1PJ6 A;  3I5A A;  2IY5 B;  2JSX A;  1WSV A;  2LQ8 A;  2VA2 A;  2AYE A;  4LFB F;  4Z7Y A;  1FRL A;  1ITP A;  3TOQ A;  1AB8 A;  3PM9 A;  4OLO A;  3N4W A;  3ELH A;  1FJ7 A;  3HFV A;  3ISZ A;  1RI7 A;  2BBE A;  1S4F A;  3EPG A;  1RT6 A;  3M8W A;  2XMV A;  4OZJ A;  4OZ0 A;  1RAG B;  3K2Y A;  1SJR A;  5CYQ A;  1S10 A;  1H7W A;  1PYO B;  2E9T A;  4LRF A;  3NNA A;  4ED5 A;  4U7U D;  2F4V J;  2DRB A;  2NQP A;  1KLM B;  1E6V B;  5GAD U;  1N5T A;  1W2I A;  1I3O B;  2GX8 A;  1RHR B;  1YG0 A;  3BPS P;  3GYN A;  1UFL A;  1SPB P;  4OZL A;  1NSQ A;  3TX0 A;  3W9H A;  5KFN A;  2Y1J A;  3I32 A;  2BZ2 A;  1XNQ J;  3OHA A;  3I5B A;  1CQM A;  1UET A;  2V4R A;  3LTO A;  4IOA Q;  4WCE Q;  1IWG A;  4D3G A;  3QT6 A;  2BKN A;  2CQ3 A;  3BH7 B;  4OX7 A;  2MKI A;  2JLE A;  4WTO B;  4LSN B;  2M52 A;  3CJ5 A;  2FHM A;  3S01 A;  5JVG Q;  1UTA A;  2XY7 A;  1TV6 A;  1BHN A;  5EX3 A;  1ZET A;  1BMQ B;  2RH3 A;  3BSC A;  2VHG A;  5FLX Y;  2DB1 A;  1NHK L;  3CJ8 A;  5HBM A;  4DV7 J;  3GIK A;  2B8P A;  1H72 C;  2I38 A;  2UUT A;  1Q79 A;  2CAJ A;  4NLW A;  3KG4 A;  1HL6 A;  4LVN P;  5CHC B;  2KN4 A;  1MMN A;  2FPH X;  4K50 A;  4J91 A;  3MM8 A;  3KLH A;  2FGO A;  3PFO A;  4N76 A;  1KR4 A;  3HMJ G;  3LA0 A;  2LP4 A;  2LXI A;  2ZVI A;  1CUL A;  1CJU A;  4OZ5 A;  3OTO F;  4DV2 J;  1GT8 A;  1HNZ J;  4U8Y A;  4JI1 F;  5D8H B;  2Y8W A;  5IZH A;  3TUZ C;  3MM8 B;  1HWJ A;  2CPY A;  5ETV A;  1MSW D;  3TJ8 A;  2AJF E;  4LF4 J;  2OPR B;  3CUL A;  3GSD A;  5E33 A;  2QRR A;  2LQJ A;  5LL6 d;  2VD3 A;  1OYD A;  4PYD A;  1H3D A;  4CT8 A;  1N33 F;  4LFA J;  3BBC A;  4F50 A;  2VFT A;  3H5Y A;  2HHV A;  2RVJ A;  5G0R A;  3US5 A;  2CJA A;  4KFB A;  1DTQ A;  1D0E A;  2GZO A;  1KQG B;  2QMU B;  2XCA A;  5CQG A;  2OUG A;  2DNR A;  3BKF A;  2RF2 B;  4Q2L A;  4RWX A;  2IVF B;  4ZJQ A;  3CUN A;  5F9N A;  2G2Y A;  4DX8 H;  1JLG A;  2OPQ B;  2AEM A;  3VWS A;  1FTR A;  2HFZ A;  2B51 A;  3EDQ B;  4AXI A;  2J5A A;  3MUT P;  3KJQ B;  4KPC A;  3GIJ A;  5KFC A;  3CCV S;  2HHT A;  3KUE A;  2UUA F;  1C1C A;  2E7W A;  3LWL A;  4A8M P;  3NGS A;  3JSM B;  4B08 A;  4NLX A;  4G65 A;  2BE7 D;  4IH5 A;  4F67 A;  3RB0 A;  2WSC C;  3KNA A;  4ER8 A;  3J81 Y;  1S1T A;  2BW2 A;  2RHQ B;  1RT6 B;  2ROG A;  4WYL A;  5CCL A;  1KVK A;  4JV5 J;  2H3E B;  3MPU B;  3NMR A;  3Q24 A;  1IKW A;  1CJK A;  1UZD A;  3M4X A;  3MPV A;  3CCZ A;  3M30 B;  2AZ3 A;  2V4J A;  1LXJ A;  3UE2 A;  3LWM A;  1KWM A;  3QT8 A;  4QR1 A;  5IXU A;  3VAF A;  2BAN A;  1IVZ A;  1SBR A;  3FQK A;  1LWE A;  3H42 A;  1U09 A;  2XY6 A;  2L08 A;  2MKS A;  4PAB A;  2KG0 A;  1NAQ A;  1GK8 A;  3NNC A;  4DUY F;  1XN9 A;  2V34 A;  2Z2Z A;  4AND A;  4LF5 F;  3MD1 A;  4IYQ A;  4MFB A;  2P5V A;  3MPY A;  2OEL A;  5B0C A;  2HZV A;  2HMI B;  2F40 A;  3DLJ A;  3UNY A;  2JVR A;  1VDH A;  1DQ9 A;  2F4F A;  4ED8 A;  4UOH A;  2CQG A;  4DCP B;  5KT6 A;  1REV A;  5GAD I;  1DLO A;  3FK4 A;  4U7U K;  1KON A;  2KT5 A;  3HHD A;  4O4G A;  1ZPV A;  1TVR B;  2G0C A;  2RT3 A;  4PQA A;  4PG4 A;  2ZH9 A;  2OAU A;  3ZTP A;  2B4P A;  3PEJ A;  5IC4 B;  3VV2 B;  4OHX A;  3JSB A;  1PCA A;  2FJD B;  2GNK A;  3AOB A;  4HEA 9;  3JS9 A;  2KRR A;  2ZJP Q;  1HWL A;  2ZWP A;  1PBU A;  2ROP A;  2UZA A;  3KLI A;  2HHU A;  4HH0 A;  4PR6 A;  4JI0 F;  4CP5 A;  1WEZ A;  5I3U A;  3K5P A;  2FHJ A;  2DXF A;  4LF9 J;  1NK4 A;  3CC4 S;  1X7V A;  4QWE A;  1NRK A;  4UUX A;  3TA2 A;  4E2F B;  3UD5 A;  3CXC R;  2ZH1 A;  2UV8 A;  3C6U A;  2VZ9 A;  4FNH A;  4RW9 B;  2DNQ A;  2GVD A;  3VTI A;  4USM A;  1XMO F;  1N34 J;  4QPX A;  3MCN A;  2RDJ A;  2OD4 A;  2HVD A;  2W7O A;  1RT7 B;  4IKA A;  5A8R B;  1C0U B;  3NGD A;  1IBM J;  3D28 A;  4DR4 F;  3LAN A;  4RO0 A;  1X8D A;  3UN5 A;  3AA9 A;  4XDC A;  2N7Y A;  3DLG A;  2PA3 A;  3IN5 A;  4CDI A;  3U7J A;  1QAX A;  2DR5 A;  3EXY A;  1FWL A;  4ATN A;  2XLJ A;  2ROE A;  3H5U A;  1RU1 A;  4I2P B;  3PIO Q;  5IS2 A;  3SSR A;  1SJF A;  1FDA A;  2KI2 A;  4OI0 A;  3L7O A;  1RWK B;  1UMJ A;  3LP0 A;  2KFZ A;  2W2Q P;  5CYQ B;  2RJZ A;  2ZZT A;  2HQG A;  4DLE A;  1TK0 A;  2WON A;  3FCV A;  1DRZ A;  1RLD A;  5CD4 H;  3UCZ P;  5MLC V;  5KOW A;  2C1E B;  2A6O A;  2MZS A;  1U49 A;  3HHN B;  1HFE L;  2DHG A;  3TZW A;  1R6V A;  1AZS B;  2C2D A;  2WZ1 A;  4PG5 A;  1E6Y B;  2YXL A;  3A8I A;  1RWX B;  2N4D A;  3JQM A;  2NZ4 A;  3I0S B;  4NX9 A;  5SUH A;  1IR0 A;  1OPZ A;  2MZT A;  5M2U A;  4KT0 C;  4YY3 J;  5IWA F;  1VK8 A;  4UQG A;  2XGP A;  1Q7L B;  3LQV A;  2ZH8 A;  4M8L A;  4P10 A;  4ILM A;  3CB4 A;  1OPI A;  4NXM J;  3KMQ A;  4KGM A;  3QRR A;  1HNV A;  4ZIT A;  5KFQ A;  4ZJL A;  1RBL A;  4YFU A;  1HNW J;  1SQE A;  1TL1 B;  3GON A;  2IAJ B;  4FYW B;  4DPX A;  3ETO A;  1RAH B;  3ICL A;  4ED4 A;  2HNZ A;  2B6A A;  4ANE A;  4U7C A;  3AY0 A;  1RIS A;  3ENQ A;  1YTY A;  2DXD A;  1O8B A;  2O1P A;  3VQS A;  2W24 A;  4DCJ B;  3HM9 A;  1D9A A;  1FEH A;  2G2O A;  1PC5 A;  1H2T Z;  3FSY A;  4IFV B;  1VBY A;  3EVO A;  4BS2 A;  1X5S A;  4ELT A;  4O4G B;  4O3S A;  2FC9 A;  5L1K A;  1RTH A;  1R0A B;  2QFJ A;  3RW7 A;  4OI4 A;  4HTI A;  4CYU B;  2CZV C;  5HBM B;  5F9L A;  3MEE B;  4PG8 A;  4HI2 A;  3TQE A;  3D66 A;  2BJ3 A;  1VS3 A;  2QZ8 A;  4OX9 F;  3DM2 B;  1SH0 A;  4M5N A;  2PMW A;  5H9F J;  4KGZ B;  2W9C B;  3DDN A;  1LK7 A;  2UXC F;  3ZNU A;  4X4U A;  2VG5 B;  3W61 A;  4FYD A;  2QJ3 A;  2OMO A;  1KHV A;  4GC7 A;  2F4V F;  3AOA A;  4JB8 B;  1LWX A;  3CCE S;  1LFW A;  4B3M F;  3IM8 A;  2MPU A;  7FDR A;  2ZKT A;  1JXE A;  3G86 A;  2Z0G A;  3E01 B;  4R5P A;  1JLF B;  1RTZ A;  1TMM A;  4OLP A;  2BEF A;  2DVI A;  3EVW A;  5A0Y A;  1N88 A;  2R7Q A;  1S6U A;  3JTP A;  3H20 A;  1JMT A;  3U1M A;  5K14 B;  4ZHR A;  5HO4 A;  1QTM A;  2UVW A;  3K7R A;  1GMW D;  2NXN A;  2CNO B;  4RW7 A;  4CLF A;  1VC5 A;  1VQ9 S;  2N3O A;  4YHH J;  2CIM A;  2CJK A;  4FBT A;  1XC9 A;  1H98 A;  1S5Z A;  3R5B A;  4OI1 A;  8RUC A;  4CT9 A;  1RAI B;  2Z2Y B;  4DOZ A;  4A8K A;  4RUC A;  3VGS A;  2EW9 A;  1JJC B;  1MU2 B;  1RTI A;  1QD1 A;  3GP9 A;  4M5L A;  2OJ3 A;  2ASJ A;  1CS4 A;  2MEW A;  2X1A A;  1LEO A;  2KXH A;  5LSL A;  3WIU A;  2CKW A;  2RIJ A;  1CJT A;  3HKZ D;  4F26 A;  5KFJ A;  2W2N P;  2W9B B;  2OEJ A;  2MHE A;  2NXJ A;  3EX7 B;  1RDR A;  4CLZ A;  3N6M A;  4L75 A;  5HVF A;  3LUY A;  3IG1 B;  2AF6 A;  4DPY A;  3J7A 1;  2DR9 A;  1RT2 A;  2Z2M A;  3EJM A;  4ZVG A;  3CCT A;  1TFW A;  3HT0 A;  3T5K A;  3H98 A;  4C97 A;  3EWG A;  4RUB A;  3VAM A;  4YB5 A;  2MQN A;  2HK3 A;  4TU7 A;  1S99 A;  2MXY A;  4KGX B;  3GB0 A;  4RWW A;  4CH0 S;  3KKF A;  2HQ3 A;  2ALZ A;  1R0B G;  1RLC L;  3OFF A;  3P96 A;  3TEH B;  1TFY A;  1WF2 A;  3SBM A;  2QLB B;  3QGH A;  3OFE A;  3WDO A;  2FVC A;  4QJV A;  4F0K A;  3DU6 A;  4HL9 A;  2WHO A;  2Y1R I;  2OO4 A;  5H9E K;  2BAB A;  4FYV B;  4HKQ A;  3Q8Y A;  2VG5 A;  1N8R T;  3KLE B;  1NPR A;  3ZNJ 1;  1X4H A;  3R1H A;  2E5L J;  1S6Q B;  4JI4 J;  4J9S A;  4TY8 B;  2MYF A;  3JXO A;  5B0B A;  3RRG A;  1U25 A;  1S6P A;  3I4P A;  5LSO A;  2IM3 A;  3VHQ A;  3DKD A;  5HQ8 A;  4AT1 B;  2J7K A;  5C25 B;  3KTQ A;  3BEG B;  5I42 B;  3CD6 S;  4QU6 A;  4ETZ A;  2JX2 A;  2DGQ A;  2G0J A;  3Q83 A;  1RTH B;  2GML A;  3D6H B;  3FC9 A;  4FXW A;  3BS9 A;  1CC8 A;  1SCJ B;  5DDO C;  4DR3 J;  3T1Y J;  3LAL A;  1YIJ S;  1R43 A;  1CG2 A;  1X9S A;  4OYI A;  3RBE A;  5HJX A;  3FGV A;  1IQZ A;  1K9M T;  4Y00 A;  1G3O A;  2GHP A;  2L9W A;  2VOO A;  1J5O B;  2AT1 B;  1DJ0 A; 
#chains in the Genus database with same CATH homology
 4J91 A;  4YS2 A;  3RBZ A;  2AEJ A;  2OGU A;  2BKO A;  3L4B C;  4XTT A;  4L75 A;  4J7C A;  4EI2 A;  2AEF A;  3JXO A;  3KXD A;  4G65 A;  1VCT A;  2BKN A;  4L76 A;  4RO0 A;  4GVL A;  4L73 A;  1LNQ A;  2FY8 A;  2BKP A;  4J9U E;  4L74 A;  3RBX A;  4J9V A;  4J90 A;  2AEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...