3JXVA

Crystal structure of the 3 fkbp domains of wheat fkbp73
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
237
Chain Sequence
TSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 kDa peptidyl-prolyl isomerase
publication title Crystal structure of the three FK506 binding protein domains of wheat FKBP73: evidence for a unique wFK73_2 domain.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Isomerase
total genus 57
structure length 237
sequence length 239
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA01
4FN2A 4DROA 4DRNA 3PRBA 1P5QA 2MPHA 2RQSA 3O5DA 2VCDA 4MGVA 2K8IA 4DT4A 4ODNA 4DIPA 4ODMA 5D75A 2DG3A 4LAYA 2PPNA 2PV3A 2KE0A 5BXJA 3KAHA 2VN1A 3O5KA 4W9OA 3UI5A 5HUAA 2AWGA 4ODLA 1D7IA 3EY6A 2XPAA 1F40A 4DRQA 3O5FA 1ZCNA 2RUCA 2JZVA 2KFWA 1W26A 4JFLA 2XP8A 3NTPA 4GGQA 1Q6HA 5I98A 3GPKA 3KCEA 2L2SA 5B8IC 3O5LA 2ZQSA 4LAVA 4DRMA 1FKBA 3O5IA 4TX0A 4U86A 5HW8A 2ZR5A 2LJ4A 4TW8A 4JFKA 1D7HA 1FKJA 3WH0A 4G2PA 2ITKA 2FKEA 3I6CA 2MF9A 3MDYB 1JNTA 3RFWA 2RUDA 4QIBA 3O5GA 1FKSA 1A7XA 4QT2A 1Q6UA 3JYJA 2FAPA 2OFNA 2F21A 4ODQA 5DIVA 3O5JA 3UI6A 4N19A 5HTGA 3KAGA 1FJDA 5DITA 2RSEA 3IK8A 1F8AB 2LGOA 4ODRA 1FKGA 3UQAA 5HT1A 4IQ2A 1T11A 1FKIA 3B7XA 2ZQVA 4ODOA 4W9PA 2MLYA 4JFIA 1FKKA 1Q1CA 3TC5A 1FKTA 4QT3A 2PV1A 3O5QA 1TCOC 4TW6A 2PPPA 2Q5AA 3IKGA 1QPFA 3PRDA 2XPBA 2F4EA 2F2DA 3KAFA 4J4NA 2XP9A 1FKHA 2XP6A 1JVWA 1R9HA 4BF8A 4ODPA 1J4IA 3NI6A 3PA7A 1HXVA 3IHZA 4TW7A 3O5EA 3UI4A 1Q6IA 3IKDA 1U79A 3ODKA 3O5MA 4JYSA 2RUQA 1B6CA 2D9FA 4C02B 4LAWA 2KI3A 1NSGA 1FKRA 2MNTA 2Y78A 1YW5A 1N1AA 1FD9A 4TYOA 2N87A 2KGJA 2XP4A 4DZ3A 1J4RA 1PBKA 3LUOA 3UF8A 1BL4A 2LPVA 3TDBA 4DRIA 2KR7A 4ITZA 4ODKA 1ZK6A 1FAPA 1Y0OA 3JYMA 4G50A 4DRKA 1D7JA 2PV2A 4JFJA 4W9QA 1QZ2A 2LKNA 2RURA 4MSPA 4J4OA 1NMWA 3RGCA 3TCZA 2KO7A 4DRPA 1BKFA 4NNRA 3O5RA 1L1PA 5HWCA 4TNSA 5DIUA 2M08A 2ZQTA 1FKLA 5HKGA 3KAIA 3O5PA 1ROTA 2M2AA 4DRHA 2UZ5A 4DZ2A 4O2TA 4IQCA 3JXVA 2PBCA 1FKFA 1NMVA 3UQBA 1M5YA 2ZQUA 4LAXA 5GPGA 4IPXA 4R0XA 1ROUA 2XP3A 3KZ7A 5HWBA 5J6EA 1EQ3A 2MLZA 1FKDA 3KACA 2XP5A 3FAPA 1EYMA 3UQIA 3NRKA 3O5OA 1J6YA 2DG4A 4GIVA 4DRJA 4FAPA 4JFMA 4U85A 1C9HA 3OOBA 3H9RB 2ZR6A 1YATA 5HW7A 2PPOA 3VAWA 2ZR4A 1J4HA 1D6OA 3KADA 4U84A 1KT1A 2IF4A 2M1IA 3CGNA 4DH0A 2DG9A 1JNSA 5HW6A 1PINA 1KT0A 2MLXA 3KABA 3CGMA 2XP7A 1QPLA
chains in the Genus database with same CATH superfamily
4FN2A 4DRNA 2RQSA 1W1TA 2P4VA 1NWUA 4ODMA 2DG3A 2KE0A 3FXYA 5HUAA 2VN1A 1ZB5A 3OA5A 1ZCNA 3NTPA 3W4RA 1SR0A 3WQVA 2IUZA 3GPKA 1GRJA 2WK2A 4DRMA 2DSZA 2YBTA 2LJ4A 1WNOA 4Z2LA 3ARZA 4JFKA 1D7HA 1FKJA 1HKIA 3RM9A 1W9VA 4WKFA 3AQUA 3JYJA 5HTGA 3KAGA 3QOKA 2RSEA 1X6NA 3B8SA 2LGOA 3UQAA 5HT1A 3B7XA 3FY1A 4WJXA 2MLYA 4MNLA 1Q1CA 1ITXA 2PV1A 1TCOC 4TW6A 3CZ8A 2B31A 2XPBA 2F4EA 2F2DA 3KAFA 1R9HA 1J4IA 3NI6A 4TW7A 1D2KA 4JYSA 4C02B 1NSGA 4IT6A 2Y78A 1LQ0A 1YW5A 1NWTA 4TYOA 2LPVA 3AS1A 3ARUA 1E44A 3ARQA 3RMEA 1QZ2A 2LKNA 4WK9A 1W9PA 1NMWA 1LG1A 3RGCA 2KO7A 3TCZA 4DRPA 3ARSA 1GPFA 4Z2HA 3EIPA 1L1PA 5HWCA 4NZCA 4TNSA 1EDQA 2ZQTA 4O2TA 1ZBCA 3ALFA 2ZQUA 1E6ZA 2XP3A 5HWBA 1EQ3A 2A3CA 4Z2JA 3KACA 1EYMA 2DSWA 2DG4A 3OOBA 2ZR6A 5HW7A 1W1PA 5GPRA 2PPOA 4S3JA 3VAWA 4U84A 1KT1A 2M1IA 1E15A 2QF8A 3O5DA 4WKAA 4MNKA 1XRVA 5JH8A 2DT3A 2PPNA 2PV3A 1F40A 4DRQA 3O5FA 2RUCA 2JZVA 3CHEA 2XP8A 1Q6HA 3ARVA 5HBFA 1UR9A 1K9TA 5B8IC 4WKHA 3BXWA 4U86A 4TX0A 4S3KA 1LL6A 1HJXA 1WB0A 3WH0A 4G2PA 3RFWA 1HKKA 1FKSA 2DT0A 1Q6UA 2FAPA 2F21A 3UI6A 3ARYA 3GU0A 4UDMA 1FKIA 3CHCA 3PR9A 1FKKA 4Z2GA 1ZL1A 4QT3A 3O5QA 1QPFA 2XP6A 1FKHA 4KQZA 4BF8A 3O5EA 4KR0B 1U79A 4QZVB 3ARWA 3O5MA 2D9FA 2KI3A 1FKRA 5DF0A 1FD9A 2AOSA 2N87A 3G6LA 1FFRA 1J4RA 1E6RA 1PBKA 4DWSC 1BL4A 4DRIA 2KR7A 1EIBA 3WD2A 3JYMA 4JFJA 3AS3A 4J4OA 4P8WA 4NNRA 3O5RA 2G8ZA 1EHNA 5HKGA 1XHGA 2A3BA 2ESCA 1ROTA 1O6IA 2UZ5A 2G41A 4MNMA 3ARXA 1VF8A 4IQCA 2PBCA 1M5YA 4LAXA 5GPGA 1ROUA 5J6EA 3ALGA 2WM0A 4P8VA 1W1VA 3UQIA 1J6YA 4FAPA 4U85A 1C9HA 1YATA 2ZR4A 1D6OA 4AY1A 2O92A 3AS0A 2DG9A 1JNSA 2MLXA 4DROA 4IQ2A 1P5QA 2MPHA 2VCDA 4MGVA 2K8IA 3ARPA 1UR8A 4ODNA 4DIPA 4DT4A 5D75A 4LAYA 1OWQA 3KAHA 3O5KA 4W9OA 3UI5A 4ODLA 1D7IA 2XPAA 2DT2A 4MAVA 2KFWA 1W26A 3CHDA 3RM8A 3KCEA 1OGBA 2DPEA 2L2SA 4WIWA 3O5LA 2ZQSA 2PN0A 4LAVA 3WD4A 1NWSA 3O5IA 2A3EA 2ZR5A 4TW8A 3CHFA 2FKEA 3I6CA 2MF9A 4MPKA 3PRAA 1A7XA 4MNJA 5DIVA 4N19A 5DITA 1FKGA 2WLYA 3WQWA 4DWSB 2ZQVA 4W9PA 4R5EA 4XAKA 2PPPA 1NH6A 4P8XA 2XP9A 1HXVA 1HJVA 4ML4A 3PA7A 1H0GA 3WL1A 1Q6IA 4HARA 3B9DA 2RUQA 1HKJA 1B6CA 1GUVA 1KFWA 1N1AA 1JCHB 2KGJA 2XP4A 4DZ3A 3UF8A 4ITZA 4ZPTR 4ODKA 3ARRA 2B5UB 4G50A 1D7JA 3WKZA 1W1YA 1ZBKA 1BKFA 4P8UA 4Q7NA 1IX5A 1OGGA 2M08A 1FKLA 2WLZA 3O5PA 5DO2A 4DRHA 4DZ2A 1NMVA 1E6PA 2DSUA 4URIA 2OLHA 3O5OA 4GIVA 4DRJA 4IT4A 4ZS6A 2DT1A 5DEZA 1X6LA 3H9RB 1J4HA 4HBOA 4PTMA 5HW6A 1PINA 1KT0A 3CGMA 2EULA 2O9OA 3PRBA 1FFQA 5BXJA 4Z2IA 2AWGA 3EY6A 3ARTA 4NSBA 4ZPVR 1NWRA 4JFLA 4Q22A 4GGQA 5I98A 3B9AA 4Z2KA 1TFVA 2ETNA 1GOIA 1FKBA 3B9EA 2F23A 4L72B 5HW8A 1LJYA 2A3AA 1HJWA 1LL7A 3BMBA 2ITKA 3G6MA 3MDYB 1JNTA 1ZBVA 2RUDA 1WAWA 4QIBA 3O5GA 4MTVA 4QT2A 3AS2A 1LL4A 2OFNA 4ODQA 3O5JA 4W5UA 1FJDA 3AROA 1F8AB 3IK8A 4ODRA 4LGXA 1T11A 1LG2A 4ODOA 1SYTA 4JFIA 3TC5A 1FKTA 1RD6A 2Q5AA 3IKGA 1E6NA 3PRDA 2DSVA 4J4NA 1JVWA 4ODPA 3IHZA 1ZBWA 3UI4A 3IKDA 4DWSD 3ODKA 4ZPWR 1H0IA 4LAWA 2MNTA 3GTYX 4HBEA 3LUOA 3TDBA 3RM4A 1JNDA 1ZU8A 1ZK6A 1FAPA 1Y0OA 4DRKA 1CTNA 2PV2A 4W9QA 3WD3A 2RURA 4MSPA 4L3NA 1JNEA 3CH9A 5DIUA 4DWSA 5GQBA 3KAIA 3WD1A 2M2AA 2YBUA 3WL0A 3JXVA 1E9LA 1FKFA 3UQBA 4IPXA 4R0XA 2FDMA 3KZ7A 3WD0A 1HKMA 2MLZA 1FKDA 2XP5A 3FAPA 3NRKA 4JFMA 3WIJA 2PI6A 3KADA 2IF4A 3CGNA 4DH0A 1W9UA 3KABA 2XP7A 1QPLA
chains in the Genus database with same CATH topology
4FN2A 4DRNA 2RQSA 1W1TA 1NWUA 4ODMA 2DG3A 2KE0A 3FXYA 5HUAA 2VN1A 1ZB5A 3OA5A 1ZCNA 3NTPA 3W4RA 1SR0A 3WQVA 2IUZA 3GPKA 2WK2A 4DRMA 2DSZA 2YBTA 2LJ4A 1WNOA 4Z2LA 3ARZA 4JFKA 1D7HA 1FKJA 1HKIA 3RM9A 1W9VA 4WKFA 3AQUA 3JYJA 5HTGA 3KAGA 3QOKA 2RSEA 1X6NA 3B8SA 2LGOA 3UQAA 5HT1A 3B7XA 3FY1A 4WJXA 2MLYA 4MNLA 1Q1CA 1ITXA 2PV1A 1TCOC 4TW6A 3CZ8A 2B31A 2XPBA 2F4EA 2F2DA 3KAFA 1R9HA 1J4IA 3NI6A 4TW7A 1D2KA 4JYSA 4C02B 1NSGA 4IT6A 2Y78A 1LQ0A 1YW5A 1NWTA 4TYOA 2LPVA 3AS1A 3ARUA 3ARQA 3RMEA 1QZ2A 2LKNA 4WK9A 1W9PA 1NMWA 1LG1A 3RGCA 2KO7A 3TCZA 4DRPA 3ARSA 1GPFA 4Z2HA 1L1PA 5HWCA 4NZCA 4TNSA 1EDQA 2ZQTA 4O2TA 1ZBCA 3ALFA 2ZQUA 1E6ZA 2XP3A 5HWBA 1EQ3A 2A3CA 4Z2JA 3KACA 1EYMA 2DSWA 2DG4A 3OOBA 2ZR6A 5HW7A 1W1PA 5GPRA 2PPOA 4S3JA 3VAWA 4U84A 1KT1A 2M1IA 1E15A 2QF8A 3O5DA 4WKAA 4MNKA 1XRVA 5JH8A 2DT3A 2PPNA 2PV3A 1F40A 4DRQA 3O5FA 2RUCA 2JZVA 3CHEA 2XP8A 1Q6HA 3ARVA 5HBFA 1UR9A 1K9TA 5B8IC 4WKHA 3BXWA 4U86A 4TX0A 4S3KA 1LL6A 1HJXA 1WB0A 3WH0A 4G2PA 3RFWA 1HKKA 1FKSA 2DT0A 1Q6UA 2FAPA 2F21A 3UI6A 3ARYA 1FKIA 3CHCA 3PR9A 1FKKA 4Z2GA 1ZL1A 4QT3A 3O5QA 1QPFA 2XP6A 1FKHA 4KQZA 4BF8A 3O5EA 4KR0B 1U79A 4QZVB 3ARWA 3O5MA 2D9FA 2KI3A 1FKRA 5DF0A 1FD9A 2AOSA 2N87A 3G6LA 1FFRA 1J4RA 1E6RA 1PBKA 4DWSC 1BL4A 4DRIA 2KR7A 1EIBA 3WD2A 3JYMA 4JFJA 3AS3A 4J4OA 4P8WA 4NNRA 3O5RA 2G8ZA 1EHNA 5HKGA 1XHGA 2A3BA 2ESCA 1ROTA 1O6IA 2UZ5A 2G41A 4MNMA 3ARXA 1VF8A 4IQCA 2PBCA 1M5YA 4LAXA 5GPGA 1ROUA 5J6EA 3ALGA 2WM0A 4P8VA 1W1VA 3UQIA 1J6YA 4FAPA 4U85A 1C9HA 1YATA 2ZR4A 1D6OA 4AY1A 2O92A 3AS0A 2DG9A 1JNSA 2MLXA 4DROA 4IQ2A 1P5QA 2MPHA 2VCDA 4MGVA 2K8IA 3ARPA 1UR8A 4ODNA 4DIPA 4DT4A 5D75A 4LAYA 1OWQA 3KAHA 3O5KA 4W9OA 3UI5A 4ODLA 1D7IA 2XPAA 2DT2A 4MAVA 2KFWA 1W26A 3CHDA 3RM8A 3KCEA 1OGBA 2DPEA 2L2SA 4WIWA 3O5LA 2ZQSA 4LAVA 3WD4A 1NWSA 3O5IA 2A3EA 2ZR5A 4TW8A 3CHFA 2FKEA 3I6CA 2MF9A 4MPKA 3PRAA 1A7XA 4MNJA 5DIVA 4N19A 5DITA 1FKGA 2WLYA 3WQWA 4DWSB 2ZQVA 4W9PA 4R5EA 4XAKA 2PPPA 1NH6A 4P8XA 2XP9A 1HXVA 1HJVA 4ML4A 3PA7A 1H0GA 3WL1A 1Q6IA 4HARA 3B9DA 2RUQA 1HKJA 1B6CA 1GUVA 1KFWA 1N1AA 2KGJA 2XP4A 4DZ3A 3UF8A 4ITZA 4ZPTR 4ODKA 3ARRA 4G50A 1D7JA 3WKZA 1W1YA 1ZBKA 1BKFA 4P8UA 4Q7NA 1IX5A 1OGGA 2M08A 1FKLA 2WLZA 3O5PA 5DO2A 4DRHA 4DZ2A 1NMVA 1E6PA 2DSUA 4URIA 2OLHA 3O5OA 4GIVA 4DRJA 4IT4A 4ZS6A 2DT1A 5DEZA 1X6LA 3H9RB 1J4HA 4HBOA 4PTMA 5HW6A 1PINA 1KT0A 3CGMA 2O9OA 3PRBA 1FFQA 5BXJA 4Z2IA 2AWGA 3EY6A 3ARTA 4NSBA 4ZPVR 1NWRA 4JFLA 4Q22A 4GGQA 5I98A 3B9AA 4Z2KA 1TFVA 1GOIA 1FKBA 3B9EA 5HW8A 4L72B 1LJYA 2A3AA 1HJWA 1LL7A 2ITKA 3G6MA 3MDYB 1JNTA 1ZBVA 2RUDA 1WAWA 4QIBA 3O5GA 4MTVA 4QT2A 3AS2A 1LL4A 2OFNA 4ODQA 3O5JA 4W5UA 1FJDA 3AROA 1F8AB 3IK8A 4ODRA 4LGXA 1T11A 1LG2A 4ODOA 1SYTA 4JFIA 3TC5A 1FKTA 1RD6A 2Q5AA 3IKGA 1E6NA 3PRDA 2DSVA 4J4NA 1JVWA 4ODPA 3IHZA 1ZBWA 3UI4A 3IKDA 4DWSD 3ODKA 4ZPWR 1H0IA 4LAWA 2MNTA 4HBEA 3LUOA 3TDBA 3RM4A 1JNDA 1ZU8A 1ZK6A 1FAPA 1Y0OA 4DRKA 1CTNA 2PV2A 4W9QA 3WD3A 2RURA 4MSPA 4L3NA 1JNEA 3CH9A 5DIUA 4DWSA 5GQBA 3KAIA 3WD1A 2M2AA 2YBUA 3WL0A 3JXVA 1E9LA 1FKFA 3UQBA 4IPXA 4R0XA 2FDMA 3KZ7A 3WD0A 1HKMA 2MLZA 1FKDA 2XP5A 3FAPA 3NRKA 4JFMA 3WIJA 2PI6A 3KADA 2IF4A 3CGNA 4DH0A 1W9UA 3KABA 2XP7A 1QPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  4DRO A;  4DRN A;  3PRB A;  1P5Q A;  2MPH A;  2RQS A;  3O5D A;  2VCD A;  4MGV A;  2K8I A;  4DT4 A;  4ODN A;  4DIP A;  4ODM A;  5D75 A;  2DG3 A;  4LAY A;  2PPN A;  2PV3 A;  2KE0 A;  5BXJ A;  3KAH A;  2VN1 A;  3O5K A;  4W9O A;  3UI5 A;  5HUA A;  2AWG A;  4ODL A;  1D7I A;  3EY6 A;  2XPA A;  1F40 A;  4DRQ A;  3O5F A;  1ZCN A;  2RUC A;  2JZV A;  2KFW A;  1W26 A;  4JFL A;  2XP8 A;  3NTP A;  4GGQ A;  1Q6H A;  5I98 A;  3GPK A;  3KCE A;  2L2S A;  5B8I C;  3O5L A;  2ZQS A;  4LAV A;  4DRM A;  1FKB A;  3O5I A;  4TX0 A;  4U86 A;  5HW8 A;  2ZR5 A;  2LJ4 A;  4TW8 A;  4JFK A;  1D7H A;  1FKJ A;  3WH0 A;  4G2P A;  2ITK A;  2FKE A;  3I6C A;  2MF9 A;  3MDY B;  1JNT A;  3RFW A;  2RUD A;  4QIB A;  3O5G A;  1FKS A;  1A7X A;  4QT2 A;  1Q6U A;  3JYJ A;  2FAP A;  2OFN A;  2F21 A;  4ODQ A;  5DIV A;  3O5J A;  3UI6 A;  4N19 A;  5HTG A;  3KAG A;  1FJD A;  5DIT A;  2RSE A;  3IK8 A;  1F8A B;  2LGO A;  4ODR A;  1FKG A;  3UQA A;  5HT1 A;  4IQ2 A;  1T11 A;  1FKI A;  3B7X A;  2ZQV A;  4ODO A;  4W9P A;  2MLY A;  4JFI A;  1FKK A;  1Q1C A;  3TC5 A;  1FKT A;  4QT3 A;  2PV1 A;  3O5Q A;  1TCO C;  4TW6 A;  2PPP A;  2Q5A A;  3IKG A;  1QPF A;  3PRD A;  2XPB A;  2F4E A;  2F2D A;  3KAF A;  4J4N A;  2XP9 A;  1FKH A;  2XP6 A;  1JVW A;  1R9H A;  4BF8 A;  4ODP A;  1J4I A;  3NI6 A;  3PA7 A;  1HXV A;  3IHZ A;  4TW7 A;  3O5E A;  3UI4 A;  1Q6I A;  3IKD A;  1U79 A;  3ODK A;  3O5M A;  4JYS A;  2RUQ A;  1B6C A;  2D9F A;  4C02 B;  4LAW A;  2KI3 A;  1NSG A;  1FKR A;  2MNT A;  2Y78 A;  1YW5 A;  1N1A A;  1FD9 A;  4TYO A;  2N87 A;  2KGJ A;  2XP4 A;  4DZ3 A;  1J4R A;  1PBK A;  3LUO A;  3UF8 A;  1BL4 A;  2LPV A;  3TDB A;  4DRI A;  2KR7 A;  4ITZ A;  4ODK A;  1ZK6 A;  1FAP A;  1Y0O A;  3JYM A;  4G50 A;  4DRK A;  1D7J A;  2PV2 A;  4JFJ A;  4W9Q A;  1QZ2 A;  2LKN A;  2RUR A;  4MSP A;  4J4O A;  1NMW A;  3RGC A;  3TCZ A;  2KO7 A;  4DRP A;  1BKF A;  4NNR A;  3O5R A;  1L1P A;  5HWC A;  4TNS A;  5DIU A;  2M08 A;  2ZQT A;  1FKL A;  5HKG A;  3KAI A;  3O5P A;  1ROT A;  2M2A A;  4DRH A;  2UZ5 A;  4DZ2 A;  4O2T A;  4IQC A;  3JXV A;  2PBC A;  1FKF A;  1NMV A;  3UQB A;  1M5Y A;  2ZQU A;  4LAX A;  5GPG A;  4IPX A;  4R0X A;  1ROU A;  2XP3 A;  3KZ7 A;  5HWB A;  5J6E A;  1EQ3 A;  2MLZ A;  1FKD A;  3KAC A;  2XP5 A;  3FAP A;  1EYM A;  3UQI A;  3NRK A;  3O5O A;  1J6Y A;  2DG4 A;  4GIV A;  4DRJ A;  4FAP A;  4JFM A;  4U85 A;  1C9H A;  3OOB A;  3H9R B;  2ZR6 A;  1YAT A;  5HW7 A;  2PPO A;  3VAW A;  2ZR4 A;  1J4H A;  1D6O A;  3KAD A;  4U84 A;  1KT1 A;  2IF4 A;  2M1I A;  3CGN A;  4DH0 A;  2DG9 A;  1JNS A;  5HW6 A;  1PIN A;  1KT0 A;  2MLX A;  3KAB A;  3CGM A;  2XP7 A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4FN2 A;  4DRN A;  2RQS A;  1W1T A;  2P4V A;  1NWU A;  4ODM A;  2DG3 A;  2KE0 A;  3FXY A;  5HUA A;  2VN1 A;  1ZB5 A;  3OA5 A;  1ZCN A;  3NTP A;  3W4R A;  1SR0 A;  3WQV A;  2IUZ A;  3GPK A;  1GRJ A;  2WK2 A;  4DRM A;  2DSZ A;  2YBT A;  2LJ4 A;  1WNO A;  4Z2L A;  3ARZ A;  4JFK A;  1D7H A;  1FKJ A;  1HKI A;  3RM9 A;  1W9V A;  4WKF A;  3AQU A;  3JYJ A;  5HTG A;  3KAG A;  3QOK A;  2RSE A;  1X6N A;  3B8S A;  2LGO A;  3UQA A;  5HT1 A;  3B7X A;  3FY1 A;  4WJX A;  2MLY A;  4MNL A;  1Q1C A;  1ITX A;  2PV1 A;  1TCO C;  4TW6 A;  3CZ8 A;  2B31 A;  2XPB A;  2F4E A;  2F2D A;  3KAF A;  1R9H A;  1J4I A;  3NI6 A;  4TW7 A;  1D2K A;  4JYS A;  4C02 B;  1NSG A;  4IT6 A;  2Y78 A;  1LQ0 A;  1YW5 A;  1NWT A;  4TYO A;  2LPV A;  3AS1 A;  3ARU A;  1E44 A;  3ARQ A;  3RME A;  1QZ2 A;  2LKN A;  4WK9 A;  1W9P A;  1NMW A;  1LG1 A;  3RGC A;  2KO7 A;  3TCZ A;  4DRP A;  3ARS A;  1GPF A;  4Z2H A;  3EIP A;  1L1P A;  5HWC A;  4NZC A;  4TNS A;  1EDQ A;  2ZQT A;  4O2T A;  1ZBC A;  3ALF A;  2ZQU A;  1E6Z A;  2XP3 A;  5HWB A;  1EQ3 A;  2A3C A;  4Z2J A;  3KAC A;  1EYM A;  2DSW A;  2DG4 A;  3OOB A;  2ZR6 A;  5HW7 A;  1W1P A;  5GPR A;  2PPO A;  4S3J A;  3VAW A;  4U84 A;  1KT1 A;  2M1I A;  1E15 A;  2QF8 A;  3O5D A;  4WKA A;  4MNK A;  1XRV A;  5JH8 A;  2DT3 A;  2PPN A;  2PV3 A;  1F40 A;  4DRQ A;  3O5F A;  2RUC A;  2JZV A;  3CHE A;  2XP8 A;  1Q6H A;  3ARV A;  5HBF A;  1UR9 A;  1K9T A;  5B8I C;  4WKH A;  3BXW A;  4U86 A;  4TX0 A;  4S3K A;  1LL6 A;  1HJX A;  1WB0 A;  3WH0 A;  4G2P A;  3RFW A;  1HKK A;  1FKS A;  2DT0 A;  1Q6U A;  2FAP A;  2F21 A;  3UI6 A;  3ARY A;  3GU0 A;  4UDM A;  1FKI A;  3CHC A;  3PR9 A;  1FKK A;  4Z2G A;  1ZL1 A;  4QT3 A;  3O5Q A;  1QPF A;  2XP6 A;  1FKH A;  4KQZ A;  4BF8 A;  3O5E A;  4KR0 B;  1U79 A;  4QZV B;  3ARW A;  3O5M A;  2D9F A;  2KI3 A;  1FKR A;  5DF0 A;  1FD9 A;  2AOS A;  2N87 A;  3G6L A;  1FFR A;  1J4R A;  1E6R A;  1PBK A;  4DWS C;  1BL4 A;  4DRI A;  2KR7 A;  1EIB A;  3WD2 A;  3JYM A;  4JFJ A;  3AS3 A;  4J4O A;  4P8W A;  4NNR A;  3O5R A;  2G8Z A;  1EHN A;  5HKG A;  1XHG A;  2A3B A;  2ESC A;  1ROT A;  1O6I A;  2UZ5 A;  2G41 A;  4MNM A;  3ARX A;  1VF8 A;  4IQC A;  2PBC A;  1M5Y A;  4LAX A;  5GPG A;  1ROU A;  5J6E A;  3ALG A;  2WM0 A;  4P8V A;  1W1V A;  3UQI A;  1J6Y A;  4FAP A;  4U85 A;  1C9H A;  1YAT A;  2ZR4 A;  1D6O A;  4AY1 A;  2O92 A;  3AS0 A;  2DG9 A;  1JNS A;  2MLX A;  4DRO A;  4IQ2 A;  1P5Q A;  2MPH A;  2VCD A;  4MGV A;  2K8I A;  3ARP A;  1UR8 A;  4ODN A;  4DIP A;  4DT4 A;  5D75 A;  4LAY A;  1OWQ A;  3KAH A;  3O5K A;  4W9O A;  3UI5 A;  4ODL A;  1D7I A;  2XPA A;  2DT2 A;  4MAV A;  2KFW A;  1W26 A;  3CHD A;  3RM8 A;  3KCE A;  1OGB A;  2DPE A;  2L2S A;  4WIW A;  3O5L A;  2ZQS A;  2PN0 A;  4LAV A;  3WD4 A;  1NWS A;  3O5I A;  2A3E A;  2ZR5 A;  4TW8 A;  3CHF A;  2FKE A;  3I6C A;  2MF9 A;  4MPK A;  3PRA A;  1A7X A;  4MNJ A;  5DIV A;  4N19 A;  5DIT A;  1FKG A;  2WLY A;  3WQW A;  4DWS B;  2ZQV A;  4W9P A;  4R5E A;  4XAK A;  2PPP A;  1NH6 A;  4P8X A;  2XP9 A;  1HXV A;  1HJV A;  4ML4 A;  3PA7 A;  1H0G A;  3WL1 A;  1Q6I A;  4HAR A;  3B9D A;  2RUQ A;  1HKJ A;  1B6C A;  1GUV A;  1KFW A;  1N1A A;  1JCH B;  2KGJ A;  2XP4 A;  4DZ3 A;  3UF8 A;  4ITZ A;  4ZPT R;  4ODK A;  3ARR A;  2B5U B;  4G50 A;  1D7J A;  3WKZ A;  1W1Y A;  1ZBK A;  1BKF A;  4P8U A;  4Q7N A;  1IX5 A;  1OGG A;  2M08 A;  1FKL A;  2WLZ A;  3O5P A;  5DO2 A;  4DRH A;  4DZ2 A;  1NMV A;  1E6P A;  2DSU A;  4URI A;  2OLH A;  3O5O A;  4GIV A;  4DRJ A;  4IT4 A;  4ZS6 A;  2DT1 A;  5DEZ A;  1X6L A;  3H9R B;  1J4H A;  4HBO A;  4PTM A;  5HW6 A;  1PIN A;  1KT0 A;  3CGM A;  2EUL A;  2O9O A;  3PRB A;  1FFQ A;  5BXJ A;  4Z2I A;  2AWG A;  3EY6 A;  3ART A;  4NSB A;  4ZPV R;  1NWR A;  4JFL A;  4Q22 A;  4GGQ A;  5I98 A;  3B9A A;  4Z2K A;  1TFV A;  2ETN A;  1GOI A;  1FKB A;  3B9E A;  2F23 A;  4L72 B;  5HW8 A;  1LJY A;  2A3A A;  1HJW A;  1LL7 A;  3BMB A;  2ITK A;  3G6M A;  3MDY B;  1JNT A;  1ZBV A;  2RUD A;  1WAW A;  4QIB A;  3O5G A;  4MTV A;  4QT2 A;  3AS2 A;  1LL4 A;  2OFN A;  4ODQ A;  3O5J A;  4W5U A;  1FJD A;  3ARO A;  1F8A B;  3IK8 A;  4ODR A;  4LGX A;  1T11 A;  1LG2 A;  4ODO A;  1SYT A;  4JFI A;  3TC5 A;  1FKT A;  1RD6 A;  2Q5A A;  3IKG A;  1E6N A;  3PRD A;  2DSV A;  4J4N A;  1JVW A;  4ODP A;  3IHZ A;  1ZBW A;  3UI4 A;  3IKD A;  4DWS D;  3ODK A;  4ZPW R;  1H0I A;  4LAW A;  2MNT A;  3GTY X;  4HBE A;  3LUO A;  3TDB A;  3RM4 A;  1JND A;  1ZU8 A;  1ZK6 A;  1FAP A;  1Y0O A;  4DRK A;  1CTN A;  2PV2 A;  4W9Q A;  3WD3 A;  2RUR A;  4MSP A;  4L3N A;  1JNE A;  3CH9 A;  5DIU A;  4DWS A;  5GQB A;  3KAI A;  3WD1 A;  2M2A A;  2YBU A;  3WL0 A;  3JXV A;  1E9L A;  1FKF A;  3UQB A;  4IPX A;  4R0X A;  2FDM A;  3KZ7 A;  3WD0 A;  1HKM A;  2MLZ A;  1FKD A;  2XP5 A;  3FAP A;  3NRK A;  4JFM A;  3WIJ A;  2PI6 A;  3KAD A;  2IF4 A;  3CGN A;  4DH0 A;  1W9U A;  3KAB A;  2XP7 A;  1QPL A; 
#chains in the Genus database with same CATH homology
 4FN2 A;  4DRN A;  2RQS A;  1W1T A;  1NWU A;  4ODM A;  2DG3 A;  2KE0 A;  3FXY A;  5HUA A;  2VN1 A;  1ZB5 A;  3OA5 A;  1ZCN A;  3NTP A;  3W4R A;  1SR0 A;  3WQV A;  2IUZ A;  3GPK A;  2WK2 A;  4DRM A;  2DSZ A;  2YBT A;  2LJ4 A;  1WNO A;  4Z2L A;  3ARZ A;  4JFK A;  1D7H A;  1FKJ A;  1HKI A;  3RM9 A;  1W9V A;  4WKF A;  3AQU A;  3JYJ A;  5HTG A;  3KAG A;  3QOK A;  2RSE A;  1X6N A;  3B8S A;  2LGO A;  3UQA A;  5HT1 A;  3B7X A;  3FY1 A;  4WJX A;  2MLY A;  4MNL A;  1Q1C A;  1ITX A;  2PV1 A;  1TCO C;  4TW6 A;  3CZ8 A;  2B31 A;  2XPB A;  2F4E A;  2F2D A;  3KAF A;  1R9H A;  1J4I A;  3NI6 A;  4TW7 A;  1D2K A;  4JYS A;  4C02 B;  1NSG A;  4IT6 A;  2Y78 A;  1LQ0 A;  1YW5 A;  1NWT A;  4TYO A;  2LPV A;  3AS1 A;  3ARU A;  3ARQ A;  3RME A;  1QZ2 A;  2LKN A;  4WK9 A;  1W9P A;  1NMW A;  1LG1 A;  3RGC A;  2KO7 A;  3TCZ A;  4DRP A;  3ARS A;  1GPF A;  4Z2H A;  1L1P A;  5HWC A;  4NZC A;  4TNS A;  1EDQ A;  2ZQT A;  4O2T A;  1ZBC A;  3ALF A;  2ZQU A;  1E6Z A;  2XP3 A;  5HWB A;  1EQ3 A;  2A3C A;  4Z2J A;  3KAC A;  1EYM A;  2DSW A;  2DG4 A;  3OOB A;  2ZR6 A;  5HW7 A;  1W1P A;  5GPR A;  2PPO A;  4S3J A;  3VAW A;  4U84 A;  1KT1 A;  2M1I A;  1E15 A;  2QF8 A;  3O5D A;  4WKA A;  4MNK A;  1XRV A;  5JH8 A;  2DT3 A;  2PPN A;  2PV3 A;  1F40 A;  4DRQ A;  3O5F A;  2RUC A;  2JZV A;  3CHE A;  2XP8 A;  1Q6H A;  3ARV A;  5HBF A;  1UR9 A;  1K9T A;  5B8I C;  4WKH A;  3BXW A;  4U86 A;  4TX0 A;  4S3K A;  1LL6 A;  1HJX A;  1WB0 A;  3WH0 A;  4G2P A;  3RFW A;  1HKK A;  1FKS A;  2DT0 A;  1Q6U A;  2FAP A;  2F21 A;  3UI6 A;  3ARY A;  1FKI A;  3CHC A;  3PR9 A;  1FKK A;  4Z2G A;  1ZL1 A;  4QT3 A;  3O5Q A;  1QPF A;  2XP6 A;  1FKH A;  4KQZ A;  4BF8 A;  3O5E A;  4KR0 B;  1U79 A;  4QZV B;  3ARW A;  3O5M A;  2D9F A;  2KI3 A;  1FKR A;  5DF0 A;  1FD9 A;  2AOS A;  2N87 A;  3G6L A;  1FFR A;  1J4R A;  1E6R A;  1PBK A;  4DWS C;  1BL4 A;  4DRI A;  2KR7 A;  1EIB A;  3WD2 A;  3JYM A;  4JFJ A;  3AS3 A;  4J4O A;  4P8W A;  4NNR A;  3O5R A;  2G8Z A;  1EHN A;  5HKG A;  1XHG A;  2A3B A;  2ESC A;  1ROT A;  1O6I A;  2UZ5 A;  2G41 A;  4MNM A;  3ARX A;  1VF8 A;  4IQC A;  2PBC A;  1M5Y A;  4LAX A;  5GPG A;  1ROU A;  5J6E A;  3ALG A;  2WM0 A;  4P8V A;  1W1V A;  3UQI A;  1J6Y A;  4FAP A;  4U85 A;  1C9H A;  1YAT A;  2ZR4 A;  1D6O A;  4AY1 A;  2O92 A;  3AS0 A;  2DG9 A;  1JNS A;  2MLX A;  4DRO A;  4IQ2 A;  1P5Q A;  2MPH A;  2VCD A;  4MGV A;  2K8I A;  3ARP A;  1UR8 A;  4ODN A;  4DIP A;  4DT4 A;  5D75 A;  4LAY A;  1OWQ A;  3KAH A;  3O5K A;  4W9O A;  3UI5 A;  4ODL A;  1D7I A;  2XPA A;  2DT2 A;  4MAV A;  2KFW A;  1W26 A;  3CHD A;  3RM8 A;  3KCE A;  1OGB A;  2DPE A;  2L2S A;  4WIW A;  3O5L A;  2ZQS A;  4LAV A;  3WD4 A;  1NWS A;  3O5I A;  2A3E A;  2ZR5 A;  4TW8 A;  3CHF A;  2FKE A;  3I6C A;  2MF9 A;  4MPK A;  3PRA A;  1A7X A;  4MNJ A;  5DIV A;  4N19 A;  5DIT A;  1FKG A;  2WLY A;  3WQW A;  4DWS B;  2ZQV A;  4W9P A;  4R5E A;  4XAK A;  2PPP A;  1NH6 A;  4P8X A;  2XP9 A;  1HXV A;  1HJV A;  4ML4 A;  3PA7 A;  1H0G A;  3WL1 A;  1Q6I A;  4HAR A;  3B9D A;  2RUQ A;  1HKJ A;  1B6C A;  1GUV A;  1KFW A;  1N1A A;  2KGJ A;  2XP4 A;  4DZ3 A;  3UF8 A;  4ITZ A;  4ZPT R;  4ODK A;  3ARR A;  4G50 A;  1D7J A;  3WKZ A;  1W1Y A;  1ZBK A;  1BKF A;  4P8U A;  4Q7N A;  1IX5 A;  1OGG A;  2M08 A;  1FKL A;  2WLZ A;  3O5P A;  5DO2 A;  4DRH A;  4DZ2 A;  1NMV A;  1E6P A;  2DSU A;  4URI A;  2OLH A;  3O5O A;  4GIV A;  4DRJ A;  4IT4 A;  4ZS6 A;  2DT1 A;  5DEZ A;  1X6L A;  3H9R B;  1J4H A;  4HBO A;  4PTM A;  5HW6 A;  1PIN A;  1KT0 A;  3CGM A;  2O9O A;  3PRB A;  1FFQ A;  5BXJ A;  4Z2I A;  2AWG A;  3EY6 A;  3ART A;  4NSB A;  4ZPV R;  1NWR A;  4JFL A;  4Q22 A;  4GGQ A;  5I98 A;  3B9A A;  4Z2K A;  1TFV A;  1GOI A;  1FKB A;  3B9E A;  5HW8 A;  4L72 B;  1LJY A;  2A3A A;  1HJW A;  1LL7 A;  2ITK A;  3G6M A;  3MDY B;  1JNT A;  1ZBV A;  2RUD A;  1WAW A;  4QIB A;  3O5G A;  4MTV A;  4QT2 A;  3AS2 A;  1LL4 A;  2OFN A;  4ODQ A;  3O5J A;  4W5U A;  1FJD A;  3ARO A;  1F8A B;  3IK8 A;  4ODR A;  4LGX A;  1T11 A;  1LG2 A;  4ODO A;  1SYT A;  4JFI A;  3TC5 A;  1FKT A;  1RD6 A;  2Q5A A;  3IKG A;  1E6N A;  3PRD A;  2DSV A;  4J4N A;  1JVW A;  4ODP A;  3IHZ A;  1ZBW A;  3UI4 A;  3IKD A;  4DWS D;  3ODK A;  4ZPW R;  1H0I A;  4LAW A;  2MNT A;  4HBE A;  3LUO A;  3TDB A;  3RM4 A;  1JND A;  1ZU8 A;  1ZK6 A;  1FAP A;  1Y0O A;  4DRK A;  1CTN A;  2PV2 A;  4W9Q A;  3WD3 A;  2RUR A;  4MSP A;  4L3N A;  1JNE A;  3CH9 A;  5DIU A;  4DWS A;  5GQB A;  3KAI A;  3WD1 A;  2M2A A;  2YBU A;  3WL0 A;  3JXV A;  1E9L A;  1FKF A;  3UQB A;  4IPX A;  4R0X A;  2FDM A;  3KZ7 A;  3WD0 A;  1HKM A;  2MLZ A;  1FKD A;  2XP5 A;  3FAP A;  3NRK A;  4JFM A;  3WIJ A;  2PI6 A;  3KAD A;  2IF4 A;  3CGN A;  4DH0 A;  1W9U A;  3KAB A;  2XP7 A;  1QPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...