3JXVA

Crystal structure of the 3 fkbp domains of wheat fkbp73
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
237
Chain Sequence
TSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the three FK506 binding protein domains of wheat FKBP73: evidence for a unique wFK73_2 domain.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Isomerase
molecule keywords 70 kDa peptidyl-prolyl isomerase
total genus 57
structure length 237
sequence length 239
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA01
2RUQA 1FKFA 1FKHA 1ROTA 1EYMA 4JFMA 3O5DA 2FAPA 4QT3A 2PV3A 1FKLA 4JYSA 4TW8A 4U84A 3H9RB 3VAWA 3OOBA 3O5MA 3NI6A 2XP8A 2XP5A 3JYMA 1J4HA 3O5FA 4LAYA 3I6CA 4ODPA 3UI5A 4TW7A 3KACA 1W26A 5HT1A 2ZR5A 2XP4A 4O2TA 2MLYA 3JYJA 2DG4A 3WH0A 5HWBA 3O5EA 1KT1A 2MNTA 1JVWA 3TCZA 4DRIA 1N1AA 2RUDA 4JFJA 4IQ2A 1FKTA 4W9QA 4DRJA 3O5IA 5HW8A 4G2PA 4JFIA 1FKKA 4DRPA 2PBCA 3UQAA 1D7IA 2KR7A 3KAGA 1Q6UA 3JXVA 1D6OA 4DIPA 2Q5AA 2M1IA 1QPLA 2IF4A 2OFNA 2MLXA 4J4OA 1EQ3A 2LPVA 2AWGA 2RSEA 3KAFA 1FKBA 3NRKA 3CGNA 2KI3A 3O5PA 1FKGA 4TNSA 2M2AA 3MDYB 3KZ7A 4LAWA 3UF8A 3UQIA 1TCOC 3UQBA 4W9OA 3FAPA 2XP6A 1F8AB 2XPBA 3KCEA 5HTGA 2XP3A 3UI4A 1M5YA 1ZCNA 4TX0A 3IHZA 2DG3A 2LGOA 2RURA 2KFWA 2M08A 1C9HA 4LAVA 3ODKA 4R0XA 1FKRA 5HUAA 4ODOA 5D75A 5DIUA 3O5GA 1JNSA 2FKEA 1Q6IA 3LUOA 1NSGA 2VN1A 1FD9A 3O5JA 3O5LA 5BXJA 4U85A 3PA7A 2F4EA 2VCDA 3KAIA 4J4NA 4MSPA 3RFWA 2F21A 5J6EA 2ZQTA 4GIVA 3O5QA 3O5OA 2L2SA 4N19A 4DZ2A 4TW6A 3IKGA 4FN2A 1A7XA 1T11A 4DRNA 4DT4A 1L1PA 5HWCA 5HW6A 1PBKA 2PPNA 2MPHA 4DH0A 4ODQA 4QIBA 1NMWA 2K8IA 2JZVA 2LJ4A 4JFKA 2Y78A 5DIVA 3EY6A 4DRKA 1KT0A 3TDBA 2PPPA 2XPAA 1ZK6A 3O5RA 2DG9A 2ZR6A 4BF8A 1YW5A 4JFLA 2KGJA 1R9HA 2PV1A 1F40A 4DZ3A 1FJDA 1J4IA 2D9FA 1Q1CA 2XP7A 4NNRA 2MLZA 4U86A 3B7XA 4W9PA 1FKSA 4TYOA 3O5KA 4C02B 2PV2A 1Y0OA 2RQSA 3IKDA 1BKFA 2ZR4A 3NTPA 3RGCA 3TC5A 1YATA 4ODRA 1NMVA 3IK8A 1U79A 1ROUA 4G50A 4ODMA 3KADA 4IQCA 1PINA 3UI6A 1FKDA 1JNTA 3PRBA 2UZ5A 1BL4A 2LKNA 2ZQVA 3GPKA 1Q6HA 1FKIA 2XP9A 3KAHA 4QT2A 4DRQA 1J6YA 1B6CA 4ODNA 2ZQUA 2MF9A 2ITKA 4DRHA 1QZ2A 2N87A 4DRMA 2KO7A 4MGVA 4FAPA 1QPFA 2F2DA 2RUCA 3KABA 4ITZA 4ODLA 1HXVA 1D7HA 2ZQSA 5I98A 4GGQA 1D7JA 4LAXA 5DITA 5GPGA 4DROA 2KE0A 3CGMA 5HW7A 4IPXA 3PRDA 2PPOA 1J4RA 4ODKA 5B8IC 1P5QA 1FAPA 5HKGA 1FKJA
chains in the Genus database with same CATH superfamily
3FXYA 2YBTA 1EQ3A 4QT3A 1WNOA 4WKFA 3O5MA 3NI6A 2O92A 4LAYA 4QZVB 1W26A 5HT1A 4O2TA 2MLYA 3O5EA 1NWSA 3TCZA 4DRIA 3ARSA 2DT0A 4JFJA 5HBFA 1W9UA 2ESCA 4DRJA 1EIBA 4URIA 1FKKA 1D7IA 1Q6UA 3AROA 1VF8A 1GRJA 3ARTA 2B31A 4DWSD 3AS0A 2ETNA 2AWGA 3NRKA 1LQ0A 3KZ7A 4MPKA 3FAPA 1F8AB 3ARZA 3KCEA 5HTGA 2DSZA 3IHZA 2DG3A 2DT3A 1WB0A 2KFWA 1IX5A 4LAVA 4R0XA 1FKRA 1GPFA 4ODOA 1JNSA 2FKEA 1FD9A 1HKKA 4J4NA 3G6LA 2ZQTA 4S3KA 4TW6A 4DT4A 1ZBKA 1L1PA 3BMBA 4P8VA 3WD1A 5HW6A 5HWCA 2MPHA 4DH0A 3RM8A 2LJ4A 2Y78A 1KT0A 2PPPA 1K9TA 1ZK6A 4BF8A 3CHFA 1YW5A 3ARXA 3B9AA 2DPEA 1Q1CA 4NNRA 3B7XA 2PV2A 3ALGA 1BKFA 3TC5A 4ODRA 4ODMA 1CTNA 1ROUA 5DEZA 3OA5A 3B9EA 1JNTA 2IUZA 1BL4A 1H0GA 4P8WA 2XP9A 3CHCA 4DRQA 2MF9A 4ML4A 3PRAA 1FFRA 2FDMA 2N87A 1LG1A 4Z2KA 4AY1A 3WD0A 4HARA 1HJWA 1D7HA 3GU0A 5I98A 5DITA 1LL6A 3CGMA 4ODKA 1RD6A 3QOKA 4W9QA 1EYMA 5D75A 2FAPA 3VAWA 4TW8A 4LGXA 3H9RB 1ZU8A 4WJXA 3ARRA 4Q22A 3I6CA 3UI5A 4TW7A 2ZR5A 2PI6A 2DG4A 1LL4A 3WH0A 5HWBA 1KT1A 2MNTA 1N1AA 1ZBVA 4MAVA 4W5UA 3RM9A 3B9DA 3PR9A 4G2PA 1W1PA 2KR7A 3KAGA 3ARYA 4DIPA 1D6OA 1HKMA 1W1YA 2MLXA 2AOSA 1HJXA 3O5PA 3CGNA 3UF8A 1FKGA 4TNSA 4UDMA 5DF0A 3RM4A 2XPBA 2G41A 2XP3A 1ZCNA 5DO2A 2M08A 1C9HA 1SYTA 5HUAA 3O5GA 3O5LA 1E44A 1NSGA 5BXJA 4U85A 3PA7A 3KAIA 4MSPA 3WD4A 3WKZA 4GIVA 3O5QA 2L2SA 3WIJA 4DZ2A 1A7XA 1T11A 4ODQA 4PTMA 1NMWA 1XHGA 1E6PA 4HBEA 3EY6A 3EIPA 3WQVA 2DT2A 2DG9A 2ZR6A 2A3AA 2PV1A 4DZ3A 2D9FA 4U86A 2MLZA 4DWSA 1FKSA 4IT4A 3O5KA 1OGBA 5GPRA 3AQUA 1YATA 1JNEA 3IK8A 4IQCA 1NWRA 1PINA 1HJVA 1OGGA 2ZQVA 3GPKA 1Q6HA 1E15A 4ODNA 2ZQUA 1W1VA 3WL0A 4DRHA 4DRMA 3RMEA 1ZL1A 4ZPWR 4MGVA 4FAPA 1NWUA 3KABA 4ITZA 4ODLA 1EHNA 4MNJA 4DROA 5GPGA 3WL1A 1WAWA 1P5QA 3CHDA 3O5DA 2PV3A 1FKLA 4U84A 3OOBA 3WQWA 4WIWA 3AS3A 1KFWA 4P8UA 1LL7A 3JYJA 4IQ2A 3O5IA 4NSBA 4JFIA 4DRPA 2PBCA 3UQAA 3JXVA 4DWSC 2Q5AA 2M1IA 2PN0A 1QPLA 1HKJA 1GUVA 1EDQA 2RSEA 3KAFA 4L72B 2KI3A 4LAWA 2B5UB 3UQBA 2XP6A 3UI4A 1LJYA 1M5YA 5JH8A 2RURA 2LGOA 5DIUA 1Q6IA 2WLYA 3ARWA 2VCDA 4XAKA 2QF8A 2F21A 3O5OA 4N19A 4R5EA 3IKGA 2DSUA 3CH9A 2WLZA 3AS1A 1E6ZA 2K8IA 4JFKA 2WM0A 2F23A 2XPAA 1HKIA 1E6RA 4ZPVR 1FFQA 2KGJA 4Z2LA 1UR8A 1FJDA 1J4IA 2XP7A 2G8ZA 1TFVA 3IKDA 2ZR4A 2WK2A 3ARPA 3CHEA 3NTPA 1U79A 3KADA 1E9LA 1GOIA 3UI6A 1FKDA 1J6YA 4ZS6A 1B6CA 1ITXA 4Q7NA 2OLHA 1QZ2A 4WKHA 1QPFA 1W9PA 1X6LA 2RUCA 4S3JA 2ZQSA 1D7JA 3CZ8A 4IPXA 3PRDA 2PPOA 5B8IC 3B8SA 1FKJA 4MNMA 2RUQA 1FKFA 1FKHA 1ROTA 4JFMA 4JYSA 5GQBA 4WKAA 2XP8A 1X6NA 2XP5A 2DT1A 3JYMA 4KR0B 1J4HA 3O5FA 2O9OA 4ODPA 4WK9A 3KACA 2XP4A 3ARVA 2A3BA 4DWSB 1D2KA 1JVWA 4Z2GA 4NZCA 2RUDA 1FKTA 3AS2A 3WD2A 5HW8A 2A3CA 1NWTA 2IF4A 2OFNA 4J4OA 2DSWA 1XRVA 4HBOA 4Z2IA 3ALFA 4Z2HA 2LPVA 1FKBA 3W4RA 3UQIA 4Z2JA 2M2AA 3MDYB 1TCOC 4W9OA 1W1TA 3BXWA 1O6IA 4TX0A 3ODKA 4KQZA 3ARUA 2A3EA 3O5JA 3LUOA 2VN1A 4IT6A 2F4EA 3RFWA 2DSVA 5J6EA 1JNDA 4ZPTR 4FN2A 4DRNA 1ZB5A 1PBKA 2PPNA 1SR0A 4QIBA 1NH6A 2JZVA 5DIVA 4MNLA 2EULA 4DRKA 3TDBA 1OWQA 3O5RA 1ZBWA 4JFLA 1E6NA 1R9HA 1F40A 4L3NA 1UR9A 4W9PA 3WD3A 4TYOA 4C02B 1JCHB 1Y0OA 2RQSA 3RGCA 1NMVA 4G50A 4P8XA 3G6MA 3PRBA 2UZ5A 2LKNA 3FY1A 1FKIA 1H0IA 1LG2A 3KAHA 4QT2A 2YBUA 2ITKA 4MNKA 1W9VA 2KO7A 3ARQA 2F2DA 1HXVA 4GGQA 4LAXA 5HW7A 4MTVA 2KE0A 1J4RA 5HKGA 2P4VA 1FAPA 1ZBCA 3GTYX
chains in the Genus database with same CATH topology
3FXYA 2YBTA 1EQ3A 4QT3A 1WNOA 4WKFA 3O5MA 3NI6A 2O92A 4LAYA 4QZVB 1W26A 5HT1A 4O2TA 2MLYA 3O5EA 1NWSA 3TCZA 4DRIA 3ARSA 2DT0A 4JFJA 5HBFA 1W9UA 2ESCA 4DRJA 1EIBA 4URIA 1FKKA 1D7IA 1Q6UA 3AROA 1VF8A 3ARTA 2B31A 4DWSD 3AS0A 2AWGA 3NRKA 1LQ0A 3KZ7A 4MPKA 3FAPA 1F8AB 3ARZA 3KCEA 5HTGA 2DSZA 3IHZA 2DG3A 2DT3A 1WB0A 2KFWA 1IX5A 4LAVA 4R0XA 1FKRA 1GPFA 4ODOA 1JNSA 2FKEA 1FD9A 1HKKA 4J4NA 3G6LA 2ZQTA 4S3KA 4TW6A 4DT4A 1ZBKA 1L1PA 4P8VA 3WD1A 5HW6A 5HWCA 2MPHA 4DH0A 3RM8A 2LJ4A 2Y78A 1KT0A 2PPPA 1K9TA 1ZK6A 4BF8A 3CHFA 1YW5A 3ARXA 3B9AA 2DPEA 1Q1CA 4NNRA 3B7XA 2PV2A 3ALGA 1BKFA 3TC5A 4ODRA 4ODMA 1CTNA 1ROUA 5DEZA 3OA5A 3B9EA 1JNTA 2IUZA 1BL4A 1H0GA 4P8WA 2XP9A 3CHCA 4DRQA 2MF9A 4ML4A 3PRAA 1FFRA 2FDMA 2N87A 1LG1A 4Z2KA 4AY1A 3WD0A 4HARA 1HJWA 1D7HA 5I98A 5DITA 1LL6A 3CGMA 4ODKA 1RD6A 3QOKA 4W9QA 1EYMA 5D75A 2FAPA 3VAWA 4TW8A 4LGXA 3H9RB 1ZU8A 4WJXA 3ARRA 4Q22A 3I6CA 3UI5A 4TW7A 2ZR5A 2PI6A 2DG4A 1LL4A 3WH0A 5HWBA 1KT1A 2MNTA 1N1AA 1ZBVA 4MAVA 4W5UA 3RM9A 3B9DA 3PR9A 4G2PA 1W1PA 2KR7A 3KAGA 3ARYA 4DIPA 1D6OA 1HKMA 1W1YA 2MLXA 2AOSA 1HJXA 3O5PA 3CGNA 3UF8A 1FKGA 4TNSA 5DF0A 3RM4A 2XPBA 2G41A 2XP3A 1ZCNA 5DO2A 2M08A 1C9HA 1SYTA 5HUAA 3O5GA 3O5LA 1NSGA 5BXJA 4U85A 3PA7A 3KAIA 4MSPA 3WD4A 3WKZA 4GIVA 3O5QA 2L2SA 3WIJA 4DZ2A 1A7XA 1T11A 4ODQA 4PTMA 1NMWA 1XHGA 1E6PA 4HBEA 3EY6A 3WQVA 2DT2A 2DG9A 2ZR6A 2A3AA 2PV1A 4DZ3A 2D9FA 4U86A 2MLZA 4DWSA 1FKSA 4IT4A 3O5KA 1OGBA 5GPRA 3AQUA 1YATA 1JNEA 3IK8A 4IQCA 1NWRA 1PINA 1HJVA 1OGGA 2ZQVA 3GPKA 1Q6HA 1E15A 4ODNA 2ZQUA 1W1VA 3WL0A 4DRHA 4DRMA 3RMEA 1ZL1A 4ZPWR 4MGVA 4FAPA 1NWUA 3KABA 4ITZA 4ODLA 1EHNA 4MNJA 4DROA 5GPGA 3WL1A 1WAWA 1P5QA 3CHDA 3O5DA 2PV3A 1FKLA 4U84A 3OOBA 3WQWA 4WIWA 3AS3A 1KFWA 4P8UA 1LL7A 3JYJA 4IQ2A 3O5IA 4NSBA 4JFIA 4DRPA 2PBCA 3UQAA 3JXVA 4DWSC 2Q5AA 2M1IA 1QPLA 1HKJA 1GUVA 1EDQA 2RSEA 3KAFA 4L72B 2KI3A 4LAWA 3UQBA 2XP6A 3UI4A 1LJYA 1M5YA 5JH8A 2RURA 2LGOA 5DIUA 1Q6IA 2WLYA 3ARWA 2VCDA 4XAKA 2QF8A 2F21A 3O5OA 4N19A 4R5EA 3IKGA 2DSUA 3CH9A 2WLZA 3AS1A 1E6ZA 2K8IA 4JFKA 2WM0A 2XPAA 1HKIA 1E6RA 4ZPVR 1FFQA 2KGJA 4Z2LA 1UR8A 1FJDA 1J4IA 2XP7A 2G8ZA 1TFVA 3IKDA 2ZR4A 2WK2A 3ARPA 3CHEA 3NTPA 1U79A 3KADA 1E9LA 1GOIA 3UI6A 1FKDA 1J6YA 4ZS6A 1B6CA 1ITXA 4Q7NA 2OLHA 1QZ2A 4WKHA 1QPFA 1W9PA 1X6LA 2RUCA 4S3JA 2ZQSA 1D7JA 3CZ8A 4IPXA 3PRDA 2PPOA 5B8IC 3B8SA 1FKJA 4MNMA 2RUQA 1FKFA 1FKHA 1ROTA 4JFMA 4JYSA 5GQBA 4WKAA 2XP8A 1X6NA 2XP5A 2DT1A 3JYMA 4KR0B 1J4HA 3O5FA 2O9OA 4ODPA 4WK9A 3KACA 2XP4A 3ARVA 2A3BA 4DWSB 1D2KA 1JVWA 4Z2GA 4NZCA 2RUDA 1FKTA 3AS2A 3WD2A 5HW8A 2A3CA 1NWTA 2IF4A 2OFNA 4J4OA 2DSWA 1XRVA 4HBOA 4Z2IA 3ALFA 4Z2HA 2LPVA 1FKBA 3W4RA 3UQIA 4Z2JA 2M2AA 3MDYB 1TCOC 4W9OA 1W1TA 3BXWA 1O6IA 4TX0A 3ODKA 4KQZA 3ARUA 2A3EA 3O5JA 3LUOA 2VN1A 4IT6A 2F4EA 3RFWA 2DSVA 5J6EA 1JNDA 4ZPTR 4FN2A 4DRNA 1ZB5A 1PBKA 2PPNA 1SR0A 4QIBA 1NH6A 2JZVA 5DIVA 4MNLA 4DRKA 3TDBA 1OWQA 3O5RA 1ZBWA 4JFLA 1E6NA 1R9HA 1F40A 4L3NA 1UR9A 4W9PA 3WD3A 4TYOA 4C02B 1Y0OA 2RQSA 3RGCA 1NMVA 4G50A 4P8XA 3G6MA 3PRBA 2UZ5A 2LKNA 3FY1A 1FKIA 1H0IA 1LG2A 3KAHA 4QT2A 2YBUA 2ITKA 4MNKA 1W9VA 2KO7A 3ARQA 2F2DA 1HXVA 4GGQA 4LAXA 5HW7A 4MTVA 2KE0A 1J4RA 5HKGA 1FAPA 1ZBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUQ A;  1FKF A;  1FKH A;  1ROT A;  1EYM A;  4JFM A;  3O5D A;  2FAP A;  4QT3 A;  2PV3 A;  1FKL A;  4JYS A;  4TW8 A;  4U84 A;  3H9R B;  3VAW A;  3OOB A;  3O5M A;  3NI6 A;  2XP8 A;  2XP5 A;  3JYM A;  1J4H A;  3O5F A;  4LAY A;  3I6C A;  4ODP A;  3UI5 A;  4TW7 A;  3KAC A;  1W26 A;  5HT1 A;  2ZR5 A;  2XP4 A;  4O2T A;  2MLY A;  3JYJ A;  2DG4 A;  3WH0 A;  5HWB A;  3O5E A;  1KT1 A;  2MNT A;  1JVW A;  3TCZ A;  4DRI A;  1N1A A;  2RUD A;  4JFJ A;  4IQ2 A;  1FKT A;  4W9Q A;  4DRJ A;  3O5I A;  5HW8 A;  4G2P A;  4JFI A;  1FKK A;  4DRP A;  2PBC A;  3UQA A;  1D7I A;  2KR7 A;  3KAG A;  1Q6U A;  3JXV A;  1D6O A;  4DIP A;  2Q5A A;  2M1I A;  1QPL A;  2IF4 A;  2OFN A;  2MLX A;  4J4O A;  1EQ3 A;  2LPV A;  2AWG A;  2RSE A;  3KAF A;  1FKB A;  3NRK A;  3CGN A;  2KI3 A;  3O5P A;  1FKG A;  4TNS A;  2M2A A;  3MDY B;  3KZ7 A;  4LAW A;  3UF8 A;  3UQI A;  1TCO C;  3UQB A;  4W9O A;  3FAP A;  2XP6 A;  1F8A B;  2XPB A;  3KCE A;  5HTG A;  2XP3 A;  3UI4 A;  1M5Y A;  1ZCN A;  4TX0 A;  3IHZ A;  2DG3 A;  2LGO A;  2RUR A;  2KFW A;  2M08 A;  1C9H A;  4LAV A;  3ODK A;  4R0X A;  1FKR A;  5HUA A;  4ODO A;  5D75 A;  5DIU A;  3O5G A;  1JNS A;  2FKE A;  1Q6I A;  3LUO A;  1NSG A;  2VN1 A;  1FD9 A;  3O5J A;  3O5L A;  5BXJ A;  4U85 A;  3PA7 A;  2F4E A;  2VCD A;  3KAI A;  4J4N A;  4MSP A;  3RFW A;  2F21 A;  5J6E A;  2ZQT A;  4GIV A;  3O5Q A;  3O5O A;  2L2S A;  4N19 A;  4DZ2 A;  4TW6 A;  3IKG A;  4FN2 A;  1A7X A;  1T11 A;  4DRN A;  4DT4 A;  1L1P A;  5HWC A;  5HW6 A;  1PBK A;  2PPN A;  2MPH A;  4DH0 A;  4ODQ A;  4QIB A;  1NMW A;  2K8I A;  2JZV A;  2LJ4 A;  4JFK A;  2Y78 A;  5DIV A;  3EY6 A;  4DRK A;  1KT0 A;  3TDB A;  2PPP A;  2XPA A;  1ZK6 A;  3O5R A;  2DG9 A;  2ZR6 A;  4BF8 A;  1YW5 A;  4JFL A;  2KGJ A;  1R9H A;  2PV1 A;  1F40 A;  4DZ3 A;  1FJD A;  1J4I A;  2D9F A;  1Q1C A;  2XP7 A;  4NNR A;  2MLZ A;  4U86 A;  3B7X A;  4W9P A;  1FKS A;  4TYO A;  3O5K A;  4C02 B;  2PV2 A;  1Y0O A;  2RQS A;  3IKD A;  1BKF A;  2ZR4 A;  3NTP A;  3RGC A;  3TC5 A;  1YAT A;  4ODR A;  1NMV A;  3IK8 A;  1U79 A;  1ROU A;  4G50 A;  4ODM A;  3KAD A;  4IQC A;  1PIN A;  3UI6 A;  1FKD A;  1JNT A;  3PRB A;  2UZ5 A;  1BL4 A;  2LKN A;  2ZQV A;  3GPK A;  1Q6H A;  1FKI A;  2XP9 A;  3KAH A;  4QT2 A;  4DRQ A;  1J6Y A;  1B6C A;  4ODN A;  2ZQU A;  2MF9 A;  2ITK A;  4DRH A;  1QZ2 A;  2N87 A;  4DRM A;  2KO7 A;  4MGV A;  4FAP A;  1QPF A;  2F2D A;  2RUC A;  3KAB A;  4ITZ A;  4ODL A;  1HXV A;  1D7H A;  2ZQS A;  5I98 A;  4GGQ A;  1D7J A;  4LAX A;  5DIT A;  5GPG A;  4DRO A;  2KE0 A;  3CGM A;  5HW7 A;  4IPX A;  3PRD A;  2PPO A;  1J4R A;  4ODK A;  5B8I C;  1P5Q A;  1FAP A;  5HKG A;  1FKJ A; 
#chains in the Genus database with same CATH topology
 3FXY A;  2YBT A;  1EQ3 A;  4QT3 A;  1WNO A;  4WKF A;  3O5M A;  3NI6 A;  2O92 A;  4LAY A;  4QZV B;  1W26 A;  5HT1 A;  4O2T A;  2MLY A;  3O5E A;  1NWS A;  3TCZ A;  4DRI A;  3ARS A;  2DT0 A;  4JFJ A;  5HBF A;  1W9U A;  2ESC A;  4DRJ A;  1EIB A;  4URI A;  1FKK A;  1D7I A;  1Q6U A;  3ARO A;  1VF8 A;  1GRJ A;  3ART A;  2B31 A;  4DWS D;  3AS0 A;  2ETN A;  2AWG A;  3NRK A;  1LQ0 A;  3KZ7 A;  4MPK A;  3FAP A;  1F8A B;  3ARZ A;  3KCE A;  5HTG A;  2DSZ A;  3IHZ A;  2DG3 A;  2DT3 A;  1WB0 A;  2KFW A;  1IX5 A;  4LAV A;  4R0X A;  1FKR A;  1GPF A;  4ODO A;  1JNS A;  2FKE A;  1FD9 A;  1HKK A;  4J4N A;  3G6L A;  2ZQT A;  4S3K A;  4TW6 A;  4DT4 A;  1ZBK A;  1L1P A;  3BMB A;  4P8V A;  3WD1 A;  5HW6 A;  5HWC A;  2MPH A;  4DH0 A;  3RM8 A;  2LJ4 A;  2Y78 A;  1KT0 A;  2PPP A;  1K9T A;  1ZK6 A;  4BF8 A;  3CHF A;  1YW5 A;  3ARX A;  3B9A A;  2DPE A;  1Q1C A;  4NNR A;  3B7X A;  2PV2 A;  3ALG A;  1BKF A;  3TC5 A;  4ODR A;  4ODM A;  1CTN A;  1ROU A;  5DEZ A;  3OA5 A;  3B9E A;  1JNT A;  2IUZ A;  1BL4 A;  1H0G A;  4P8W A;  2XP9 A;  3CHC A;  4DRQ A;  2MF9 A;  4ML4 A;  3PRA A;  1FFR A;  2FDM A;  2N87 A;  1LG1 A;  4Z2K A;  4AY1 A;  3WD0 A;  4HAR A;  1HJW A;  1D7H A;  3GU0 A;  5I98 A;  5DIT A;  1LL6 A;  3CGM A;  4ODK A;  1RD6 A;  3QOK A;  4W9Q A;  1EYM A;  5D75 A;  2FAP A;  3VAW A;  4TW8 A;  4LGX A;  3H9R B;  1ZU8 A;  4WJX A;  3ARR A;  4Q22 A;  3I6C A;  3UI5 A;  4TW7 A;  2ZR5 A;  2PI6 A;  2DG4 A;  1LL4 A;  3WH0 A;  5HWB A;  1KT1 A;  2MNT A;  1N1A A;  1ZBV A;  4MAV A;  4W5U A;  3RM9 A;  3B9D A;  3PR9 A;  4G2P A;  1W1P A;  2KR7 A;  3KAG A;  3ARY A;  4DIP A;  1D6O A;  1HKM A;  1W1Y A;  2MLX A;  2AOS A;  1HJX A;  3O5P A;  3CGN A;  3UF8 A;  1FKG A;  4TNS A;  4UDM A;  5DF0 A;  3RM4 A;  2XPB A;  2G41 A;  2XP3 A;  1ZCN A;  5DO2 A;  2M08 A;  1C9H A;  1SYT A;  5HUA A;  3O5G A;  3O5L A;  1E44 A;  1NSG A;  5BXJ A;  4U85 A;  3PA7 A;  3KAI A;  4MSP A;  3WD4 A;  3WKZ A;  4GIV A;  3O5Q A;  2L2S A;  3WIJ A;  4DZ2 A;  1A7X A;  1T11 A;  4ODQ A;  4PTM A;  1NMW A;  1XHG A;  1E6P A;  4HBE A;  3EY6 A;  3EIP A;  3WQV A;  2DT2 A;  2DG9 A;  2ZR6 A;  2A3A A;  2PV1 A;  4DZ3 A;  2D9F A;  4U86 A;  2MLZ A;  4DWS A;  1FKS A;  4IT4 A;  3O5K A;  1OGB A;  5GPR A;  3AQU A;  1YAT A;  1JNE A;  3IK8 A;  4IQC A;  1NWR A;  1PIN A;  1HJV A;  1OGG A;  2ZQV A;  3GPK A;  1Q6H A;  1E15 A;  4ODN A;  2ZQU A;  1W1V A;  3WL0 A;  4DRH A;  4DRM A;  3RME A;  1ZL1 A;  4ZPW R;  4MGV A;  4FAP A;  1NWU A;  3KAB A;  4ITZ A;  4ODL A;  1EHN A;  4MNJ A;  4DRO A;  5GPG A;  3WL1 A;  1WAW A;  1P5Q A;  3CHD A;  3O5D A;  2PV3 A;  1FKL A;  4U84 A;  3OOB A;  3WQW A;  4WIW A;  3AS3 A;  1KFW A;  4P8U A;  1LL7 A;  3JYJ A;  4IQ2 A;  3O5I A;  4NSB A;  4JFI A;  4DRP A;  2PBC A;  3UQA A;  3JXV A;  4DWS C;  2Q5A A;  2M1I A;  2PN0 A;  1QPL A;  1HKJ A;  1GUV A;  1EDQ A;  2RSE A;  3KAF A;  4L72 B;  2KI3 A;  4LAW A;  2B5U B;  3UQB A;  2XP6 A;  3UI4 A;  1LJY A;  1M5Y A;  5JH8 A;  2RUR A;  2LGO A;  5DIU A;  1Q6I A;  2WLY A;  3ARW A;  2VCD A;  4XAK A;  2QF8 A;  2F21 A;  3O5O A;  4N19 A;  4R5E A;  3IKG A;  2DSU A;  3CH9 A;  2WLZ A;  3AS1 A;  1E6Z A;  2K8I A;  4JFK A;  2WM0 A;  2F23 A;  2XPA A;  1HKI A;  1E6R A;  4ZPV R;  1FFQ A;  2KGJ A;  4Z2L A;  1UR8 A;  1FJD A;  1J4I A;  2XP7 A;  2G8Z A;  1TFV A;  3IKD A;  2ZR4 A;  2WK2 A;  3ARP A;  3CHE A;  3NTP A;  1U79 A;  3KAD A;  1E9L A;  1GOI A;  3UI6 A;  1FKD A;  1J6Y A;  4ZS6 A;  1B6C A;  1ITX A;  4Q7N A;  2OLH A;  1QZ2 A;  4WKH A;  1QPF A;  1W9P A;  1X6L A;  2RUC A;  4S3J A;  2ZQS A;  1D7J A;  3CZ8 A;  4IPX A;  3PRD A;  2PPO A;  5B8I C;  3B8S A;  1FKJ A;  4MNM A;  2RUQ A;  1FKF A;  1FKH A;  1ROT A;  4JFM A;  4JYS A;  5GQB A;  4WKA A;  2XP8 A;  1X6N A;  2XP5 A;  2DT1 A;  3JYM A;  4KR0 B;  1J4H A;  3O5F A;  2O9O A;  4ODP A;  4WK9 A;  3KAC A;  2XP4 A;  3ARV A;  2A3B A;  4DWS B;  1D2K A;  1JVW A;  4Z2G A;  4NZC A;  2RUD A;  1FKT A;  3AS2 A;  3WD2 A;  5HW8 A;  2A3C A;  1NWT A;  2IF4 A;  2OFN A;  4J4O A;  2DSW A;  1XRV A;  4HBO A;  4Z2I A;  3ALF A;  4Z2H A;  2LPV A;  1FKB A;  3W4R A;  3UQI A;  4Z2J A;  2M2A A;  3MDY B;  1TCO C;  4W9O A;  1W1T A;  3BXW A;  1O6I A;  4TX0 A;  3ODK A;  4KQZ A;  3ARU A;  2A3E A;  3O5J A;  3LUO A;  2VN1 A;  4IT6 A;  2F4E A;  3RFW A;  2DSV A;  5J6E A;  1JND A;  4ZPT R;  4FN2 A;  4DRN A;  1ZB5 A;  1PBK A;  2PPN A;  1SR0 A;  4QIB A;  1NH6 A;  2JZV A;  5DIV A;  4MNL A;  2EUL A;  4DRK A;  3TDB A;  1OWQ A;  3O5R A;  1ZBW A;  4JFL A;  1E6N A;  1R9H A;  1F40 A;  4L3N A;  1UR9 A;  4W9P A;  3WD3 A;  4TYO A;  4C02 B;  1JCH B;  1Y0O A;  2RQS A;  3RGC A;  1NMV A;  4G50 A;  4P8X A;  3G6M A;  3PRB A;  2UZ5 A;  2LKN A;  3FY1 A;  1FKI A;  1H0I A;  1LG2 A;  3KAH A;  4QT2 A;  2YBU A;  2ITK A;  4MNK A;  1W9V A;  2KO7 A;  3ARQ A;  2F2D A;  1HXV A;  4GGQ A;  4LAX A;  5HW7 A;  4MTV A;  2KE0 A;  1J4R A;  5HKG A;  2P4V A;  1FAP A;  1ZBC A;  3GTY X; 
#chains in the Genus database with same CATH homology
 3FXY A;  2YBT A;  1EQ3 A;  4QT3 A;  1WNO A;  4WKF A;  3O5M A;  3NI6 A;  2O92 A;  4LAY A;  4QZV B;  1W26 A;  5HT1 A;  4O2T A;  2MLY A;  3O5E A;  1NWS A;  3TCZ A;  4DRI A;  3ARS A;  2DT0 A;  4JFJ A;  5HBF A;  1W9U A;  2ESC A;  4DRJ A;  1EIB A;  4URI A;  1FKK A;  1D7I A;  1Q6U A;  3ARO A;  1VF8 A;  3ART A;  2B31 A;  4DWS D;  3AS0 A;  2AWG A;  3NRK A;  1LQ0 A;  3KZ7 A;  4MPK A;  3FAP A;  1F8A B;  3ARZ A;  3KCE A;  5HTG A;  2DSZ A;  3IHZ A;  2DG3 A;  2DT3 A;  1WB0 A;  2KFW A;  1IX5 A;  4LAV A;  4R0X A;  1FKR A;  1GPF A;  4ODO A;  1JNS A;  2FKE A;  1FD9 A;  1HKK A;  4J4N A;  3G6L A;  2ZQT A;  4S3K A;  4TW6 A;  4DT4 A;  1ZBK A;  1L1P A;  4P8V A;  3WD1 A;  5HW6 A;  5HWC A;  2MPH A;  4DH0 A;  3RM8 A;  2LJ4 A;  2Y78 A;  1KT0 A;  2PPP A;  1K9T A;  1ZK6 A;  4BF8 A;  3CHF A;  1YW5 A;  3ARX A;  3B9A A;  2DPE A;  1Q1C A;  4NNR A;  3B7X A;  2PV2 A;  3ALG A;  1BKF A;  3TC5 A;  4ODR A;  4ODM A;  1CTN A;  1ROU A;  5DEZ A;  3OA5 A;  3B9E A;  1JNT A;  2IUZ A;  1BL4 A;  1H0G A;  4P8W A;  2XP9 A;  3CHC A;  4DRQ A;  2MF9 A;  4ML4 A;  3PRA A;  1FFR A;  2FDM A;  2N87 A;  1LG1 A;  4Z2K A;  4AY1 A;  3WD0 A;  4HAR A;  1HJW A;  1D7H A;  5I98 A;  5DIT A;  1LL6 A;  3CGM A;  4ODK A;  1RD6 A;  3QOK A;  4W9Q A;  1EYM A;  5D75 A;  2FAP A;  3VAW A;  4TW8 A;  4LGX A;  3H9R B;  1ZU8 A;  4WJX A;  3ARR A;  4Q22 A;  3I6C A;  3UI5 A;  4TW7 A;  2ZR5 A;  2PI6 A;  2DG4 A;  1LL4 A;  3WH0 A;  5HWB A;  1KT1 A;  2MNT A;  1N1A A;  1ZBV A;  4MAV A;  4W5U A;  3RM9 A;  3B9D A;  3PR9 A;  4G2P A;  1W1P A;  2KR7 A;  3KAG A;  3ARY A;  4DIP A;  1D6O A;  1HKM A;  1W1Y A;  2MLX A;  2AOS A;  1HJX A;  3O5P A;  3CGN A;  3UF8 A;  1FKG A;  4TNS A;  5DF0 A;  3RM4 A;  2XPB A;  2G41 A;  2XP3 A;  1ZCN A;  5DO2 A;  2M08 A;  1C9H A;  1SYT A;  5HUA A;  3O5G A;  3O5L A;  1NSG A;  5BXJ A;  4U85 A;  3PA7 A;  3KAI A;  4MSP A;  3WD4 A;  3WKZ A;  4GIV A;  3O5Q A;  2L2S A;  3WIJ A;  4DZ2 A;  1A7X A;  1T11 A;  4ODQ A;  4PTM A;  1NMW A;  1XHG A;  1E6P A;  4HBE A;  3EY6 A;  3WQV A;  2DT2 A;  2DG9 A;  2ZR6 A;  2A3A A;  2PV1 A;  4DZ3 A;  2D9F A;  4U86 A;  2MLZ A;  4DWS A;  1FKS A;  4IT4 A;  3O5K A;  1OGB A;  5GPR A;  3AQU A;  1YAT A;  1JNE A;  3IK8 A;  4IQC A;  1NWR A;  1PIN A;  1HJV A;  1OGG A;  2ZQV A;  3GPK A;  1Q6H A;  1E15 A;  4ODN A;  2ZQU A;  1W1V A;  3WL0 A;  4DRH A;  4DRM A;  3RME A;  1ZL1 A;  4ZPW R;  4MGV A;  4FAP A;  1NWU A;  3KAB A;  4ITZ A;  4ODL A;  1EHN A;  4MNJ A;  4DRO A;  5GPG A;  3WL1 A;  1WAW A;  1P5Q A;  3CHD A;  3O5D A;  2PV3 A;  1FKL A;  4U84 A;  3OOB A;  3WQW A;  4WIW A;  3AS3 A;  1KFW A;  4P8U A;  1LL7 A;  3JYJ A;  4IQ2 A;  3O5I A;  4NSB A;  4JFI A;  4DRP A;  2PBC A;  3UQA A;  3JXV A;  4DWS C;  2Q5A A;  2M1I A;  1QPL A;  1HKJ A;  1GUV A;  1EDQ A;  2RSE A;  3KAF A;  4L72 B;  2KI3 A;  4LAW A;  3UQB A;  2XP6 A;  3UI4 A;  1LJY A;  1M5Y A;  5JH8 A;  2RUR A;  2LGO A;  5DIU A;  1Q6I A;  2WLY A;  3ARW A;  2VCD A;  4XAK A;  2QF8 A;  2F21 A;  3O5O A;  4N19 A;  4R5E A;  3IKG A;  2DSU A;  3CH9 A;  2WLZ A;  3AS1 A;  1E6Z A;  2K8I A;  4JFK A;  2WM0 A;  2XPA A;  1HKI A;  1E6R A;  4ZPV R;  1FFQ A;  2KGJ A;  4Z2L A;  1UR8 A;  1FJD A;  1J4I A;  2XP7 A;  2G8Z A;  1TFV A;  3IKD A;  2ZR4 A;  2WK2 A;  3ARP A;  3CHE A;  3NTP A;  1U79 A;  3KAD A;  1E9L A;  1GOI A;  3UI6 A;  1FKD A;  1J6Y A;  4ZS6 A;  1B6C A;  1ITX A;  4Q7N A;  2OLH A;  1QZ2 A;  4WKH A;  1QPF A;  1W9P A;  1X6L A;  2RUC A;  4S3J A;  2ZQS A;  1D7J A;  3CZ8 A;  4IPX A;  3PRD A;  2PPO A;  5B8I C;  3B8S A;  1FKJ A;  4MNM A;  2RUQ A;  1FKF A;  1FKH A;  1ROT A;  4JFM A;  4JYS A;  5GQB A;  4WKA A;  2XP8 A;  1X6N A;  2XP5 A;  2DT1 A;  3JYM A;  4KR0 B;  1J4H A;  3O5F A;  2O9O A;  4ODP A;  4WK9 A;  3KAC A;  2XP4 A;  3ARV A;  2A3B A;  4DWS B;  1D2K A;  1JVW A;  4Z2G A;  4NZC A;  2RUD A;  1FKT A;  3AS2 A;  3WD2 A;  5HW8 A;  2A3C A;  1NWT A;  2IF4 A;  2OFN A;  4J4O A;  2DSW A;  1XRV A;  4HBO A;  4Z2I A;  3ALF A;  4Z2H A;  2LPV A;  1FKB A;  3W4R A;  3UQI A;  4Z2J A;  2M2A A;  3MDY B;  1TCO C;  4W9O A;  1W1T A;  3BXW A;  1O6I A;  4TX0 A;  3ODK A;  4KQZ A;  3ARU A;  2A3E A;  3O5J A;  3LUO A;  2VN1 A;  4IT6 A;  2F4E A;  3RFW A;  2DSV A;  5J6E A;  1JND A;  4ZPT R;  4FN2 A;  4DRN A;  1ZB5 A;  1PBK A;  2PPN A;  1SR0 A;  4QIB A;  1NH6 A;  2JZV A;  5DIV A;  4MNL A;  4DRK A;  3TDB A;  1OWQ A;  3O5R A;  1ZBW A;  4JFL A;  1E6N A;  1R9H A;  1F40 A;  4L3N A;  1UR9 A;  4W9P A;  3WD3 A;  4TYO A;  4C02 B;  1Y0O A;  2RQS A;  3RGC A;  1NMV A;  4G50 A;  4P8X A;  3G6M A;  3PRB A;  2UZ5 A;  2LKN A;  3FY1 A;  1FKI A;  1H0I A;  1LG2 A;  3KAH A;  4QT2 A;  2YBU A;  2ITK A;  4MNK A;  1W9V A;  2KO7 A;  3ARQ A;  2F2D A;  1HXV A;  4GGQ A;  4LAX A;  5HW7 A;  4MTV A;  2KE0 A;  1J4R A;  5HKG A;  1FAP A;  1ZBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...