3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
2YEVA 3AT8A 4X8AA 2HVJC 5EBLC 3KG2A 4H33A 2EIMC 3HPLC 4MW8A 2WLIB 4MTGA 3SYQA 4MW3A 4LBEC 1R3JC 4J9ZB 5B1BC 3AGWA 3E83A 3FB6C 3OR6C 4MVZA 3ZRSA 3OUFA 3F5WC 3LDCA 2WLIA 3VOUA 2GIXA 2QKSA 3E8GA 4RUEA 2A79B 1ORQC 1OCRC 3E8BA 4X89A 3SPCA 2EIKC 3LNMB 3K06A 4CBCA 1OCOC 3ASNC 3ATAA 3ABLC 3ATFA 2H8PC 3E8HA 5KUMA 1KKDA 3OR7C 1J95A 3FB7C 3AG2C 3K0DA 4QNHB 2WLLB 5EBWC 3STZC 1R3KC 4P30A 3ABMC 1V54C 1BL8A 2DWDC 1R3IC 1P7BA 2Q67A 5E1AC 3ATBA 2JK5C 4P9OA 3T4DA 3K0GA 4JTCB 4JTDB 3RW0A 3UM7A 1QLEC 3RBZA 2EIJC 4LCUC 3T1CA 3AUWB 2ITCC 2Y69C 3LDEA 2DYSC 4EKWA 2KB1A 4G27B 4RO2A 4KFMA 3ASOC 4WFGA 2WLKA 2AHZA 3ATDA 5CBHA 3LDDA 4MTOA 1G4YB 4HYOA 3LUTB 3ABKC 2X6AA 3K04A 5EK0A 1K4DC 3STLC 3SJQC 4MS2A 1OCCC 2R9RB 1S5HC 2W0FC 3AG1C 4GX1A 4MVRA 3F7YC 5EBMC 3SPHA 5B3SC 2X6CA 2BOBC 2HFEC 2WLHA 2BOCC 3WG7C 2Q69A 4PDVA 2A9HA 4QE7A 4I9WA 4XDLA 4GX2A 1M56C 2EINC 4MVQA 3K03A 5IY5C 4OXSA 2AHYA 3PJSK 4DXWA 3E86A 2WLJA 3ZJZA 3BEHA 2X6BA 2EILC 3IFXA 4PA3A 4XDJA 3ATEA 2WLMA 4XDKA 4GX5A 4R50A 3SPJA 3R65A 3K6NA 3T4ZA 3TETA 3K08A 1ZWIC 2K1EA 4MVOA 4H37A 4WFFA 4PDRA 1JVMA 3UKMA 1U4FA 4PDMA 4WFHA 4X88A 3SYOA 2IH1C 2QTOA 4G28B 2Q68A 3X2QC 3OGCC 4F4LA 3TCUA 2HVKC 2WLLA 2ZXWC 3OUSA 1LNQA 4J9YB 2ATKC 5BZBA 1OCZC 4ZBMA 2Q6AA 2OCCC 3F7VC 3SYAA 4QE9A 4JTAB 3SYCA 1N9PA 2HG5C 4TWKA 3SPGA 5EC2C 2P7TC 2WLNA 4RUFA 4MVUA 5J9PC 1V55C 2DWEC 3VSQA 4MVMA 4UUJC 5CBFA 3T2MA 1U4EA 3AG4C 3AT9A 3EFFK 3E89A 4HZ3A 4GX0A 1XL6A 2HJFC 4MTFA 4P2ZA 1M57C 2IH3C 3GB7C 3RVZA 3FB5C 2ZD9A 3E8FA 4PA6A 2A0LA 1R3LC 4BW5A 5CBGA 3SPIA 1K4CC 4RAIA 2E4FA 4PA4A 4LP8A 4P9PA 4MSWC 3FB8C 3JYCA 4WFEA 5B1AC 4R8CA 4MVSA 2ITDC 3AG3C 2NLJC 5KUKA 1XL4A 4PDLA 4R6ZA 4PA9A 2DYRC 5EC1C 4PA7A 3SYPA 3RVYA 3IGAC 4R7CA
chains in the Genus database with same CATH superfamily
1NEZB 1GM8A 3ESPA 1YEDA 4OZFA 1Q6HA 4QRPA 3VH8G 1NDGB 2PP8A 1OT2A 1MCPH 5FO7A 3I6KB 3AGWA 1KC8W 2XXCB 1SJEA 4HWZA 3KPNA 4N9GA 4GS7C 3HKEA 1PAZA 4K94C 3SDAC 4B9KC 1EAPA 2EZ0D 5K59E 2R69H 1EQWA 4U7MA 4XCCL 4JANA 1OM9A 3T6VA 4PJHF 4FX5A 2EDQA 5I1LB 3S3PA 1JGEB 2A4EA 4K3HA 3JARA 4BXVA 3K58A 1N36B 1SC5B 5DFTA 3SDAD 4P2CG 3BX7C 1L9PA 3O3DB 4G1MA 2F7IA 5C08D 1M7DA 2A9DA 3B5HA 1K8DA 3AZUA 5IHBA 5CO1A 3TZVC 2ESVE 4AM0Q 4KKQA 4JANB 3OPZL 3MJ8A 3U36A 2DV6A 4M3KB 5HYJB 5JDSB 2HRLA 4DQOL 1M7XA 1H2SB 1YYLL 1PSKL 1BZDA 4R97B 4G59C 4PGBA 1AQKH 1JFFB 1WIOA 2JTYA 4YNYB 3HW7A 3AQZA 4WI0B 1I5XA 4JF3A 1L3NA 5HHOE 3KAAA 1SA0B 4OLVH 4ZYKB 1NL0L 4XNUH 1FN4A 3JUZA 5FYKE 3UC0L 2QQNH 3L3KB 1UUNA 4XNQB 5E24E 2V3EA 2BOCA 5J56B 4Z77A 1CXKA 3EJQA 2OCHA 1T89A 4JGMA 3NEOA 3ZDZF 5L6YL 4JFUA 4RDQG 1U9KA 4GUOA 4YHPA 3IC9A 1JPEA 3UXFA 1ZWIC 2Q7NA 5LG6A 4AM0B 1CDBA 1E5CA 2ZOUA 2BVOB 1OSEA 1R5VB 2DTSA 5CSZA 1CP9A 2J1KA 3LSOA 4RZCA 1XCWA 4KX9A 3JSSA 5EEWA 1TMCB 2NXZD 2WTRA 3KYKL 3RGHA 1BFVH 4ZPTB 1TVBA 4IMKC 4X6CB 2EJ7A 1EN4A 2P7TC 3FL7A 3IGAB 3MV8E 3P73B 2AXHA 1MI5A 2DTML 4JHUA 4JRYE 5LOVA 1JPFB 4Q6YA 1HH9A 3LSUA 2NY7H 3ZS8C 4TLKA 4BFKA 3UT5B 3PU7A 3RDTB 2JJTC 4PLKC 2QSTA 4ZX3A 4KOBA 3W37A 4XPAL 2F18A 1ZE3H 5ENWB 3T3PB 1PQZA 4MJHA 4AYID 1PNDA 1KIPA 4QRTA 1H2NA 4OCSL 3GMLB 4UNVA 4FZ8H 4NRXB 1J5EB 4LDOB 4ZXBA 1M9WA 4FNLL 5KBMA 3FB8C 4H25A 5FKPB 4OI9A 5I23A 1RUKH 1BZ7A 1XL4A 1I7ZA 2JIXD 5HJ3B 1AACA 3MODL 1K34A 1KGXA 1WFMA 4K94L 4WNQB 3VA6A 1JFHA 3CD4A 4L8DA 4PH8A 2VDOH 1AH1A 3FUKA 5BVPL 2WLIB 1SQVH 4HJSA 5DUPL 4HEMA 5FHAL 3E83A 5B66Z 1OKEA 2P90A 1CGTA 4GO6B 3VB9A 1S9YB 2Z1KA 1NC2A 4IIJB 4QIWF 1F1AA 2H8PB 3WENA 2P7TB 1YNLL 1HSBB 3GHPA 3LN5A 1BJ1J 1FG2A 1G7JB 3D8MA 1CD0A 3G5XA 4I0PD 3RG1C 3QYMA 3ZRVA 3WS3B 5T5NG 3F8UB 4JFZH 1RXLA 4AIOA 3CHSA 3GTNA 4QNHB 2UXCB 1X7QB 3ESUF 3IYLW 4K07A 4R7LA 4YDLC 3JALB 4P9OA 3EOTH 5I1GL 4XCEA 3ZE0E 5JJEB 2MOQA 3NG5A 1FLRL 3LRSA 1V05A 3L48A 4AY0A 2KQMA 4GY4A 1Q0YH 3IXAA 2DN9A 1EGJA 2VLRD 2YIAA 2YQBA 4XNAA 3FQTA 3PL6A 3H3BC 4JRXA 3K4DA 2WCPA 2AJXL 4ATWA 2XFGB 3LUTB 1G6RH 5DRZB 4LKXA 3KW7A 3DMMB 4XN5A 4JI2O 5T8IA 5JXEA 5FK9B 5GRVK 4MQTB 1MWAL 1UD3A 5CILH 2APSA 3FBQA 4JASA 3BN9D 5FV1L 4KQ0A 3ABUA 2R4SH 2ZUSA 4RFEA 1RJYA 4JPIA 1UM6L 1Y18A 2JKTM 2XICA 3N0PB 2YEQA 3EYUL 5KX5A 1N3NA 3BPCB 4K55A 3KLDA 4N2EA 4H5SA 5F71A 1K6QH 4WDIA 4IBVA 3S3CB 2K1EA 1GAFH 3WHE0 1RIVH 4F2MB 1T83A 4UT9H 1IGYB 1NU1H 4PGEA 2OMBA 4MDIA 5D1ZA 1JV2A 4L29A 4F37F 1OT4A 1Z32X 2NY0C 4AITA 3QIBA 1W72H 4A5UB 3JD1A 4IK6A 3WN5A 4AV4A 1Q6IA 5D96B 2EDBA 1H3TA 1IARB 3RWHA 4FJZA 4CRPA 1S0VA 4PJ5D 1N64H 1U3NA 4UT6A 2QWNB 1VQ4V 4CN4A 5LYJA 5F2VO 1E67A 2P67A 1L9TA 1NC2D 4U3XA 1FJGB 5JXED 2GBOA 3E3QC 2VDQL 3HS0C 2GSIB 4FYTA 1I53A 3EGDA 4HWBH 4MQXD 1JP5A 2MPVA 2YAPA 4WKXA 4X4ME 3GIVA 1WWCA 3F83A 4XVJH 4HETA 2ORBL 1P4BH 5D55A 5HD8C 4JM2A 3B3IB 1DK1A 3PAVA 2MW2B 2BSBA 3HBZA 4NHCL 2FECL 3BP6A 3KYMB 1S78D 3AUVA 2ICEC 4D0CB 2LVEA 3QQ4A 2ESVB 3C5XA 5HVWA 3RKDD 1W15A 4FLYA 4E2OA 4FFZH 4FQHB 3UEZA 4OB5H 3H7BB 3L75H 3B9DA 1NEZG 1ZAUA 1OGAB 4PJ7F 3H6JA 2GK0B 4LARH 1TJHL 3ZHUA 4W6XB 4R4BB 4MB5A 4I85A 2F5AH 5I8OL 4LBEC 3CBKB 3MLUL 2YUVA 1WA0X 3IDIB 5ES4B 4P9HL 1E6JL 3RKPA 2CA4A 3O9WA 3CE1A 1AKPA 1EZUA 4N3TA 2P5PA 4P5KB 5F6IC 2AQPA 3VFOB 5MP6L 1KU9A 3A22A 4KPHL 3RUGB 5EZOH 3T0VA 5A40E 5H4YA 2PYJA 2ZCHL 1F4YL 1NIDA 3QFGA 5KBLA 2WXOA 4HPHA 3HMXA 4KQ4H 1YMMD 3TIEB 1NBQA 1IE4A 1UUSA 2WB7A 4LGPB 4N2MA 5E1AC 3GSRB 3IETB 2RMNA 3RW0A 4UCOA 3SDCB 3UPCA 4LCUC 1DJZA 1N5AA 1O9HA 2YGPA 2VKWA 1WV7T 3KWWB 1FBIL 4PJGE 3UP1A 3HB3B 3WNIA 4DQOH 1PF3A 5FO8A 3SDDA 3LKPA 1FGVH 3QDJD 3LH9A 2K9PA 2ZUUA 5FS5A 5CWSA 1IQDB 3QXTA 4ZW7A 3W57A 5DMYA 4I1RA 1R6VA 2VLRE 4UT6L 2AF2A 1CZ8H 3UT5A 2QQNL 5EU4A 1JGIA 1VEMA 4X5XA 3RWCA 1PZDA 3T4AB 2W0KA 2K4AA 1NPNA 5D7IF 3DO7A 3APDA 3BKML 4FKHA 4XAKD 4X64B 4LWSA 5LBGA 4YAQA 1F58H 2FSEA 3GSVB 4LLVB 3AM8A 3D50A 1A9EB 4EAEA 1TVBB 3IE4A 4DEUA 4HX1B 1FORL 3B2PA 4ZXBB 3VMPA 4X7SL 3NJLA 3O3AB 3T2OA 4GYCB 4WFFA 2OJ1A 3VXRD 5BXFB 1KECA 1QHQA 3HG2A 3GBDA 4P49A 2PPCA 1A6AB 2AXFB 3S36L 1D3CA 3BVNA 4HT1L 3THML 3MOBL 5HDBE 2HVKA 1G0DA 1HNZO 1BF2A 5FYJU 2DY2A 1PCSA 3KL5A 3CFJA 3OC5A 4IIQC 4M5TA 2ZCKH 3T8XB 2C9PA 3PL6D 4JRXD 2VERA 2CLVA 2BNQB 5ICUA 5MEQA 1J1OH 3TEWA 3UQ8A 1JZHA 4XNQA 1SFDA 1J0HA 3AG4C 1U3HD 1TXKA 3QYNA 3VRLF 4HZLA 5CLZA 5BMVA 3EGSB 4OJDH 5E8NA 2QADD 2FR4B 2FO4A 1YEKH 4I5SA 2EDTA 4E5XB 5HHMD 3CLFL 1CBVH 2K70A 4L4VD 1G7MB 1AGBA 2X1PA 3A4DA 4U3FH 3SGEI 3RFZB 3S48A 1KB3A 3WG7B 5I2IB 2PWHA 2CKBL 3INUH 4OD1H 5MEQB 3VXNB 3MMEB 2ZNJA 2O5NA 4AL8L 5JW3L 1KDJA 3SO3C 5T1KB 1RVFH 4L5FL 4BCYA 3GPEA 4E9WA 2IADB 3O3UN 3EUDA 2G60H 4DGUA 1PKXA 2ENQA 3L9BA 2HFTA 3E0GA 3PHQB 4JO8A 3UG5A 4QY8A 4R7DB 4XXWA 1DVFD 3V6ZA 3DYOA 3CV5A 2GTWA 4GXVH 5E6RB 3H56A 4G6FD 5JJJB 5F7EH 2CBPA 35C8L 3HBGA 3DXRA 3GBLA 3FB7A 4H1LA 2Y7MA 4MCZB 2Q8AL 4OD3L 1OCRC 1G1KA 1X5JA 1MWOA 5JW4N 1IVTA 3KNBA 1TYEB 3KPNB 1WWWX 1BVNP 1SFHA 3QP3A 2WVSA 3X12A 3GRWH 3TZVD 4Y5VC 1ESOA 3Q3GA 4FDWA 4X1IA 2ZR2A 3K3WA 2XYCA 1UH2A 3G5VA 3BAKA 4GRLC 5BQ7B 1WS8A 4M8VA 3HPLB 5JZ7D 2NY1C 4PJ9A 3ML9A 2OZ4H 4GBXD 2AKRB 2P5WE 3K0GA 2NXYC 4LSSH 1Q8MA 4J3VA 3F6LA 3FTGA 1B2WL 4PJ5B 1A6UL 2EIEA 3CDZA 4WHDA 2CDGA 4F9LA 4J8QA 4UQEA 3BH4A 3O6ML 3NZUA 4LOUC 5B8CC 4OUOA 3D0VA 3I02B 4GG6E 4Q9QH 1LK3H 2OWOA 2W65B 3FN9A 4BIOA 1SN0A 5IW1A 2XFXB 4N1HB 5IHWA 4N0YH 3ZHSA 2HJLB 2WZ0A 2X12A 4WWKB 5EIIG 4GUPB 4LLVA 1KJMB 3HNTL 4G7QB 2Q69A 3L70H 3ZZ1A 1MCQA 4LLWA 4U1NA 2WP3O 3Q44A 5AVQB 5LHIA 3U6RA 1DQJA 2AXGA 1MFEH 3WLBA 2ZJSL 2J6EA 5JXEC 1UXSA 1E3XA 5EB9A 1S2EA 1O7SA 5KSUB 4B9PA 3DSQA 1CICA 5DDHA 4HNAB 3BHBB 1TQVA 3GSWB 4DKAA 1YN7B 2F58L 1ED3A 1TU2A 3L4WA 1KXHA 2WIMA 2X4UB 5DURB 1R3IH 3V0GA 2F0CA 3UTSB 1ORQA 1HILB 5ACZA 3PNRB 3SKUD 1PNCA 3H7BA 3HC3L 5E6YA 3UZVB 1T1XB 1T1YB 1A6ZA 3WE6A 3EO0A 5EH1A 4G8FB 2JJTA 4GT1A 5LMUB 4GKLA 1EJFA 1ZLSH 2J5LB 3QCVH 5KZCD 1GRWA 1VF5B 1NMBH 1CDGA 1KENL 1SVZA 3Q2WA 2Y1ZA 5LBSL 4JBSA 2YR3A 1RUML 4U6XA 3U6XA 4L4TA 1IEAB 4PJ8A 1QLRB 4JI8B 1H9DA 4WNSA 1UJTA 3I50L 3RDTD 4FMVA 4HKZA 4E9QA 1ZLEA 3BN9C 1PPJH 1IQWL 4NLHA 1YPZE 3VRIA 3QR1A 3Q6FB 4XC1L 3RVWD 5I18L 2Y7QB 3K0YA 2AS5M 3M1CA 1G7HB 4MD5A 2FIKA 5EO9A 2WBJB 3QDJB 3MLZH 1S9XB 2AJVH 1U6AH 4G43A 4R7NA 3ZKMD 1UENA 3V7MA 3PREA 5HHVL 1CC3A 4NM8H 4PP1D 4M5YH 4NRYA 4ZI8A 3SGJA 2XAQA 2VOTA 5HI5C 1SF5A 3E6HB 4KMQA 3EJPA 4XMVA 1MRCL 3ETDA 2JI2A 4OFQA 1NBYB 3EFFA 3SKMB 3N1GC 4KKBC 1J9CT 2LLGA 4J39A 3UMNA 4PBDA 3D4ZA 3RWRD 4F7MB 4HJJL 5J1TC 1QI3A 1FFXB 3BPCA 4FFZA 4OZIB 2WAHA 3WSQL 3VNZA 1UKQA 3P3RA 2X4PA 1QABA 2F61A 3MRHB 3C8KB 3DX3A 5LCVA 4GFXA 2B9BA 3FRPA 3MCKA 2J71A 4BZ1L 2UU9O 1ZIBA 2P7TA 2ZF8A 3LS5L 4ESKA 4LLYA 3LXBA 2WWKT 4ETQB 3PDOA 3SDXA 4JI4B 4JREB 2JK5C 4QIRA 2CH8A 4OTXH 5EUOE 5GRYA 1S7VB 3RY6C 2C1PB 4N21A 5BXZA 3GGWB 1F1GA 4PJDF 4XMWA 4IMLB 1TTFA 5JIDA 1A25A 3MV7E 3FQXA 1H3PH 1SF3A 2QADB 3JVGC 4LVOB 4NC1E 3ZHLA 1G1YA 3WU1A 1KBVA 1SY6H 4PJEA 3SCMD 4EEQA 2TRYA 5FYJE 1I1AA 2VUOA 2BOCC 1IT9L 3VWKC 1Y18B 4KZEH 3L95A 4Z78B 1EGJH 3GSNL 5IB4A 5BRZA 4XPHH 4PS4H 4LEOA 5F6HJ 3D08A 4DP6X 3KGTA 4XO8A 1JOYA 4EO5A 8FABA 1IJNA 2ZDIC 3NP4A 4OLWH 3C5JB 3POHA 4R7DA 5EUKB 4Y19A 1A2YB 1MHHA 5IFHH 4X6DA 1FBIH 5C0DA 3UBGA 4N4YB 3EDFA 1Z5HA 4HSCX 4QXGH 5K1VA 7FABH 2D3VA 4NP4H 4MZRA 1NLDL 5AZEL 1A7NH 1CIUA 2NY5L 1K4CA 1CURA 2F19L 1SY6A 4HXBH 1IBHA 2YN5A 2DLIA 5MENE 1YECH 4KHXH 5ECGA 3U83A 3QQ3A 1G5GA 5LGKA 3ECBA 3L72H 1PZBA 2X4OB 1BX2B 1ET8A 1MH5A 5C09E 2B59A 4MNQE 1FVEA 3NIGF 1ZHNB 4CSZA 2OZ4A 3ZHQA 1S5JA 3IJHB 4I8DA 1AQHA 5JNYA 3SR2C 5T3ZL 3DYPA 3K6DA 2O5XH 4Y89A 5T1MB 1UJ3B 2J2ZB 5I74C 1D5AA 2EX3A 3OKNB 3VWKB 1AD9B 1U96A 4D0BA 1I08A 2O5ZH 1MFUA 1NAKH 5AOJA 4BK8A 5EIBC 1ZLDA 2PTTA 2ZXAA 5IWLC 1IZJA 1GAFL 4GAJH 5GZNC 2QA4V 3JALA 3BQUD 4G7SB 1ZTEA 1GL4B 2ZUXA 2AGJL 2Q10A 5LGJA 3TNNB 1A3LL 4XMPL 3R7QA 3BY6A 1OT1A 1YZBA 5TQ2H 2BIQA 4NQCE 5AVTB 3RT3C 3K9AA 4DZ8A 4OCRL 4C58B 5K9QG 1KEMH 4QXTA 4YIPA 1P7QB 2E9JA 3DIFB 3DX4A 5IB3A 1IVLA 1WYJA 1G7LA 1AGBB 3CRQA 1AZBA 4H2CA 2XTAA 5C0NC 4HS3B 1PNLA 2Y9RT 2OS7A 3MGOA 4NRZA 4W9DC 3AAZB 4XNZC 1AJQA 1QCEA 2OX5A 3BLBA 2DBLL 4FG6C 4LAJH 4Y2DC 3KWWA 3UYRL 1LEGB 3KPSA 5EOCJ 1J5EO 5L88L 3KYKH 4YHHB 1K92A 5IROD 5K59F 1YTFB 4ZHQB 3NP3A 4DVRL 2NQDA 2XA8L 4WK2B 1TJXA 2Y4TA 1MEXH 2FB4H 3JT0A 4NRXA 5CKAA 4ZT1A 4LZKA 4ZSOE 3QO5A 1X6NA 1YZZA 4K5LA 4DR2B 2A5UA 3GNMH 4C83B 1U33A 5CN1A 1L9QA 3N9GL 4IGBD 5FPRA 5ISZA 2ICWB 5TE6L 1PG7X 2D7TH 3RTQD 4K5PA 4TRPL 5I16A 4NSKA 4Q0XH 4XPFH 4PAZA 1GR7A 3QNXB 3GSVA 2X2IA 2KQNA 5DJ0A 3WIHL 3WEOA 4BZ1A 5K5YA 2Z6FA 2VDOB 3II1A 3ZHRA 1T2QH 3U1SH 3HE6A 1AP5A 4QF1B 4FQLH 4JO4H 3T4ZA 1U8JA 2DQHL 2GUZA 1JF1A 4LOUD 1OY3B 3VXSA 1S76D 5IBTL 4V33A 2XOKG 1TUPA 4L4VE 4UAOC 1VIWA 5HHNB 1F11B 3C8DA 4CVZB 3EDEA 1Q9KA 2G5BB 2NXYD 12E8L 3CSYA 4MXQC 1FRGH 4U49A 1AB3A 4Y1SA 3T0EA 1ACZA 4PVNA 1F8TH 1NCOA 2XBDA 3OWEA 3L4CA 1N0NA 3C6LC 3GHEH 4XCFH 2FLBT 4JRXE 3EO1B 5IOPA 5J3HD 2X3BA 4GKJB 2V8MA 5DEJA 3S3SA 1NTMH 3PABA 1JGUL 4XGZA 2MHAA 4IKNA 4PG2A 1P0SE 2DQEL 4JFDD 1RLWA 1P9MC 3QORB 4EJ1C 2AV1B 3GDCA 2EIDA 1ETA1 4GAGL 1YEIH 2OCJA 3V0JA 1ZS2A 2PWFA 1BZEA 3ALPA 3NRPA 1F18A 4GW5B 2ZM6O 3UH8A 2BO0A 2IWGA 4FI7A 1OF2B 1B9ZA 4FFBB 2XWZA 2WQUA 5LBSA 2OSWA 4P59H 2JLPA 1SKVA 3T2PA 3QEUB 4KWUA 2BH0A 4ZQTA 4P3CL 2JKNA 1E4WH 4LVNC 2BW5A 2R9HD 4JDEB 2OR8A 4N3UA 5FW8A 1OAYH 2FB5A 5BJTB 1Y6NR 7TAAA 3ETBF 5CZKA 4EKJA 5GISL 3OG4B 3DIFA 5FO8B 4WTZA 3U2SA 4QXWA 3SYQA 2VN7A 2JCCA 5I1DB 4Q9CA 5JORB 3VD1A 2EXWD 3I50H 1EXGA 2Q7YB 3FNKA 2B9ZA 4YSOA 2KPWA 1ZLUK 3NBNA 4W9JC 1FFOB 4WFBV 2ZJSH 4CBCA 3QJTB 1KCSL 1MG3C 4KVNH 3VGHA 5CGMA 3DGDA 3UAAA 3ABLC 3NIFB 4XBEL 1FDLL 1Y0LA 4OSUL 4PJAB 1YC8A 2G9HB 3JWNH 1IKOP 1N6QH 3GVMA 3VI4B 5DFVD 4PRPB 4DR3O 3OTOO 1U8QB 3MUY1 2E7HA 1V54B 1M2VB 4TNVK 1NOAA 4OI8A 3TVMA 2HRHA 4FLXA 2NQ3A 3N06B 2BHUA 1GM9A 4L5FE 4FI6A 1OIOA 2EO7A 1AI7A 1FVEB 2HUHA 2A9BA 5J2TB 2NMSA 4I3SL 3UFIA 3LEYL 2W9DL 1AXTH 1N10A 2EIZA 1RHFA 1BZ9A 5HHOB 2C9SA 1ERNA 1XREA 3DX8A 3V6OC 1AS6A 1VFAB 3W3BA 5I76B 3PHOB 5MHSE 4KK8D 3K03A 1J87A 1LM8V 3GBNL 1QSEE 1JRHL 3TIDA 5I6OA 2JSFA 2A73B 4OLYL 4QPEA 2ZKWA 4AH2A 4J23A 5E6ZA 4G83A 5EZJA 4JFHD 4HGKC 3KGRA 3VFWA 3H54A 1U6AL 3QXVA 2IMMA 4DV1O 1YMHB 4JFTA 1U41A 1B0GA 3DX8B 3RVXC 1JV5B 5JOFB 2R2EA 3D12B 3JCUZ 3PAYA 5IM7B 3FYIB 5DA4A 2BSKA 5EOTA 2Z8VC 4UQCA 2XZAH 4JTAB 4KXRA 1VPOH 2WWOA 3C2SA 4E9LA 1JZJA 2Y1VA 4FNPA 3EKCA 4AOFA 3IB4A 3UAJA 3IMWA 1H8EG 1SLVA 4XX1G 5GRJH 2B3RA 4MMXA 1T66C 4W4LA 4AEHL 3EFFK 2CCWA 4IRZH 4M7LH 3MV9B 2VXQA 1IAOA 2R9AA 1OE2A 3UO1H 4L87A 3HG1E 4I0KA 1Z3RA 4TVPH 1GTFA 2D0FA 5DRNB 1W0KG 3ZY7A 2XV0A 1C5BL 3HA0A 2KZ1B 4U31A 4GT0A 2E3CA 1N32B 2F5BH 3LQAL 3KEDA 4OD2B 2AABL 3TPKA 1MJ7L 5L2KB 2O26U 2H41A 4NN5B 4I0PC 1Z9OA 1FCGA 3PQYD 4WFFE 4MJIA 2FIKB 2LT9A 3DV4B 4MVBD 3K8KA 5I19H 4N8CH 3CHXA 1FP5A 1XSKA 2ZOLB 4JI5O 2XWXA 3GXNA 5T3XE 4ADIA 1ROPA 4JKNA 1DJWA 3KLKA 4Z7UB 5AWNH 2HKAA 4PQXA 3RYHA 1MZEA 2XG4A 3FO2B 4CS4A 3FAWA 4U1SA 4YWGL 5JW5A 4J1UB 5ESAA 1D5ZB 1RURH 3C5ZD 4OCRH 4NZRH 2WQWA 4UM9D 1AVAA 2IAMB 3L7FA 2OMYA 5DO2D 1I9RH 1R19A 3DIDA 4HKXA 3D3VD 3PNWB 4PJXE 5FGBA 1HN1A 3P3YA 2Y06L 4KV5E 4U3SA 5FAAA 3HAEG 4O2BB 3ILPB 4APXB 3L6FB 3OV6A 2DQFB 3LRHA 4DGVL 2AK1H 2MKWA 4KAQL 4TUJA 2FJUB 4DW2L 1KJ2B 1VFUA 5DO2C 1CT8A 1HYSC 3ECVA 3X11A 1RULH 1RZPA 4FNRA 3KWXA 2VRAA 4FQJL 4NM4H 3BHBA 4PWIA 3P4NB 2JKWA 1AO7D 1BXAA 3D85A 3IK2A 4KKNA 3CSTA 1DEEA 4MNGE 1HWWA 5CBHA 2IANE 3US9A 1Y6XA 3B77A 1AXIB 4EB6B 1SXCA 1J5DA 4AL8C 2WXLA 3LN9A 1OCCC 3K5LA 2DQIH 2O6DA 1PKQB 4QHUA 4Y16B 4B3EA 2F1EA 5HHNA 1F0LA 1XEUA 2W0PA 5F9JB 4F57L 3V8OA 3C8HA 5F7NC 3BWUC 4DK0A 3GSOA 1JPGB 4R26H 5IR1B 1KCWA 4X99B 1KXQE 4O02L 2PN5A 3CSGA 2V6HA 2ZE5A 3NH7L 1FZOA 4PTTB 5L4JA 2GIMA 4L5FH 4U7KA 4PG9A 5FUOH 3HNSH 1NH6A 2DN7A 3WTXA 3JAMN 3VG0L 1IGFH 3S37X 1S8DB 3V5DB 1BPLB 2J73A 4K0KO 2MOGA 3MTXA 2ZXWC 4J27A 5FM5M 4X98A 1YNKL 1DBKH 2NW2B 2VB5A 3Q3GB 1XHXA 1NBZA 4X99A 3QJSB 3L3KA 1KELH 4G5ZL 2XKNB 5ALBH 3DETC 2VXUL 1FS0G 1DFXA 1U92B 4GLRI 4UT9A 2W0FB 1M05B 3FU8A 5EBMB 4GG6A 3NFSH 4KDVA 1J8HD 4ABQA 2Q7YA 4LPTA 5DRWB 1KC5H 2IBZH 4HZ3A 1OZTG 3AG7A 2CIKA 3RWGB 4PJGA 4D6TH 3WFEH 5I15H 1IDSA 2OMZA 2OJZH 4R4FH 3N40F 1IAIL 1U8JB 2NX5A 1JJOA 5I0WA 2FUTA 5DK0B 3FU3A 3TXSA 2ILMA 3BLPX 2WYTA 2DLEA 4LPWA 3TBWA 2VL5A 1HWHB 4OGXL 4PUBL 5IZ7A 1N34B 3NACL 4ZW8A 4L8BA 3BAWA 5D7EA 3JWNG 4MB4A 4KV5F 1PD6A 2YUWA 5BS0D 3K6FA 7PCYA 1OWWA 5ETUA 5HHPB 5T1LA 3T0BA 5LMNB 2VRKA 2Y5TB 3C08L 5HHOD 2FX8H 2VR5A 3C2AH 1EN6A 2OXHB 2LW7A 1MY7A 2DWTA 2J56A 2UXGA 4M6OH 1A66A 4PWGA 3QORA 1WISA 1F45A 1LD9B 4IHOA 1NGQH 3A23A 4B27A 2CHDA 1IXBA 4CNIB 4ABMA 2CAKA 5E9DA 4F7CA 3HEIB 3QUKB 3NESA 5DEFA 4KKCC 3ZR6A 4XBEH 1NLBL 2EEFA 5CZRA 2DL2A 1T1ZA 5DT1L 4ODHL 5EA0L 1BM3L 1F3JB 4MX7A 1HWGB 5DMKB 2DMXA 1YG9A 4EUPB 1EDQA 3RHWK 4WI2A 2ZXQA 1F2XK 3BO8A 3OZ9L 4A7GA 1WWBX 4O58L 5E8OB 1VIBA 4WUUB 1A6WL 3LX9A 3T1CA 4F7CB 3MUGB 4ANUA 2K3HA 4GAJL 2QV4A 5I8CB 2ZZUT 1ZLVK 4X6CE 1QHPA 2OW6A 1NMBL 2EDHA 4O51B 2AJZB 2W9DH 4XRCA 4BE5A 5FOJA 2XV6B 5KSBF 3S5LA 4WTQA 5FUCC 3CC4V 2OYLA 3FU7B 1UCTA 3UM7A 1NWPA 4G6JL 5DHVB 1JZ8A 5E4OA 5F1SA 5G55A 2Y0IA 2XN0A 3LN4B 5D7KD 5HXMA 4DK1A 2DM3A 3G5ZB 1MH5B 1NCJA 1F3DH 1TQCB 2E75B 3O4LE 4O2CB 4WSGA 2R0ZH 2XN9E 1MIEH 1U3HC 5DEGA 1N4CA 4ZOBA 5LMUO 4IBUA 1E1QG 1S5IL 3MACL 3PUUA 3CVHA 2Z31D 1RZIA 2D7PA 5FA4A 4OJFH 3G4SV 4Q6IC 1RFDL 3MOAH 4J4PC 3RVWC 5CIPB 32C2A 3LHPH 3MLXH 4H8QA 4FM1A 2F9BT 2AZ0A 4R7VA 3OB0H 1PLGL 3ZTNH 4JY4B 4K23L 1DVSA 4XT1C 1LP9A 2BXZA 4UINL 5AVXB 3T0EC 5LDSA 3GBEA 1E43A 1IBLO 1MVUA 3C60A 4HWBL 3RJOA 3AG1B 2YBRA 3EGDB 4YXKL 5MI0C 3BT2H 4HDIA 4YUEH 4I4TA 3D39E 1U4EA 4U6VL 5I1LA 4JI7B 3FT3A 5C92A 2EZ0C 4NJ9L 3VXPA 1J5CA 2XTJB 5F7LB 4Q8BA 4UDTB 5D8JL 4A55A 2X9XA 1EK3A 4HJ0C 1WB7A 1S7XA 1EN5A 4DV3O 5CEYB 3QI9D 1A9BB 3S7GA 3TVMB 1QSZA 4J80A 5AYTA 4XNDA 2KKQA 4M62L 4PREB 1OPOA 2QSCL 4H2AA 3VFRB 4A7SA 3HTLX 4XXDB 5LBVA 2SEBA 4DIXA 2GTZB 3TT3L 2Z5UA 4QHUB 3MO1A 2VR9A 4P9HH 5ILTH 5LQBH 3KE0A 4NFBA 3L3GB 2UWEB 3NZHL 1KUQA 3MVSA 2IEPA 2YAOA 1WC7B 4RGNE 4TV9A 3SKOA 3CJHA 2V5SA 2ZG3A 1T2JA 3HC2A 4XPAH 3QRGL 3HR0A 2H1XA 3MXVH 3FYEB 43CAA 1RPUA 5DWUH 2BCCH 1ZSHA 4FXKC 3S8WA 1XEDA 1KCVL 3IDUA 4K5NA 4JO3H 5DRNA 1CICD 4H0LC 4J3OG 4KY1H 3WY4A 5GIRA 2CMRH 1FPTH 4JO2L 4YK4C 4PI2A 4IU3B 2ATAA 2DWDC 4DO5A 1A4JA 2VERN 3ZMNA 4F2MA 1A7NL 3EIFA 5IT2L 3H2PA 1UA3A 2AK4A 2IJJA 4JHAL 4P46C 1QEXA 3SE9L 1N4XH 3TC9A 4KKPA 4TNFA 5DTFB 1ENVA 1PMYA 3G04A 2HKOA 2D31A 4QLWA 3N2KB 1X7TA 3NSJA 2OBGA 4AGMA 2D7QA 3D25A 4GJTB 3FULA 2VIRA 2VZSA 1VEPA 5ENWA 3GEWB 4TQFA 3D85D 3NTCL 4G9FA 1NMAH 3GHBH 1FFRA 1KYOJ 4WV1B 4QY8B 2WZPA 5DD0L 2EINC 1TZHA 2IXQB 2F7RA 3P4LA 1HKFA 4AENB 5D6DA 2FO1A 3RTQC 1XZWA 1A7OL 2QELA 5L2KA 1AE6L 1SXSA 5C8YA 2ENYA 1AP2B 3EJSA 2CDFB 4OR1A 1NR1A 4KOCA 3WJMB 1YSCA 5BS0B 1EHLL 3S98A 3DUUA 4DGIH 5I1KL 1UVQB 2MFNA 3NDZE 3SBPA 1WG3A 1FJ1A 3FMGH 4KI5C 4BH7A 1NZ6A 5DJAB 3H1LH 1UKTA 2WLLA 1FNSL 3G5WA 2ED7A 1T7YA 2VZOA 1LNQA 2IPUK 4M6ML 3AM8C 2BC4B 3GSNB 3OR6A 3FT1A 3EOAA 1TUBA 3JWOL 3HR6A 1TYRA 1TTBA 2N05A 1WJZA 4HNAA 4PFEA 4KMLB 2Z35B 1NGYA 1EXHA 4LKXB 3DX6A 3RWFA 3UIZA 1M2OA 3WFCL 1BEYH 4A37A 4P5SA 5F1OB 1HT6A 1YSOA 1MN4A 2OPCA 3G9AB 1VQLV 4R26L 5D7KE 4B3VA 1QYGH 5PCYA 3Q8FA 3EYVB 5JW3H 4EPSA 2FSDA 1E5YA 3AREB 1FZOB 4PTTA 4XZUA 4ZFGH 3H9SB 4X6EB 5DQDL 3AXLA 3P30H 2X2UA 1SLUA 5ITFB 1BWWA 2VW6A 2NZ1A 4D7PA 1KDIA 4JB9L 4OLUH 4DUXA 2IH1B 1MHPH 5H6QA 4RWHA 3X14B 4P23D 3VRLE 4JM2D 1P4RA 3P9MA 1O9ZA 1WP8A 2ADIB 1MNUL 4OFKA 1QFWM 4J10A 4QJ3B 3VRIB 3K46A 5B3JF 4EN3A 1LEKB 1P2CA 1OAXL 2Y2TA 3DRQB 3ZE1B 4XPTL 4AJVA 5JZ7C 3L1EA 3BO8B 2VM9A 2C1OA 4PEEA 4I1PA 5GGRY 5F1KC 2KZWA 2X1OA 3BQUC 4N86A 5ESQA 2V2TA 1KJ2A 4MQSB 3BKJL 1F23A 5CHNB 3ASNB 2N1KA 4RMSA 3VGAB 1RZKC 4WHTA 2PTMA 4LLDA 2F7QA 1HZHL 2R1YA 3IF1B 4LCCA 2XKNA 1E9QB 3QPKA 4M7ZB 4NNXB 2F54A 1QA9B 3ABMB 5F7DB 3MUHL 4HU8A 2DWYA 4DEPB 1QTSA 3T65B 1BD2D 5FM4A 1R5WA 4O4LA 1B4RA 3OAAG 3B8NA 1YY8B 1AO7E 1WZ1H 2C4FT 1HHKA 2Z8RA 4PJ9D 4YHYC 2RA1A 4XI5C 2IPKA 2ZUVA 4KRPD 4NCC1 2JJ2G 3D39B 4PGCB 4EI5C 1R4XA 4LCYA 1E7VA 1XSJA 3RL1B 1IC5L 3HG5A 4P57A 2LU5A 3WFEL 2FO4B 4HMDA 3APMA 2DMKA 1TTCA 2VDKB 4HUUB 5GGTA 1SHSA 1KTLA 4YDKH 3POCA 4GXUN 5F9JA 3BDBA 2HYMA 3ELQA 4PU2A 4D0CA 2CDGB 3E8UL 4POUB 1AQDA 2ZX9A 4POZC 4GG6F 1S8DA 3V5DA 3F58L 3QIUD 4KO7A 1NANI 2HUEA 2ZAHA 4YPGB 3ZTDC 5KN5B 5LA6B 1G1XB 4HT1H 2KUTA 3BUDA 2FR4A 1LEIA 1NGYB 1AGFA 1JI1A 3VQLA 4ZKIA 1KY7A 3LKNA 2DQUH 4J28A 5D5MA 1X9UA 5DN6G 3OKDB 5IJBC 5T3XD 2M2DA 2PLTA 5H8DA 3QTCA 4RGNB 5CD3B 3D6GA 5I1EH 5DUML 2NY4B 4KRLB 1KPVB 4WFFD 1G9NC 1LDPL 2VC2L 5IGXH 2BIIA 2WOBA 2FGWL 1EBAA 5H37A 1W0VA 4I77L 1DQML 1T5KA 3JV5A 5EU3B 3F5WB 4HIXL 3T4AA 3I56V 3DVGB 2DQCL 4BSWB 3HG1B 2Q7GA 5JOPE 1LO2L 4C4KT 3PG2A 4K71C 4MA8H 4QI3A 5JW4M 2IAND 1YN6A 4Z5RB 4AYBA 5IDJA 1A7PL 1VFAA 4K15A 2QM7A 3LKPB 3B6SA 3FUDA 2WBWB 3SE4C 1OTSD 5CA1B 1JPSL 3IN2A 5DZ9A 1ZHNA 1CJYA 4KHPO 5JUEL 4OM1H 4TTDC 4HAGA 3MRKA 1EUUA 3C6EA 2J8UE 4JKWA 4ABUA 1W6WA 3ZZQA 1I9IH 3FU5A 3D85B 4X8CA 2MCMA 4D7BA 1GTNA 1TCRA 2YPVH 4OT1H 2DLFL 4PRBA 1HR0B 3EUUA 4S2SB 4XBPA 1LQBC 4G2AA 5F89B 4KVCH 4PJEF 4I5BA 4XOAA 1SJVA 1RMFH 3OTOB 1JIBA 3ZDXF 4DV2B 1NIBA 4OH2A 4JO3L 3TBTB 4JN2B 4LFHD 2ZE0A 4IOIB 5PAZA 1JMKC 1TZOA 4OQTA 3E8HA 1PJWA 1NFDB 1QFWH 4LCIL 4CC0A 4MMZA 1A6AA 1Z9MA 3WS6A 4KUZH 3ZKSD 4JJ5B 3VH8B 2BJMH 1ZVHA 4IBTA 2BERA 3R4RA 2XBZA 1W9XA 4NKMA 4EFBA 4QHLB 4N22A 4RDBA 5CEXA 2VC2B 1CF1A 4WUUD 1HJBC 5TGBB 2YPVA 3CCMV 3RILA 4KNTA 1M1XA 2WKLA 4OJEH 1DVTA 4QAWA 2ADQB 4LHUG 4YDJA 4YHML 2Q8AH 5LNGA 1JG9A 1FAFA 1HTYA 4DFIA 3R66A 4MS2A 3QAQA 2P42B 4M1DH 3FTZA 4JAMB 3GRWL 4LRNH 4L8CA 5C6WH 2A38A 3U0WL 3VI4E 4Z7WA 4HJTA 3QWRD 3WFBH 3W9DA 1RP9A 2HCZX 5LHGA 3FK3A 2WUBH 3ARVA 4ZXBD 2BIMA 3KYNA 2GBAA 3DX7A 3RB5A 2XQBH 4DGIL 3SQBB 1JZ6A 4WTWA 4UB6Z 3A0RA 3P4OB 3ZCCA 1EEYB 4Y5XB 1FGVL 4ELDA 3ARBA 2A9AA 3DX6B 3PWVB 5IHUH 5L9DL 1U4FA 2WZ5A 4MA7H 4G1EA 4O2BA 3ILPA 4ZX5A 4O58H 4L8CB 1X5HA 3IGLA 2AI0H 3MBEB 2UYLA 4PJIF 2FTKA 1ORSA 3DX7B 4J3WA 1CS6A 1KULA 2ZP0T 5KSAB 3FT4A 2DWEC 3M6DA 3FUJA 3B09A 5TF1L 3F04A 3HE7C 4MTMA 3EH5B 2HJLA 3ULUD 1D5NA 1QATA 2RTTA 1MLBA 3O4OC 2AV7B 4GX0A 3AWFA 2QFRA 3SGDI 3BAJA 1F4WH 1KPUA 5CR1A 1SDDA 3PYCA 3EHBD 1GVIA 3CXHJ 5J1AA 2UXNA 3S36H 1CVSC 1FIGL 1MCFA 3Q06A 4JGUA 1JGLH 4ZD3L 1HC1A 2J1XA 1T1ZB 3GM8A 3QPXH 4GQQA 4HS8L 5SWSE 3N41F 2NSMA 3TVMD 4YDMA 2ZSWA 4P2OA 3IJEA 3QO8A 2IU0A 4IBQA 3PV6B 1D9KA 4Y7MA 4I5BB 5LXTA 4OJYA 1TENA 3FTVA 4XNMA 3NABL 4FQXD 4WHTB 3DGCR 3D4YA 4XMKL 3TNMB 2Z8WC 3RUGF 2BINA 1G0XA 3ZHVA 5JYLA 4MJ2A 2NUPA 4Y4KB 5HDLA 5F1NB 1JNHA 5DSCA 3Q4HB 2EQDA 1A7OH 1DLHB 1T0PB 2AXTZ 3FBKA 2CE4A 5AW1B 5C0GA 2DKUA 2NY4C 1BYPA 3UCSC 5GGVY 2H26A 4H13B 1DE4A 3DX9B 5IVXF 4DVRH 4JYBA 2QBWA 4K3EH 4FG6D 4PGCA 5EF0A 5K39A 3ZYZA 1GM7A 1V3JA 2WXMA 1NWOA 4W1TA 4PJGB 1YHQV 2JNZA 2BHFA 4JGNA 4U1JB 3IU4L 5HP5A 3B2UD 2CK0L 2Y23A 2C3WA 4DP1X 3NSYA 5E8DL 5IMKB 3T1HO 4RGOL 4YXLL 2YPKB 2EDMA 3VRJA 5EOQL 2VDLH 4H0IA 4QRPD 1PL4A 2R9RB 2DWSA 3AMLA 4GSQA 5DD5H 3VWJB 4TNWK 2GTQA 4ODTL 5LA6A 1H8OA 1IAIH 4B3MB 1EBPA 4PS4L 4TVUA 3JVGA 5EIQA 3MRCB 1HCFX 4UWQB 4MJ6B 2WCGA 2A77L 2WBJA 3CDFA 2JB5L 1KG0A 1JTTA 4Y88A 2WN3A 3QIBD 2A83A 5CD3A 5J8OA 1GCYA 3JD4A 4P06A 4ZW6A 1HE7A 3F58H 3FOLA 4F5CA 1MHPL 4NPYA 3V0VB 4Z3JA 4NNXA 2QR4A 3UTSD 1BBJB 2DTMH 4H20H 1BX2A 3HC0A 2FEEI 4TVPD 3OR6B 1NDMA 1XIWC 1KSRA 3T1FA 3TCUA 1XMWA 4FTDA 1OZUA 3E1ZA 1FVDB 5I71C 3HNTH 3KZ8A 4PBXA 5IKCB 2E74B 4NI6A 3EFOA 3FB6A 3AW5A 3ILDA 4X9QA 2H1LM 5L4FA 5CINH 3F84A 1GZHA 4WGKA 1P5VB 1U95A 4TQDA 3KXFB 5F7UA 5IROC 4I55B 4MTFA 2UUCO 3M1BA 4UIMA 5J13C 1TPXB 1CQYA 2Y6TE 1TMQA 3QG7H 3GDBA 4LLDB 4N0RA 5H94B 5B3JE 1I0HA 2CO7A 1K9MW 3OZ9H 3G08B 4AQYB 1OAYL 2WBJD 3DSNB 2ARJA 3A6CL 3T65A 1NCWH 2RB8A 4XBGA 1H3WM 1FFPB 4P3DB 5B1AB 4RSYA 4IS6B 1JPXA 3RKDC 5HHXL 3SE3A 2J5WA 2JI3A 3IFOB 4EQ3A 4WI4A 1DBBH 2CO7B 4Q6IA 1LO0L 5MERA 3H01A 2UUCB 2J6EH 2PW2B 5LP6A 5IWAO 3ILQD 4KVCL 5IUCA 1I7FA 4L23A 1P6FA 2CAZC 1CLYL 2JQZA 3CN0A 2R0KH 4XNYH 5I66B 4YJ2A 2VR4A 1L7IL 2C1OB 1KN2L 3GS4A 1M71B 3MRFA 4NQEA 3LKSA 2K6WA 4XX1E 1V3LA 1Q0YL 4FHKA 4UNTA 1Q9OB 4NQCD 3SY0A 4TLSA 4UCFA 1EEQA 1XR8A 5KTEH 2OYQA 3BJLA 2WN2A 1UZ8B 2EIMB 3TPUB 4JFED 5KVEE 4Z8FL 4LFCO 1VADB 1BL8A 5EMYA 5SX5H 1VERA 1G6RL 2MNWA 2PYFB 2X4QB 3GFUA 5GSVA 1LTXA 1UD4A 4KKAD 4KKLD 2MQGA 2UVEA 3NK4A 1EHNA 1KXVA 4ZMPA 4OX9B 3KPPB 2VMDA 3WS6C 3FKUS 4MA3B 5I6LA 3C6LA 3X1BA 1KTDA 2HLFD 4JFQA 1WBYA 4J8RA 1I7TA 3GIZH 3N2GA 2EYSB 3K04A 3DRTB 1QHOA 5KW9L 5GZOA 4L05A 5K9KA 3ARBB 3SOBL 4Q0XL 1EAOA 4R96B 2XDHA 3RIAF 5EZLB 4Z7AA 3V0DA 2M7WA 1R3JA 1N67A 1IM9B 5EOCL 5ADPH 5J0BA 5JO5A 2C3VB 3SKJH 4IOSD 4DKEL 1GZHC 3ILEA 5HGAA 2ZP8A 3HS0B 1F4XH 4YHZH 1BIIB 2C34A 3MGOB 4N20A 4UBDC 4NKDB 3BWSA 3FFCA 3TT3H 2ZSVA 3QFJB 3EDKA 2FATH 5D1ZI 5JCOA 3LRLA 4BELD 4BCXA 1CG9B 4JFEA 3RGVD 1HZHH 2OR9H 2PYEA 4R84A 4O4YL 3WIIL 4F2ME 3PFUA 4JM2F 1M1XB 4YC2B 4LF6B 4HLEA 4PG2C 3MLSH 3OMAB 3DJ9A 3ARDB 5E6SB 2DLFH 4LIQH 2HP4A 4JDZB 4ZO9A 3SPVA 2AW9A 5K93A 3ZDZE 1IBGH 3MRBB 2YIBA 1JGUH 3HI5L 1LO5B 1E9OA 1XEQA 1YF2A 4MHHG 1J10A 3BGFB 5D9SB 2EDKA 3F7QA 5HI4D 5C0BD 1FAIL 3O6FB 4JM4L 1R34A 3HN8A 5IK3B 5CA3A 5F9WB 5HGBB 5A2LH 1ZXKA 1GXEA 3S36X 3ULVH 2ADPA 1RUKL 4LOEA 3VD3A 2F23A 3K7UA 2FNWA 5KVGE 1K4DB 2VCOA 4ELKB 4JUTA 3IMTA 1XB6A 1NTDA 1H3PL 4PJEE 3CSXA 3QNYA 1XNQB 2WP3T 3VFVB 3I75A 1S9KC 4ZOAA 1F3DJ 2CDEB 3EYOB 4UCRA 3NA9H 4V1DD 4BAYA 3BFRA 1WICA 3SGEH 2EJRA 4L2YA 5HHQA 1IU1A 1WAAF 5E2UL 3W82A 3MRIB 4WBNA 1OGAE 1KMIZ 3CFDA 1NSNL 4ZUWB 3QAZB 4HJIA 1T5XA 1RJLA 4RAVB 4NUJB 4GMTH 3UACA 4AMKH 4B3RB 3IAPA 5I17A 1KNOA 3MBWA 3OJVC 3L3IA 2AEQH 2FO8A 2XTJE 3LCYA 1I31A 3I2CH 1F4WL 4NO2A 5F88B 4AUJA 3JASB 1U8QA 5F70A 1H2LA 3QIBB 4IOIA 4JY5L 4YHKH 3TN0C 5E6ID 3QHFL 4ZTPL 3VXUE 3VTMA 4UQ9A 4FTVB 2ZKXA 4WBNB 3WEBA 1NS1A 2QPUA 4KUMA 1I1YB 1U8IB 1VMGA 4I1NB 3SDYH 1QRNA 2NOYA 1GJUA 1AC6A 4GOSA 2GV9A 2ICCA 2C7FA 1R3IC 3H4FA 4HSQA 5I6MA 4ZMAT 4EZKA 4I48A 2QKAA 1DL7L 4YDLB 3GMOA 1PS3A 4EUPH 4HIJB 3ZGIA 5K1PA 4DKFL 2O61A 1P4UA 3KGSA 4M7KH 2MHAB 4OM1L 1AGFB 4F3FB 2L4OA 3DMMA 4JFWA 3TBWB 1RZJH 2Z34A 1OCZB 1IGJB 4JCLA 4O02H 4DHLA 4DPAX 4HSAC 3NH7H 1U8CA 1QHTA 3UTTD 2HFEC 1S7WA 1WSST 4ZSOB 2HFFA 3OKLA 4LH7A 4PJIE 1AAJA 1NOFA 3LPFA 3MRMB 1NKOA 1WH0A 1S77D 4UT9L 3H1KH 1AILA 4YSQA 1MCNA 5ITBL 3U82B 4AIXA 4AYFB 3VXSE 4GKKB 3CXHK 1X5AA 2GVYA 1G1OA 4H88L 2IDFA 5ANMA 3LEXB 3WKMH 3DWTA 1SHMA 3QJOA 1JCKA 4J6IA 3UJTH 3UTZA 3RFZC 2E7LA 2DOSA 1ADQH 4PDMA 1WP6A 3ZT5A 2WBJC 3NQIA 2WWWA 4YDZA 2J4WH 3S35X 2FIRT 1B3IA 3D48R 3LN4A 1XF2A 4DFHA 1A7RH 4RQFA 1KP3A 1NC4A 4P04A 5D9SA 4ODWB 2X05A 1ZS8B 2CO3A 1TQBC 2ZT9B 5F7KC 2PW2A 1XDTT 3PGFL 2H3NA 4OCWL 4FQPA 4D3CH 1C5CH 2MKLC 3VFGH 4B3SO 4KFZC 4RMWA 3GUFA 2GFBA 4Z7QF 5CGYC 3HKCB 4JI0B 3BWAB 4GG8B 4I3RH 4UTAA 3FO1A 4UOJA 1Y0LB 4HAKA 5AUMB 5CUSL 4MJJA 4JRYA 5C07A 4AYGA 2GY7B 3HR5B 3K81A 1QSVA 3QBTB 2F8OA 1NTZH 3QZWA 4NB7A 4S0TD 1FZKA 1NCCL 2VLLA 1AGEA 4GBXC 1D9KD 5BXFA 1A4AA 5ISZE 4PA4A 2ZDIA 3UTSE 3L5WB 4YHPB 3IBEA 2GSGB 1N34O 4GFTB 1GGCH 4YHOH 5B38B 2B3IA 1D5BB 4C7UA 2XZAL 3CZNA 5SWQA 2W5PA 1CFNA 1WZ1L 2Y22A 2J8UB 2BSRB 2Z4QB 4JI0O 3DXAA 4XP4L 4PRIE 3TF4A 3EBAA 3PAUA 4E9TA 1RK1A 1NGWB 4FKEA 4QRQB 4DV6O 5JIMA 1UOWA 1WCBA 4UZSA 2E3VA 1WP7A 1U36A 4LF8B 3RGBA 4FQXB 4GRWF 2Y5QA 4PJFB 3JTSB 4LO9A 4QYOA 3GMNA 4JQVA 4X89A 1T0NA 5C0AA 2J21A 4RAUA 3V4LA 3ZBMA 1B6UA 4W4NA 1JPGA 1J8KA 2OSYA 4EUPG 3FCBA 3A6CH 1N2RA 1UEMA 1NCWL 4ZAKB 4EDWL 4YXWG 2DI8A 1ZXQA 3KPMB 5DVOA 5F96L 4R90L 5LUMA 4TSAL 4TOIA 2LU4A 3MJ9A 4PJFA 5ILTL 1OAZL 4RX4D 3MNZA 3LNEA 4ENED 4NM4L 2WIIB 1ZD6A 4JHZA 1M6UA 5F44A 3KVDD 3L71H 3ARSA 1NTKH 3IJ9A 2WXQA 1IKFL 2EE9A 3ZIAG 1IFHL 5EBWA 3ASOC 2AAAA 3G6JA 2HHHB 3KLHD 1BAGA 3OQ3B 3ZDZB 4QDGA 4P48A 4LSQH 4XWOC 3CCJV 3FH7A 1H8NA 2YD4A 4XMLL 3SJQC 2AW2A 1SPDA 1F4NA 1Z2GA 1HCVA 4QRPB 4HZAA 4XCNB 4JL2A 1R24B 3MN8A 3QH3A 1EA9C 4F33B 5C6PB 1LO2H 2GBUA 4I4WA 4YHLH 3VFPB 3CLEL 1TQTA 1A8ZA 1CXHA 2JGDB 4APXA 4ZIBA 4MRBA 1M3JA 3CMOL 5TPWL 5DS8A 2JKRM 5E9AA 3T5WA 1KLGA 4D9QD 4X6CF 3NIDE 4EOWH 1RL1A 4HUXA 1XF3B 5HJDA 4GI6A 1W8EA 1G9MC 2HVBA 2VXSL 2DKSA 4YDIH 1MCOH 4F8PA 1ND0B 4NUPA 2LFRA 1JYWA 3RYHB 2XG4B 2H47C 1H3VA 3CPLB 3CWBH 3IJSA 2NXZC 2EH7L 2OTUB 5DQ9A 4XP5L 1AQ8A 3VXRE 3CFIC 4U3CA 1ZMYA 2BCKA 3QUZB 4NN6C 2Q6AA 2YXMA 4A2HA 4L9LA 4RWYL 5SX4H 3WMQA 4OLXH 4AK2A 3SPGA 1RM1B 4ILDA 4FTVD 1R6NA 1ZTXH 3UBHA 3ZL4L 5IKCA 2YQGA 3BAXA 5JQ6H 4P5MB 3L5XL 2X40A 5D7LA 5E7FA 3SKJL 4XP9H 2Q9LA 2QPSA 3GSUA 4N2GA 5IJDC 5J9PB 3B8YA 3RZWA 4E42B 2N56A 1KB5B 2ADFL 3MJGX 1QLEL 5AW0B 2JI1A 5CB4B 1EJ6A 3EYSL 1XF4B 2ZNXA 4JHBA 2OSLB 5JHBA 4KUZL 1RD6A 1YEHL 2A0LA 3VXNA 1BQUA 2PR4H 1THZA 1WFUA 2F08A 1UPGA 1INQA 2FKXA 3HHSA 1UQSA 5L2KD 3OSVA 3R1GH 3RWFB 3QDJE 1QI5A 3K6SB 1J5IA 3MRLA 3HKDB 1UOKA 2VDRH 3GO1H 4PS7A 5D2NE 3OJ2C 3MRJA 4PJXF 1IEBB 5F7YC 3ZK0A 2MWCA 3IGFA 3SO3B 3R0MA 2X6VA 1QBML 2EILB 4YFEA 1QZNA 3SQBA 3LDBC 1H5BA 3QJHB 1AXSB 4X8AA 4D7TA 4MW8A 3S0PA 2ZX7A 3EFDL 1GYAA 1SOQA 4YX2L 2NXZB 3P2BA 2UXBO 2QKSA 2GPZA 1MJJA 2ENJA 4JO2H 4UQIM 4Y5YB 2ZOTA 3MZTA 4XVOA 2PWEA 4FI8A 1INDH 2F53B 3TFKC 1S3KH 2KDGA 4QEGA 3S3BB 5C8JA 2OP4L 1ZGLB 1U30A 5EU5B 3B7TA 1LEKA 4DR7O 5ICYA 3NACH 5I1JH 2JCCE 2DQGL 1SQFA 2E46A 1NUGA 1P7BA 1V7ML 1GAXA 2P44B 4DKDC 3OKYA 2LVCA 5IEHA 1FRGL 3O3BB 1KBHA 4L0YA 4H8VA 3KVPA 3ZDXE 1TSHA 3CFNA 3HC4L 2P9RA 1UWEL 4BCZA 4IIZA 3LJ3A 4MTOA 2VUYA 2Y2YA 3ABGA 1NDGA 1TZHB 2BWDA 5HGBA 4OCSH 1AE6H 2JF1A 4M43L 2NT0A 3NN8B 5FPIA 5AW5B 1W8OA 1RZIB 1CN4A 2KG7B 2P6JA 4JGSA 4DV2O 3PV6A 5AYUH 1I3GL 2BZ7A 3V6FB 2Z3FA 3ARBD 3BUYB 5DZJA 2EP6A 4WWKC 4ELKA 1C16B 1S9WA 2RFXB 2B0SH 3KJ6L 3T3PE 1NC4B 3ZJZA 3HG3A 1B4TA 4U6YB 1D6VL 5IESL 2ZKHH 3NDYE 4YIOA 3PABB 4XGZB 1A9BA 4QOKB 1JWSB 3CDGA 3C60B 3UJTL 1ZDQA 1MCLA 4MVOA 3MX0A 5INDA 4HIEB 4I9QA 3BWZA 3R8QA 2X88A 3K8MA 3QR0A 1KZYA 2H5UA 3F7LA 3N3EA 3D69B 4G3YL 4NZ8A 5ANHA 4F4LA 3PDGA 1S9VB 5J13B 3DSFH 4UQ3A 4DTGH 1YUHB 4QHKI 5INCA 4OLEA 3WJJA 5I8CA 3DPBA 1HKLL 4XCEB 1XIWD 4KJYA 1FA4A 4FG4A 1XO8A 4DGVH 1RU9H 3HFFA 1MCDA 2KSDA 1SOXA 1UXWB 1BBDH 3U46B 1NT2B 2GCYB 3IJ8A 1VQ5V 4NQTA 5H2FZ 1QQDA 4ONGH 4ZAKD 2ED9A 2PI5A 2IDTA 2LTQB 3W38A 3O8XC 4NO3A 3OPZH 5AVYB 4FCHA 1R5IA 4HS6B 3G6BA 4LLUA 4OF6A 1HHKB 1G87A 4KX8A 1N8RW 4H8WL 1N32O 2PCFA 3SDAA 3U1PA 1BF5A 2YXVA 1XVSA 2JVDA 2AJUL 1ADQL 2FBJL 2XBTA 3KPMA 5TDPA 3SD5A 5C2UB 3MLTA 4N8VG 2J4WL 2COVD 2PCPB 2AJXH 1QPXA 4MFHA 2R59A 5F1IA 3DECA 1HEZA 4LF9B 5TQ2L 3ZTEA 2IWKA 1K8AW 3NCJH 4JRYD 5C07D 4OQTL 3BP7A 4NBXB 3F5WA 2JFCA 3VGDA 15C8H 2RIKA 3T3MF 4LEEA 4BSVB 1X5IA 3BI9X 5DRXA 3J07A 3HMWL 1QKZL 2FHFA 1SXBA 4A66A 5FIEA 1TT6A 2I60H 1YPZF 4YDVA 4NO2B 4DVBB 4J9ZB 4A7GF 1SBBA 2WQAA 4MXWH 2ZR3A 1WGVA 1TO5A 3HE7A 4FK5C 4FRWA 4QHNA 3O65A 5DEGB 3MUZ1 1OZ0A 1R3HB 2J8OA 3B37A 5KG9B 4RFNC 3D2UA 2QGBA 2I07A 4QGPA 1RM1C 3NIDB 2AXWA 3HLKA 2H9GB 4K7PY 5DURD 5JA8B 2OSXA 5KSBE 4KTYA 3C3TA 3AVEA 3GLEA 3HS0A 1D9KC 4UDUA 2CNYA 2X70B 3ATBA 5KHKA 2RHEA 4NFDA 1ZLUH 3UGXA 4W93A 3L4VA 2RQEA 4L1BA 3QUGA 2MK3A 1L1FA 4FQIL 5LDUA 5BO0D 2CO4A 3GF8A 4KROD 3BRGC 3TH3T 4WNQA 2GFBB 4B08A 5I9QB 1IFRA 2IG2L 2BRQA 2C5DC 2ESVD 2R8SH 5CZVL 2MQ0A 3TWCH 2NTFA 4EN3D 3JSNA 2VZ3A 2QJ1A 3O4LD 4QKTA 1UQSB 3OZKA 3QG7L 1AQDB 1J0ZA 2VM3A 3W2DH 1U0QA 2N0MA 1RPKA 3OHXB 3I6LE 5JTWA 4PRAA 3ZHNA 4NUGL 3CXDH 2PY5A 3QULB 5KVDE 2GUOA 1XMQB 3LD8B 2PXYA 5DD6A 2E7BA 3TYGL 1M71A 3WD5H 3QEQB 3LS4L 1FH5H 2XYBA 1JN6B 3RL2B 3CDZB 3MRNB 3ULVD 2E27H 1YLBB 3V7AE 1RURL 4U3HA 5BO1L 5EO0A 4DKTA 1IIIA 4JFFE 3HKCA 3BWAA 4XPGH 1E4KA 5I5MA 1S5HB 2BVPA 2F58H 3SGIA 4JI1O 3RY5A 3VFTA 4F7PB 5I6NA 4JNXA 3SDDB 3JARB 1PDKA 1DZBA 2VIRB 2TSBA 4XP9L 1O7DC 1YEWA 1AC0A 4W4OA 4W9GC 3WIFB 3MRNA 1SHWA 2WTPA 4YPGA 4XO3A 5GGSY 5DUPH 1YEHH 1DQJB 3ZIMA 2VS0A 3C75A 4QRRB 4F27A 5JDSA 5HYJA 4DV3B 2BP0A 3WO4B 3CZLA 3DO7B 4PCTA 1RUAL 3AFLA 4CUCA 1F90L 4DOHE 1ET5A 4NYLA 4A6YB 8PAZA 5KBPA 3QQ3B 1KIRB 1KPRA 3ZRWA 1DDHA 4BH7B 2R39A 4AMXA 1G6RA 3PWLB 5C08E 4OLXL 2BE3A 4G9DA 1S78C 5D7JC 4Z3HA 4PLJD 3Q8CA 2IALA 3BN3B 5JQGA 3IFNL 4D8PB 5CBAB 3DX1A 1ACCA 3OLEA 4GQRA 3D30A 1CLZH 1Q94B 1HHJA 2K9FB 4XOCA 1KB5H 1JZEA 3FUHA 2ZKYA 4FXGC 3T09A 4D7SA 1UWXH 2F54B 2I32A 3M8OL 4W9ZA 4ZAKA 4HIQA 1VENA 1PX8A 4NTXA 3OVUB 4EOWL 4PTUA 4DT2A 4PJAE 1BQHA 3QNEA 1VFMA 3HUJB 5BMFL 4LSUH 2XC8A 3BXNA 3WYRA 4EBQH 3EAKA 2A2QT 4DP8X 1MAKA 1A4KB 3INOA 3UBFA 3IFPA 5ITFA 1T5WA 3VD9A 2EINB 5KBNC 4O9HH 1MFBH 1YNKH 3GK8H 3QC6X 2J20A 1OB1B 1TFHA 3SODB 3APQA 4RNRB 1B6DA 1DQVA 1NEZA 2Q1EA 1K72A 1WPCA 1GGTA 4AYSA 3TS8A 3I9AA 4BZ1H 4I2XA 1WZMA 1OGAA 2H26B 2ICWI 3N91A 4U2YA 5IFAH 4ZW3A 4ODWA 4LSTL 1P2CB 2XPGB 4J41A 4IBZA 2UVFA 1INDL 1QNZH 5F3HA 2W0FC 5EBMC 1JHTB 2YWYA 3C3SA 3NAAH 2WLHA 4NO3B 5B38G 1NPUA 2B08A 2B1HH 4ZUWA 3W0WA 3JWDL 4U1JA 4YHNB 1YNTF 2F1MA 1D5IH 3BP7B 2A0LC 3LH8A 1SESA 2HTLC 4XNMB 3VQ1C 4ZI7B 4A04A 2UUAB 5JPNC 4ZDHB 3ZPDA 5IVZA 5L8LB 3EJRA 3L9DA 3ZMTA 1CCZA 3II3A 2IAAC 5LGYA 4K5MA 1LE9A 4PDRA 2V9QA 5ESAB 2OL3A 3FSZA 3JVFC 4L18A 1B0IA 2WCSA 3B9VA 4B9YA 4XVJL 3X2QC 5IUSA 3F7YA 3RWIB 5E5MB 4Q14A 4CH3A 5FF6A 1FVCA 4GBXB 1SN2A 1TKWB 1T0MB 3U0PB 4TV8A 2O4EA 4PB9L 2MCPL 1JYVA 1AIFA 3FQXB 4NQXA 5F3BA 5EEYA 2Q86A 1JV2B 4L29B 1AJ7L 1USZA 4HIJA 4PJCF 4AVIA 1XNQO 3OX8A 3P4OA 4Y5XA 4CS3A 4UDUB 2OSLA 4OF8A 4FAAB 1XIWA 5LJYH 2JXMB 3H9SD 3GKZA 1OQXA 5IJ9B 4BKLB 1OGTB 1KJMA 1OXYA 4WWKD 1QPPA 3IDIA 3MX0B 2UYLB 1LK3L 4GUQA 5CZXC 1I1FA 5I1IH 4AT6A 2PCXA 1RUPH 2CO6A 4HBQA 2WYHA 4FFVD 4JL1A 4OQTH 3ARQA 2P8MB 5BOPA 4U3JA 1T6WA 2F2HA 1EJOH 3A24A 1S9YA 3Q0HA 4OZIF 1SNRA 4HIIA 3WDIA 4PA7A 2X4SB 3JUYA 1WCQA 5FW7A 3LZFL 2O5XL 1RZFL 3ELAT 3FRUA 4NYKA 3L54A 4L1HA 4CDHA 2UV3A 4KKLC 3I9GL 4Y4KA 4GO9A 4KJQD 4A38A 2ITDA 2XQYG 4S1SH 2YPLA 1AXSA 2EDEA 3BKCL 5AFAA 5DQDH 4UTAH 4OGAD 1FFNB 3UAFA 2CR3A 4KTEH 5FX3A 4PY8I 1RUQH 1GGUA 2HX9A 3ARGA 2GIYA 2YD7A 4FP8L 4YSSA 1TQCC 4X0NA 1PY4A 4I89A 3KKYA 1RZKH 5KA5A 1XGQB 1R3KC 4GIPD 3TV3H 1HL5A 4Z0BH 1NKDA 4OGQC 3V6BR 2LAGB 4LCWE 2C9UA 3M1BB 3TU6A 1PM9A 3G5ZA 5LHDA 4ZFOA 1RUMH 1D7CA 5EO9B 2W59A 4FL4C 5CZVH 3BT2L 1XV8A 4OX9O 3MDJA 3INUL 3TBSB 3TBYA 3K4ZA 1ZHLA 5JIHA 4X65O 4HD5A 4H5SB 4I50B 4JG1H 1LP9F 1PEWA 1QFPA 4PV8B 5A2CA 3AG1C 4LFBO 1FV1A 1LVEA 5I75B 4J42A 1DN0B 4NYLB 4A6YA 4N90D 5HYEA 4J3SA 4AHCA 1GOFA 1XH0A 3B9KA 3CMGA 3QJZA 3LB6C 2IVFC 5FWQA 2HVJB 3FSWA 3IDYB 3HHMA 4QOKA 4QHMB 4RGMC 1NKGA 1R0AL 1Z3GH 2BJML 5BS0E 3NJJA 1MNUH 2HLAA 2OR7A 2P1YA 4PJCE 3DHJA 4Z7VA 3OPUA 1KTCA 1TCMA 1J1PL 2ZCLH 5D70L 2DW4A 2P47B 2GEQA 2V7HB 5E95B 3SJVB 5MEPB 1EO8L 5H9CA 4KBPA 3DOSA 3E35A 4RFOH 4D2NA 4G9DB 3WU2Z 4IOFD 4UAOB 4TULH 5C3LD 1K5SA 5GSRA 1AYOA 2X3CA 4QXVA 4AILC 2A73A 2JS5A 1G9NH 2J44A 1ITBB 2W9EH 4HFWB 1FIEA 3N1QC 4LOVA 2F54E 3G5XB 3MLYL 4NJAH 4EUPA 3RFZA 4RRPG 4G2KA 1JGDA 1XMQO 3Q2VA 4OVUA 1SQXH 2HJFC 1FZJB 2OTLV 3I84A 3H0TB 3H8NA 4JFYA 3T1FB 3HLAB 2EVJA 1I3RB 3VXMA 4QXGL 4AMWA 5E1HB 1FIGH 3VYPA 1AG0A 5D1QD 5L9DH 4HS8H 3TM6A 1BSIA 1R3KA 3LXCA 3RVVD 5CN0A 2F68X 3DKHA 3G9VA 1Z5VA 5E00A 2NT1A 3KM1A 5T5FL 2R9HC 2V5MA 2JGDA 2CR0A 3C09B 4WCYH 2P4KA 3HRZB 5DO8A 5F1NA 5I2IA 1T04A 4WFHD 2YFOA 5CN2A 2DWDA 5K9OA 5JPNB 1Q9KB 2FGWH 2G5BA 2IGTA 3QO1A 4J5VA 5TF1H 1UB6B 1ZVYA 4DR1B 2XUWA 2E5LB 1UOVA 4FERA 2FWOA 3ASWA 1HKLH 3CPUA 4J3OF 3DIVA 3FUIA 5C0CE 3HKBA 4FF9A 5DJXB 3LZLA 1DCEA 2WQXA 1ZLWH 4HX1A 3E8GA 5BZDA 4K94H 5GHWL 3ZMSA 4LFBB 2Z91B 6TAAA 2WVTA 2W07B 1EHLH 1AHWC 4JFDE 4K35A 4XXCC 1AROP 1AR2A 2D73A 2NY6B 1YI2V 4K3EL 2YEZB 2DQJL 1MFBL 3IRPX 4S1DD 3QQNA 3GIZL 5EO0B 5ISZD 4M1GH 4XMXA 4I0CC 2Y69C 2VDKL 4EKWA 1HINH 3NXSA 2J6WA 4U1GC 4JQXC 4IRJA 4X5RA 4Y5XC 1J18A 5FHBL 3N5AA 3MV9D 2VRZA 1L6ZA 2Z93A 4GKZA 4ALAC 4AQ1B 4CILA 1F4XL 2VAJA 4DK5A 3GIVB 3Q6GL 3JAKA 3KYAA 1KB9K 1ILUA 4LSPH 3V79C 1BAFL 4NC0B 4X1KB 1AP6A 4WZ9A 3EH4B 3LHPL 3RA7H 3ZDYF 2YC1A 2EE6A 4J7ZA 4UI2A 3UL4A 3LEYH 5IB3B 2XTJC 1JQ0A 2OTWB 1MEXL 3HFMH 3S34L 3EYFB 4WHYH 2B5IC 2GB2A 1JI2A 4I9WD 3SDCA 5J06A 2V0AA 1IQWH 2IDQA 3OLGA 4ICWA 5B1BB 3CTTA 2A6DA 2X44D 2EC9U 3KCYA 4IHJB 1PL0A 1P5UB 1TZ8A 3S35H 3CMAV 4AEIH 2EUXA 1QNZL 3F6IA 4GP8B 1ACXA 4P2AA 3W7TA 1K5QA 4RMVA 2N74A 1CLZL 1WQVT 2VDNB 4KTDL 4ZUTB 4OGQB 4QHKJ 2IIJA 1T66D 2DH3A 2X0UA 4URTB 1YTFD 3APOA 4FLOA 2YD2A 4AQEA 3WB0A 2BNUB 1JK9B 1GS7A 1XMOO 3PXJA 4XE0A 2YDEA 2QSCH 3B5TA 3DUSB 1OPGL 1BJ8A 4ODVL 2K1MA 4HCGA 2CJUL 2ICWA 4DR6O 3KPOB 4CW1A 2ADYA 1NFDE 4D0DB 1K5WA 3BPLB 1OAQH 2OQJA 5C0EB 1AY1H 1MREL 5EYPB 5LVEA 1F7YA 5EF3A 5DJ6B 2XPZA 5DLLA 3TO4B 2A9MH 4ZRGA 1M9NA 3FO9A 3FTSA 3Q43A 4OBRA 3BD5A 2NNRA 4HD9A 1JPTL 2DIBA 4QRBA 3CVIH 1YYML 5M7QA 3SYPA 5E1IA 2PYED 4X80L 4IIQB 2X9WA 3OGOE 2YEVA 4GKJO 5C0RL 3TWYA 3N42B 3PDOB 3OJDB 4I3GA 4FNLH 1N0XL 4TMPA 1CE6A 5CSBA 1KIQB 5B1BC 1VF6A 3CIQA 4MJID 2CA3A 1NCHA 3HJ0A 2DQHH 4PRHB 3FRPB 2I25N 1EXUA 4QJ5B 1PLCA 5B38A 3WY2A 1NR7A 3BPOB 4N8CL 1IILE 3AWGA 3ZE2E 2IPUG 3EDDA 3UYOD 1FO0H 1BS3A 2EIKC 2KLTA 3L74H 1MRFH 3AROA 5L0QC 5IQNA 4K9JA 3MFFB 1M3IA 5I1IL 5CCKL 3K5OA 3AS0A 3JYBA 3ZQ9A 3GJFK 1HEHC 1CE6B 1ZANL 1T5XB 2Y0SA 4IM8A 4NCC2 1OHZA 4LHQB 1JHLH 1GHFH 1RPRA 2NQCA 4HHAA 4IDJL 4HOZA 1DBBL 2HJFB 3OAYK 5KJ7E 4W9FC 4AKQA 4KH9A 5IHZA 5FPOA 3GHBL 1JZ2A 1FC2D 5GJSL 2KYIA 4JFZL 3DOIA 3IAYA 4XMTA 5AAMA 1JMXA 3II2A 1F4AA 3SQRA 2O5ZL 1L7IH 4ODUA 1HX0A 4FQJH 2AJSH 3ES6A 4LKCA 5JHDE 5T1DH 2G2RB 1HL4A 4MKTA 3ZBHA 2D2CC 3UZEA 4DV4O 4KK6C 2IM9A 4U0QB 4YSEA 2VQ1A 2XWJB 4DP4X 3V9FA 2ZIDA 4MAUL 2JCCB 5ANMB 1X6LA 2RR3A 5HI3C 5I1DA 5KYYA 2R7EA 3QHZL 1L9OA 1ZL8B 3O8XD 2R69L 2F93B 1GKFA 2KC0A 1DO5A 3IDGA 4YBLC 4EIUA 4FZEL 5GS0L 3NCJL 2YXHA 4IJ3C 2ZIOA 1BOYA 2E7CA 2NR6A 1MSPA 3EOBA 1J8RA 3GD1C 4XMKH 4ZDHA 1ZLSL 1ZVSA 1KXQA 2NUTB 1F58L 3EJUA 4Z7WE 3UDWC 1K2DA 3TYFB 3WNJA 3BRFA 1YRKA 1KN4L 3MROB 2YLKA 3Q5OA 2Z3YA 2X9ZA 4X6DB 3T6XA 3KDMB 3SYAA 3FHEA 4N0UA 2V9RA 4NIYE 3HNSL 4LDCA 4EI6B 1WBYB 2CIIB 2UUDK 4GB9A 2ISDA 3H55A 1O7VA 4QO1B 4MD5B 4I0XA 2NN4A 1OSYA 1UD8A 2XWBA 5DMIH 5JW4R 3CVHB 4X65B 2B16A 4R96A 1FSKC 2OMUA 1PQZB 3ZHDA 2HFGL 2J25A 2IH3C 3EJYC 1NAMB 5FA3A 1VADA 2XZCL 5IJVB 2BFVL 4M1CC 5GPRA 1JZ4A 4PREA 2XV2A 1FLTX 1P84F 2OI9B 3DTXB 4IT5A 4NKDA 2AEWA 1I7ZB 3QH3B 3ZIYA 4F33A 3UC2A 4JFEE 4BFFA 2MPAH 2DEXX 5HGHA 3JASA 3RPIA 3SKNB 1H9VA 7CGTA 4JVUA 2YD0A 3NIGB 1OTSC 1CFQB 2UXVA 1C12A 3WE6B 5C86A 1M7DB 3EH3B 4JI4O 1SQBH 1YAIA 4U3JB 3HI5H 3LXAA 4XP1L 2EXSA 2PZSA 2BVOA 1IGTA 1SDAB 3LVTA 3B2VH 1TZGH 1ITCA 4AGQA 2AEQL 4HUVB 3ZQXA 4LSDA 4U6XB 5GGUB 4O5LH 3U9PL 5A6MA 2CBOA 4FG0A 2WSSG 3L5WA 5DI8A 2BP3A 4BWTA 3X1GA 2N04A 5KSUA 3ZYOA 1YJ9V 2J12B 4NQEE 2CH7A 2WUBL 1CL7I 3CFTA 3NFPA 4C8XA 4BWWA 5MEOB 2QMJA 4NQCB 1GOHA 3S8GB 3UJJL 3BCCH 2DAVA 1WTGT 5FO9A 3ULUH 2DQMA 4JHAH 4JE0A 3TBVA 1VSCA 5DR5H 2ODIA 4ZUVA 5FO7B 4P4RA 2R69A 5ACZB 1KEGL 1V54C 3I6GB 5CEZD 5D1QC 5E6IA 5J2UB 1J1XL 1ADQA 2HLEB 4UYPA 2DWDB 5K9OB 5E1AA 4TS6A 1PYWA 5MEOA 3L2NA 4M7LL 2KB1A 1IT9H 1E5AA 4DN3H 4CADA 3KYOA 4ELMB 5F9AC 2AHZA 1Z9NA 3IPBA 3PGDB 1C8PA 2VR6A 2XKUA 4L3CB 4R7XA 2SODB 3PJSA 2F43G 1ZK5A 4RIRA 1HU8A 1HYRC 4KTGA 3WKPA 3FD9A 4BFIB 5EU6B 4F8QA 4ECNA 5BV7L 3UPRB 1G1CA 5TE4H 3ROOA 1VCAA 3BVXA 2X6CA 1BAFH 4EIBA 1IE5A 4YO0B 5IY5C 4NQVA 3KWTA 3FMGL 3MCG1 1KBGL 2WLJA 3HPJB 5KWYC 1FZKB 1Q9WA 4CH5A 1AR5A 2VLLB 3PWPD 1WF5A 4MJ4A 4U1KA 4WQOA 3FN0L 3V0AC 2Q7HA 2B1AH 4FYSA 5FYLH 4N9GB 1RJZB 3O6FC 4M02A 2JKSA 1T83C 1T04B 1GKEA 2BCKB 3EDJA 3M8AA 4KHPB 2HP8A 2VDRB 3RYIA 1EX0A 4TM9A 4IQHA 4KUCD 4AQAB 4QNPF 1IJ9A 2VN5A 1I7UA 5IP4A 2R0KL 4XNYL 3P11L 5E2JA 4IBWA 2FT7A 3ZOAA 1Z5WA 1VQMV 2IGFL 4P5TB 1ZUQA 2KZBA 4ODXB 5T3XL 2JIZG 1JD9A 1FPOA 1RJCA 2CO2A 5I6XC 5H2BA 3D87B 2PGGA 2ADFH 3M17B 4ALAL 1TTRA 3EW3B 1OHHG 2R2CA 3T71A 3WDHA 4M61A 4RMUA 4PLNC 3D09A 4X1YA 2IOIA 1QFOA 3T0EB 2ZAGA 4U1HB 2EO9A 2QT6A 3AAZA 3U36B 3UROR 5MEND 3GMQB 4TTGA 2NY2B 1L6XA 5ITBH 1BQSA 1PLGH 3CBJB 4HFWA 4AQYO 2XU9A 3WMSA 3ZTNL 3RY6A 3N44B 2GC7C 3HKZA 2AP2A 3WIIH 1XCQB 4YR6A 3FTYA 3KPRB 4O4IA 2HTKD 2XN9B 5C0BA 1NFKA 4DZ8B 5IJ0B 2R2HB 2H32B 3IU3B 1BYOA 3UO3A 1XWVA 4NTYA 1XMOB 5I16B 3WTTA 2ZWSA 2LQRA 1XCQA 3BFOA 1VB9A 4DZBA 5IVXE 5FFOA 3CE2A 4NR1A 4PB0H 4MWFA 4ZFFB 1AI1L 5L2JB 1KF9B 2P24A 3Q6GH 4R4FL 3H1IH 1PKQE 3JWDH 3RI5K 4YJ3B 5BRZB 1SXZA 4JR9H 5AVSB 5KJRH 4NN7B 1N0LB 2W9EL 3MV11 2IH1A 1CICC 3SDLA 2JQMA 4JPVH 3PIQB 3BAYA 4NJAL 5CHNA 3VGFA 1UXLA 2ZPKH 4RMTA 5J2UA 4TL5A 4HQQH 1DUZA 4J4PA 4WIQA 5FGCE 1KELL 5KUMA 2CM5A 2C7UA 2WSKA 5KSBB 3AG2C 3SDCC 2E8YA 1ZPLA 1N6UA 2UZIH 3B34A 1O75A 3L7FB 4JRWA 4LCWB 2YO3A 1S7VA 2Q67A 2CGYA 3VGAC 2Y48A 2A4ZA 4A68A 4PW9A 1ZS8A 1ULVA 5K1XA 3N43F 2Y4UA 3EO9H 5FR3A 4G27B 4NXNB 1U91B 2IF7A 3V0HA 1ACYH 4JKLA 3RNKA 4BDVB 1OEZW 2D8KA 4IL6Z 4PJAF 1I1FB 4N6RA 1MFAL 1ZGLA 4YO0A 5DZVA 1VP7A 5J1AB 4TV9B 3SKOB 3E9TA 4N23A 4YSCA 3C5SB 1HL9A 2HTKC 3E8UH 5AALA 4JFVA 3SDYL 2RDCA 3GXMA 1IBYA 1IVSA 1CMOA 1BFVL 1MVYA 3QXDA 2APVA 1I9JL 2QHRL 3MYJA 4XP6L 3RPIB 4UTBL 4DXWA 2WJ5A 4IBYA 4YDNA 1I9EA 1INEL 3QDME 4LP5A 5KMGB 3D69A 2J3SA 2ZNIA 3NRQA 1TA8A 1HW7A 4HHWA 1MA1A 3SPJA 1CT8B 3WB1A 2CIIA 2NTFB 4JM2B 2BSTB 3GHEL 2XOTA 4FLVA 3OTTA 3VCLB 3IMVA 1IEBA 2QTOA 4LDLB 1U93A 1F5WA 1NGQL 2HVKC 1S6NA 2NYZA 4TSCL 5E4IA 1AHWA 3CXHF 5AYQA 3GSOB 2YKLL 3M7OA 1A6VL 4POYA 1BA9A 2HT3D 5AW8B 4Y2OB 4KK6D 1C16A 2L8AA 4BYHA 4KHTH 1BQLL 1KJ2H 4FHBD 4EI5D 4JAAA 1JK9A 1QACA 4RUFA 3J2PA 3MTRA 1VFBB 1IAOB 3VGGA 5DI8B 1KV7A 1QD0A 5TGBA 3U9WA 3VXUB 5B8CA 1KJ3L 2A74C 5CCHE 2A9NH 3FDWA 2YSSA 4FQ1H 4IYHA 5GS3A 1MHEB 3FO0H 1OO2A 1Z6JT 4WSKA 1B4JH 4NZRL 5GONA 2GJRA 1TTGA 1E9PA 3PWVA 5CLXA 5SWSB 4MLSA 3UPAA 2XZQH 5SWZA 1TYJA 2XJLA 1MF2H 4UCTA 4JYAB 2Q6WB 2NLJA 1D5XB 1E6OL 1HILA 1SEQH 2Y7SA 1FORH 1G94A 2AK1L 3W9DB 1XAUA 3G6AB 2VDMH 4BM7A 5EU6D 1AMXA 3ES6B 4LKCB 3SDXF 2AVGA 5IQMA 3KWUA 4L3AA 3FF7A 1URZA 3K72B 1BZ7B 2JQAA 2Z9TA 4IIQA 1KGCE 1WPXA 5FNVB 2GJ6A 2VLJA 4MCZA 5TDPB 1KFAL 4H88H 1AD0A 2IV8A 3WKML 1P84K 1B3QA 5KTEL 2ZWYA 3KPTA 4U1SB 3L9RB 4NAMA 3COOA 4M5SA 4JYAO 2OKMA 4KDWA 2XY1A 4QWWD 1PZAA 4ODVH 2DJUA 2NW3A 5CB4A 4A2FA 1XQ8A 3LNDA 2VXUH 3QIUB 1I8KB 1A3ZA 3B40A 1HR0O 1PZCA 4J3OC 2WKOF 4NWTL 4Z7UF 4XPTH 3RY4A 2P5WD 5I73C 3QDJA 2B9AA 3AEIA 5DYFA 4LU5L 4F7TB 1XH1A 3X3GH 1BWMA 2AV7A 1HSBA 3STZA 3FB6B 2CJSA 3NJXA 4EI0A 3FRPG 4U05A 5D2LE 3K2IA 1OALA 1S7RA 4WVRA 3FTUA 2C2AA 3EFFB 2NY2D 2ZSVB 2MMXA 3ULAB 3WXWH 3IJ4A 1CE1H 1KCVH 5I1AA 4J3UA 3UZQA 5J9PA 1JTPA 4JQIA 2BHYA 5GGSA 3D0VB 3I02A 4OZ4B 4WENB 4M7JH 1DBKL