3JXVA

Crystal structure of the 3 fkbp domains of wheat fkbp73
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
237
Chain Sequence
TSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the three FK506 binding protein domains of wheat FKBP73: evidence for a unique wFK73_2 domain.
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Isomerase
molecule keywords 70 kDa peptidyl-prolyl isomerase
total genus 57
structure length 237
sequence length 239
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jxvA01
2XP3A 1ZK6A 4G50A 2RURA 1EYMA 2F2DA 5DIVA 1R9HA 3UF8A 1JVWA 1FKHA 3PRDA 2IF4A 4LAWA 3TCZA 2MLXA 3IKGA 5B8IC 2ZQUA 1FKSA 2RUCA 4ODMA 3RGCA 3CGMA 1YW5A 5HUAA 3O5LA 1KT1A 5HKGA 4ODKA 4U84A 2DG4A 3JYMA 1FKGA 3KAGA 1N1AA 3TC5A 5HW7A 3KADA 2RQSA 2KO7A 2MF9A 4J4OA 1W26A 1BL4A 3RFWA 3UI4A 5DITA 2MLZA 3TDBA 2PBCA 2ZQSA 3PA7A 2ZQVA 2F4EA 2ZQTA 4DRNA 1BKFA 1B6CA 4W9PA 2ZR5A 2LPVA 1F40A 1HXVA 3NRKA 3O5QA 2Y78A 2XPBA 4ITZA 4DROA 5HWCA 1T11A 5I98A 2UZ5A 5HW6A 1M5YA 1FKKA 4U86A 1JNSA 1Q6IA 4G2PA 3CGNA 4BF8A 3GPKA 1KT0A 1J4HA 1U79A 1F8AB 2PV3A 4J4NA 4TX0A 3NTPA 2XP7A 3PRBA 4LAXA 1FKJA 3O5GA 3UI5A 4FN2A 4DZ2A 2PPNA 1D6OA 1FD9A 4QT2A 2KGJA 4IQCA 4O2TA 4ODPA 2FAPA 2XPAA 4JYSA 4TW8A 2MPHA 4ODOA 3IHZA 1Y0OA 3O5OA 4DRJA 4DRKA 5GPGA 1QZ2A 3KAFA 4JFMA 3FAPA 4TNSA 1QPLA 4TW7A 4C02B 2DG9A 1FJDA 4LAYA 2ZR6A 3KAIA 2VN1A 3WH0A 3LUOA 4ODRA 1FKTA 1NMVA 2VCDA 3O5PA 4W9QA 3MDYB 5J6EA 1YATA 3UI6A 4JFIA 3O5JA 2D9FA 2RUQA 5DIUA 4R0XA 3KABA 3O5MA 5HT1A 4DRHA 1EQ3A 4JFLA 5HTGA 2XP8A 1ZCNA 3JYJA 1PINA 3H9RB 2KFWA 4DIPA 2XP4A 4TYOA 2OFNA 1D7HA 3O5DA 4QT3A 4QIBA 2K8IA 5HWBA 4MSPA 3ODKA 2KI3A 3UQIA 3B7XA 3IK8A 3O5IA 1C9HA 2M2AA 2JZVA 5BXJA 1FAPA 2XP6A 2L2SA 1A7XA 1QPFA 2MLYA 2PPOA 2ITKA 4GIVA 4JFKA 4ODLA 4ODNA 4DRMA 2RUDA 1Q6UA 2ZR4A 3O5RA 1FKFA 2XP9A 3O5FA 4MGVA 1ROUA 3KCEA 2LGOA 3EY6A 1FKRA 4ODQA 1D7JA 1FKIA 1JNTA 1NMWA 2FKEA 4U85A 2N87A 3VAWA 2PPPA 2KE0A 3O5EA 1TCOC 4DRIA 4DT4A 2Q5AA 3JXVA 2XP5A 3OOBA 4DH0A 1J6YA 4IQ2A 4FAPA 2PV2A 1L1PA 2M1IA 2PV1A 2LKNA 1FKDA 1FKLA 1Q1CA 2DG3A 4W9OA 4DZ3A 4TW6A 1FKBA 1NSGA 3KAHA 3UQAA 1J4RA 3NI6A 4LAVA 1J4IA 1ROTA 3I6CA 1PBKA 1D7IA 2LJ4A 2M08A 2F21A 2AWGA 2MNTA 3KACA 2RSEA 4IPXA 4GGQA 5HW8A 1Q6HA 4JFJA 3O5KA 3IKDA 4NNRA 4N19A 5D75A 4DRQA 2KR7A 4DRPA 3UQBA 3KZ7A 1P5QA
chains in the Genus database with same CATH superfamily
1R9HA 1FKHA 2IF4A 4LAWA 3IKGA 5B8IC 2PN0A 5HUAA 3PRAA 1KT1A 1EDQA 4U84A 3JYMA 1SR0A 4Q22A 5HW7A 2RQSA 3RFWA 5GPRA 5DITA 1UR9A 2ZQSA 3BXWA 3PA7A 1ZBCA 1BKFA 1GPFA 1OGBA 3NRKA 3CHDA 2Y78A 1NWTA 4Z2LA 1M5YA 3RMEA 3CGNA 3CHCA 1F8AB 3PRBA 4LAXA 2WK2A 2PPNA 3ALFA 3CZ8A 2KGJA 4ODPA 1E44A 5DO2A 2B5UB 4JYSA 4MNKA 1QZ2A 4C02B 2DG9A 1FFQA 2VN1A 4HBOA 3WH0A 3LUOA 4ODRA 1FKTA 1NMVA 3RM9A 4W9QA 1E6RA 3KABA 1LJYA 5HT1A 1EQ3A 4JFLA 1ZU8A 3GTYX 3WQVA 2P4VA 1ZCNA 4ZPVR 3AS2A 4DIPA 4WIWA 4Z2JA 4QT3A 1EIBA 3ODKA 1SYTA 2IUZA 3UQIA 1C9HA 3WD1A 2RUDA 4WKFA 2XP9A 1X6LA 1GUVA 3EY6A 1FKRA 3RM4A 1JNTA 1NMWA 1OGGA 4U85A 2N87A 1GOIA 3ALGA 4QZVB 3JXVA 3AS1A 2DSWA 3CHFA 1L1PA 2PV1A 1UR8A 4W9OA 1Q1CA 1HJXA 4WKAA 1NSGA 4LAVA 2DT0A 1D7IA 2LJ4A 3WIJA 2AWGA 3KACA 4XAKA 5HW8A 2DT2A 3WQWA 4DRQA 4Z2GA 1E6PA 4KR0B 1P5QA 2XP3A 4Z2KA 1NWSA 2F23A 1EYMA 1LL4A 3UF8A 4P8WA 3PRDA 3TCZA 1H0GA 3G6MA 2RUCA 4ODMA 1HKMA 4HBEA 5JH8A 3O5LA 1ZBWA 4ODKA 1FKGA 3KAGA 3KADA 3WD3A 1OWQA 1GRJA 3UI4A 2ZQVA 2DPEA 1CTNA 2LPVA 2FDMA 1HXVA 1T11A 5I98A 3W4RA 5HW6A 1FKKA 1Q6IA 4G2PA 1X6NA 1KT0A 4Q7NA 1HKJA 3NTPA 3ARVA 3O5GA 3UI5A 1W1TA 3B9AA 1D6OA 1FD9A 3AS3A 4O2TA 2YBUA 1E15A 1Y0OA 5GPGA 2DSVA 2DT1A 3FAPA 4JFMA 4LAYA 2ZR6A 3KAIA 1E6ZA 3AROA 1XRVA 3MDYB 2DT3A 5J6EA 1FFRA 3O5JA 2D9FA 3ARYA 1W9VA 3JYJA 1PINA 4DWSC 1HJWA 1H0IA 2O92A 3O5DA 4QIBA 1WNOA 2A3EA 4MSPA 2KI3A 1IX5A 2M2AA 3ARTA 2EULA 4NSBA 2MLYA 4GIVA 4ODNA 4ODLA 4DRMA 1Q6UA 4MGVA 5HBFA 3KCEA 2LGOA 4UDMA 3FY1A 1FKIA 3QOKA 3WL0A 2PPPA 1TCOC 2XP5A 1WB0A 2WLZA 4FAPA 4Z2HA 1FKDA 1FKLA 4P8XA 1W1PA 3KAHA 3B8SA 1J4RA 3NI6A 1E6NA 1ROTA 1HJVA 3I6CA 1PBKA 4IT6A 4DWSB 4IPXA 1Q6HA 4JFJA 3ARZA 4N19A 3ARWA 2KR7A 2A3BA 3ARRA 1JNDA 3AS0A 1ZK6A 1JNEA 4G50A 5DIVA 4MNLA 1JVWA 4L3NA 1EHNA 1NH6A 4MTVA 2MLXA 2ZQUA 1FKSA 1LL6A 2WM0A 3CGMA 1YW5A 2WLYA 1LG1A 2ESCA 1N1AA 3TC5A 4J4OA 4W5UA 2KO7A 2MF9A 1W26A 1BL4A 1LL7A 2F4EA 2ZQTA 4DRNA 2PI6A 4W9PA 2ZR5A 3G6LA 1F40A 1W1YA 3PR9A 4HARA 4DROA 5HWCA 1JNSA 4BF8A 1J4HA 1U79A 2PV3A 4J4NA 1W1VA 2G41A 4FN2A 4DZ2A 2ETNA 2FAPA 1WAWA 3O5OA 4DRKA 5DF0A 4DWSA 3KAFA 1W9UA 4TNSA 1QPLA 1FJDA 1K9TA 2VCDA 2AOSA 3GU0A 4WJXA 3CH9A 2RUQA 3O5MA 4DRHA 3WD4A 4S3KA 3H9RB 2KFWA 1D7HA 4WK9A 2K8IA 5HWBA 3EIPA 2OLHA 1TFVA 5BXJA 4IT4A 1FAPA 3B9DA 2XP6A 2L2SA 1A7XA 1QPFA 3WD0A 2PPOA 3O5RA 4PTMA 1XHGA 1ZB5A 1ZBKA 1D7JA 4MPKA 2KE0A 4DRIA 2G8ZA 4DH0A 4IQ2A 2M1IA 2LKNA 2B31A 4DZ3A 5DEZA 1FKBA 3UQAA 2M08A 2DSUA 3BMBA 3ARXA 2MNTA 4GGQA 3UQBA 3IKDA 4DRPA 5D75A 1ZBVA 3KZ7A 2A3AA 3RGCA 4MNJA 2RURA 2F2DA 1O6IA 1HKIA 3B9EA 3RM8A 3CHEA 4ZPWR 1VF8A 4NZCA 5HKGA 2DG4A 3OA5A 2QF8A 2MLZA 3TDBA 2PBCA 1B6CA 4LGXA 1ITXA 3O5QA 2XPBA 4ITZA 4S3JA 2UZ5A 4ZS6A 2O9OA 4U86A 2A3CA 3GPKA 1D2KA 3WL1A 1W9PA 4TX0A 2XP7A 1FKJA 4L72B 4QT2A 4IQCA 4Z2IA 3WD2A 2XPAA 4TW8A 4ML4A 2MPHA 4ODOA 3IHZA 4DRJA 4WKHA 4TW7A 1NWRA 4KQZA 4R5EA 5GQBA 1LQ0A 3O5PA 3ARPA 3WKZA 1YATA 3UI6A 4JFIA 5DIUA 1HKKA 4R0XA 5HTGA 2XP8A 1NWUA 4AY1A 2XP4A 4TYOA 2OFNA 2YBTA 3AQUA 3B7XA 3FXYA 3IK8A 3O5IA 4P8UA 2JZVA 1LG2A 4JFKA 2ITKA 2ZR4A 1RD6A 3O5FA 1FKFA 4MAVA 1ROUA 3ARUA 4DWSD 2DSZA 4ODQA 2FKEA 3VAWA 3O5EA 3ARQA 4DT4A 2Q5AA 4URIA 3OOBA 1J6YA 1ZL1A 2PV2A 4ZPTR 2DG3A 1E9LA 4TW6A 1J4IA 1JCHB 2F21A 4P8VA 3ARSA 2RSEA 1KFWA 4NNRA 3O5KA 4MNMA
chains in the Genus database with same CATH topology
1R9HA 1FKHA 2IF4A 4LAWA 3IKGA 5B8IC 5HUAA 3PRAA 1KT1A 1EDQA 4U84A 3JYMA 1SR0A 4Q22A 5HW7A 2RQSA 3RFWA 5GPRA 5DITA 1UR9A 2ZQSA 3BXWA 3PA7A 1ZBCA 1BKFA 1GPFA 1OGBA 3NRKA 3CHDA 2Y78A 1NWTA 4Z2LA 1M5YA 3RMEA 3CGNA 3CHCA 1F8AB 3PRBA 4LAXA 2WK2A 2PPNA 3ALFA 3CZ8A 2KGJA 4ODPA 5DO2A 4JYSA 4MNKA 1QZ2A 4C02B 2DG9A 1FFQA 2VN1A 4HBOA 3WH0A 3LUOA 4ODRA 1FKTA 1NMVA 3RM9A 4W9QA 1E6RA 3KABA 1LJYA 5HT1A 1EQ3A 4JFLA 1ZU8A 3WQVA 1ZCNA 4ZPVR 3AS2A 4DIPA 4WIWA 4Z2JA 4QT3A 1EIBA 3ODKA 1SYTA 2IUZA 3UQIA 1C9HA 3WD1A 2RUDA 4WKFA 2XP9A 1X6LA 1GUVA 3EY6A 1FKRA 3RM4A 1JNTA 1NMWA 1OGGA 4U85A 2N87A 1GOIA 3ALGA 4QZVB 3JXVA 3AS1A 2DSWA 3CHFA 1L1PA 2PV1A 1UR8A 4W9OA 1Q1CA 1HJXA 4WKAA 1NSGA 4LAVA 2DT0A 1D7IA 2LJ4A 3WIJA 2AWGA 3KACA 4XAKA 5HW8A 2DT2A 3WQWA 4DRQA 4Z2GA 1E6PA 4KR0B 1P5QA 2XP3A 4Z2KA 1NWSA 1EYMA 1LL4A 3UF8A 4P8WA 3PRDA 3TCZA 1H0GA 3G6MA 2RUCA 4ODMA 1HKMA 4HBEA 5JH8A 3O5LA 1ZBWA 4ODKA 1FKGA 3KAGA 3KADA 3WD3A 1OWQA 3UI4A 2ZQVA 2DPEA 1CTNA 2LPVA 2FDMA 1HXVA 1T11A 5I98A 3W4RA 5HW6A 1FKKA 1Q6IA 4G2PA 1X6NA 1KT0A 4Q7NA 1HKJA 3NTPA 3ARVA 3O5GA 3UI5A 1W1TA 3B9AA 1D6OA 1FD9A 3AS3A 4O2TA 2YBUA 1E15A 1Y0OA 5GPGA 2DSVA 2DT1A 3FAPA 4JFMA 4LAYA 2ZR6A 3KAIA 1E6ZA 3AROA 1XRVA 3MDYB 2DT3A 5J6EA 1FFRA 3O5JA 2D9FA 3ARYA 1W9VA 3JYJA 1PINA 4DWSC 1HJWA 1H0IA 2O92A 3O5DA 4QIBA 1WNOA 2A3EA 4MSPA 2KI3A 1IX5A 2M2AA 3ARTA 4NSBA 2MLYA 4GIVA 4ODNA 4ODLA 4DRMA 1Q6UA 4MGVA 5HBFA 3KCEA 2LGOA 3FY1A 1FKIA 3QOKA 3WL0A 2PPPA 1TCOC 2XP5A 1WB0A 2WLZA 4FAPA 4Z2HA 1FKDA 1FKLA 4P8XA 1W1PA 3KAHA 3B8SA 1J4RA 3NI6A 1E6NA 1ROTA 1HJVA 3I6CA 1PBKA 4IT6A 4DWSB 4IPXA 1Q6HA 4JFJA 3ARZA 4N19A 3ARWA 2KR7A 2A3BA 3ARRA 1JNDA 3AS0A 1ZK6A 1JNEA 4G50A 5DIVA 4MNLA 1JVWA 4L3NA 1EHNA 1NH6A 4MTVA 2MLXA 2ZQUA 1FKSA 1LL6A 2WM0A 3CGMA 1YW5A 2WLYA 1LG1A 2ESCA 1N1AA 3TC5A 4J4OA 4W5UA 2KO7A 2MF9A 1W26A 1BL4A 1LL7A 2F4EA 2ZQTA 4DRNA 2PI6A 4W9PA 2ZR5A 3G6LA 1F40A 1W1YA 3PR9A 4HARA 4DROA 5HWCA 1JNSA 4BF8A 1J4HA 1U79A 2PV3A 4J4NA 1W1VA 2G41A 4FN2A 4DZ2A 2FAPA 1WAWA 3O5OA 4DRKA 5DF0A 4DWSA 3KAFA 1W9UA 4TNSA 1QPLA 1FJDA 1K9TA 2VCDA 2AOSA 4WJXA 3CH9A 2RUQA 3O5MA 4DRHA 3WD4A 4S3KA 3H9RB 2KFWA 1D7HA 4WK9A 2K8IA 5HWBA 2OLHA 1TFVA 5BXJA 4IT4A 1FAPA 3B9DA 2XP6A 2L2SA 1A7XA 1QPFA 3WD0A 2PPOA 3O5RA 4PTMA 1XHGA 1ZB5A 1ZBKA 1D7JA 4MPKA 2KE0A 4DRIA 2G8ZA 4DH0A 4IQ2A 2M1IA 2LKNA 2B31A 4DZ3A 5DEZA 1FKBA 3UQAA 2M08A 2DSUA 3ARXA 2MNTA 4GGQA 3UQBA 3IKDA 4DRPA 5D75A 1ZBVA 3KZ7A 2A3AA 3RGCA 4MNJA 2RURA 2F2DA 1O6IA 1HKIA 3B9EA 3RM8A 3CHEA 4ZPWR 1VF8A 4NZCA 5HKGA 2DG4A 3OA5A 2QF8A 2MLZA 3TDBA 2PBCA 1B6CA 4LGXA 1ITXA 3O5QA 2XPBA 4ITZA 4S3JA 2UZ5A 4ZS6A 2O9OA 4U86A 2A3CA 3GPKA 1D2KA 3WL1A 1W9PA 4TX0A 2XP7A 1FKJA 4L72B 4QT2A 4IQCA 4Z2IA 3WD2A 2XPAA 4TW8A 4ML4A 2MPHA 4ODOA 3IHZA 4DRJA 4WKHA 4TW7A 1NWRA 4KQZA 4R5EA 5GQBA 1LQ0A 3O5PA 3ARPA 3WKZA 1YATA 3UI6A 4JFIA 5DIUA 1HKKA 4R0XA 5HTGA 2XP8A 1NWUA 4AY1A 2XP4A 4TYOA 2OFNA 2YBTA 3AQUA 3B7XA 3FXYA 3IK8A 3O5IA 4P8UA 2JZVA 1LG2A 4JFKA 2ITKA 2ZR4A 1RD6A 3O5FA 1FKFA 4MAVA 1ROUA 3ARUA 4DWSD 2DSZA 4ODQA 2FKEA 3VAWA 3O5EA 3ARQA 4DT4A 2Q5AA 4URIA 3OOBA 1J6YA 1ZL1A 2PV2A 4ZPTR 2DG3A 1E9LA 4TW6A 1J4IA 2F21A 4P8VA 3ARSA 2RSEA 1KFWA 4NNRA 3O5KA 4MNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP3 A;  1ZK6 A;  4G50 A;  2RUR A;  1EYM A;  2F2D A;  5DIV A;  1R9H A;  3UF8 A;  1JVW A;  1FKH A;  3PRD A;  2IF4 A;  4LAW A;  3TCZ A;  2MLX A;  3IKG A;  5B8I C;  2ZQU A;  1FKS A;  2RUC A;  4ODM A;  3RGC A;  3CGM A;  1YW5 A;  5HUA A;  3O5L A;  1KT1 A;  5HKG A;  4ODK A;  4U84 A;  2DG4 A;  3JYM A;  1FKG A;  3KAG A;  1N1A A;  3TC5 A;  5HW7 A;  3KAD A;  2RQS A;  2KO7 A;  2MF9 A;  4J4O A;  1W26 A;  1BL4 A;  3RFW A;  3UI4 A;  5DIT A;  2MLZ A;  3TDB A;  2PBC A;  2ZQS A;  3PA7 A;  2ZQV A;  2F4E A;  2ZQT A;  4DRN A;  1BKF A;  1B6C A;  4W9P A;  2ZR5 A;  2LPV A;  1F40 A;  1HXV A;  3NRK A;  3O5Q A;  2Y78 A;  2XPB A;  4ITZ A;  4DRO A;  5HWC A;  1T11 A;  5I98 A;  2UZ5 A;  5HW6 A;  1M5Y A;  1FKK A;  4U86 A;  1JNS A;  1Q6I A;  4G2P A;  3CGN A;  4BF8 A;  3GPK A;  1KT0 A;  1J4H A;  1U79 A;  1F8A B;  2PV3 A;  4J4N A;  4TX0 A;  3NTP A;  2XP7 A;  3PRB A;  4LAX A;  1FKJ A;  3O5G A;  3UI5 A;  4FN2 A;  4DZ2 A;  2PPN A;  1D6O A;  1FD9 A;  4QT2 A;  2KGJ A;  4IQC A;  4O2T A;  4ODP A;  2FAP A;  2XPA A;  4JYS A;  4TW8 A;  2MPH A;  4ODO A;  3IHZ A;  1Y0O A;  3O5O A;  4DRJ A;  4DRK A;  5GPG A;  1QZ2 A;  3KAF A;  4JFM A;  3FAP A;  4TNS A;  1QPL A;  4TW7 A;  4C02 B;  2DG9 A;  1FJD A;  4LAY A;  2ZR6 A;  3KAI A;  2VN1 A;  3WH0 A;  3LUO A;  4ODR A;  1FKT A;  1NMV A;  2VCD A;  3O5P A;  4W9Q A;  3MDY B;  5J6E A;  1YAT A;  3UI6 A;  4JFI A;  3O5J A;  2D9F A;  2RUQ A;  5DIU A;  4R0X A;  3KAB A;  3O5M A;  5HT1 A;  4DRH A;  1EQ3 A;  4JFL A;  5HTG A;  2XP8 A;  1ZCN A;  3JYJ A;  1PIN A;  3H9R B;  2KFW A;  4DIP A;  2XP4 A;  4TYO A;  2OFN A;  1D7H A;  3O5D A;  4QT3 A;  4QIB A;  2K8I A;  5HWB A;  4MSP A;  3ODK A;  2KI3 A;  3UQI A;  3B7X A;  3IK8 A;  3O5I A;  1C9H A;  2M2A A;  2JZV A;  5BXJ A;  1FAP A;  2XP6 A;  2L2S A;  1A7X A;  1QPF A;  2MLY A;  2PPO A;  2ITK A;  4GIV A;  4JFK A;  4ODL A;  4ODN A;  4DRM A;  2RUD A;  1Q6U A;  2ZR4 A;  3O5R A;  1FKF A;  2XP9 A;  3O5F A;  4MGV A;  1ROU A;  3KCE A;  2LGO A;  3EY6 A;  1FKR A;  4ODQ A;  1D7J A;  1FKI A;  1JNT A;  1NMW A;  2FKE A;  4U85 A;  2N87 A;  3VAW A;  2PPP A;  2KE0 A;  3O5E A;  1TCO C;  4DRI A;  4DT4 A;  2Q5A A;  3JXV A;  2XP5 A;  3OOB A;  4DH0 A;  1J6Y A;  4IQ2 A;  4FAP A;  2PV2 A;  1L1P A;  2M1I A;  2PV1 A;  2LKN A;  1FKD A;  1FKL A;  1Q1C A;  2DG3 A;  4W9O A;  4DZ3 A;  4TW6 A;  1FKB A;  1NSG A;  3KAH A;  3UQA A;  1J4R A;  3NI6 A;  4LAV A;  1J4I A;  1ROT A;  3I6C A;  1PBK A;  1D7I A;  2LJ4 A;  2M08 A;  2F21 A;  2AWG A;  2MNT A;  3KAC A;  2RSE A;  4IPX A;  4GGQ A;  5HW8 A;  1Q6H A;  4JFJ A;  3O5K A;  3IKD A;  4NNR A;  4N19 A;  5D75 A;  4DRQ A;  2KR7 A;  4DRP A;  3UQB A;  3KZ7 A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 1R9H A;  1FKH A;  2IF4 A;  4LAW A;  3IKG A;  5B8I C;  2PN0 A;  5HUA A;  3PRA A;  1KT1 A;  1EDQ A;  4U84 A;  3JYM A;  1SR0 A;  4Q22 A;  5HW7 A;  2RQS A;  3RFW A;  5GPR A;  5DIT A;  1UR9 A;  2ZQS A;  3BXW A;  3PA7 A;  1ZBC A;  1BKF A;  1GPF A;  1OGB A;  3NRK A;  3CHD A;  2Y78 A;  1NWT A;  4Z2L A;  1M5Y A;  3RME A;  3CGN A;  3CHC A;  1F8A B;  3PRB A;  4LAX A;  2WK2 A;  2PPN A;  3ALF A;  3CZ8 A;  2KGJ A;  4ODP A;  1E44 A;  5DO2 A;  2B5U B;  4JYS A;  4MNK A;  1QZ2 A;  4C02 B;  2DG9 A;  1FFQ A;  2VN1 A;  4HBO A;  3WH0 A;  3LUO A;  4ODR A;  1FKT A;  1NMV A;  3RM9 A;  4W9Q A;  1E6R A;  3KAB A;  1LJY A;  5HT1 A;  1EQ3 A;  4JFL A;  1ZU8 A;  3GTY X;  3WQV A;  2P4V A;  1ZCN A;  4ZPV R;  3AS2 A;  4DIP A;  4WIW A;  4Z2J A;  4QT3 A;  1EIB A;  3ODK A;  1SYT A;  2IUZ A;  3UQI A;  1C9H A;  3WD1 A;  2RUD A;  4WKF A;  2XP9 A;  1X6L A;  1GUV A;  3EY6 A;  1FKR A;  3RM4 A;  1JNT A;  1NMW A;  1OGG A;  4U85 A;  2N87 A;  1GOI A;  3ALG A;  4QZV B;  3JXV A;  3AS1 A;  2DSW A;  3CHF A;  1L1P A;  2PV1 A;  1UR8 A;  4W9O A;  1Q1C A;  1HJX A;  4WKA A;  1NSG A;  4LAV A;  2DT0 A;  1D7I A;  2LJ4 A;  3WIJ A;  2AWG A;  3KAC A;  4XAK A;  5HW8 A;  2DT2 A;  3WQW A;  4DRQ A;  4Z2G A;  1E6P A;  4KR0 B;  1P5Q A;  2XP3 A;  4Z2K A;  1NWS A;  2F23 A;  1EYM A;  1LL4 A;  3UF8 A;  4P8W A;  3PRD A;  3TCZ A;  1H0G A;  3G6M A;  2RUC A;  4ODM A;  1HKM A;  4HBE A;  5JH8 A;  3O5L A;  1ZBW A;  4ODK A;  1FKG A;  3KAG A;  3KAD A;  3WD3 A;  1OWQ A;  1GRJ A;  3UI4 A;  2ZQV A;  2DPE A;  1CTN A;  2LPV A;  2FDM A;  1HXV A;  1T11 A;  5I98 A;  3W4R A;  5HW6 A;  1FKK A;  1Q6I A;  4G2P A;  1X6N A;  1KT0 A;  4Q7N A;  1HKJ A;  3NTP A;  3ARV A;  3O5G A;  3UI5 A;  1W1T A;  3B9A A;  1D6O A;  1FD9 A;  3AS3 A;  4O2T A;  2YBU A;  1E15 A;  1Y0O A;  5GPG A;  2DSV A;  2DT1 A;  3FAP A;  4JFM A;  4LAY A;  2ZR6 A;  3KAI A;  1E6Z A;  3ARO A;  1XRV A;  3MDY B;  2DT3 A;  5J6E A;  1FFR A;  3O5J A;  2D9F A;  3ARY A;  1W9V A;  3JYJ A;  1PIN A;  4DWS C;  1HJW A;  1H0I A;  2O92 A;  3O5D A;  4QIB A;  1WNO A;  2A3E A;  4MSP A;  2KI3 A;  1IX5 A;  2M2A A;  3ART A;  2EUL A;  4NSB A;  2MLY A;  4GIV A;  4ODN A;  4ODL A;  4DRM A;  1Q6U A;  4MGV A;  5HBF A;  3KCE A;  2LGO A;  4UDM A;  3FY1 A;  1FKI A;  3QOK A;  3WL0 A;  2PPP A;  1TCO C;  2XP5 A;  1WB0 A;  2WLZ A;  4FAP A;  4Z2H A;  1FKD A;  1FKL A;  4P8X A;  1W1P A;  3KAH A;  3B8S A;  1J4R A;  3NI6 A;  1E6N A;  1ROT A;  1HJV A;  3I6C A;  1PBK A;  4IT6 A;  4DWS B;  4IPX A;  1Q6H A;  4JFJ A;  3ARZ A;  4N19 A;  3ARW A;  2KR7 A;  2A3B A;  3ARR A;  1JND A;  3AS0 A;  1ZK6 A;  1JNE A;  4G50 A;  5DIV A;  4MNL A;  1JVW A;  4L3N A;  1EHN A;  1NH6 A;  4MTV A;  2MLX A;  2ZQU A;  1FKS A;  1LL6 A;  2WM0 A;  3CGM A;  1YW5 A;  2WLY A;  1LG1 A;  2ESC A;  1N1A A;  3TC5 A;  4J4O A;  4W5U A;  2KO7 A;  2MF9 A;  1W26 A;  1BL4 A;  1LL7 A;  2F4E A;  2ZQT A;  4DRN A;  2PI6 A;  4W9P A;  2ZR5 A;  3G6L A;  1F40 A;  1W1Y A;  3PR9 A;  4HAR A;  4DRO A;  5HWC A;  1JNS A;  4BF8 A;  1J4H A;  1U79 A;  2PV3 A;  4J4N A;  1W1V A;  2G41 A;  4FN2 A;  4DZ2 A;  2ETN A;  2FAP A;  1WAW A;  3O5O A;  4DRK A;  5DF0 A;  4DWS A;  3KAF A;  1W9U A;  4TNS A;  1QPL A;  1FJD A;  1K9T A;  2VCD A;  2AOS A;  3GU0 A;  4WJX A;  3CH9 A;  2RUQ A;  3O5M A;  4DRH A;  3WD4 A;  4S3K A;  3H9R B;  2KFW A;  1D7H A;  4WK9 A;  2K8I A;  5HWB A;  3EIP A;  2OLH A;  1TFV A;  5BXJ A;  4IT4 A;  1FAP A;  3B9D A;  2XP6 A;  2L2S A;  1A7X A;  1QPF A;  3WD0 A;  2PPO A;  3O5R A;  4PTM A;  1XHG A;  1ZB5 A;  1ZBK A;  1D7J A;  4MPK A;  2KE0 A;  4DRI A;  2G8Z A;  4DH0 A;  4IQ2 A;  2M1I A;  2LKN A;  2B31 A;  4DZ3 A;  5DEZ A;  1FKB A;  3UQA A;  2M08 A;  2DSU A;  3BMB A;  3ARX A;  2MNT A;  4GGQ A;  3UQB A;  3IKD A;  4DRP A;  5D75 A;  1ZBV A;  3KZ7 A;  2A3A A;  3RGC A;  4MNJ A;  2RUR A;  2F2D A;  1O6I A;  1HKI A;  3B9E A;  3RM8 A;  3CHE A;  4ZPW R;  1VF8 A;  4NZC A;  5HKG A;  2DG4 A;  3OA5 A;  2QF8 A;  2MLZ A;  3TDB A;  2PBC A;  1B6C A;  4LGX A;  1ITX A;  3O5Q A;  2XPB A;  4ITZ A;  4S3J A;  2UZ5 A;  4ZS6 A;  2O9O A;  4U86 A;  2A3C A;  3GPK A;  1D2K A;  3WL1 A;  1W9P A;  4TX0 A;  2XP7 A;  1FKJ A;  4L72 B;  4QT2 A;  4IQC A;  4Z2I A;  3WD2 A;  2XPA A;  4TW8 A;  4ML4 A;  2MPH A;  4ODO A;  3IHZ A;  4DRJ A;  4WKH A;  4TW7 A;  1NWR A;  4KQZ A;  4R5E A;  5GQB A;  1LQ0 A;  3O5P A;  3ARP A;  3WKZ A;  1YAT A;  3UI6 A;  4JFI A;  5DIU A;  1HKK A;  4R0X A;  5HTG A;  2XP8 A;  1NWU A;  4AY1 A;  2XP4 A;  4TYO A;  2OFN A;  2YBT A;  3AQU A;  3B7X A;  3FXY A;  3IK8 A;  3O5I A;  4P8U A;  2JZV A;  1LG2 A;  4JFK A;  2ITK A;  2ZR4 A;  1RD6 A;  3O5F A;  1FKF A;  4MAV A;  1ROU A;  3ARU A;  4DWS D;  2DSZ A;  4ODQ A;  2FKE A;  3VAW A;  3O5E A;  3ARQ A;  4DT4 A;  2Q5A A;  4URI A;  3OOB A;  1J6Y A;  1ZL1 A;  2PV2 A;  4ZPT R;  2DG3 A;  1E9L A;  4TW6 A;  1J4I A;  1JCH B;  2F21 A;  4P8V A;  3ARS A;  2RSE A;  1KFW A;  4NNR A;  3O5K A;  4MNM A; 
#chains in the Genus database with same CATH homology
 1R9H A;  1FKH A;  2IF4 A;  4LAW A;  3IKG A;  5B8I C;  5HUA A;  3PRA A;  1KT1 A;  1EDQ A;  4U84 A;  3JYM A;  1SR0 A;  4Q22 A;  5HW7 A;  2RQS A;  3RFW A;  5GPR A;  5DIT A;  1UR9 A;  2ZQS A;  3BXW A;  3PA7 A;  1ZBC A;  1BKF A;  1GPF A;  1OGB A;  3NRK A;  3CHD A;  2Y78 A;  1NWT A;  4Z2L A;  1M5Y A;  3RME A;  3CGN A;  3CHC A;  1F8A B;  3PRB A;  4LAX A;  2WK2 A;  2PPN A;  3ALF A;  3CZ8 A;  2KGJ A;  4ODP A;  5DO2 A;  4JYS A;  4MNK A;  1QZ2 A;  4C02 B;  2DG9 A;  1FFQ A;  2VN1 A;  4HBO A;  3WH0 A;  3LUO A;  4ODR A;  1FKT A;  1NMV A;  3RM9 A;  4W9Q A;  1E6R A;  3KAB A;  1LJY A;  5HT1 A;  1EQ3 A;  4JFL A;  1ZU8 A;  3WQV A;  1ZCN A;  4ZPV R;  3AS2 A;  4DIP A;  4WIW A;  4Z2J A;  4QT3 A;  1EIB A;  3ODK A;  1SYT A;  2IUZ A;  3UQI A;  1C9H A;  3WD1 A;  2RUD A;  4WKF A;  2XP9 A;  1X6L A;  1GUV A;  3EY6 A;  1FKR A;  3RM4 A;  1JNT A;  1NMW A;  1OGG A;  4U85 A;  2N87 A;  1GOI A;  3ALG A;  4QZV B;  3JXV A;  3AS1 A;  2DSW A;  3CHF A;  1L1P A;  2PV1 A;  1UR8 A;  4W9O A;  1Q1C A;  1HJX A;  4WKA A;  1NSG A;  4LAV A;  2DT0 A;  1D7I A;  2LJ4 A;  3WIJ A;  2AWG A;  3KAC A;  4XAK A;  5HW8 A;  2DT2 A;  3WQW A;  4DRQ A;  4Z2G A;  1E6P A;  4KR0 B;  1P5Q A;  2XP3 A;  4Z2K A;  1NWS A;  1EYM A;  1LL4 A;  3UF8 A;  4P8W A;  3PRD A;  3TCZ A;  1H0G A;  3G6M A;  2RUC A;  4ODM A;  1HKM A;  4HBE A;  5JH8 A;  3O5L A;  1ZBW A;  4ODK A;  1FKG A;  3KAG A;  3KAD A;  3WD3 A;  1OWQ A;  3UI4 A;  2ZQV A;  2DPE A;  1CTN A;  2LPV A;  2FDM A;  1HXV A;  1T11 A;  5I98 A;  3W4R A;  5HW6 A;  1FKK A;  1Q6I A;  4G2P A;  1X6N A;  1KT0 A;  4Q7N A;  1HKJ A;  3NTP A;  3ARV A;  3O5G A;  3UI5 A;  1W1T A;  3B9A A;  1D6O A;  1FD9 A;  3AS3 A;  4O2T A;  2YBU A;  1E15 A;  1Y0O A;  5GPG A;  2DSV A;  2DT1 A;  3FAP A;  4JFM A;  4LAY A;  2ZR6 A;  3KAI A;  1E6Z A;  3ARO A;  1XRV A;  3MDY B;  2DT3 A;  5J6E A;  1FFR A;  3O5J A;  2D9F A;  3ARY A;  1W9V A;  3JYJ A;  1PIN A;  4DWS C;  1HJW A;  1H0I A;  2O92 A;  3O5D A;  4QIB A;  1WNO A;  2A3E A;  4MSP A;  2KI3 A;  1IX5 A;  2M2A A;  3ART A;  4NSB A;  2MLY A;  4GIV A;  4ODN A;  4ODL A;  4DRM A;  1Q6U A;  4MGV A;  5HBF A;  3KCE A;  2LGO A;  3FY1 A;  1FKI A;  3QOK A;  3WL0 A;  2PPP A;  1TCO C;  2XP5 A;  1WB0 A;  2WLZ A;  4FAP A;  4Z2H A;  1FKD A;  1FKL A;  4P8X A;  1W1P A;  3KAH A;  3B8S A;  1J4R A;  3NI6 A;  1E6N A;  1ROT A;  1HJV A;  3I6C A;  1PBK A;  4IT6 A;  4DWS B;  4IPX A;  1Q6H A;  4JFJ A;  3ARZ A;  4N19 A;  3ARW A;  2KR7 A;  2A3B A;  3ARR A;  1JND A;  3AS0 A;  1ZK6 A;  1JNE A;  4G50 A;  5DIV A;  4MNL A;  1JVW A;  4L3N A;  1EHN A;  1NH6 A;  4MTV A;  2MLX A;  2ZQU A;  1FKS A;  1LL6 A;  2WM0 A;  3CGM A;  1YW5 A;  2WLY A;  1LG1 A;  2ESC A;  1N1A A;  3TC5 A;  4J4O A;  4W5U A;  2KO7 A;  2MF9 A;  1W26 A;  1BL4 A;  1LL7 A;  2F4E A;  2ZQT A;  4DRN A;  2PI6 A;  4W9P A;  2ZR5 A;  3G6L A;  1F40 A;  1W1Y A;  3PR9 A;  4HAR A;  4DRO A;  5HWC A;  1JNS A;  4BF8 A;  1J4H A;  1U79 A;  2PV3 A;  4J4N A;  1W1V A;  2G41 A;  4FN2 A;  4DZ2 A;  2FAP A;  1WAW A;  3O5O A;  4DRK A;  5DF0 A;  4DWS A;  3KAF A;  1W9U A;  4TNS A;  1QPL A;  1FJD A;  1K9T A;  2VCD A;  2AOS A;  4WJX A;  3CH9 A;  2RUQ A;  3O5M A;  4DRH A;  3WD4 A;  4S3K A;  3H9R B;  2KFW A;  1D7H A;  4WK9 A;  2K8I A;  5HWB A;  2OLH A;  1TFV A;  5BXJ A;  4IT4 A;  1FAP A;  3B9D A;  2XP6 A;  2L2S A;  1A7X A;  1QPF A;  3WD0 A;  2PPO A;  3O5R A;  4PTM A;  1XHG A;  1ZB5 A;  1ZBK A;  1D7J A;  4MPK A;  2KE0 A;  4DRI A;  2G8Z A;  4DH0 A;  4IQ2 A;  2M1I A;  2LKN A;  2B31 A;  4DZ3 A;  5DEZ A;  1FKB A;  3UQA A;  2M08 A;  2DSU A;  3ARX A;  2MNT A;  4GGQ A;  3UQB A;  3IKD A;  4DRP A;  5D75 A;  1ZBV A;  3KZ7 A;  2A3A A;  3RGC A;  4MNJ A;  2RUR A;  2F2D A;  1O6I A;  1HKI A;  3B9E A;  3RM8 A;  3CHE A;  4ZPW R;  1VF8 A;  4NZC A;  5HKG A;  2DG4 A;  3OA5 A;  2QF8 A;  2MLZ A;  3TDB A;  2PBC A;  1B6C A;  4LGX A;  1ITX A;  3O5Q A;  2XPB A;  4ITZ A;  4S3J A;  2UZ5 A;  4ZS6 A;  2O9O A;  4U86 A;  2A3C A;  3GPK A;  1D2K A;  3WL1 A;  1W9P A;  4TX0 A;  2XP7 A;  1FKJ A;  4L72 B;  4QT2 A;  4IQC A;  4Z2I A;  3WD2 A;  2XPA A;  4TW8 A;  4ML4 A;  2MPH A;  4ODO A;  3IHZ A;  4DRJ A;  4WKH A;  4TW7 A;  1NWR A;  4KQZ A;  4R5E A;  5GQB A;  1LQ0 A;  3O5P A;  3ARP A;  3WKZ A;  1YAT A;  3UI6 A;  4JFI A;  5DIU A;  1HKK A;  4R0X A;  5HTG A;  2XP8 A;  1NWU A;  4AY1 A;  2XP4 A;  4TYO A;  2OFN A;  2YBT A;  3AQU A;  3B7X A;  3FXY A;  3IK8 A;  3O5I A;  4P8U A;  2JZV A;  1LG2 A;  4JFK A;  2ITK A;  2ZR4 A;  1RD6 A;  3O5F A;  1FKF A;  4MAV A;  1ROU A;  3ARU A;  4DWS D;  2DSZ A;  4ODQ A;  2FKE A;  3VAW A;  3O5E A;  3ARQ A;  4DT4 A;  2Q5A A;  4URI A;  3OOB A;  1J6Y A;  1ZL1 A;  2PV2 A;  4ZPT R;  2DG3 A;  1E9L A;  4TW6 A;  1J4I A;  2F21 A;  4P8V A;  3ARS A;  2RSE A;  1KFW A;  4NNR A;  3O5K A;  4MNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...