3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
2DWDC 4WFEA 3ABKC 3E8FA 3ZRSA 2X6AA 5E1AC 3ATDA 2H8PC 2HVKC 2AHYA 3T2MA 4XDLA 4MVMA 4UUJC 5BZBA 1ORQC 3SYCA 1OCOC 3K08A 3RW0A 3SPJA 4X88A 3SPGA 2X6BA 2JK5C 4LP8A 1ZWIC 5B1BC 2HVJC 4LBEC 2BOBC 3STLC 3ZJZA 1U4FA 5EC2C 2HFEC 2R9RB 3ABMC 4PA9A 4P30A 4X8AA 4ZBMA 3AUWB 3FB6C 3SYPA 4MVUA 3OR6C 2KB1A 4JTAB 3OUSA 1M56C 2DWEC 3AG3C 4PDLA 4QE9A 3T4DA 1LNQA 4BW5A 2W0FC 3E86A 2Q68A 4H33A 5EBLC 2IH3C 2A0LA 3R65A 4HYOA 5EC1C 5IY5C 2K1EA 4DXWA 3E8HA 3FB7C 2GIXA 4PA7A 4PDRA 4WFFA 4RO2A 2DYSC 4WFHA 3ATBA 3SYAA 4H37A 5CBGA 3AG2C 4MVZA 3UKMA 1XL4A 1S5HC 1OCRC 1QLEC 1K4CC 1OCCC 2DYRC 2WLIB 3F7VC 3LDCA 2WLKA 4JTCB 3HPLC 3K0DA 2Q6AA 2WLIA 3E8BA 4GX0A 3SYOA 1K4DC 2ATKC 3LDDA 1N9PA 3SPIA 4R7CA 3OUFA 3JYCA 4QE7A 4HZ3A 4JTDB 4P9OA 4RUFA 5EK0A 3LUTB 3LDEA 2ITDC 2QTOA 3SPCA 4XDKA 2IH1C 4QNHB 3AT9A 3E8GA 3F5WC 4PDVA 4MVOA 4MTFA 2BOCC 4X89A 3VOUA 1R3JC 4MVQA 4RUEA 3RBZA 3RVZA 3UM7A 3K6NA 3AGWA 5EBMC 3K04A 4MVSA 4PA6A 3PJSK 4MS2A 4G27B 4MSWC 5B1AC 2ITCC 3ATEA 4CBCA 2QKSA 2WLJA 4EKWA 2Q67A 3LNMB 3OR7C 1JVMA 3FB5C 3IFXA 4GX5A 4I9WA 3SPHA 2WLMA 2NLJC 2OCCC 3KG2A 4MTOA 4RAIA 3AG1C 3GB7C 4R6ZA 2EIMC 2WLLA 2X6CA 5J9PC 3ATAA 3T4ZA 3TETA 3WG7C 3AT8A 1XL6A 2HG5C 2WLNA 1R3KC 4GX1A 3K03A 4LCUC 2AHZA 5EBWC 2P7TC 4PA3A 4GX2A 3ATFA 3E83A 4MVRA 2EINC 3ASOC 5CBHA 3F7YC 4PA4A 2E4FA 2A79B 3TCUA 3X2QC 2Q69A 4P9PA 4G28B 4OXSA 2EIJC 5B3SC 4MW8A 4MW3A 3EFFK 4PDMA 2Y69C 1OCZC 4J9YB 2A9HA 3OGCC 1U4EA 1R3LC 1M57C 2ZXWC 2YEVA 2EILC 3K06A 3STZC 4XDJA 3T1CA 4TWKA 4WFGA 4J9ZB 2WLLB 5KUKA 3AG4C 3ABLC 3E89A 3SJQC 4R8CA 3SYQA 3BEHA 4KFMA 1BL8A 1R3IC 1V55C 3FB8C 4R50A 3ASNC 5CBFA 3VSQA 1G4YB 3K0GA 3RVYA 4F4LA 1KKDA 2EIKC 4MTGA 1J95A 3IGAC 1P7BA 2WLHA 1V54C 2ZD9A 2HJFC 4P2ZA 5KUMA
chains in the Genus database with same CATH superfamily
1YG9A 1RFYA 1EVTC 1GJWA 5FW6A 2OXHA 1BQRA 3K1DA 3CIAA 5AUMB 5B5EZ 1D5XA 1NPNA 2QLYA 4YE4L 4CAGA 3QPQD 1T89A 2BIHA 1LQSR 1I8UA 4YDLB 3QEHA 4K07A 3C8HA 3N40P 3LXBA 5FWRA 3HKEA 5GISH 1FNFA 2E47A 2RA1A 3NEEA 2FQEA 2V9TA 3CJHB 1LMIA 1X6NA 4LP5A 1RSOA 4Z0BH 1URIA 1EMTL 1G7PA 2CPCA 2R29L 1QLEL 3HS0A 1FNLA 4FZ1A 2D0HA 4XWGL 5KVFE 3CFEB 4RBPK 4CMHC 2IALB 1WP6A 2VABB 2W9LA 4WTWA 4ZMQA 9PCYA 2Q2LA 1JWUA 3EYVA 2VDLL 5CO1A 3ZHDA 2Q10A 4B9GA 4PP1C 1F4HA 2R1YB 3PHQB 1DJGA 4UVAA 4WI0A 3LN4B 2HX9A 2HVKB 5TF1H 1E9OB 1QX1A 1K5NA 5CBAB 1G7JA 3MRQB 1S5HC 3EJRA 4NHCH 1Y7VA 1TLKA 2RD0A 1MIMH 3DWTA 1AJNA 1MFBL 3BCDA 5FEBA 1V7MH 5IESH 4KMTL 4X1KB 3WO4C 1F0LA 3K5NA 1JF6A 4LSSL 5CS7A 3TBWA 4GBXC 2MMXA 4AW4A 1MG3C 1R46A 1SXCA 4GEIA 2FJSA 3HB3B 1JPSL 1KOAA 3AREB 2GBUA 4OT1H 2BOCA 2GTWA 1I75A 1X4ZA 2E6JA 3L5JA 1MFUA 3MLWL 1UWGH 4HIEA 5A6MA 1G6RB 1D5BB 1A7PH 1W72B 1CWVA 2DM7A 4MB5A 4NCC2 5HDLA 3JYBA 2BNRE 2EYRA 3S35L 2OK0L 2QWRB 3WHE0 3RJQB 5GTIZ 4Y2DA 1CYXA 1CE1H 4QTIL 4AQEB 3EGSA 2ETWA 4K5NA 2VR3A 1GZHA 3HC0B 3L7EA 3LTVA 3MBEA 1FP5A 3IMWA 3A67H 3GB7A 5HHME 3V4VA 5DFWH 1M7XA 1DJHA 1EDHA 4XRCB 4HKZB 5I5MA 2AITA 1GKFA 2FYYA 4K73A 3VX1A 3Q8CA 2CDFB 3WIHH 4GKJB 5ISZE 2P5OA 2NCMA 3BFWA 4K71C 1GS8A 3ML0A 3P3YA 2DLTA 2DLGA 3OJ2C 3LEVL 1WF5A 2GTZB 3JD1A 2G60L 1RPUA 5E2UL 1O6SA 2N56A 4MA8H 4NQED 3A3YB 1ZD6A 3MBXL 2JRIA 3UROR 5J8OA 4D8OA 5IKCA 3MUY1 1I1YA 4F7EA 1A7RH 2AJSL 1LK3H 3B40A 1KNOB 2XWZA 2GVYA 3OTOO 1HH9A 2Y7NA 2O61A 3L3OC 1JFQH 1FPOA 2CIIA 1VFBA 1G7QA 4G7SB 4NXSA 1IGTA 3RGHA 3LVEA 4EB6A 4JFXA 3HZMA 5ERWA 4JEGB 1K33A 4JYAB 4DVRL 2ZOLA 3BHPA 3OKDB 1T5WB 5KAQF 1JPFB 4FAAB 3VQ1C 1O5PA 5CGBA 2TRHA 1H15B 1N5AA 1UZ8B 5KYYA 5FO7A 4BEIA 4OX9B 4FMKA 5LMNB 4P2OB 2V3EA 2ZINA 4PP2B 3PWLA 4JV5O 4TSCH 4A37A 4NQVA 5E0FA 1JP5A 5JORA 1NS1A 1AR5A 3CXHF 1FYTB 1NGWA 5EU7E 5AYUH 3UMNA 5E1QA 2NY0D 4QRPB 3IFOA 5C6TH 4XAKD 3SO3C 2HJLB 4HS6A 4ZW3A 1SJEB 2P80D 4ABVA 2PR9A 4JO4H 4PYHA 1DFXA 3ISYA 5DJDA 4TLTA 3O2VL 2E74B 4NZTL 2OJZH 1CICB 3DX0A 4JY4A 1AP5A 1KLFB 2MNWA 2APVA 2PZSA 3K2KA 5C0ND 4YXKH 4P23C 5IJ9B 1MWAA 2F9BT 4B9PA 1VKXB 2ATKC 1X5GA 3OAUL 4DV7B 4YSPA 1R5IA 4FCAA 3TN0B 4PBVC 2MKLC 4JKPL 3MLZH 4RNRB 1S7XA 4YOKA 1J8SA 1E50A 3RPIA 5KS9A 1OHQA 1TTRA 4F2MB 1HILA 2Z7ZA 1KN4L 3EO9L 4I7ZB 5KSBF 5GJTL 2IWKA 5JXED 1C08B 2WM0A 1NIDA 3IAGC 1FJGB 2BP8A 4Y4FC 2C26A 5ICXA 1BFOA 1CFQA 1ADQA 4UDTB 4LNUA 5FM4A 5CD5C 4LRIC 4DR2O 2YA2A 1EZVY 4P9MH 3QXDB 4RMUA 5G4NA 2PLTA 4N0CD 5F7BA 4ELMF 5L4MA 1B4LA 4GUNA 1EFXA 3MUZ1 1QNMA 1TAEA 3BT0A 1F8TL 1EGJA 1GOHA 3RGVA 5ALBH 5EOCH 4DK6A 2AXGB 1YF2A 4E36A 2J8UA 4S1QH 3M99B 4JFQB 3TCUA 1XZ0A 1NCIA 1JFFA 1I5YA 3I6GA 3X1GA 3WTTA 1W80A 4HS8L 4X1IB 2BP0B 1BYNA 2GI0A 1VZIA 1DVFD 3B8YA 2KPWA 2XN9B 2Z4TA 3PABA 1A6PA 2WLZA 3WKPA 4OLEA 4I50A 2XC8A 3AQZA 2ZUSA 5E99L 1I7RB 1U3HA 3Q2NA 3ILPA 1EA9C 2EIMB 5KVDL 5I1KL 1JGIA 4LQFH 1DVZA 4EUPB 1D2PA 2EVFA 4XBPB 1SJXA 2PCYA 4AV4A 1TZHA 4EDXA 5J13C 3HKBB 2A38A 5FNVB 1QRKA 4R84A 3EO1A 4WFED 4G1EB 3FTYA 4YAQB 5DJCB 4ZYKB 3WENA 1WA0X 2Z4QB 3PV6B 4P5MA 3QG6A 2KKQA 1XGTB 1I7UB 4H2AA 1QABA 1DQDH 4KQ3L 4CNIB 3QNZB 2WIMA 1R19A 5F89A 2O5XH 2WO3B 3M46A 3MO1B 3QRGL 4S1DC 3MV8A 4H7VA 1IBGH 2WLYA 3C5JA 1T04B 4XCCL 1N3NB 3LV3B 1JYNA 2KC0A 4LCVA 4IYHA 1HE8A 1ZANH 4R3SA 3MV7E 4JJ5B 4J3OD 4DPCX 3NBNA 3B3IA 3CPLA 1ORSA 4FI6A 1KU9A 5I1EL 2EDFA 4DN4H 1PAZA 3U0TB 1ZSHA 5HVHC 1ADWA 4Y4KA 1JUFB 3UTSA 1GGYA 2H8PB 4M43L 5EC1A 6PAZA 4L4VD 3HNTL 2X0UA 3ETTA 5EG6C 1OCOB 3FSAA 4U4BA 5EDSA 3F85A 3QO5A 4ZMWA 1A6AB 1QYGL 1GAFL 3QDMD 1MABG 2VUKA 1GSKA 3MV8E 3T4AA 1UH2A 3NT0A 3QO0A 1QZ1A 4UBDD 5A7EA 3HEIB 1MQKH 1U2CA 1QLNA 4KTDL 2I85A 5T1JA 4R96A 4HXAL 3GHBL 1IGFL 4MQTB 4J8RA 3RVTC 4MDIB 4JFFA 4PVBA 4N9OB 1BXAA 2IAMD 1WK0A 1VA9A 3IMTA 4QHLA 4QTHA 1NEPA 2AJVH 1QRNA 5J89A 5JW3H 1YN6A 4LF3B 5FYJD 2AF2A 4DR1O 1YAIA 3UTSE 1RUKL 2IMMA 4ZDHA 2CTWA 1NAMA 1XWVA 4UNTA 3ZKNC 5C2BH 3QTCA 3PGCA 1AO7E 1TNMA 4R0LB 5F9OL 3N42B 5M7QA 4PJEA 2R0WL 3T1FB 1F2XK 3KZ8A 1QQDB 5I0WA 4OCNC 2YHGA 4CW1A 3V9CA 4NQQA 5LHGA 2LLNA 3EYQC 1QO3A 3P11H 3E9UA 4JFEB 2OSWA 2WVVB 3FQ1A 4YHNB 2OR8A 2CH7A 3QQ4B 4LMQI 2VZUA 4U3JB 4HUNB 5KVEE 3DMMB 2BVUA 1DLHB 3FS9A 4DWHA 1R3KA 3CSTA 5GGTL 1GN4A 4BWTA 4JFFE 3VJ6A 3MCLL 4ESKA 5A1AA 5A6IA 3COOA 3UABA 5FCUL 3OKKB 3ORJA 4M56A 1D5NA 4PJ8B 3FMGL 2LFEA 2C5DC 3FQ4A 4YHMH 3N2JA 1NI8A 4AZUA 3O65A 1GMIA 1EEYB 4YHKH 5MENB 1BJMA 4H0LB 5KVFH 1E1QG 2P24B 5HI3C 5JNYA 2IGTA 2GJ6B 2W92A 1R73A 4R8CA 3ARDA 3BEHA 3H42H 5HFMA 1ACYL 1CK0H 4UQ2A 5AAWC 4OV5B 4P4KB 5KYWA 1KULA 4FFYH 1QMUA 4YPGB 1R3HA 3KHOA 3GLZA 4AE0A 2K9PA 5DUPL 4J3OF 3HMWH 1PEZA 4FQQA 2Z91B 3FT9A 2ED8A 5BRZD 1CLYL 3ZE0E 1YZZA 3QZBA 5JIHA 4AEHL 1T21A 3TJEH 2GHWB 2XETA 3B56A 1ES0B 3FSWA 3TBBA 5I1HH 2I9TA 2EINB 2Y36L 1ORQC 3VWKD 5HDQL 5EF2A 4JKMA 3ARFD 4QLRA 1QLRB 4RMVA 3DGDA 3SCMC 4WTZG 2X4SB 1N70A 4AEIH 4FMTA 3ZJZA 1F11A 3EYFB 2IOMA 1FAIL 3WJLA 5AAPA 3RDJA 5ADPH 2WZAA 3N9GH 4HLJA 3PP4H 3BP7B 4GH7B 3RVUD 1HINH 3H4HA 2XWBA 4ODSH 3VRJB 3KW8A 4UYPA 4X9FA 3GSNB 4WFAV 3ZIAG 2W0FC 1PX8A 2VR7A 4LF7O 3BA8A 4LVOC 4MVBD 2PGGA 1EJ8A 4BIOA 5J2TB 1YSOA 4CILA 1WFMA 3MSPA 1FXHA 2GTAA 1O9GA 5JDJA 4YX2H 1AROP 2Q7YB 3MXVL 1EBAA 4KPHH 1DUZA 2PABA 1OTTC 4MXVE 1K6QH 2HMIC 4PBWD 2ZAIA 3NOIA 4G6ML 4JY6B 1OAZH 3OPZL 4M1GH 1ZHNA 2F61A 2CRYA 1CIUA 1GYCA 2WWMD 5TFSH 4NYLA 4H13B 2E7HA 2EDKA 4PGEB 4AENA 4LBEA 4P99A 2A6KA 4UILL 4PVLA 3FQ2A 5K9JH 1JZ5A 2BP3A 1KCUH 3BFRA 1BMZA 4F3FB 4MVOA 3U10A 2D0FA 3N50A 4KROB 4K3AA 4NENA 5HPMA 4LF8O 3KH4A 1ZVYA 3EOTH 5E23A 2BY1A 4FFBB 3VSVA 5T33L 4KTEL 4X8JB 3JASA 3O4LA 5CZVL 4EXPX 3OWEA 4ANXA 1DJXA 3DIFB 1B4JL 4J2XA 4N2HA 3UBGA 3NA4A 4V1DD 3V4VH 1WE5A 1T1ZA 4YJ2A 4NYKA 3K71B 1WLHA 4ZOLA 1HT6A 2BCKB 4RMRA 3RNQA 1R1CA 3DHMA 3GSQA 4Y1AE 3IDUA 2ICEC 5H4ZA 4JANA 4JI7O 3AS1A 4BZ2L 2FQFA 5F9DC 2Z31D 2GQHA 2Y2WA 3B34A 1YTFB 5T3XL 1XHXA 2DBLL 3O9WB 5EWIH 3CBRA 3MC0A 1L6PA 3L74H 1ZT1B 4P07A 4X7TB 2EO7A 1UENA 2D2CB 4QRBA 5ILTH 1BQ5A 4NSKB 1X6LA 1Z5VA 3CN2A 3FOMA 3ESNA 4KQ4H 3IXTA 1YC7A 1KYUA 4IEFA 3MDSA 3SKJL 1BZDA 4N68A 5CP3H 1NMCB 2ZR3A 3FRUB 4YHHO 2DJ4A 4K3GA 2QWQB 1X7QA 2XZAL 3T0XA 1DCLA 3M1BA 1SY6H 1NLDL 3L2LA 1QFWM 3SHSA 3IC7A 2AEQL 3VXSB 4P2QA 5CB4B 2F95B 1ZL8A 4WK0B 2LW7A 3BISA 2I07A 2XWEA 3GZOA 3M88A 3CH1B 2YD4A 3QPQC 4Y5VA 4Z95L 1CG9A 3N41B 3HR5B 43CAB 2H32B 4Z7WE 3WOVA 1QA9B 1XNRB 1ZHKA 4M7LH 4I55A 3W56A 4PJBA 2CUIA 4FOMA 4PRNB 1R17A 4PVNA 3MRBA 5DA4A 1PGRB 3WS3A 2VCOA 4ODVL 2OT5A 3BDBA 4K3JL 3SJVD 1XZWA 2VMDA 4BKTC 2JK5A 5AW7B 3MCG1 3WUWG 2AABL 2Z35A 3DOSA 3EFFB 3CWBH 1ZOXA 4R4NC 4G5AA 4N8VA 3CQQA 1CLZL 4RAHA 1D5RA 2HT3C 2PWHA 3CFTA 4M5ZL 5E2WH 3AS2A 2WPDG 4C57C 1WZMA 3E86A 3ZHQA 2WBJB 4P2QE 2I9LA 3MGOB 1I8LA 1P1ZB 1FNHA 1T0NB 2CKBB 4LHUD 3A0RA 1BQHA 4WZ9A 5IDJA 1MWAH 1V3LA 2XBZA 4K7PY 2ILLA 5ACZA 3QRFM 1T7YA 3TGUH 3PJLA 5C9KA 3G5VB 3L3GB 5TGBB 4G43A 3SYOA 2YICA 1OM9A 4Z7VA 1YNTA 5TPWH 3SGDH 4GOSA 4B5EA 5CILH 3PQYB 2KMWA 1AVMA 1AR1B 1V7NL 3LKSB 2OMXA 4NQDD 5D7KE 4RQFA 5GQBA 2JLPA 4U6HA 4Z1VA 1LR1A 1DANT 3HG3A 5C09D 5LXGL 5E9AA 4PI2A 4LVHB 7CGTA 5I1IL 2FO4A 3FYIB 3QIWB 3X1NA 1YEEL 1KTDB 3M45A 5I2IB 3ZHTA 1ACXA 1KPVA 3EBGA 3U82B 3FTZA 3CVHB 3MLZL 4YEFA 3C2SA 3ZZLA 4KHPO 2WNWA 3UCQA 1VPOL 3D30A 5E5RB 3KLLA 5TDOA 3UPAA 5H35A 2F58H 1MFDL 1GYUA 4M8UA 4PB0L 3FFDA 1EEZB 3CBKB 5CR8A 1CFSB 3LZLA 4FNTA 2CA4A 1KFAH 2YPLA 4IHOA 4KP4A 2R29A 1YYMH 3SE9L 5KVGL 5J1TC 3PWJA 1A7NH 4GYBA 4LL1A 2EDLA 3WLBA 5C0AA 5LOVA 4K0KO 1RJYA 4KI5D 4AXWA 4AMKL 4Q0XH 1L3WA 1NCCH 4JFWA 3NN8A 1WWCA 2OBGA 4N2LA 3F7YA 5EA0H 5ETUA 4HWEL 4Z7NB 2Z3YA 1EEUA 1MCFA 1Q82W 1CDBA 5JWPA 5AYQA 3D7PA 3T1YO 4H26A 2QSQA 2N1TE 3GKWL 3H1IH 1QFOA 3ZKXB 4BSVB 2OJEB 3L8QA 4WFGA 1Z3GH 4ZXBA 5KBMA 3CDGA 3JVGA 4KDWA 3U0PA 3NTCH 5LNEA 2K6WA 2H94A 2F5AL 4WU7B 1RK1B 5E94B 3ZRXA 3CFDB 4WUUE 4IBSA 1K34A 4DV2B 2ORBL 1NBYA 3CLFH 5C0AE 4B7LA 4DGIH 4JO1H 4JZNA 2WSDA 4PCTA 5EEUA 3TZVD 5LXVA 4DPBX 3BMWA 4PJGA 3BVDB 3MYJB 1FGNH 3LQMA 3ZY7A 4DKEH 2B1HH 4N22A 4HK3N 2W8CA 3ZE2B 3RA7L 4DZBA 2VDKH 2YMXH 4FNLH 3H2WA 3ZL1A 3ZKSD 2VDNL 1U4FA 3PNWA 2R23B 3OGCB 1B0WA 3QDJE 2NN4A 2PYFA 3UJIL 5J3HD 1F3JA 4LSRH 4KZDH 2J1KA 4FULA 1P6FA 5EC2A 2NY0C 3LQZA 4DGVL 3AJ7A 4X6CF 2X0LA 1SF3A 3QQNA 5BW7C 3R4DA 1TUBA 4N2NA 5CCKL 4PB9H 3CSYA 1OSYA 2BWQA 1TCRB 3POCA 3Q1EA 1VGKA 2QSCH 4W81A 4P2AA 32C2B 2X4RB 4L4TD 2HPTA 1JZ2A 3WU2Z 1FSKC 3UEQA 2YQGA 5JUEL 1ZLUH 2HYMA 4WFHA 3U4BL 3FAWA 1ZANL 1AGCB 4KHXH 4H37A 3LEYL 4Z0XB 1GA2A 1AFVL 4L9LC 2CBMA 4GAFB 4M6AA 4YSUA 1NL0L 3ARBB 1QFWI 1NUDA 4Z3FA 5DEFA 4TSBH 5LO7A 5TE6H 5KVEH 3F12B 1T1YA 4XCYA 4LPTA 1SA0B 1AHMA 2IV8A 2OMWA 5IF0B 3ZDZE 5FR3A 3Q8BA 4I0PA 3STLB 3PWUB 3QQDA 3VXPA 4MJJA 4F93B 4DYLA 1A0QL 1RU9H 2ATKB 1BREA 1N36B 4HJGA 4AH2A 4ZS6C 5IB1B 1HCZA 4QHNB 1Y1DA 4KI5F 5HGDB 3ULSB 1Q8IA 1VEOA 4UTAL 5L8LB 4BKLA 4WFHE 2D73A 4N0CC 4YWGH 5GS0L 4XP1H 3ZHVA 2X4NA 2BE3A 1FL6B 3CTTA 4Y4FB 3SPHA 1RH8A 4OGAD 4D0CA 2WLMA 2FSDA 2H1PH 4Y2OB 1K8AW 4KO5A 3CJJA 3AC0A 5JDSB 2RCVA 3ZN0A 1I8KA 1SOSA 2NZIA 1PD3A 2UY6A 4PJ9D 1M2VA 4EF3A 3JQOB 4P49A 4BWWA 4NHUA 4EI5D 1Y74B 4X0NA 5L4JA 3S9DB 1WFNA 3LNDA 1DVFC 3U4EB 2EDJA 2KERA 2CIKB 1ZCRA 2X4TA 4U1GC 1GJIA 3AROA 1MUJB 5D7IA 1YNLH 1WC7A 3DX9A 1KXQE 1A9BB 1UOWA 4LSDA 1D7FA 1I7ZA 4OZ4A 2MQCA 4BFBD 1U4EA 4HW6A 5EBMA 5FUCE 4RA0C 3R7RA 3W5NA 2Y7QA 5A16B 1M1XA 5JO5A 4G8GA 3D39B 1R3LA 1TUEB 5IVOA 2JQAA 3W81A 4WNSA 4HGKC 1QR1A 1DO5A 4XNZB 3NZHH 2IQ9L 3FCBA 1D3CA 4UAOB 3VQWA 5I74C 1JRHI 4WFFE 5I76A 3ZZ1A 1R33A 4K8RD 1YMMB 2FNBA 3APNA 3ATDA 5L88H 4M61A 3T2MA 1OL0A 3GNMH 4FM0A 4XPBH 2L8AA 4YHPB 2A77L 3PGFH 1QTPA 2Z65C 1LD9B 4I0XA 2PWEA 2XWXA 3EG9B 1N0JA 4Y16B 3ZO0A 5C3IA 3K9SA 4W9FC 1FO0H 5B1BC 4R7DB 3VXME 2NR6A 3MRHA 1RZKH 4J3OC 2ICWB 4ZUUA 4XMPL 2H47C 4BK8A 3KLAB 3CD4A 4G8GE 4AMXA 3NZ8B 1NCOA 4CS2A 2QQLH 1VZGA 1USQA 2VIRA 3U9PL 1KCWA 2X7LB 1AZRA 1ZXKA 3T3PE 2WSSG 3T65B 1UM5H 4PJ5A 5D7JD 3WFHA 5E4IA 3BPOB 4ZFZB 2HTKD 3KJ4C 1TU2B 1EK3A 5EBLA 3EHBB 3T0AA 3VI3A 3HE6D 3D2UD 4PIRF 1T0MA 4MA3B 3EYOA 4HHAB 2XI9A 1AZZC 4KK5D 5DRNA 5I8EB 3ALXA 2P49B 4E41B 3C9NB 3SJBC 5GS1A 1C5BL 1HNGA 1KFGA 3ZUNC 1DUYB 3P77A 2D7NA 2IAMC 3K2UL 4XNYH 4PJXA 3MMEA 1SXAA 2ITDC 5E6IA 5DDHA 3GUTB 1Q9KA 3FQXA 2I25N 1T1WA 3RU8H 3TWCL 4UT9L 4DP4X 3CZFA 4M6OL 1AS8A 2XZCL 4PJ5E 3TIDB 4DEUA 1NJIW 3B09A 4IW4C 4X99A 4Y9BA 1I1AD 5D70H 4A67A 2E5EA 4GSXA 1A4JB 2DW5A 3FUFA 3P54A 3BAEH 1PD1A 3QUMA 1KIQB 1MJ8H 1UQSB 2VLLA 1TJGH 2ITCA 1FUNA 3W7UA 1GAXA 4ZMAT 4EZLA 3FN3A 3QP3A 1O9ZA 3VTMA 1ZKAA 1I85C 4IJ3C 3BY6A 3QF7A 2WINB 4OV6F 5T1MA 1MCIA 5TE4H 3VU2A 4JI3O 1E4WL 1T2XA 2V2TA 3OWRA 4G6JL 4MVRA 4X62B 2EBOA 1YHPA 2PXYA 3QZWB 4Q20A 1YPZB 4PJ7F 5IB3A 3O8XD 4PTTA 2V4LA 4RMSA 5CMAA 2AXJA 1PLBA 4K3DH 3TEWA 2OIGA 3D0VB 2BX5A 4KXRA 3Q7JA 3EIFA 4HK3J 3HZYA 4MSWB 3MLUL 1JNNL 3W7SA 5FM5O 1MHPH 1CLVA 2VISB 1PD0A 3HE7C 5D1XD 5FYKU 3L08A 4J6RL 3ABLC 3PDDA 5IM7A 1GL4B 3WB1A 3GRWA 4C4BA 4IBYA 4WEBL 1E4JA 2EDOA 5AB2A 1ZSDB 1TTGA 3LXUX 5E2TH 5DI8A 4MYPA 3VWKC 3QDGE 3WDHA 3LKNA 3CC5B 2BVOB 3ZMTA 1DN2A 1JTOA 4K4KA 1XNQO 4XP9L 1SJVA 3FUJA 5F7DB 1CTMA 4ZAKC 4KWUA 2EIBA 3HNSL 5DJAB 1U30A 2DMKA 4HX1A 4YBQD 25C8H 2G3MA 1UJWB 2D3LA 1HI6A 3RGBA 4JFHD 2CCVA 1SVZA 1IM9A 3HS9A 4KVNH 3IMRA 4LLAA 3UBFA 3D4YA 4GJTB 4F6EA 4YGVA 5BJTB 2VLKB 4WCYL 4FI8A 5CUSH 1UCBL 5ITFB 5IHWA 3HBPA 4BELD 4XNMB 1MLCB 3I02B 2COQA 1Y6KR 4WKXA 1HQ4B 5ESQA 2IU0A 4OQ1A 3HUJF 1V5JA 3FB8B 4JCWA 3TEZA 2JXMB 2Y72A 5EU6A 2Z1KA 5AW6B 5GGTA 3PHOA 3EF7A 4NKQB 3IGAB 5FHBL 2QTEA 4RQQB 4H88H 4JGMA 4TV8A 5E2WL 1E27A 3S88L 3WYRA 1JN6A 2K7QA 2VC2B 3RVWC 2DQDH 2AZUA 1LHZA 2WWMC 2C3GA 3ARGA 2DB8A 5AD0B 1WD8A 4Z7IA 1A6TB 1EH9A 3EFDL 2CLVA 3T0WA 2XRAL 1ZWIA 2PO6B 2C7UB 2B9ZA 2QGEA 4PN6A 2W07B 2CCLA 1UM6L 5D5ME 3UJJL 1TQCC 2JIZG 1FAKT 4CDGC 5IVNA 2IXQB 3NFSL 3PF2A 1PF3A 3VVWA 2OMVA 3JAKA 3DO7A 4PDVA 4UM9D 4QJ3B 4QAMB 5CBEB 4WDIB 4MVQA 2XTJD 1ZLUK 3RBZA 2G4GA 4JI0O 3WXVH 1GY1A 5DT1H 5D1ZC 1GGCL 3IMBA 5L0QB 3H8NA 2J1WA 1WT5A 3QWRD 1FKAO 3N2GB 2F54B 4QHUA 5JR1L 1U3JA 3VFWB 1WZLA 1EWHA 1XO8A 3N0AA 5FDWB 4JFZH 2XKUA 1A6ZB 4JPKL 5K9OA 3LD8B 4JQXC 3P32A 3WIFB 1T4WA 3L5WB 2Z31C 4MJ6B 3SDDA 5AW9B 4H4NA 1T2QH 5DK0B 3IKKA 4HK0B 4UF7C 2PF6A 2YXVA 4ZJ9A 5CZKA 4HAMA 1KKCA 1KBHA 1I82A 2VUOA 3K6DA 1ZXQA 3GMOA 1SN0A 5AALA 1H2GA 1P84F 2ICEB 1FAFA 5LYJB 3FTXA 4UCFA 4F8OA 3BP4B 3KPRA 3RWCA 1N5YL 3BIAX 3GLAA 3ZRWA 1I9IL 1MRDH 1QBLL 1PNDA 2D7MA 1M7DB 2P8PA 5FB8B 3QIUD 1VENA 1KLUB 12E8H 3DTUB 2FX7L 1JZ3A 4Z76B 4IM8A 3AU0A 1MWOA 2IWEA 2PUQT 4RISH 5I15L 3O4OC 5I18L 4NJAL 2YWYA 1H2LA 4Q0XL 2F53A 4DNLA 3A0OA 2JKIS 1LGVA 1FNAA 2GYSA 2A83A 3WIIL 1AZBA 3H0TB 4TQIA 3UAJD 4IK7A 3QO1B 2B1AL 2FEJA 5F97E 4XVJL 1LO4H 4JRXE 3KPRE 2BDNH 5H2BA 1CFNB 4X64O 1HNWB 4BSJA 1JGDB 1Z9SB 2HAZA 2XUWA 4PGBB 4K3EL 1TJHH 5SV3A 5LCVL 2EZOA 1XH3B 3V0WL 3LSUA 2O5ZH 3PHQA 4HALA 3ZTEA 1F4MA 3LN4A 2HVKA 2LJ2A 1Q38A 2FZ3A 2P4KA 2O1AA 4F8QA 4HJ0D 2DOCA 2N7AA 2YFOA 4H8PA 2HFEC 5HHNB 2QA4V 1USZA 4XN1A 4HV8B 4M93B 5CLXA 4JTAB 4I8DA 4S2SB 1NUFA 2X09A 1J1PL 5SX5H 4KAQH 2QWPB 4X1KA 1DVTA 3SDYL 1WBYB 4TTGA 4DEWA 3IN0A 4HF5H 2A3QA 1WISA 2O30A 3IWVA 3MRKB 4BA0A 4WHCA 1SRYA 5EEYA 3QCTH 3WNLA 1PYWA 5ITZB 5DMKB 5T1KB 4POYA 2AV7B 3AREA 3OG4B 1XTLA 4M5TA 3VU1A 1P4UA 3IU3B 2MNJB 1Y18B 2YD3A 1HDJA 2VZSA 1S78D 2QADD 3MRCB 1OQOA 3B4NA 2BJML 2HB0A 2LAAA 2Y0SA 4JO2L 5D93C 3IPFA 1RZGB 1KB5B 1A7OL 1PS3A 3NXSA 1AZVA 3QQXA 2YXLA 3QHFH 4TULL 4P5TA 2HVJB 2BOBB 4XMWA 3JBG7 5A2CA 2YI9A 2GUZA 4QE7A 2W95A 4PRPB 3PAZA 4Z77B 4XRCA 2NTSP 4HKZA 5IVXB 1U8JB 2HKFH 4O51B 5FECB 1MFAH 1YEGL 5F9AC 2WTRB 3EGXB 2CDFA 3T0VA 4OFPA 3ULVE 4WK4B 2WQ8A 1NBVL 5I6LA 3TCXA 1G7IB 3K8MA 5LJYH 3R7QA 3CCJV 5LGKA 1J1XH 4IKJA 2H3KA 4YO0B 3UC0H 2FEDD 3DBSA 1WG3A 3HHMA 1EHKB 4I77L 5I1JH 3BUTA 4KI5C 3HI1B 2OZ4L 2ZYIA 3BWUF 4YWGL 4YBHA 4LCUC 5DK2B 2H1PL 1UOVA 1KNOA 1AZNA 2IOIA 5JHBA 3KS0J 3P30L 2J1YA 5DD0H 5GRVK 3IJSB 4ATWA 5DRXB 1RQ5A 1EN6A 4RFNC 4ACPA 5TK4A 2FLBT 2EH7H 5D96C 1L0YA 2YD9A 4G82A 1GH6A 4P0DA 2XU9A 4V11A 3ZK0A 1QP1A 3SOBL 4AWJC 2NX5B 1T5WA 3HI6H 2H45A 3OKDA 4K55A 4LSUL 2TSAA 1JPFA 5TDNA 3V9EA 3NGBB 3WKNA 2F4VO 1HOCB 3DPDA 1UZ8A 5J7CC 2FWOA 4P2OA 4I5SA 4PP2A 1HC1A 2QKAA 2WKOA 3TZVC 1JIBA 1I1FB 5DVNA 1HEZB 4L87A 2R56H 4HJ1A 5EIIB 3TFBA 3SY0A 1XBLA 1NC2D 2YKLH 1AHWA 1GYVA 5T5FL 3TT3L 4ZKIA 2ZXCA 1RSFA 1SJEA 1XIWC 3NZHL 3U4KA 2Q4PA 1FXKA 2FTAA 4RGOL 2M8XA 3DPBB 2Z6FA 3H4FA 1UVQA 1XGYL 1KLFA 4X8AA 1T7ZA 3MJWA 4RMTA 3FB6C 1CU4H 4WIQA 3G6AA 3CFMA 4RRPM 1QBMH 4WI8A 2CUGA 1FFTB 3BZEB 4NUQA 1OW0A 2NY0B 5DZJA 1E42A 3TN0A 2BVQB 2Z8VC 4GAYA 1DVQA 4U6XA 4JFOB 3RPKA 1WAAF 3L3JB 3TJHD 4WWKC 5H8DA 1UCTA 4F2MA 1FYTE 1WIOA 2EYTA 1SZTA 5AVTB 3VFMA 4BHUI 3WFDH 4BM7A 4QRPE 2LQTA 1R47A 1FSKB 5CHNB 4BCYA 3R8QA 4NPKA 1AR4A 1VFUA 5FUZH 3TXAA 3NSCA 2WA4A 4PPTA 4UDTA 4JG1L 3UBXB 1LWRA 3LDCA 1INDH 2X89A 3D06A 4UQ3B 3MJ9H 1VACA 3QXDA 5HDRA 4DJMA 1EO7A 4DQOL 3FFCD 4MQXD 5DJ8A 4UZSA 2IH1C 4IOFC 3VG0H 2W80C 3C5ZB 3L9EA 2APWA 1AJPA 4JB9H 2GJPA 3K79A 2CM6A 2PF4E 1TT6A 1I7FA 3D33A 1Q0XL 3PY9A 4NXNO 3QUMH 2CO3A 2FHFA 3HG2A 3MA9L 4TL4A 3FQRB 2PPAA 4G7YL 4X1IA 3HOGA 2BP0A 4X0KA 1IGIH 2P06A 2XN9A 5SWSD 4JDTL 4PJ9C 2BH0A 3AMKA 1IC7L 4XXWC 1ODUA 2JI2A 5E8PB 1ZGLB 1I7RA 1PLGL 3HPLB 4JG9A 4FADA 4N2FA 3HMXA 2JB6B 2RAMA 1KCBA 1T20B 1ZDSA 4EUPA 1MJ8L 1X4TA 1GO3F 1WP7A 1TJGL 3O6LH 5H4YA 4YY3B 4O4HA 4WUKL 3HKBA 3HFFA 2FUQA 1UXSA 4FQ2L 5D7SH 3SE4C 3I85A 3IAPA 4HKJA 3JD2A 1GW0A 5DJCA 4YAQA 5ECJE 4U1JA 5IMLA 1XGTA 3GRWH 2ZIMA 1NCUA 2E6PA 4CNIA 4O5LH 3MO1A 1ILSA 2BVYA 2CTRA 4DT2A 4YIOA 4GLRH 4X4XB 4OPHA 1LUWA 3UO2A 1P9MA 1PZ5B 4MDJB 4U4IA 4K8RC 3LV3A 1DJYA 3B5HA 5LAPA 5J57B 1U95B 1NAKL 3A4DA 3UZVA 4FLQA 1WJ3A 1MHPL 4JJ5A 4M3HA 1RI8A 2VDOH 4KC3B 1ED3B 2AQSA 1PZ3A 4OB5L 4FKEA 2B14A 2C4FU 4P5KA 2XY1A 2AGJL 4PYGA 4UTAA 3U0TA 2OMBA 1JUFA 1HKLH 1EBPA 2H8PA 1AY1L 1SQMA 1MNUL 1PVHA 3DGGB 5CJOH 3S96B 3DI3B 5IQMA 1KV7A 1A6AA 4MNQD 3LN9A 1W8OA 4ZBMA 4HBCL 3B2UD 3ZTCC 1M57B 3E80A 1SFHA 3D36A 2E75B 2IDSA 1CVSC 2G30A 3VXOA 1RUPH 2PYEB 4NPYA 1IM3A 2FHBA 2DWEC 4LGSB 3CXHJ 1X4XA 4JZJB 4XC1H 1BAWA 4J27A 1PTZA 4H33A 2EC9U 1LDPL 3HE6C 4DV5B 3VD1A 1WNSA 4LCYA 4L4VB 3IMVA 1Z2GA 3IAYA 1IDSA 3AU1A 4IGGA 4FXKA 4MJ5B 3AXLB 4X6FB 3W0WA 3ZQ9A 4YDKH 3KJ4B 1BIIA 4FGMA 4G2AA 5E8OB 3QDMB 3EOAB 4JQIH 4UUJB 3O6KH 2UZIL 3VFOB 3W9EB 1QFWL 4OZHA 4KJYB 4EN2A 2PW2B 4R0LA 5CINL 4WAFA 4AGPA 1KTJA 1QQDA 3EOYG 4GX0A 1MDAA 2BIMA 3VDBA 5SX5K 4JFEA 2EDMA 4IU3B 2WVVA 3GI9H 4J3WA 1FNGB 1DVXA 4AC4A 2X4UA 4QCIB 3OV6A 3L71H 2ODIA 1KJVB 1I1AC 4U1IB 2WBXA 3EYSL 5DJ2B 4OZIF 2ITDB 5IB4B 5LGJB 3CXFA 3G6JB 3FOLA 3ZT7A 2FVNA 4F15C 1J88A 4UB0H 5AVWB 4BUGA 1SKVA 4OCRL 3RVXD 2ERJB 2F8IA 1LNUB 3OKKA 3P1VA 4PJ8A 3RVVD 4JHZA 2X9ZA 1CCZA 1CGSH 4Y2LA 4CC5A 4X5QA 2Q0ZX 4I2XB 2JCCB 2ETNA 3FN9A 4U0RC 4KK8D 4O2FB 1EEYA 3UQ8A 4X6DF 2HEPA 3SGKA 4YS4A 3RX7A 2VL5A 2P24A 4MNGB 5GTHZ 2GJ6A 1CD9B 1DL7L 2YD6A 5C0GB 5JHDA 3RIFK 1KSRA 2YQ2A 4RLDA 4XPFH 1HZKA 4GXUN 4PIBA 3ETQA 3PDGA 3BSZH 4P4KA 4FQXA 5HSFA 3NJMA 1MHEA 1U8NB 1U6AH 4CDHA 3O8XC 2R2CA 3QE5A 3U36A 2EXWC 3OGOE 3X2QC 4HHWA 3HKDB 1SOXA 3QXAB 3MV11 4QHKJ 3TNNB 1SM3H 2VRQA 1H3PL 4BCXA 3D3VD 2WQRA 3T4YB 1M71B 3HR6A 4HIHB 2J44A 4TNFA 1QLRA 1CF8H 3Q1SH 4K94L 4KXAA 2X4SA 1Q81W 2NYZA 3KEHA 3I9GL 2BY2A 3PWNA 5MENE 2WLLB 5KUKA 1NR7A 2YOAA 3V6FB 3LIZA 3PJSB 2L7JA 2WAQA 2GJ6E 3DUHA 3ABLB 3MJGX 2K0RA 1AXSB 4Y8AA 5LA6B 4Z3HA 4K9EH 4GMTH 5IT2L 5EEWA 3BP7A 4NZUL 4PJHF 3EYUH 4OPAA 2ZUQC 1V3JA 5BRZB 1BA9A 2UXDB 4GFTB 2D3OW 1JRHL 3GSXA 3QEUB 4YBQC 4ZTPH 3TURA 1FYJA 2P7TB 4MZIA 3DK2A 5J2TA 3QZPA 4YQXH 3ARFB 3CFKB 3IF1B 3VNZA 4ODWB 2Q7YA 4UZGA 4Q56A 3BQUC 1Q90A 5I75B 1IURA 4U1LA 4YZFE 1BV8A 3TT1H 4Q9QH 3HFMH 4R9HA 5EPMB 5CEYB 2GHYA 4JY6A 5MHSD 3UO3A 1TSRA 1ICTA 1BQSA 3VCLA 3WTUA 2P45B 2CTPA 3K58A 3L75H 1XAUA 5IWLC 3W11C 5BV7B 4KHTL 4X66B 4HBNA 1SQFA 3HJ0A 4PGEA 5L6YL 3A5VA 3ULVH 4P2RD 5T3ZD 5FO2A 1PNCA 3NCMA 1WFOA 2EDRA 3QA3B 4FQIH 4MRCA 5D4JA 4F3FA 4ZMLA 4F9PC 3SJAC 3O3AB 5EIVA 4DXWA 1G6RH 4IT5A 1W72H 4FFBA 5IJDC 4WVRA 4KZCA 4BGDA 5GONB 4PS4H 2W65A 4HCRL 2Y6TE 4JR9L 5HGAB 3BP5B 1RULL 2K9UA 4R90H 3DIFA 2AVFA 3TV3L 1U33A 4Z1MG 1X5ZA 3CHOA 2COVD 1DFBH 3GPEA 2AJYL 4TNWF 3K71A 1XGZA 2BCKA 3G7TA 1VSCA 1N18A 3GVMA 1EZVX 3RDTA 5DZAA 2PCFB 2WQVA 4Q9RH 2X9WA 1M56B 4LOEA 4PG2A 1R5VB 4ZPVB 1COBA 1GZQA 5D2LB 5DHXB 2VXUH 3QI9A 3UM7A 2NSMA 2GSGB 3QWQB 3BAYA 1F7YA 3NFPB 3DJSA 4TUJB 4V1DB 4KKCD 2VQEO 3UCSC 3ZX1A 3KNBB 1ZTMA 4JHAH 1YEHL 4Y2DD 3DXRA 5IQ7H 2Q5BA 3ULUE 3FQUA 3WE6B 2XFXB 3QWNA 4ILDA 4WHYH 3MBED 1B88A 3VXSA 4M8VA 5CB4A 3QIUC 4MCYB 1F4WL 4QRFA 2BW5A 3OKNB 3CH1A 3VB9A 3OMAB 1G1YA 3ASOC 3HR5A 2VH5H 3RBSA 5B3SC 1SEBB 4KVCH 2ZWZA 5GSVB 2EQDA 2D7TH 2QQKH 4FNRA 2JKWA 1JGLH 1KXVC 4MA1C 4PRNA 4RFEA 4ONFH 3UAJC 3ZYOA 2UXCO 3D34A 1EJOH 1E67A 4HUKB 1SYSB 1OLZA 2AQRA 3BVNB 3OR7B 5E00A 2H3OA 2Q76B 3MLXH 3DC6A 1XQ8A 5INDB 1BL8A 3CE2A 1PL3A 2DJSA 3EFFA 1UJ3B 3CBJB 3VSQA 4DUYB 2XTLA 2GK0B 3AM8A 4ZUVB 4ZFOA 4JJHA 2P26A 3VXSE 3VW3L 5IMOB 3O6FC 3LPGA 3L1OL 3GS4A 1ZT7A 1UA3A 1TO4A 3V0GA 1T0NA 2CKBA 3HLAB 1S5IH 5EU4B 3SJVB 4YXWG 2C2AA 1OZUA 2HXAA 4A2FA 2C3VB 3TBTA 1F42A 2WTPA 3Q6GH 3HRZC 3RTQC 4EBQL 5E5MB 1M05B 1FG2B 2FO8A 1F90L 1UWXH 3RE0A 3U30B 4CSZA 4LU5L 2VKXA 2P5WA 5KAQG 1BAFL 4XN5A 4JI4O 1VQ6V 1SRDA 2DIEA 3LKSA 3T0EA 2OTLV 3ASNB 3O6ML 2AI0L 4BQ9A 1WVZA 1G0YR 4LHUB 1XTMA 1S78C 3QXVA 1KP3A 2AZAA 1AJ7H 1CU4L 1OPGL 1LMKA 1PKOA 2BZDA 2EKJA 4I5BB 2Q5ZA 3QIWA 3I6LD 4P48A 1JA8A 4YJZL 3RWHB 1IEHA 1VF5C 2OPCA 3U25A 3WEMA 5I2IA 2N01B 4HETA 1AQHA 2H7WA 4ZUSB 3CVHA 2XT9A 5I8CB 2EP6A 3QISA 1E8YA 3Q8FA 1Q0YH 3ABTA 5D6CA 5D93B 3ARZA 1EEZA 4NQDB 5AVZB 1CFSA 1OF2A 4FQJH 4M3KB 3SPIA 2JS5A 2MOQA 4N85A 5C09B 3SKOA 4PV8B 4XNUL 5IHBA 3OE7G 1CDJA 1VLXA 3ZHUA 1TENA 2EXYD 1LEKB 4LMQE 3PQYE 4YSCA 3VDAA 1W2KT 1IX9A 4DR6B 3TH2T 1GGUA 1P69B 1PV0A 3ARUA 3MJ9L 4X2UA 1SQ2N 2VDPB 3WN5C 2AC0A 3B37A 3J07A 1S2EA 1A7BA 2R0LL 1JHLH 3UACA 4NP4L 5IW6B 3E22A 2VZOA 3MRPB 3PIQB 1JMKC 3QFJA 4LF4B 1TETH 3FO2B 3INUL 2HG0A 2X6VA 4MNHA 2RDCA 1GN3A 2AJUL 4BSVA 5KAFZ 1OP4A 2PKDA 1FH2A 3HMXH 4OJCA 4AUUA 3B7YA 4B7KA 4EUPH 2Z7YA 5SWQB 2G38A 4I4WA 4AZ8B 3I3DA 2QPDB 4GX1A 2UZXB 4UI2A 1EFXD 2DQFA 2I27N 2VN6A 3CZNA 4Z7UB 4ZQKA 1XGUA 5EO0A 5GGUA 4F58H 5E94A 2EVJA 1J5CA 4QWWD 4CVZB 1R3IL 4Y5XB 1KF9B 1OGPA 5DZLA 1TPXC 3OC5A 4IOIB 4ADJA 2ZSWA 3SO5A 1NLBL 4OU3A 4NO0A 4E42B 3MYJA 3DX8A 3AXIA 3B9KB 5F0LB 4Z7NE 1ZVNA 3MTRA 5D9SA 3L4TA 2F66C 4QHMB 2EILC 4PM1A 2AANA 2CLZA 3KJ6H 3S8FB 3D51A 2R23A 3OGCA 3EW3B 1MXDA 2B1GA 4NFBA 2YUZA 3ZMUA 2ZUYA 5I1GL 2EJRA 1U3HD 2HLDG 1SBSL 1SLXA 3V9FA 3ZR5A 1J95A 5FUOL 2GFBB 3G9VA 5F3HA 2DWXA 1TCRA 1R6KA 1IBMO 4OUOA 2YSUB 1DBAH 2N59A 32C2A 3FUNA 3QR0A 3VNYA 4DGYH 1T03H 2IDFA 3DHPA 3ARSA 2HN7A 3T2OA 5FA3B 5L8JB 4CN4A 4YLCA 1YJDL 4A5UB 1AGCA 3JAWB 1V3MA 1BEXA 3OXRA 5GGVL 3UTOA 4BK5C 3LZFH 4ZFFA 3RWDB 3ZE2E 3D9AL 5C1MB 3P0YH 3U79A 4A66A 2PWFA 3F12A 2B1IA 3IS1X 1SA0A 1MAMH 4YJ3B 4ZPTA 5IF0A 3D85B 3TJHC 3AADB 4GS7C 4OJAA 2OZ4A 3STLA 1ZLWH 3ZLQC 4HJEA 4JASA 5LP6C 1JPXA 1L9OA 1MCHA 3MUGA 4L4TB 1WDAA 4JF3A 1MRFL 4P9HL 4LVNB 3UBXG 1HP8A 3P30A 4D6TH 2DLFH 4GNKB 5KS9F 5HGDA 2VAAB 3K4DA 4ZUTA 3ULSA 1V54B 3CCMV 3QJRB 1AKPA 2VERA 2CG9X 2X0WA 1MNGA 4FNUA 1KCSH 4LASL 5E1AB 1EAPA 2JEXA 2NNUA 3BZDA 3Q6FA 4Y4KD 3I50L 5GRUL 3RKPA 3ULAB 1URFA 1FPTL 2DI9A 5ECGA 4YN3A 3UTSD 4HVBA 4N2OA 4MQXC 2ZX8A 3E3QE 5FFGA 2E8ZA 4UIKH 4Y2OA 3QO7A 1RZFH 1NGXB 4PV9B 3ELAT 4EOWH 5GSRA 1FIGL 5IMKA 3INOA 2HX8A 5D71L 1AI4A 2KQNA 2P8MB 1T7XA 1PEWA 2F5BH 3N04A 4X7SH 5MEOA 3OR6B 4N9GB 3P9LA 3CMOL 4ETQB 3VMOA 3OHXC 1JV2B 1Y74A 3L4UA 3QXTA 4JFFD 3CCSV 1HKFA 3RX5A 3QXWA 5T5FA 3A4AA 4HFUL 1EZSA 4MHHG 5DHYA 3J7AU 2CIKA 1QRND 4YDNA 1R1BA 2HHHO 1RZPA 1PPJH 5C93A 4XMZA 4EKWA 3VQMA 4PGCA 4XBFA 3M6DA 1OY3B 3KG2A 2BHYA 1YAZA 4XNXH 1JGEB 1L7TH 5CJQH 3NYKA 5B8CA 4RDQF 3KH3A 3D39A 4TNVK 4EI5B 2RALA 2VZVA 5AZEL 1A3RL 5I8KL 3LH9A 5FYLD 3BKCH 4HIPA 5CJBA 4NRYB 4PBXA 4B9CA 1AAJA 4NBZB 2WD0A 3QNFA 3T9WA 1UADC 4KX9A 3P4OB 1K9MW 3CHSA 1T0PB 4JAMB 4YHPA 5BCAA 2L7UA 1R3JA 3X14B 3EG9A 3LIZH 4LLUB 1FLTX 3KM2A 5F70A 4EO5A 2BSSA 3ASWA 1NTMH 4DFIA 2AEOA 3GSNH 3HVNA 3OD3A 5DURD 4KZ0A 1JCVA 3W1ZA 3KLAA 4NN5B 2BINA 4BKSC 5JXAH 3D39E 3NZ8A 3ARDD 3FQTB 1CF8L 1PX3A 3P3TA 5CIPB 3FKSG 4I48B 2D3NA 2X7LA 4IBQA 2OQJB 4FHJA 1J5OH 3EXLA 3AFLA 3T65A 4NJ9L 4JAAA 2D31A 4ZFZA 1LWHA 1A7QL 1YMME 3ETDA 4J3OG 1XQ4A 3A8TA 4JYBA 4LHQB 4TTDD 1ZHBB 4UOW1 3WY3A 5TJWK 3BKML 3L2NA 5F7LB 3M07A 4BWUA 2ZOOA 5D4QA 4YQXL 1CXZB 3C9NA 4YE0A 2LU4A 1VESA 5E1GA 5GS2H 1IKFL 1KIRA 3IJHA 2EECA 4UDUB 2ENSA 5B1NA 5D7JB 5IQLA 3WLWD 3GUTA 2BRRL 1XF2B 4OD1H 4KXBA 4DFHA 2P46B 1KBGH 1DBJL 2XIBA 3D2UB 1RIUH 4FG4A 3QWOA 4NQSB 4PLKD 1A4JA 1DQLH 3MR9B 1GGBH 4B3RB 4ODXB 2NUPA 1AE6H 4LCCC 1KIQA 1UQSA 2CO7A 1UWXK 2NCEA 2O6DA 4XBEL 4TUUA 2AERT 4E41E 1KZYA 5IHZA 1S77D 5CN1A 3EADA 4OCYL 3CLEH 2ENQA 1G9NL 2IOOA 2WY3B 3TH3T 4HUVB 2E9GA 3MRFB 1IGCH 2O6PA 1P6WA 5IK3B 4BXVA 2A9MH 3MGTB 3RVVC 5KVMC 4V33A 3DTXA 2P47B 3Q3GA 5I17B 1KB9K 5HHXL 4F80A 2FBJL 5CWSB 3ZE0F 2RJMA 3LRGA 4KK8C 4NI6A 3QZWA 4F15B 1KC5L 3G6BA 1YPZA 4JQVC 3WDJA 3TX4A 3BVOA 1HEHC 4XN2A 2KPNA 2XXGA 3O4LD 5A2LH 2VR9A 3BO8A 3EJUA 1HHGA 1F5WA 3FONB 2AMUA 2OTUB 2FD6H 3FC8A 4HUCA 2BWIA 4MSWA 4FQLH 3RYFB 2VISA 5F6IB 3WG7C 2NRDA 1R5WB 4D3CL 3DUUB 4UT6L 2RJZA 2H32H 4LARL 2WO2B 3LRKA 1UXLA 5E8DH 4L3ED 5J12C 2AQPA 1H3GA 1TKWB 4IYKA 2Q8AL 4FLXA 1BVZA 4OGXH 5IIEB 4ODHL 1F58H 3VXQB 3Q06A 5CA0B 5F3BB 3WUZA 4H8QA 5DJAA 4X8GA 1YPZE 4ZHQB 1DTUA 3GO1L 5I0VA 5D1XB 4MXVF 4AJWA 4M7ZC 2E46A 2VH5L 2A7BA 2J72A 3SY6A 1PL0A 3UZEC 5BJTA 2VLKA 4XB7A 5ITFA 4BRVA 5H6RA 1NJ9B 1MLCA 4XNMA 4AIZB 3NR7A 2XNDG 1A6WL 3A24A 1UB5B 5B1OA 1HQ4A 4F57L 5LMUO 1I4FA 5B38B 4AHCA 3O11B 1HWWA 2CKBH 4G80B 4P2QD 5MEQA 4AVIA 2JXMA 2OULB 3KR3H 1T89C 1RP9A 3AB0C 1CR9H 1HH6B 3IGAA 3KPOB 4YHZL 5L9DL 4RQQA 3T2NH 3GRBA 2CGOA 2IM9A 5DO2D 6FABH 3HG1B 4FIPC 5DHVB 1NOLA 1U58A 5AD0A 1MJJA 1A6TA 1LJMA 5MI0B 3QZLA 7TAAA 3QJSB 4DRXB 1K73W 4L1HA 1ZV2A 2J20A 3VFGH 2VLKE 2PO6A 3KWVA 1A1OB 2VXSL 3JTSA 3QULB 4DP2X 3L5XH 1E3ZA 3OJVC 1XBRA 43C9A 2QFRA 3HC3H 1NPUA 3MODH 4TQPA 3L95A 4OCWL 2CJUL 5D7KD 5EIQA 1Q1JL 2VQ4A 4PLNC 2B4CL 4QRUA 3CVHH 3N2KB 4HPOH 3B2VH 2DWDB 2UV3A 3E6HB 3N2GA 2F54A 3SYAA 3GYRA 3Q5YA 2L0DA 1O6VA 4YNYB 1IAKA 1BXVA 3VFWA 3CHXA 2CO6A 4YXLL 1A6ZA 3FUEA 5F7HA 2DYRC 3JD0A 4GAJH 1DQMH 1R6NA 4JTCB 2YS4A 3DETD 3DSFH 2GSIB 3FAXA 3L5WA 1G7LB 4MJ6A 1O7VA 3Q44A 1ZLWK 3X12B 5K9QI 1NFDB 2H6PB 2ZXAA 4N21A 3CVIL 1U8MB 3SSGA 4OLXH 1G7MB 1XMWA 4UM9B 3FO9A 2XTJB 2YSTA 4XHJC 5DYOB 4G5ZL 4IRZL 3JWDL 4J2QA 4LO9A 4O4IB 3BSGA 2BOCC 4X89A 5BO1H 4KKCC 1NDMB 3O3BB 1B3IA 3P2BA 5DFTA 1M7DA 4Z7WF 1NCHA 3F5WA 4MS2A 3QEQA 4Y2DC 2F54E 4LF6O 5C86A 3FB7B 2JKRM 4FFZL 4I9WA 2IBZH 1BFVL 4AYFB 3TF4A 5FKPB 3MBEC 5JW4Q 5ANMB 2MOVA 3GB7C 1MG2C 1LDSA 2X6CA 4L0ZA 1RJZA 5TQ0H 1AR2A 1H5BB 3P40A 5EZJA 1BZQK 2MW2B 2HTLD 2YPLD 4M8QB 1JHKL 3T6ZA 1K4DB 2EC9T 2ZM6B 3DVGB 3Q2WA 4TLKA 5DR5H 1G8MA 3S8GB 3BKYL 1F00I 4J8QA 2WOBA 1IQDB 2J5WA 3ES6B 5C0AD 1Z9PA 3ASOB 1Z9SA 2MJWA 1CXLA 3B2DC 5E79Z 2AV1A 4TQEL 2QVIA 4YK4B 4ZOAA 2B39A 4HCRA 1XH3A 1UOLA 2WYHA 3JAMN 1L5GB 3RWEB 1J87A 4MWFB 5LHHA 4N28A 1E6OH 4ALAH 4I9WE 1MI5E 3BP6B 1T3FA 4JN2B 1RPOA 1F2QA 3EH3B 4MD5B 4ZXBD 5HHNA 2FWUA 2N1KA 3BPCB 4WFGD 1AP2B 3AG1B 5EU7C 3EO0A 3FSVA 3MOBL 2GSMB 4OUUB 4S2SA 1QPPA 4YFLI 4JRYB 2VYRE 4UV7L 1U8KA 5E7BA 2BRQA 4CVXA 4ZQTA 4JI1O 5IQ9B 1HNZB 3MRKA 5BXFB 1WBZB 4LK4A 2ZNJA 4W93A 1JGUH 1CQKA 1FZMB 5DD1L 5ITZA 2J8OA 5T1KA 4F8NA 2AV7A 1LE5A 3F04A 3S4SB 5GZNC 3FUHA 1TEGA 3IU3A 4ODTH 3V6OA 3W2DL 3IDYC 2B0SH 3U46A 5JQGB 4S0SD 1SERA 4R7VA 4LESA 4LHUG 3B2PA 4CH5A 1GGIH 1RZGA 4DGYL 1P4LA 5LGNA 3DLQR 4HPYL 3I5DA 4P59L 1BXXA 5T1DL 5GRWA 4PRPA 4PSRA 3CFUA 2IGLA 4J10A 5LNGA 2OLDA 4H1LB 4DZ8A 4Z77A 3ZL4H 2VMJA 4IGBA 4O51A 1IFHL 3VFSA 5FECA 3ZQWA 4K0OA 2QADB 4C58B 2CR0A 1KJ2L 1DP0A 3VA2C 4KMLB 3BIKB 5D1QD 4RETB 4Y19A 4UOJA 2PCPB 1F6AB 4OJDH 4WFHD 3X3GH 1G7IA 3P0VL 2Q73A 5CCHE 4ANVA 4HT1H 3K80A 4YO0A 3G5ZB 5BZWB 2NY6B 3REWB 5CKAA 2KLTA 2AJXL 3L6FA 2X5PA 4FYQA 4AI8A 4N1CA 4I0PD 1IE5A 2X6UA 1XCXA 1OGTB 1IL1A 1AYRA 2XAJA 3HCVB 5DVOA 2R0KL 3LN5A 5IVXE 1JXKA 4NRXB 4B9ZA 1R75A 2UXBO 4OD3L 1UD8A 4XO8A 4B9YA 1Q72L 3N27A 4ZFGL 1LLAA 1FFXB 1M3IA 1VERA 1INEL 1ZK5A 1L0XA 1G94A 4OM0L 2XQYG 2NX5A 2PI5A 4PR5B 4FQPA 5F2FA 4ENZA 1LTXA 1OCCB 2VMFA 4QWWC 3RGVC 5DQDL 1P84J 2QVKA 3GMLB 1D9KD 3BAAA 1MCPH 3N5AA 1RPRA 4K7FB 5IW1B 3DSNB 1I1FA 1NTZH 1HEZA 1ZDQA 3APFA 3CQPA 3HBGA 5EIIA 2O26U 4JI2O 1RVFL 5GRJH 5IBTH 2D2OA 3MN8A 2QKCA 3GXMA 1U93B 1RUAH 2ZT9C 3QZMA 3PWVB 4MQSB 1PFCA 4XODA 3MOAH 4D8PB 5CAYB 4WCEV 3DPBA 4YDMA 1FZOB 1NGQL 1U3HC 4AQOA 5KJ7E 2NX5E 5D7LB 1W6LA 4EE2A 3GXPA 3SYQA 3ZDZF 4UB6Z 4LFBB 3TVMA 1JGVH 5E8NB 4YHLL 1DSWA 4G8GD 3K0GA 1T5EA 2E8YA 1XUQA 1RIHL 3DHUA 3IDGA 4PJDA 4UQEA 3B43A 4X7DC 4HZLB 3CC2V 3OJMB 2BVQA 5CJ8A 4MMXC 4FQ1H 4JFOA 1MVUA 2X42A 1E8XA 4DR7O 3M7FB 3VQLA 4HJIA 4L1TA 4N2BA 1ID2A 3H3PH 5KBDA 5CHNA 3SPVB 2BOLA 2EYSB 4PRIA 4J3UA 3MXWH 2H9GB 3K91A 4G9DB 1UGKA 1SQBH 3UBXA 2RCSH 4UQ3A 1GMGA 1H6UA 4TS6A 4F2EA 2J43A 4A7TA 4QIWF 4DKTA 2V4DA 2UVFA 2P5PA 2XX1A 6CGTA 1CD8A 3SQRA 3K0YA 1FHNA 4HD5A 2P6JA 1VQ7V 1YDPB 4G8IB 4POZD 5DJXA 3KWTA 2KLSA 1NTDA 1G5AA 2H26B 3C5ZA 4TQ8A 3SKMB 4Y4KC 3JD4A 4XAKE 2K70A 5ID0B 5EC1C 1ET5A 1LO3H 2P4VA 4PJ5D 3U7WL 3RIAK 4ZI7B 3RIFF 3B9EA 3FT0A 1RZ7L 3OB8A 2HJFA 1QTYT 2DQMA 2KI6A 3V52H 5IT9N 5G5DB 1NUGA 3UG5A 5CBGA 3WDIA 5BRQA 3HZKA 3V0VB 4ANUA 2BSCA 3FU6A 4WW1B 3T4AC 1OB1B 1ZTXL 2Y48A 2H4EA 4A7VA 4PRHA 5CEZH 3CCLV 4I18B 2UWEA 5D72L 1G9HA 3OX8B 2QKIB 5HHQA 2LAGB 5HPOA 4E2LA 1E28B 4ZS7H 4L8SB 3U2SB 3WTWA 3CFBA 1Y0LB 4JM4L 2YAQA 2DQGH 5ICZB 4L8BB 3ULUL 1AE6L 5DXWA 3ZHSA 1T1XB 3CDYA 5I73B 2JB6A 5I23A 1KCLA 1UT9A 2MRYA 5J11B 5E6ID 1DQIA 3TA3A 5CMUA 1IC5L 5LN8A 4J42A 4N90D 3MYZA 4JZOA 1F6FB 4EQ2A 3RVZA 4LEXL 5CLTA 3QFGA 3VM5A 4FP8L 4AYMC 4DR3B 5DEDA 5HY9B 4R2GD 4MMYA 1QUNA 1VAHA 3A6CL 5D7IF 4NR1A 3RYCB 5TD4A 5HD8D 3ZSTA 1MF2H 2OYPA 2O57A 4NNYA 4MAUH 3BDYL 5EFIA 1NPJA 4N3UA 3GBNL 3WS6A 4X4XA 2BNQB 4OZIB 2WLNA 1RIVL 4QRSB 1PZ5A 4D2NA 1R3KC 5EU5B 1C1EH 4RSVA 4YDIH 5KW9H 4JHWL 1U95A 5C0CD 4OI8A 3E83A 2V9RA 4L9DA 3T3PF 4W4OA 4Z8FL 3QORA 1F13A 4DV3O 2E7BA 3P2TA 1XR8B 4GKSB 2AKRB 5C7XH 2VZ1A 2PXYD 4BIKA 1H19A 4NQXB 4GI9A 4JAVA 2YRPA 3DV6B 5E2VL 4QHKI 4W68A 3N85H 2ZKXA 1A3ZA 1KGJA 3UYRH 2XN0A 3GSRB 5FGCB 2H6UA 2VJXA 5SWZB 3DGGA 5C6PB 5LGUA 1CD1B 3T0BA 4Q2ZA 2MWCA 5EZIH 4ASUG 2NY1D 1XH0A 2DQUL 2J88L 5GIRA 1HNXB 2J73A 3L9DA 2PYEA 5I6OA 4JZJA 1XSJA 3T04D 4OLUH 4EVNB 2FGWL 2VC2H 1ZE3C 3IN2A 4FLRA 1YRKA 4KRPD 4YSEA 4C83B 3WNKA 4MJ5A 4X6FA 2LGWA 4QXUH 4UZUA 3SPGA 4MNQB 3RN4A 3P69A 3WNJA 2JI1A 2V6HA 4UUJA 3W9EA 3VFOA 3WY2A 1CR9L 3HAEB 1I5XA 1IM9D 1NANH 4FHBD 4ABWA 2I5YL 4PV1B 1RZKC 1UUNA 4U1MB 4XMTA 1FNSL 2JGDA 4Z7OF 1HXKA 1D6VH 2FLRT 2ZXQA 5F1KC 1X5XA 4B5ZA 2VZTA 2W9DL 4QE9A 4IU3A 1FNGA 2PYEE 1JTTA 1BJ1H 3KBEA 4QCIA 1FLRL 3KYKH 4PJXF 4U1IA 5DJ2A 3RAJH 1YEDB 5I0DA 2F8XC 2H3XC 3EBIA 1CPYA 4PWFA 5LGJA 3G6JA 5EU6D 4HUXB 1MFMA 2Q9OA 4HKBB 4MCNA 3U9WA 4L4VE 4I0KA 4L8DA 3X1EA 1LNUA 5DHMC 1CN4A 4YHOH 5INCA 3QDME 3ARGD 4I2XA 2JCCA 4FQCL 1FE8H 1UKQA 3OKYA 2LVCA 4O2FA 2FL5A 1PG7X 5L3GA 3WKMH 4MAYC 4A6YB 4P57B 4NGHH 3ZMZA 4LFCO 5C0GA 3A0HZ 2R0ZL 2E3CA 3O81A 2GC7C 4FM1A 1YXBA 1IAIM 2IPTH 3ZTJG 1OZ0A 4DAGL 5I1CL 4S1SH 3FQYA 3GSWB 3PDOA 1DEEB 2WXJA 3HKDA 2QHRH 3G6JE 5FYJE 2CDEB 2OSLA 3TNNA 3BRFA 3T4YA 4B97A 1M71A 5GS3A 3MLVH 3RI5K 3U7YL 3GS0A 5E2JA 1JVMA 2A6IB 2BIOA 2GITA 4B9KC 1U8HA 4NXMB 2JCCE 3SQOH 1HVXA 2R4RL 2LP7A 3K2MC 3JZYA 2VXQH 2WLLA 2W9EH 5ADOH 1UUSA 3DRTA 3V6FA 4ANWA 3PJSA 4MNGE 4DH2A 4IKIA 3DX4A 3K2IA 2EIDA 3H9SA 2AXFB 1AXSA 5LA6A 3CYOA 4XP4L 3WJMA 1HN1A 1CZ8L 3EJPA 1FL5B 1MHHA 4MJIB 5JPMA 1IV8A 3KPRD 3RYHA 3CK0L 2BY0A 5F96H 2P7TA 2NXZC 4U2YA 5H94A 5GGRA 4BHUA 2A6JB 3CFKA 3IF1A 3UP1A 3LMJH 4BGLA 3FUKA 2Q7AA 2JJSA 1OCZC 5HJBA 1FFPB 3V4UH 4G7RB 5EPMA 4LE8A 5CEYA 1DLBA 4J3SA 3RWIB 4GRLA 3IJ4A 1O9VA 3NAAH 4NIKB 4OCSH 3V4PL 3ZMRA 2F53D 4XPTL 3MFFB 4I3RL 2ZE7A 4Y5VC 5EOQL 4HIXL 3TBCA 4ZBJA 1FI8C 5DO2C 5BRZE 5EH1A 3KL0A 3MV01 3RURA 1C16A 5EZLA 3G71V 3FQNA 4AQYO 3KM1A 1TJMA 2KZWA 2I24N 1MW2A 2QGCA 4L29A 4L3CB 5G55A 1KB5H 3DO3A 3NJJA 5GONA 4D7TA 2MCPL 3H2QA 2JK5C 1IVLA 4AUJA 3C90A 1N7MH 2A9NL 3BP5A 2G9KA 3H1HH 2YMOA 1RSOB 2Y3NA 5FF6A 1CXEA 2Y9RT 4ONGL 1G7PB 5AZ2L 3HS0B 4P2RB 1ONQB 4AILC 2CGYA 1OSZA 2EH8H 5AOIA 2Q0OC 2PCFA 3WFEH 3OPUA 1X3DA 4KOBA 1OALA 4POUB 4DR5B 2H0PA 4K7PL 3TV8A 3H56A 1PKXA 1R5VA 4NWUL 2YEQA 4ZPVA 5IWAB 1MHCB 2XZZA 2JKNA 4X80H 4WI0B 2Q7EA 2GSGA 2QJ1A 3HB3D 4GSUA 3JT2A 2E76C 1G7JB 3BN3B 4PLOB 3NFPA 3HG0A 4OLVL 2DM2A 3WIFA 2WPGA 4J3TA 4FC3E 2JI3A 4GKJO 4QF1A 5GRYA 4WGKA 1VJSA 2NXYB 4P5TD 4PJIA 5EOTA 3WE6A 2XFXA 3MFGB 3EBHA 1WEJH 4KBPA 1HW7A 3MD0A 2V17H 4N2DA 3CGTA 4HGMA 3NABH 4S1RL 3CN4A 4KUMA 4ERSH 5EOCJ 5D2LE 1J5IA 3M1OA 5FO9B 4EIBA 4HMEA 1U3NA 4PWGA 1IBLO 5L2KA 5GSVA 4NAMA 4UV9A 1QWUA 2EDDA 3KYMB 2HTLC 4YUEH 4V1DE 5DJ0A 3I3EA 3CZKA 2AJ3B 1SYSA 3OTOB 1PNLA 2D9CA 4OF5A 1PLCA 1NMAL 4WTQA 2NSQA 2CGRL 3THML 2GK0A 4OSUH 3ATFA 4GKKB 2BERA 5IMOA 4IYIA 1S4IA 2N74A 2ZKOA 4FVMA 1HHJB 3F7YC 2A4CA 2RQEA 3I2CH 4QXGH 5AWNH 3V2AR 3WV0A 4CMMB 4N20A 4OX9O 2OYQA 5LMNO 1JOIA 4TVSa 3IVKA 1MCPL 2BW4A 2R69A 4LCWA 4WI3A 3VI4A 3HLAA 4ZXBC 3NCFB 1WAZA 1ULVA 3CNKA 1O6SB 2MTAA 3NCCB 2FTKA 2AS5M 4V2BA 2X9YA 2C3VA 3EDJA 4MA7H 5IHUL 3JVGC 1IAII 4ELDA 1SBBA 5IBTL 3DOIA 1OK8A 5IFJB 5E5MA 1M05A 1EO5A 5IKCB 3GI8H 1I1YB 4F7EB 2VLJB 3S4SG 4NM4L 4P2OD 3MNZB 4IRZA 1BSIA 1GOFA 1HH9B 2K45A 4W9GC 2O61B 2CIIB 5EBWB 2DQ6A 4IRSC 35C8L 4LSTH 4F5CE 1IGTB 4I5BA 1NSNH 5EZOH 3RWHA 1JDAA 3SYCA 4CH4A 4JFXB 3ULVF 5ERWB 4DCQA 2ZOLB 1H8SA 4ZUSA 3LHPH 1A8ZA 4RRPA 3SJVE 3GT6A 4L1DA 3GZPA 5EC2C 2J1ZA 4HWEH 3Q9PA 5FO7B 3ZEDA 5D7HA 2WUBL 4NKGB 3BWSA 5LB1A 3SDXB 1NA8A 1E30A 2QTSA 4PV8A 3MLTA 1VARA 1D5IH 2DN9A 5JORB 1ZJAA 2HLFC 1KBPA 5JH7A 5JIMA 3IFOB 1YNKL 1R0AL 4HS6B 4DR2B 3LS4L 1D7BA 4ZOBA 5B3JE 2FATH 3E8HA 4S11A 4TNVF 2MQ0A 4X7CC 3T6WA 3PIQA 3MRPA 2K3HA 1YYCA 4DV0O 1B0GB 4I0PC 2WBWB 1PG7H 5D1ZI 2W6IG 4K2UL 4CSSA 1LO2L 5FYKL 1G0XA 3LPPA 2VB5A 2X89D 3V5KA 1SDAB 3JARB 4QTFA 3WSQL 2VRKA 1BF5A 4NQDE 1R5IB 4HC1A 4AZ8A 4D0BB 1S7XB 3L45A 1F51A 5C09E 3RPIB 3E35A 2NNXA 4Z7UA 1KGCE 1FGVL 1HILB 2HKHH 2VN7A 3E8GA 4CVZA 2XQYA 4Y5XA 5D2NB 4IOIA 2ZCKL 3R0MA 4J80A 4N2MA 4NERA 4DN3L 2BP8B 5FUCC 5I71C 5ICXB 3NCBB 4HWBL 5GHWH 1D6EB 1BFOB 1CFQB 4JO8A 4LNUB 1OF0A 3L1GA 3B9KA 1UXWB 2DQIH 3QPXL 2DD8L 2YQ3A 3K72A 2XN9D 5IFHH 4DW0A 3OKLB 4NC1E 4MGXA 3P9MA 4J3VA 3Q4HA 1V05A 3AWFA 5C0JA 5DC9B 3RFZA 1KBWA 1PD6A 2YC1B 4UQIM 2CA3A 4KI5E 2J8UB 2WKOF 1EHXA 4Z7UE 1L9SA 1XZ0B 2OMUA 4TUYB 1JFFB 3I6GB 15C8H 2QV4A 5FS5A 4P5SA 3C12A 3V6ZA 3F83A 3S36X 4HU8A 3C60B 1WWBX 4OIAA 4P3DB 1H3WM 3C09B 4DGUA 2A1WH 4LH7A 4P3CL 1ECYA 1VFOA 4ETYA 1R3LC 2V5MA 1X9LA 4J3OH 5DWPA 3PHSA 3RWDA 3H2PA 3U6RB 2YPVA 3L1EA 2OR9L 1QFUH 4YJ3A 3BAKA 3ILPB 4JM2D 4PUBL 3VXTA 5JHLA 3D85A 3SQBA 2ZAGA 1OAKH 4GW4B 4FJYA 3UYRL 5EORH 3J27A 5KTEL 4HDIA 3OG6B 4D0DB 1MIEH 1E9QA 1MJ7L 4H8HA 1KB3A 5BVPL 3CV5A 3ZZQA 1OSPH 1PP9H 2G3NA 3J8F7 3L7FA 3UGEA 5JZ7D 5ITBL 3OB0H 4P5MB 1P0SE 3QG6B 1A5FL 5A6LA 3T3MF 4L1LA 2NR6C 5F89B 4WK2B 2NDFA 3QQ3A 1BLNB 2JQMA 3P3NA 1FH5L 1MFEH 2LGNA 3JWOH 3C5JB 5FWQA 1KB9F 5LBQA 1R34A 1CURA 4O2AB 3MZGB 4PV9A 3US0A 1HL5A 2WXPA 4FN0A 3N1MC 1EQWA 4FG2A 5FYJH 3B3IB 5LGHH 1IM3D 4N9GA 1C7SA 4DR1B 4ETQA 1KEGL 1Y66A 2Q86A 4L4TE 2ZP8A 5EBLC 1JV2A 3WFBH 2WQAA 4Q8BA 4IL6Z 2WXIA 1C5CH 2DDQL 1G87A 2WMPB 5EC1B 2K6ZA 4OM1H 1IC4L 3DUSB 1IVSA 3W0WD 4NLAA 5GS1C 3CXHK 3QT2A 1TR7A 1W9XA 2OCJA 5B1JA 3R1GL 3QO0B 1L9RA 1HIML 4HKXA 2FQGA 3CCEV 5AKTA 3EJQA 2WNGA 1NMBL 3BD5A 5E6IC 1UJTA 3BYTA 4KKZA 2X1OA 3ELQA 4J8RB 2TRYA 4PMEA 3LUTB 4JFED 1RAMA 1J10A 2QDVA 3AT9A 4R2GC 3WN6A 4QTHB 4URTB 1QRNB 4BDVA 3OSVA 4HD9A 5DD5L 1Y76B 3QG7L 1TF4A 4XNDA 5HD8C 4KXZH 3VD9A 1KDJA 3S48A 4JAMA 4ZDHB 3JWNG 1NAMB 4G3YH 4JE0A 3PGCB 2ITCC 2ZIOA 1Z9OA 4PJ8D 2PTTB 4PJEB 3D08A 2KDYA 4QAWA 4XE5B 5SX4H 4BINA 4P2YA 4DKAA 3WTSA 4F6RB 4CW1B 1QO3B 5EN3A 1S3JA 2F19L 1KN2L 2CZNA 1XR9B 2YGOA 3K8KA 3PWPA 3U6XA 3MLVL 1B04A 5JHDD 1WIUA 1BQ0A 1JXJA 2C9QA 4H20L 1QCEA 5CIPA 1DYZA 1XT5A 2PXYC 2WV3A 2I26N 3CZGA 3NACL 2OQJA 4FQXD 4P4KD 3VJ6B 4A55A 1KG0A 2J1XA 5DZOA 4N3TA 3BH9A 4TMPA 2A79B 3BUIA 2Y1ZA 1M1SA 3IE9A 2GIYA 1TVHB 1ETA1 2R2EB 1TJIL 3L1FA 1PZUB 1IGYA 4ZMXA 5BV7H 3L4VA 5IYBO 1CFBA 3K81A 5B4MD 2V37A 3ARDB 5F7EL 3E89A 1UTDA 4ZD3H 5KYWB 3SB3A 1R3HB 4H8WH 1WZ1L 4B9FA 1E2VA 2QPFA 3T8XB 2XWDA 2M1KA 1MCKA 4FQQB 3DV4B 1XF2A 3HAEG 2UUDH 1MOEA 1U3YA 1U96A 2OI9C 2FSEB 4LSQH 3ECBA 4IIZA 4OCMC 1WA2X 3B2XA 1RMFH 2V9QA 1Q90D 3MR9A 1YA5A 5KOMC 4TT3G 1F1DA 1TOXA 2DIJA 4ODXA 3ZZSA 2BSRB 4PW3A 3UG4A 4NUGL 4LF8B 1MRCL 2LU3A 2XWBB 1EO8L 4NDMA 2M7WA 4LAQH 5LBSL 4HUVA 3KBPA 2L7EA 3H9HA 4X8CA 5E1HB 3CFIC 3MGTA 5GS2D 2W6JG 3DO4A 8PAZA 5I17A 1Q9LA 1DUZB 3ARGC 3HTLX 3S0PA 5I19L 1WGOA 4O2EA 1EIBA 1PZCA 2IJ0C 1O7DC 3QUHA 3FF8A 1JWMB 3E8UH 5DHEA 4TPRH 3AG2C 4FLYA 2XWJA 5DEZA 5J0BA 4BAYA 2CK0L 2R9HD 1FRGH 2D03H 3EJZD 4R7NB 5FM5M 4OLZL 3FONA 1E4XL 2OTUA 3IFNL 1YY8A 2Y5TA 2FX8L 2QT6A 4NYLB 4JPIB 3RYFA 3QO8A 1J5HA 3NESA 4LBEB 1BQZA 1X5KA 2A6KB 1HL9A 3IFLL 1NKDA 2AK1L 2CWRA 4G72B 4N2IA 1R5WA 3WFCL 2E9BA 4GRWB 1HSBB 4WI7A 5GGSY 3BUQA 3RDTD 3SDCA 3V5HB 4NENB 3DTDA 1TKWA 3G5YA 1NBZB 2EDWA 3CHQA 3JASB 3O4LB 2HSIA 3EH4B 3QI9D 4APXB 5IIEA 5CA0A 3IU4H 1RPQA 1ZLSH 3GJFA 4M1DH 3SDDC 4YZFF 4QPJA 5C0IA 5E03A 3QUZB 4KK9C 4KTYA 4HJSA 4X4MA 5HI4C 2GTQA 4ZOLB 4CBPA 2CK2A 3RNQB 1J5EB 1WPBA 5G2NA 4KVPA 1S5HA 4OZGA 4L3EB 4O58H 2V5RA 1K8IA 1G5GA 2LQRA 4PGJA 5I0ZA 1G84A 4R6UA 3FAVA 4BFEA 3VXSD 2R69H 5B38A 3WXWH 4ECNA 1L9PA 3FOMB 1PM9A 4MX7B 1HH6A 4YDLC 4MXWH 3BUYB 3KPOA 3KDMA 4IEFB 2EIJC 1ZIAA 3S3XA 4GBXA 5DA0B 5HYSB 5JIDA 4N2CA 4IHJB 3AUVA 5FGBC 2FKXA 4WY7L 3HG1A 5JA9A 3V0AC 5D1XE 4B7EA 2WW8A 2ZKHH 1X7QB 1IBBA 2NY7L 3M1BB 4JDZA 1DJZA 4DP7X 3CSBA 3QULA 3RWRD 1ZL8B 2QWOB 4IBWA 2WXQA 4K9EC 1YEJH 1QEXA 1VEMA 4BCZA 2P43B 4YSTA 1KXTA 1CXHA 3L3HA 4XMXA 1ZHKB 1SMAA 2HVKC 4PJBB 4R26H 3O0LA 2DWDA 3TGXA 3MRBB 3L3KA 3F64A 4I9XA 4JFHE 3OKEA 4YNYA 2QM7A 1VF6C 3UBHA 2ZXEB 3HG1E 5JCOA 4Y8DC 3QJQB 3PHAA 1KGUA 1YYLL 2JFCA 2ZX7A 1W0VB 3DOSB 4G6AC 5ALCH 4HEPA 3S3CB 2GSIA 3MNVA 4HOXA 1RZJH 4MVUA 1NFDA 3F7QA 2VDPH 5B21A 5AENA 1HZHH 3T08A 1UA6H 2P5WD 3GM8A 3OLEA 2I9LB 3ULVC 4CU7A 3AREC 3HB3C 2YAOA 3T0ED 1ID5I 3OB0K 2CBPA 4O4IA 2OTWB 3ZSSA 1S3RA 2ID5A 3CSGA 4Y4HD 4JFDD 4P4RA 3GZQA 3QIWD 3TBSB 5FC9A 1BLIA 2F74B 4JCMA 1KMGA 4F7KA 1WD9A 4V2CB 4WJ5A 2K7PA 2PCXA 5ACZB 2AJZB 3CC4V 4HC1H 1G1XB 2B3IA 4OAWA 4QXVA 4RAVA 3TP4A 3PFQA 4G43B 4K5PA 4AYFA 4Z7VB 3VXUD 3E8BA 1YNTB 2UZYA 2UYLB 2Q6WA 1EAQA 3IJ7A 3TF7C 2RMNA 4NS0A 5A2JH 1NBCA 2LTQB 4M8QA 4PVMA 2XIIA 4CC4A 1UATA 3DVGA 1UD5A 3MRGA 1FZKA 2A99A 1LP9A 2E6QA 1BGXH 2XTJE 4P5RA 1M53A 4X9GA 3VACA 1IQDA 1UC6A 3VG9B 2HLAB 4X83A 4HJJH 1CIDA 2EIEA 1S7WB 2XBTA 1KPVB 3GRGA 3N41F 4A2HA 1V8HA 4XPHL 4XN7A 5TDOB 2MK3A 1IU1A 5H35B 2JH2A 5TDPA 2YXFA 2IDCA 2R59A 1CT8A 1A02N 2XNAB 4QXTA 4JI8B 3RWEA 3QFJD 4MWFA 5BMFH 1LEGA 1IQWH 2DMBA 4UU9A 2YPLB 4IHOB 4JN2A 1LXMA 2FHCA 1QLEB 4TYUA 5I26A 1WCQA 3ATAA 4MD5A 5ANME 1HEJC 3B9DA 2YD8A 2Z8WC 3NPZB 3PWJB 1J0ZA 3LPFA 4RGNB 1R6TA 4U3SA 5LOVB 4JRYA 4GX2A 4Z23A 1XDTT 2VDLB 1SLUA 2AEPH 3AWGA 5IQ9A 2X70B 3UFIA 3IM1A 5BXFA 3FD9A 3NN8B 3DX2A 2IF7A 5JJJB 1FZMA 3FK3A 5ETUB 2WSKA 3QB7C 3VGFA 4DTGL 5LWYL 2B7DT 2IGFL 2YPVH 4IDJH 1AS7A 4H26B 4NO0D 5JQGA 5JHLH 3IDXL 1EHLL 3GM0A 1JV5B 1RUQL 3MJ7A 4NNPL 4P2OC 3CDGB 4AT6B 2B9AA 3AG4C 4KNSA 1JXFA 4DW2L 2JB5H 4R50A 4LRIA 4M62H 1MA1A 2LV4A 3O3EA 3QCVL 3RL2B 2WLHA 1AHWC 1NBYB 1J9SA 4H1LA 3KGRA 4JRYE 1AC0A 3GXIA 5FHAH 1RUMH 2YIHA 3ZVVA 4PJGB 2YK1H 3ILDA 4YDJA 4WF7A 3K08A 2E74C 1N36O 3FO0L 1BBDL 5C0RH 1KELL 4YIPA 2KDGA 4RWUA 2HRGA 1AVAA 3NIGB 2PYFB 4G42B 5K69A 3G5ZA 4IMKA 2C9SA 1OW0C 4X7EC 3U0WL 1KECA 4PI0A 1C8QA 1NCBH 2Z8RA 3LQZB 4H0IA 5F0MB 3TN0C 4Z1PA 2XAFA 1PY4A 5MP6L 3BE1L 4Y89A 4W9JC 4ZX5A 1V55B 2W0LA 3MHZA 4IDLA 1JZ7A 1RZQA 1VGKB 4I7ZC 5IR1B 2DMCA 2UUDK 1INQB 5DUMH 3B7TA 3HCVA 5D1QB 1FBIL 4OBRA 2O5YL 4NRXA 1TZGH 3RWGA 3ABKB 1I94B 5AW2B 1DSFH 2FR4A 1MY5A 3OF6A 1XSIA 3A4EA 5DEFB 1FFXA 4JKWA 3D8CA 3QNEA 1L1FA 1E8WA 2N4IA 2WB1A 2OMWB 2RIKA 1I9RH 4XMKH 3VUAA 4Z7NF 4Z7AA 4I0PB 2BVEA 4F8PA 2NQCA 1AQDB 1T2JA 3GDCA 4PR5A