3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
1V55C 2IH1C 3K6NA 2NLJC 1LNQA 1ORQC 3LDEA 4PDVA 3T2MA 3ATEA 4R50A 4XDLA 5B1BC 5IY5C 2Q67A 3AG3C 4J9ZB 3SYAA 3LNMB 3F5WC 3TETA 2EIMC 3FB5C 1R3IC 3T4DA 3OR7C 3IGAC 4QE9A 2Y69C 3SYCA 2BOBC 2KB1A 3OUFA 2QTOA 2ITCC 3SPIA 3VOUA 1N9PA 2Q6AA 3FB7C 5EBWC 3RVZA 3SPGA 3BEHA 2EINC 1R3JC 3ASOC 1U4FA 1XL6A 2WLLA 2WLIB 3GB7C 2BOCC 4XDJA 3OUSA 3SYPA 3LUTB 4WFGA 1S5HC 2K1EA 3IFXA 1OCRC 1BL8A 3RW0A 5EBMC 1G4YB 2WLMA 2E4FA 3AUWB 4MTFA 4R7CA 4DXWA 2AHZA 1V54C 4H37A 4H33A 4JTAB 5B1AC 3SYOA 1U4EA 3K04A 3ATAA 3EFFK 3RVYA 2H8PC 4MSWC 4MTOA 4PA4A 1J95A 2P7TC 2ZD9A 4MW8A 2EIJC 3ASNC 3K03A 4JTDB 4HZ3A 3SYQA 4CBCA 3AT9A 2EILC 3ATFA 3SJQC 4P30A 4X89A 5BZBA 2HVKC 4PA9A 4PA3A 1JVMA 4MTGA 4GX5A 4OXSA 2DYRC 4MVMA 3PJSK 4MVOA 3UM7A 3SPHA 4RAIA 1XL4A 3WG7C 5CBGA 1R3KC 4G28B 2W0FC 4RUEA 3ABMC 4MVZA 2WLHA 2AHYA 3JYCA 3OGCC 4P9OA 4WFHA 4ZBMA 5CBHA 1KKDA 3ATDA 3ATBA 3AG1C 2HG5C 4BW5A 2WLLB 4MVUA 5EC1C 4GX2A 3UKMA 4MVSA 5CBFA 5KUMA 3KG2A 4MS2A 4XDKA 1OCCC 2A9HA 2WLNA 4LCUC 3RBZA 3E89A 3AG4C 3K0DA 4PDRA 4WFFA 1K4CC 1QLEC 2ZXWC 2YEVA 2ATKC 4MVQA 4X8AA 5EK0A 4G27B 4R6ZA 2X6CA 4QNHB 1P7BA 2JK5C 4I9WA 5B3SC 3X2QC 3T1CA 1OCZC 3LDDA 4HYOA 3ZJZA 4RUFA 5EBLC 4EKWA 4RO2A 3F7VC 4QE7A 2A0LA 4P2ZA 2R9RB 2HFEC 3F7YC 3FB8C 4MVRA 4R8CA 1OCOC 3R65A 4P9PA 5E1AC 2X6AA 3SPCA 2QKSA 2Q68A 3OR6C 4UUJC 3E8GA 4LP8A 4PA7A 3K08A 4PA6A 2A79B 3VSQA 2Q69A 4X88A 5J9PC 1M56C 2WLIA 3ZRSA 3E86A 5EC2C 4KFMA 1ZWIC 2GIXA 2IH3C 3LDCA 2WLJA 3ABKC 4PDMA 2WLKA 3STZC 2EIKC 2HJFC 3HPLC 3K0GA 3E8HA 2HVJC 2OCCC 2ITDC 3ABLC 3AG2C 3E8BA 1M57C 1R3LC 2X6BA 2DYSC 2DWEC 3E83A 3E8FA 4GX0A 4MW3A 4J9YB 4TWKA 4GX1A 3SPJA 3TCUA 3AT8A 4F4LA 5KUKA 4JTCB 1K4DC 2DWDC 3AGWA 4LBEC 4PDLA 3STLC 3K06A 3FB6C 4WFEA 3T4ZA
chains in the Genus database with same CATH superfamily
1VPOL 5AKTA 1KNOA 2ISDA 1NGYA 1UB6A 3QPXH 1R6TA 2XFXA 3GHPA 3UJJL 2BSDA 1FH5H 1D6VH 2Z0BA 1FO0H 1JXKA 1FAIH 3CFQA 4M7KL 3ULUC 1MKFA 3CRQA 1MAJA 3HAEH 1SOKA 3QJRB 3H3KA 1TEGA 1SOSA 3X12A 1AS7A 3EDEA 1QO3A 3D2TA 2W92A 2XBZA 3BZFB 1R3IL 4M6NH 4TF4A 4LSPH 2FO4B 3QUYC 3BA9A 1RMFL 4X7DC 1QSEA 2ZOKA 3UPCA 2DIAA 4LGRB 1P84K 1U8IB 4U33A 1FVCB 4YWGL 2J25A 3ZCCA 2EINB 4I4TB 1CR9L 1JN6A 1U2YA 1Y0LB 2A9NL 4JFFD 3QIWD 2OLDA 2MNUA 3W11D 5D72L 4Z7QB 2AJXL 1X6LA 1J12A 5I75C 3HI5H 4LNRB 4U4IA 3ETQA 2ICES 2A6IB 4LIQL 4HQQH 4JHZA 3UYPA 3IJYA 3TZVA 3PAVA 1A64A 1Z9MA 4KHTH 3RX7A 5BCAA 2FSEB 4J5VA 3QUXC 5IWLA 1PD6A 1BZ9B 3WBDA 1DGSA 5EEXA 4XTRD 1IBDA 2QWOB 1NGQL 4Z8FL 1RH8A 1A3LH 1CO1A 1SQGA 2J8UE 4YHZL 1LP9A 1AFVL 1U30A 3HHSB 3MBEA 5KX5B 2KUTA 2XZCH 4ETQA 1IGIL 3MLUL 3NN8B 1RPUA 2WO3B 5BZWA 5CEZE 1PQZB 4JRYB 4W81A 3QRLA 3EOTH 4IDJH 3KBPA 2XC8A 4FJZA 3U30C 2XTJC 1KGYE 1U92A 4YBHA 3R7RA 2KH2B 4X80L 3H42L 1OLLA 3QJTB 4PJBF 5ESVA 2VW4A 1NCAL 4NQEE 1E3FA 2E9IA 4Y9FA 1IKFL 2NX5E 3CZSA 2EH7H 3I50H 1TCMA 3LHPL 4P46C 1P53A 4X5LA 3RA7H 1DQML 1NBVH 2J1ZA 4CA4A 3BVNA 2CAZC 4N2BA 3OKDA 3S4SB 4N68A 4JR9L 3UQ8A 1P5UA 1NBQA 3EYFB 1MXDA 1DQDH 5D7JD 1QEWA 1W72L 4Q74A 4X8GA 4R0LB 5DGQA 2C3WA 5E9DB 4Z7OF 4JANA 3UC0L 2WQWA 3H55A 3NUKA 4U0QB 1NBMG 4U1GC 1ED3B 1LLAA 2Z31A 1SZNA 3GYRA 3AGVA 1DSFH 3OR7A 1CI5A 1M56C 1Q72L 1CZ8L 4NRZB 5C3LD 5DZNA 5ID1B 4QRRA 4HWNA 3RN4A 1QSED 4KXCA 1HL4A 2ZOUA 4MQTB 5T1KD 1I7RA 1QBBA 4PR5B 4XC1L 1MCWW 2WNXA 4BQ9A 1LD9A 2P49B 4P5MB 2ZOWA 2QQQA 2WOBA 3QQDB 1AVAA 4NHCL 1N8OE 4F8TA 1M90W 4P8QA 4UCOA 2YUZA 3BDXA 1FWXA 4JB9L 4PGZA 3TZVD 2JIZG 5IDJA 1U9KA 2PNDA 2XWBA 3ATEA 4UT6L 4PLJD 3EGXA 3E1F1 4WI7A 4Z7NF 2R0KH 4I3SL 4JAMB 3KCWA 3STLB 5D1XC 1BVKA 4JVPA 1OW0C 4N2HA 2CCWA 2EZ0D 2XSKA 3NP4A 4YPJA 4X9IA 4FNPA 5TD4A 1FL6A 2OSLB 1BQHG 5DJXB 4PLNC 1LJMA 2NR5A 3PJNA 2ZE0A 4R4NC 2ZNJA 5LXTB 3TJTA 3HKEB 2EIMB 3SGDI 1JGLL 3WO3B 4PJGA 3CCUV 1FNGA 2V2WA 2W07A 3RDTB 1Q82W 2Y69B 3RWJB 4AJWA 3VD5A 3CS5A 4NO0A 4UINL 4PBDA 2MCMA 3T3MF 4CNIB 1I1YB 1GYAA 5I6LA 1GAFL 5FO2A 2GJRA 1SHWA 2BHZA 1LEGA 3PFUA 3RX5A 1N2RB 1DQQB 2E7LA 1L9PA 3EH3B 4ELMB 3CRAA 1UXWB 1D5AA 5C0BB 2QJ1A 3Q43A 5JW4R 2LVEA 2ZKMX 1UD4A 4K23L 1OF2A 2FLBT 1B0RA 3HB3D 1G1XB 4B97A 5A3ID 1VQMV 2NSQA 2VLME 5E2TH 3V0JA 5FHBH 1GS8A 1RKRA 4U1MA 4K35A 3LRSB 2AXGA 4RFOH 4NBXB 2AVFA 4KKPA 2D03H 3K5LA 3OPZH 3QZBA 2Z31D 2J88H 3OG4B 2WQSA 2YQ2A 4UOW1 1Q94B 1JRHI 2WWKT 4E42A 2ERJC 4N2GA 4D7TA 3G5WA 5AAWA 4XMWA 1L4IA 2AJVL 3MV7A 1ZHKA 2ETWA 2ZKHL 2BHUA 5IEHA 1CGVA 5GRXG 2NY2B 5FGCB 4X1IB 3AG1C 1U6AH 2VKXA 4U6VH 5PCYA 4HJGB 3ETBJ 2L6LA 2Y7OA 2YEZA 4M6AA 4DW0A 5CR8A 3UTPE 5KYXB 1W6LA 2QFPA 3BPOB 3PG2A 4NO5A 2WA3A 5CD5D 2VMDA 3M8OH 5JW5B 1IBKB 2BIQA 2X88A 3FQXA 1BGXL 3LIZL 4HUUA 5EIQA 2O61A 3BI9X 4X7TA 3NIDB 3T1HB 1S7TB 5FPOA 1FC1A 4E9LA 1T5WB 4N5ED 5ANMB 3US0A 4OGQC 1G9NL 3GRGA 1A7OL 3O3BB 1K4CB 2XNAA 2A74C 4PJ5A 4Z0BH 5KYWB 1CL7H 4O4HB 1HDMA 2IC2A 5J57B 3NH7L 4PVLA 4X88A 4ZRGA 2XWJB 4RMVA 5TK2A 4YE0A 1LEKB 2Y1AA 3VFMB 3VNYA 5F2VO 4OPAA 1BZEA 1OE3A 4Y16C 5HHOA 4OM0H 4XHQA 2G60H 3BJLA 3HPLC 2AXFB 3W57A 3QZWA 1IX9A 4NO0D 5GIRB 4JQXC 3K8KA 1CICA 2XICA 4XP9L 4DETA 4XAWH 2ADIA 2BWIA 3RB5A 3WO4B 4ONFL 3U2IA 2AK4E 3GXPA 3QIBC 1YYMH 5E6ZA 4JO2L 2YXWA 4JV5O 3KL3A 4HZLA 1TJXA 3ZQXA 2DQIH 2K9UA 2Q7YB 5JOPE 2XTAA 3F6LA 4BHUA 2GAZA 2OV0A 1NKOA 1UVQA 5DHDA 4I88A 4M1GH 1JGDA 3L4WA 5J5EA 4WWPA 3D2UB 3B2UC 3LPGA 3MCG1 4FTVB 4AENB 2RB8A 4QPEA 3KYMB 1F7YA 5AVTB 3QJZA 1D2PA 1S78D 1KBGH 5E1GA 4AUUA 4MD4A 2NCMA 3DC6A 4HNAA 3O6FC 2J1KA 3DVIA 3FRPG 1PEZA 3MV7D 2IAMD 2F8VA 4FZ1A 3QNXA 2VL5B 3IRCA 2LGWA 4ZFQA 1TTFA 4BFGA 1TNMA 4GP8B 1T6WA 4MX7B 4E2OA 2X6VA 1WSST 2WXQA 2PTMA 4EIZC 2LFEA 4LKXB 1AGCA 3RYCB 3HE6C 3L3HA 2NSXA 3FDWA 3IDMB 1NLBH 4GKZA 1OV8A 3GHBH 4XN9A 4XNMB 2DLFH 3IJHA 4J3SA 4XMPH 1BHBA 3SQOH 2IJIA 3TNMA 3T0EA 3PHAA 3ZYJA 1ACCA 3CDGB 4MLIA 1Z66A 4XCNA 4X6CE 4XC3H 4K3JL 4M02A 3IU4H 4KMQA 5I18H 4BFIA 2WBKA 3DLQR 3KJ6L 3L6FB 1HW7A 2H32A 4OZIF 4NQVB 1XMQO 2BP0B 4O4LA 1JYVA 3MV8E 4J3OH 1IAIH 1KCVL 2WYZA 5I8CB 1RZKH 2B7DT 2X0VA 3NCMA 3WSQH 2DQDH 2F08A 1M7DB 5AAMC 1IM3B 1MFCH 4QJ3B 2OSXA 3WMSA 1I9JH 1U3ZA 2OTUA 3MJ7B 4POZC 1L7TL 1LMKA 3F62A 1LNUB 5CP7B 3A0BZ 1CICD 2V3EA 1IGTA 1E40A 1JV2B 3SDDC 3APNA 1CG9A 2BC4B 3EBIA 3GNMH 3NFNA 4WKXA 1E6OL 4ORGB 1KCUH 2GBOA 2F7PA 2R0ZH 3G5XA 3D5OF 3UBXB 1Z5YD 2YEVA 1AP5A 3CHXA 3ZHRA 4DR5B 1AACA 1KYDA 1QLRB 2P28B 4H8QA 4WKZA 1SN5A 4WTWA 1BSMA 4X98B 2IWGA 1WAAE 1D9KC 4RNRB 3C08L 4OY9A 4OLYH 1EEYB 1CFNA 4R90H 2VDMB 4ODXB 4OLWL 4HP5A 2TSBA 5CU5A 3VFVA 2P5WB 3AMKA 3H1ZA 4YO0B 2GYSA 5ETUB 5HDQH 1HKLL 2B20A 4F8NA 3RGHA 1HYSC 4J3OD 3L3KA 3BVWA 1HH9B 3VJ6A 1KTCA 5SX5H 5GONA 1O7DE 4DRXA 2YZ1A 2ZX9A 1GC1H 1FGVH 2K8MA 1G9ML 3EOBB 4HDIA 2YC0A 3GSNH 3LNNA 1DLFL 1RZJC 4DYLA 3BPLB 4YDJA 1M1KW 2BZDA 4DGIL 4Y5VA 1KIRB 4L4VB 4Y19B 3QAQA 5JPNB 3C2AL 3L13A 4RH4A 3T0ED 3P77A 1ORSB 3LXCA 5IGXL 4DR6B 4X2UA 1JJOA 1TMQA 2BX5A 2FWOA 5TDNA 5IVNA 5LDSA 4R50A 2BCKB 1RHHB 4GKSB 3ZE2E 2HLFC 4JFFE 4P04A 3P3NA 2UUDK 3A0RA 1YEGH 3VAEA 3C6SA 4XXDB 5LNDA 3GK8H 4RETB 3HZYB 5DD3L 2A6JA 3TX4A 2OT5A 1KXQE 4YE4H 5IY5B 4PGCA 3D0AA 5DR5L 1MWAL 2Y2WA 4DN4H 4Z7UB 5C0JA 3MRCA 1P4BL 1ZSPA 2JS3A 4EI5B 3H85A 1R0AL 4K3HA 1A1OB 3SBRA 4X4YB 5DS8A 1ZRUA 4Y89A 3IFNL 4DV2B 4LQFH 3DI2B 4WTZG 3FHEA 3FHAA 2GBAA 3OAUL 4XODA 1YECL 4OZFA 2Z7ZA 1AKJB 1AZUA 1RLBA 5HJ3A 3QUHA 4HK3J 2L4OA 2HSIA 4PV8B 1M9SA 2WNWA 1I8IB 5IFJB 2V7NA 3U11A 4R5VA 5DA4A 3BPNB 2EJ7A 2QZ5A 1TJHL 4XNQA 1XT5A 4XN5A 3I84A 4L05A 2OMTB 3HZKA 3IDNA 4XVJH 3TVMC 2QQNH 4W9IC 4XNUH 4XX1E 4G7SB 2NY0D 2V6HA 1KJ2A 1JF1B 1TITA 4GAFB 4KI5C 4MJ5A 3WHXB 1FP5A 2EIJB 2KMWA 3B5HA 1NPUA 4NKIL 3UBGA 3SD2A 4GLRI 1D5BA 3NCYS 4M7ZB 4CBZA 3VQMA 2BVOA 3KWWB 4NNYA 3MDJA 3IMWA 1ZTXL 2MCPH 2X1PA 3MRKA 4R5XA 5DHXB 3CN1A 2VW6A 3CSYA 4UTBH 5EN2B 3JTSA 4HIEA 5GJSL 4N2CA 5C9KA 4U49A 4IJTA 4L1DA 2CO1A 3ECQA 4J28A 3PP4H 1YN6A 3SE8H 1BXVA 2XN9A 2N05A 5L7XL 1KEGH 1D5XB 1H3UA 1QSEE 3QRBA 4DGVH 1K85A 5EK0A 2WTRA 1UM5H 2JTYA 2B2XL 3UZQA 4N2DA 3RWEB 4BEIA 4BGDA 1N3NB 3VE0B 2PXYB 1KOAA 5KG9B 4OIAA 5B1KA 4NYLA 2UUBB 3VXRA 1KYUA 3QZNA 1MAMH 4TNGA 3WE6A 4G1MB 1RSFA 3S3SA 1INDL 4DR1B 5HYFA 4Z95L 1FXHA 1MHHA 1RULL 3ZRSA 4CH6A 1SM3L 3F12B 5CIPH 4Z7VF 1PG7W 1AR4A 5BS0D 2BDNL 4XCEB 2ZUQB 3IU3A 4AIOA 1IE4A 1BIHA 5EBWA 3ETDA 2IOOA 2F1MA 1I0HA 3TBWA 1LP9E 3KVDD 4X6EA 2X1OA 3LRGA 1DBML 4HT1H 4MS6A 43CAB 1BVZA 5CJXA 3N41B 2DPKA 2WINA 4B3TB 3NRPA 5KOMC 1XDCA 2R4SL 4JI3O 2RDCA 5IT2H 2VQEO 2ZKOA 4JPWL 5D2LA 1KTDB 3QUZC 3DX9A 4IIQC 5D7SH 5FO7A 1BD2D 4U0RC 2GT9A 4WNQA 1U3JA 4IBVA 3LNMB 4DPRA 4PY7B 2P7TA 2CO3A 3ZHTA 2FH8A 2I5YL 3K59A 3UGEA 2VISB 4OKDA 1WFIA 3T2NH 3F6IA 3FTSA 3RFZA 4MA3B 2Q5BA 4ELKB 1J1XL 3IJ9A 3MMEA 2A6KA 2WZAA 3MKKA 4NAQA 2R27A 5C0EB 4WQOA 2DICA 4PB0H 3UBXI 1KIQA 1W0VA 4M5ZL 4U7KA 4BWWA 1IBMO 3LVTA 1YJWV 2NY7L 1XB6A 4X0KB 3CPLB 3HR6A 1OGSA 1FI8C 4UIKL 2HG5A 2G75B 2XN9D 3EO0A 4LLYB 4QRRE 1OQXA 4IJ3B 4H33A 2BVTA 4L29A 1SJEB 4FD0A 5KVDE 3BZEA 4ZZKA 4G8EB 1SFHA 3ATAA 3FULA 4F15C 3BD4A 3I2CL 1YDPA 4MSWC 1W72A 1MFAL 1RK0A 3E3QC 4LPWA 3QH3A 1NMBL 3ZGIA 1AD9A 3ZZSA 1JG9A 3K46A 1J5OH 3BVDB 4MAYA 2FBJH 4N3TA 1S7VB 3UCQA 2DMCA 4NPJA 5DJ0B 1KELH 2ED7A 3VXRD 3ULVF 3Q9PA 2RN9A 1AS8A 4X62O 1UH2A 2Z8WC 3DUSB 1WCQA 3P69A 4G43A 4GAJL 4ZMYA 1P7GA 3BA8A 1JGUH 3ET9F 5DA0B 1WZAA 4R96A 4K7PH 5EOCL 3TXAA 3VG9C 4A5UB 3ILPB 2Z6FA 4ZUUB 4O2EB 2GFBA 5EORL 2D8KA 5HBBA 1BVLA 4FOMA 4JI4O 3T0WA 3MRRA 3EJPA 4RLDA 4Z3EA 1QA9B 5I1CL 4BSVA 5BVJA 4GEIA 2N7BA 4JL1A 1NL0L 1Q6UA 4YSRA 5LOVB 1MJUH 1KEML 1X7QB 3KW8A 4PJGE 4XE0A 5DWUL 3IVKB 5KYUA 4DGYL 5K39B 4A2GA 4UT6A 1XILA 1CB4A 2UX6A 5BRPA 4F58L 1K4DA 1GZHC 3MNVA 1AR5A 4WBNA 1T1WA 5DI8B 5JJNB 5AVWB 5HYJA 1TJIH 5TE4H 2K7QA 4HCRH 4MAUH 1QNZH 4WWOA 2ZXWB 4KDTA 5EZJA 5KVMC 1YEDA 4UOQA 1RPRA 4PS8A 2N7AA 5C3TA 3UEQA 3WIAA 4HJJH 3HS9A 1VQKV 3N85H 1JPFA 4FQJH 4N9OB 2Y23A 3QQNA 2G2RB 2J8UF 4GRLB 5MP6L 1C9SA 4XNBA 3DOSB 3WLWD 3K4DA 3EJTA 5GRJL 3ZUCA 5J9PB 4MW3A 4FFZL 3MV7E 4FFVC 5F9AC 2O6EA 4XNZB 2YA0A 3HS0C 4RMQA 2CBTA 4EZJA 2CIIA 4M6ML 2NY4C 3GFUA 4IGBA 1CBJA 2E6JA 4G7YH 2ZICA 1J1PL 1FLTX 4MAYD 4BFFA 3S37H 4B9CA 3EUDA 1RFYA 2APFA 5LXGL 3M86A 3LPFA 4CVZA 2BXYA 1S9XB 3MJ9H 3NAAL 1MWOA 1OTTC 3IGUA 4JZ2A 3WL9A 1CXEA 4A2DA 3TFBA 2W91A 1AROP 2ZNXA 4YEFA 4TQ8A 3JCUZ 4FVMA 2BFVH 3TA3C 4AYDC 4PJ5E 5FV1L 4YS4A 1AB3A 1TEYA 2FGZA 3QNZB 4MS8C 4WY7L 2J5WA 4WFGA 3BAYA 3QUXB 1XZWA 2ATPA 3LIZA 1IFRA 1UM4H 3U79A 1I8UA 3ZHNA 3MBXH 2GI7A 5HHOE 4HMCA 3WXWL 1MHEB 4WI4A 3UAEA 4Y2OB 4R7DA 5E8PB 3SYOA 4YXHH 1WC7A 3HFFA 3BX7C 3DJTA 5JTWA 2QWQB 4NFBA 1U8CB 3BUQA 5MEQB 3IFOA 5HYJD 1TXKA 3P9LA 1KMIZ 3BCDA 3T08A 2AV7B 3W7WA 5EIIB 1A7NL 1J10A 3FT1A 3WKPA 1MZFA 1T1YB 4V1DB 2WUCH 4KJWD 4B9GA 2B9ZA 4FNUA 2HFEA 4FE9A 4J3VA 3PL6C 4BH7B 1A8ZA 1ZTEA 3SPHA 1NCNA 1PNLA 1B2WH 2OFQA 4FQ2H 5FYKH 4KMTL 4Q52A 4L3AA 4TL4A 2J44A 3EHBC 2HLEB 3ZN1A 4GMTL 2QM7A 3QQ4A 2W9EH 4CADB 4GZRB 2VM3A 4K71B 2YQGA 4FP8H 1GS7A 1CI3M 2ZP0T 1A9EB 5E0QA 4CILA 2PMZA 4XMZA 1FJ1B 4ZKIA 5K93A 3CZLA 4M4RA 3L9RB 5D2NB 1NFDB 4QRUA 43C9A 3MU3A 4GQPH 1EJOH 4NQCB 1XDTT 2XG4B 3ZTEA 5K9OA 1FXKB 1EMTL 3ZYIA 4IRZL 4HS6B 5CKGA 3TBSB 5JPMB 1D7CA 3JARB 5IBTL 4R8CA 3PABA 4LU5H 3DBSA 4H13C 4QRPB 4XN7A 3T0EE 4XBFA 3R66A 2BO0A 3GGWB 3V0GA 2WXLA 4JG0H 3QJFB 1Y07A 3U9PL 5CJOL 5CJ5A 3WFEL 2B0SH 2GW5A 2R29L 4OT1H 4WUUB 4PS7A 3FUDA 1HFUA 2D2CC 5IW3A 4UQAA 2J72A 2XAJA 1K92A 1DZBA 1AQMA 4UM9B 5JXED 4GH7B 3RPKA 4O58L 4U1SB 4WFGD 3CLFL 4U1NB 1LK3H 3VRJB 5GGSY 3MX0A 5J13B 1IQDB 2X6BA 2Y6SC 3KHOA 5D1XB 5TQ0H 2PTVA 4NZRL 4ZI8A 5FYJL 2X4TB 2YGNA 5KEZA 1WGVA 2SEBA 5LGJA 1RPOA 1MRDL 3HAEG 1FGNL 2IDUA 4P23A 2OJEB 2WGNB 3SPIA 2C4XA 1H3PL 1NJ9B 1O6VA 3E6HA 4WWKC 1N67A 4LF6O 5K9QI 1NC2A 4NZTH 4QY8A 3KNBA 1PTZA 5ICYA 4LLMB 1MUJA 3BABA 4OM1L 1NFAA 4IS6B 3GKZA 2HN7B 3DYOA 5FNVB 2C9SA 1ZXKA 4L8CB 3CZEA 3D39B 5IVXB 2OXGB 4X42A 3OV6A 1U95A 2PP8A 4H5SA 3FN0H 5CJQL 5E99H 1HEZB 1HQRA 4HG4K 5IB5A 1F0LA 3WXVL 2LW1A 3LKOB 5K5YA 2XWDA 3V0WL 4NRYA 4Q9RL 2ZXGA 1CGYA 2FR4A 1SQ2N 1VMGA 1DQJB 1JFQL 3PXHA 2VW7A 4IQHA 4DP7X 2IANB 2E4FA 4M9OA 2DQEH 3SB3A 1WAEA 2ZR3A 1BZQK 3NQIA 1NBYB 3CFEA 3DC0A 1TOXA 4NQXB 4XWGL 4ZAKB 2N0KA 4A04A 1IURA 5AB9A 3H2PA 4TSBH 4XPBH 3ATFA 3ZTNH 1XGZA 4CC1A 1NQBA 1MRCL 2EIEA 3LS4L 3RL1B 1XD1A 1YZBA 2QTVA 1G7LB 2DMBA 3GXIA 1FSKB 2IJHA 3HKZA 4QHMA 1C08A 1ND0B 3GBML 3ZKXC 2EILB 2ZZUT 1HXMB 2CUIA 5E51A 5ENWA 2TSAA 4G6FB 4DHLA 4WFHA 4FAAB 5C0DB 2YGQA 2QKIA 2HTKD 1UEYA 2IV9A 5JOFA 2V3DA 3SBWA 5DJ2B 2A74B 2VQUA 3QXAA 4XXCC 1A6ZB 4LCWA 2ITDA 2E4TA 4HKXB 2MTPA 3NSCA 4MD0B 4P23D 5F3FA 5BS0E 2AI0L 2HLAB 2IH8A 1CTNA 5I66A 1FV1A 2GJ6A 4PGBA 2YQ3A 4UV4L 2ADGA 4U6HA 1NC2D 2G5BB 2ZD0A 1L3WA 4JQIL 1J8SA 1FH5L 1D6VL 3IKKA 2VKWA 3T1FA 2BSEA 5BZDB 2V2TA 1A65A 4ZMTA 3VYOA 1MWAA 3CXFA 5JZ7D 2RQ6A 5JHLL 3V0EA 2E9BA 5CA0B 1S9YB 3FU0A 1KIPA 2F53A 4LLVA 2QWRB 4ZD3L 4HUVA 2WBJB 4KGJA 1HNGA 4QXWA 5J06A 1I08A 3CFTA 2HJKB 3ORJA 1WLEA 4KZDH 3L9BA 3R7QA 5IUCA 1AZVA 3VWJB 4MCYB 1UOLA 2IH3B 3OB0K 3AXLB 1U8OB 3GXUB 4U3SB 1FRGH 4WHCA 3T6ZA 4NUJA 1TVBA 4GSUA 1R1CA 4JY4B 5DMGC 5J8OA 3QARA 4YXWG 1T03H 2YSUB 1WJ3A 4KY2A 2UWEA 1PD0A 4PD4J 1DLBA 4ODWB 3ZKND 1WAAF 2XN9E 4YC2B 2ZSVB 4YDVB 5LGKA 3FB6B 4ABUA 1HXKA 2J43A 1OWRM 3KXFA 2IPUG 4HWEH 1IMHC 2XT1B 3G6AA 3BIKB 3P02A 4Y4HB 1DQKA 4DZBA 3OKMA 3UROR 5ADOL 1EAPA 3VXRE 4WFHD 4XWOC 3WDHA 3ZHLA 5BVPH 4Q58C 4HH9B 2GJPA 3L3IA 1K73W 2A99A 3HOGA 3ZRWB 2FATH 3PDGA 2V2XB 5HYSB 3SGDH 3MRMB 4LCWD 1OEZW 2XIIA 5LMUO 4JN2B 5MEPA 2EH7L 1E42A 3OHXC 1VIWA 1ILUA 1S5IH 3RVUC 5CFAA 5E24E 2CO6B 2BHYA 2DQUH 2A9AA 1XR8B 1OO2A 3MNZA 4ZS6C 3T0BA 1UB5A 4FXGB 5SWZA 4BV1A 2P3YA 1F13A 1WD8A 5HD8D 4DV4O 5GZNA 5IYZB 4YHPB 1ZANH 4LIQE 2BSED 3CU7A 1LYQA 3LD8C 2WOYA 4L3FA 4AQ8C 1XF2B 3DTDA 3GSOA 4JQVC 1T4KA 5FPRA 3ZE2F 4ZX4A 4ANXA 1DSFL 4X66O 1JTPA 4Y9EA 5D2LE 2HPOA 1YPZA 3GWJA 1EDQA 2H3XC 2X4UA 4XO9A 2F53D 1Z2KA 3DHUA 2PPEA 3DROA 3O6KL 3RTQA 2WVVA 3MRQA 4MHHI 2HRHA 2UUCO 3TYFB 2H1PH 2YHGA 4HCIA 1JRHH 1BQLH 1R46A 3MAWA 5CBAB 2EC9U 4JREC 4KJYA 3FQ1A 3K72A 2H94A 4IGGA 4BXSV 3M7FB 5IMMB 3KDPB 4MVBC 1XXFC 5HHQB 2P5PA 2HKAA 3LKPA 1E6JL 3UX9B 2NY1C 1ET5A 4Q9BA 2BIMA 4O02L 3WFHB 3QO8A 4P9MH 2DEXX 4PRNA 5DJAA 4CSZA 4DFHA 5C7XL 4PG9A 4DV3O 5FUZL 3PDDA 1EHAA 2VH5H 2CLZB 2ZJSH 4AQAA 1LO4H 1MVFA 3BH9A 4FG6C 1VGEH 7FABH 2CK3G 32C2B 4XO3A 1V7ML 2H6PB 2VDOB 2B1GA 1TG8A 3VSQA 3KLLA 2AEOA 2C9PA 4UCRA 3TH3T 3JD0A 4PS4H 4FQXB 5IVZA 1YSCA 2NY3C 4P57B 4S1RH 4KNQA 5ITFB 4G3YH 1YMMB 5F44A 1KG0B 4XBPB 1KXVA 4OLXL 3S96B 4JFZL 1EZLA 5AB1A 5SWQA 2OI9C 2JVUA 4QOKB 1QI3A 3WY3A 3WTTA 3CE2A 4FXKC 1J9SA 1F42A 1RU9H 3QIUC 4FG2A 3O2WH 2WSSG 3WNPA 2C5DC 4A1RA 4XR8C 3KJ4C 5SWZD 4G2AA 4MXQD 4G11A 1T3FB 3N55A 1ZA3A 3P2DA 1LK2B 4HV8A 1R6VA 3V95A 1MHCA 4ZHQA 4WNSA 2A77L 1RK1A 3TESA 3QEUB 4NNPH 1N26A 3L3DB 4RFOL 4BUGA 5IB2B 5I1EH 3BT2H 3OPZL 2J88L 1I8AA 1RUMH 1SF5A 4PFEA 3CSXA 1HNXO 1Q6IA 4PHZA 2XZQH 2Y1VA 3PAZA 4RBPK 1U8MB 3N2KA 1I53A 1UUNA 5HYJE 4S0HA 4LPTA 5EO0A 2QGNA 3ZE0E 3B2VH 3HKDB 3FOMA 2J3SA 3QFGA 4KJQC 1JZEA 2UYLB 4RMTA 5A2LH 2BOCC 3LUTB 2Z5UA 4QTHA 2I27N 5T1MA 3M8OL 4J3OG 4WO4C 3WS3A 3HI1B 4PHXA 1YN7B 2ZE5A 2QEXV 1ZD6A 4M61A 4KVNH 5D4QA 3DVGB 3U1SH 1LP9F 3B1UA 4KRPC 1PX3A 1JJUA 1PSKH 3R18A 2KQNA 3MLPA 3WEMA 1UT9A 2IMNA 3MRFA 2C4FU 3WNJA 1P1ZA 2QGCA 4Z0BL 4X0NA 1CL7L 3VH8B 2YAPA 2YEQA 2IJJA 4PI0A 4TUJB 1EZUA 2LVCA 4DNLA 5EIBD 4JJ5B 4JFQB 2W0LA 4LFHD 4MA8L 2FWLB 4GX5A 3E7JA 3V6BR 2JSFA 4ZDHB 4HPYH 3U0TA 1VADA 3HRZA 1ASQA 3S35X 4UQIM 3DOHA 3W56A 3AQYA 4XAWL 4FFZA 2J6WA 3VFNB 4ZXBA 3OGCC 1TQWA 2WWNA 4GXFA 4XP5H 4NQDA 3FTGA 1T5XB 2KG7A 4S1SH 4W9CC 4U6XA 2Z9TA 3EF7A 3ABMB 4B3SB 3MUUA 4ZOLA 2ZG2A 5D4HA 3HG1A 1QLEC 4WFGE 4CJ0A 4NKQB 3CVHL 1AGDB 4PJDA 3UYRL 1DVYA 3HKCB 4EJ1C 4F3FB 2P8PB 4LF9O 1C1EH 4OBRA 1RSYA 3AY4C 3O3EB 1KBGL 1UADC 4PRAA 2VQFB 4NFDA 3QUML 4PJ7A 2HPTA 5J12C 5E9DD 4DPBX 2EXWD 3OPUA 2E7MA 5DZ9A 2CK0L 3J2PA 1IXMA 4I5BA 2LAAA 4A7TA 3G08A 1OF0A 3QCTL 2CKNA 4DVRH 5DM6V 1W16A 5G5DA 4UUJB 4LSSH 3HZVB 1AR2A 3GHBL 3GMMB 4J9YB 4YJ3B 1PU0A 5ISZA 3MBWA 4QCIB 4TNVF 2ADFH 2Z91A 5AW3B 1N59A 1UOKA 4ODSL 1CT8B 5DURB 2VXVH 4PJXF 4Y2DA 3STBA 1P4RA 1R3LB 5BMVB 5E2VH 3ZX6A 1YYLH 4W9JC 3S36L 3T0VA 2FT8A 1QEXA 3ARXA 4KQ4H 5J6GA 1AY1L 3CMOH 3C5JA 3AG3C 1FFOA 4HJEA 3S3XA 1PS3A 3Q5YA 2CIKA 5DF0A 1RZPA 2QKAA 1V3KA 2F5BH 4HCGA 4JY5H 4M43L 3VI3A 4DV5O 4C56B 2BM3A 3H3BC 4ZOAA 5AUMA 3FU5A 3F83A 3QJSB 2QTOA 1SLUA 1RSOA 5IHZB 1JMZA 5DHYB 3T04D 4F15B 3FB7C 2J4WH 4NUGL 2PKDA 5IHUH 3BEHA 1LQBC 3C8DA 3SGJA 2DQ0A 1TO5A 4NQDD 2HRGA 4OZGB 4XPAH 5PAZA 2OMWB 3TCLB 3QO0B 2XWTB 4KTEH 1WQVT 5JDSB 4CZZA 4H20L 2J1WA 4DUXA 4F7PB 1NOFA 5CLZA 4N0FA 3CBKB 4XXWA 1OP4A 5E2WL 3MRBA 4R90L 1YNLL 4IRZA 5JW4N 3CZKA 2BNUA 1JF6A 1G9NC 1MFNA 4M93B 1GTOA 3D36C 4OZ4B 3CRMA 2MKLC 3BN9C 5IWAO 2UXNA 5CSZB 3OT7A 4N2EA 3M1BB 2R29A 4RAVA 1FFPB 4QRQA 4LH7A 5EZIL 2VDRL 2VR9A 1YHPA 1DQLH 3PWPA 2FQFA 2K7PA 1YJDH 3HNVH 3RPIB 1R6NA 4J80A 4JG9A 4K8RC 3ZMEA 1XGUB 4XZUB 5C2BH 2D3OW 5IT9N 3NSXA 4LLQA 1MCRA 2CH8A 5HI4D 1DE4A 5E9NA 1VZHA 3UO1H 2BY3A 1XGYH 3EG9A 1P7QA 2XX1A 4GLRH 4FYTA 4OLUH 3WJLA 2ZXQA 5ISZD 3FFDB 2IG2L 2XXCB 3CE1A 4LCUC 3ZMZA 4LHUB 2MQ0A 4JM4H 4MNHA 5JHMA 2MOQA 4NQQA 1XBLA 3FOLB 4Y2DD 4UFZA 1ZVSA 5KANI 3QQ9C 1F3DJ 1O75A 4Y9BA 1H5BB 3CXDL 3SE3A 4YJ2B 3UACA 4U1IA 5LCVA 3GK8L 4G83A 1X5GA 3PE9A 5HVHC 1L9RA 2BVUA 5L2JA 1BVNP 4LLAA 4KUZH 3V2AR 3TIDB 5DQDL 1GJIA 3BUPA 2OAAA 1ML0A 3K71B 1TZIA 5I6PA 1G43A 1NIFA 5EU4A 1A6WH 5IK3A 1A14L 2BRRL 1PBYA 4D3CH 4BUHA 4QXTA 4LQFL 5GGTL 3T8XA 3NK4A 2P22C 3STZC 3K91A 1P4IH 4K3EH 5AOKA 1PG7H 4NJ9L 4YGVA 1P0SE 4UQ2B 2K6YA 3REVB 3E83A 2MIZA 2OMXB 4J3OF 5FS5A 4DP1X 2B1AH 1A4KA 2D7QA 1GHFL 4YPGB 1LL1A 4K94H 4WFHE 3BVVA 3MUY1 3F7PC 2Z1PA 4U2ZA 5FA4A 4YDKL 4HA1A 3KMDA 3L5WB 4N6QA 5EFIB 4Q20A 2PCPB 2DDQL 5I2IA 4MKTA 4HSCX 4LCWE 5F70A 4XVJL 2RBLA 2XUWA 1H2LA 1EWHA 3QEGH 1E4WL 3G6DL 4KTDH 2GJ6E 2Y24A 3D2UD 2L7QA 3BUDA 3TETA 4OAWB 1MREH 3ZVVA 4NXNO 4G8FB 3QI9A 2B15A 5E4EC 5ICXB 3TO4B 2JF1A 1NWOA 1SBSH 3G7TA 4ZO7A 4B9JA 2CWRA 5C6WH 2LAGB 4UF7C 4QRBA 1KGCE 3T4AA 3GJFB 1RP9A 4LSQL 3RBSA 4LLDB 2J7LA 5AKSA 5FYJD 1YC8A 4JFYA 4IKLA 4X99B 5JQGA 1P7QD 5E94A 3A24A 5CILH 4P0DA 2F53E 1QI4A 2FBOJ 3FFCB 1RJZB 4LSVH 4DP8X 4DXWA 3ASOB 2X38A 4JQIA 1IC5L 2JIXA 2RCSL 2HFFB 3K2KA 5TFSH 4MA7L 2OR7A 3G6JF 4JFSA 1Q38A 3RVYA 5EBMB 3CVBA 2Q2EB 3EYOB 3ZQWA 2QKCA 2VDMH 3EJYC 3HNTH 3LXUX 4KPHL 4NHUB 4ODHL 3PF2A 5JHLA 2QSCL 4WK2B 5GRZA 5D8JH 3RWDA 2UWEE 2WXOA 4PVMA 4AK1A 4AQ1A 3MLTA 2OR8A 2ZDIA 3UTQA 1NIEA 5ICZA 4NQUA 2YOAA 1AIFA 5I23A 2N56A 3KXFE 3PHQA 2WJ7A 3B9DA 1ITBB 3LYRA 4UVAA 4LMQI 1F3JB 4I18B 5K1PA 3G5VB 2AAVA 4HT1L 1TO4A 4PRHB 3MO1B 3ZDXF 3NZ8B 3BSZH 2W0FB 3VG0H 5IT2L 1J0KA 2W60A 1OV9A 3A2FA 1THCA 4P4RB 2X9ZA 3CRCA 3PIQB 4HHWA 5TDOA 4L1TA 2VITB 3JWNE 35C8H 5EUOA 3GI8H 4NXMO 2Q9LA 1FVEA 1V3MA 3RYHB 3B5GA 1DBKL 2F18A 5FO9A 3CHSA 4PGDB 3CMAV 5E6YA 5C9JB 5ITZB 5IYBO 2P5WD 5SWZE 5B39B 2BVYA 3QI9D 3UG3A 1TT6A 5AW1B 4CSSA 4F7MB 3E8VA 3KCXA 3MCKB 4KOBA 1L8DA 4AIZA 2P24B 3GBLA 2LV4A 3OAWA 3LZOA 2DBLH 1OT4A 3MA7B 3ESOA 4KKBD 4UZUA 4EQ3A 4QXGH 4WWKB 5JNYB 5L2KD 4FM1A 3KEHA 3LV3B 4UU9A 1UOVA 5AVYB 3SQBA 4CS4A 1I3GH 3FQNA 1YPZE 3O8XB 5M7QA 1GY2A 1OT1A 3K6IA 3H6JA 4B3MO 1KY6A 3CLEL 1U0QA 3NSFA 4Y19D 1PEWA 4GO8A 4Y9GA 3CC4V 4XMKL 1VESA 4G7QB 4E41A 1RLWA 2IH1C 1IEBA 2E9GA 3V4PL 2FBJL 3GXDA 3GT6A 3F3HA 3J80N 1NBZA 1KELL 3VFSA 4AILC 4PRIB 5D5MA 3VUAA 1NGPH 3H2QA 4P2YA 4OSUL 3T8MA 4GG8B 4RGND 1JGUL 4PG2C 3I3BA 4XP6L 4PJIB 4K7PL 5B7EA 2LFGA 1OHZA 4XPTL 5DMJB 2EYSA 5LGYA 1FHGA 2VUKA 4HG4J 1SLVA 2EIDA 2X4SB 2HKHH 4PJ8C 1OSYA 3LJ3A 3ULVC 4F7TB 1T0NA 2YIHA 4HXAH 4JHVA 4M1DH 5IIEB 1FZJB 1J5CA 1G1KA 4FNQA 4XDJA 3B8SA 3X1BA 3VFOB 4AEHH 5DUBB 4RRPG 1VFOA 3AS3A 4O02A 2WKOF 2XWCA 4Z6AT 4J8QA 2WAMA 4WSKA 2YXVA 4AE1A 3KD4A 4DZ8B 4FQ1L 3BLBA 1QCEA 3M1CA 2WIIB 3U7AA 2DYPB 5HGAB 1URFA 4ZX3A 1UKSA 5L3GA 5DYOB 5LBQA 1MH5B 2CR0A 2NY5H 2VDQL 1VF5B 4MMYA 2IAAC 1QABA 3OXSA 2BVEA 4HJJL 4XP1L 3N0AA 4D9LL 1ZLSL 3F7YA 3ZYOA 3N85L 1Q9KA 4NN7B 1P69B 3J7HA 5A7BA 2AJYL 3Q8BA 2PYEA 3IAGC 5F7BA 1OT2A 3FT4B 2C3GA 4JV5B 1RPQA 3NCJL 4F5CA 5EF3A 5GSRA 1A0QH 1KTKE 2CGOA 3C5ZA 1LO2H 5IR1B 5EO9B 3H1KH 4KAQL 3WNNA 5SWSA 1Y6MR 5F7KC 4O9HL 3WYRA 4JF3A 3IPFA 2H2SD 3T6VA 4RMWA 4E41D 1ETZB 3F6JA 5ERWA 3S37L 3AM8C 2XKNB 3X2QC 3VFUB 2NLJA 3SEPA 3VFTB 2PXYD 4TRPH 5E6IA 2EZPA 1HI6A 5TH2B 1IVSA 4AWJC 5LL6Y 3ZIAG 2WO2B 4KNUA 3W81A 1IT9H 5H37A 5JORA 3U2SB 2VTFA 3FCSB 4NN5B 1VZIA 5AVZB 3OLEA 1I1AB 2GI0A 4M6OL 4RESB 1EGJH 2VR3A 3B6SB 4N87A 3H9HB 4ESKA 3CD4A 5D2LF 5KSBA 3UTSA 3H7BB 1OAYL 4FNSA 2B4CC 3EYQC 1HJBC 4WW1A 4U1HB 3A23A 2H0FA 3MBXL 1QRKA 1TZGL 3QAZB 5AOZA 2NNUA 1PCSA 3BISA 4I48A 4TNVK 4RVBA 2AZAA 1VF6A 1MW1A 3ALXA 4YLQT 1S7QA 1XMQB 3EYSL 1QBML 4EOWH 3EUUA 4NQDE 4YSSA 4X20B 1XREA 4DP6X 3KDMA 3U83A 4EI6B 1IQWH 3APOA 2MMXA 2RJMA 2JGDA 4EB6B 1VEWA 3PAYA 1GGIL 3GINA 3HG1E 5ILTH 4MLSA 3H1LH 4JM2A 3FB5C 4PJDE 5D6CB 4FQ2L 4MQXD 1YEHL 5I74B 4DGWC 4JKMA 2PYED 4QHKI 5LBGA 4M8RA 2FIKB 1U8QA 2LU7A 1K5WA 5AVUB 4PV1B 2YSSB 1I9IL 3DPDA 2W9EL 4PJ7E 5FO8B 3C5ZD 1D5IH 3VWKC 4CC4C 2UZPA 2XG5B 3K9AA 1BW8A 5SWSD 1H2KA 5T3ZL 2OR9H 1QW8A 1SEBA 4Z3TA 3WFVA 2XPYA 1ZLUH 3VXQB 3CVHA 2CG9X 1A1MB 2FX8H 2I26N 4FZEH 4QUOA 3VQXA 4B5ZA 1AXTL 5KHJA 1LDPH 4YX2H 1U4EA 3CCRV 4QHPA 3C90A 2NW2A 4KVCL 3KKYA 4F9LC 2FK9A 4LU5L 3DVNA 2ZWNA 4Z7OB 5DRNB 5ISZE 1Q9OA 3QUMA 4JN1H 5I26A 5T5NG 4OFPA 4FGMA 1J0IA 3LEYH 5E6ID 4N85A 5GGUB 2LOEA 1S76D 1ZT4B 5L3CA 3GPEA 1DFBL 1MCNA 2DIEA 4AMKL 1C16B 4DERA 4ZUTB 4L37A 1XF5B 2R4RL 3FAXA 3KYOA 4OXSA 3SKOB 1SY6H 3ASNB 1OSZB 1VCBC 5CF3A 1LK3L 5EEWA 2FHCA 4GBXC 4WI8A 5I82A 1UURA 3VI3E 4C54A 4ZBMA 1KB5B 1NUDA 3IDGA 2B39A 3ZE0F 2DMKA 3CVIL 4K7PX 4F8PA 1ZWIA 2F1EA 3V0AC 4GAYA 1LM8V 1VKXA 1EAQA 1AJ7H 3ZTJH 2MOVA 3B2DC 3V52L 1Z9LA 2K9FB 2PYFB 4P59H 2BSTA 4NZDA 2NT1A 4WFFA 1ZPLA 3MCYA 1RUKH 4Z7NB 2IIJA 2XWRA 3P9MA 4LAJH 1AQKL 3MGTB 4DOHE 5TISZ 1TQCC 1DJXA 1L1FA 4OCRH 3UO3A 3KPQB 4I2XB 3HFML 2OQJB 4PELA 2IADA 3W5MA 1FDLH 2QE7G 4JM2D 1SLXA 5C0ND 1J11A 1UYWH 4A39A 1QR1A 1M6UA 3FN0L 4NN6C 1VERA 3WIHL 4UB6Z 1ID2A 1RCYA 4HVBA 1SYVB 2NW3B 3BFQG 5LYJA 2ZG3A 4O4YL 4OUUB 4WV1A 5FV2A 3FBQA 5DMKB 5DQ9A 5DFVD 4LF7O 3GHEL 3PWPE 3P11H 2DQEL 3FO9A 3IKCB 3G6EV 5EO1B 4OI7A 5TGBB 4J42A 3JAKB 2R9HD 4E5XB 5DJDA 4R3SA 5FUOH 3VQYA 1DCLA 3PQYB 5CUSL 5FYJE 3INUL 2DKSA 3AREA 1P7KB 1OP3H 2BLFA 3L1OL 1BYNA 1A1NB 4WK0B 4TQFA 5D7IA 3V4VB 1I5XA 25C8H 3A4FA 4P5RA 4E9YA 5I8OH 5GGQL 1U3HA 1PLGL 2GB2A 1SQPH 2PO6A 2Y5TA 5LBVA 3EGDA 1ZLZA 5D96C 1JUFB 1OARH 4GG6F 1AZNA 4LKCA 5F7FA 4ENED 2QSVA 5HDWA 2DN7A 4NPKA 3PGDA 1ZHLA 4KWUA 2HMIC 4NC2B 5D7LB 3FQTB 2FJHB 5IBLD 2O5YL 3BO8A 3EO1B 3H9SA 4D7SA 2DD8H 1J8KA 2H7WA 4G5AA 1IKNA 3N44F 2OYLA 4UBDD 4A2LA 2I9TA 4FQLH 4CJ1A 1R3JC 3AY2A 5E08L 5ACZB 1BHGA 2CR3A 2OMYA 3WNLA 4GRWB 1FF5A 4N21A 4JL2A 2Y0SA 1JERA 3L95A 1OGTA 3KM2A 4L3EB 5SX5K 1IFHL 4X8XA 3AUWB 2JB5H 1YVWA 4WFFD 2Z3FA 4I0PA 2J8OA 4HHAA 5E8DL 2LLLA 5EPMB 1X5HA 4AV4A 4J7JA 2VNCA 3E8UH 5GW7A 4F6RB 3K0WA 2C9XA 4JKLA 3OGCB 1XHHA 1PW3A 3KPPA 4JTDB 4L9LB 3U2JA 4ODTL 3EXJA 4JGJA 1CJYA 1QQDB 1A7QL 4OCXL 3D0LB 1N8ZA 2NT0A 3FB8A 4LRIA 1NAMB 5FCUH 5GGTA 3RGVB 1HHHB 3FT0A 1YTFB 2JKTM 4ZQKB 1DEEA 2WPGA 1CGWA 3V4UH 5C1MB 2ZM6O 3L3OC 4J10A 3ECBB 3VYNA 4L3CA 4HXBH 4FFYH 3HR0A 1A32A 1S3KL 3NYKA 5FLXN 4XNDA 3CFDA 2IU3A 4JI3B 5JA9A 2VQEB 5BV7B 3GIVB 4L8SB 4W9FC 4C59B 5L2KE 4FQQB 4HJIA 4N0UB 2WXNA 5J12B 2HVJA 2W6IG 4ZS7L 3ARGA 3E89A 4LOVA 4B7IA 2CGNA 4OD1L 1U3HD 3V52H 2PO6D 2H0JA 3APFA 4HBNA 1EO7A 2GJZA 4P9HL 5LAPA 4PB9H 4HOWA 5I1KL 4H0IA 1H3TA 3IXAA 4HWEL 3VXUB 4IHOA 1DJSA 3HBPA 1MCWM 1QFWI 5GS0L 1TUPA 3LQAC 3O9WB 2NR6A 3W7TA 1FL3A 3H9SD 3QDJA 4F8OA 4Q2ZA 1IBMB 5BVPL 4ALAC 2WJ5A 4WUUD 5B38B 3CJHA 1PCXA 3TT1H 4QWWD 4RGNE 5J89A 1OCOB 1HL9A 4DVBA 3RKDD 1SXCA 2V3FA 3EKCA 1S7XB 3D4GA 4QXUH 1KDIA 2Q73A 1CD9B 1TTAA 2EIKC 4CH4A 5AG2A 2LO1A 3BWAA 2D4FA 2Q86A 4X64O 3D1MC 2VR7A 4LFHG 2DQUL 1ZIAA 2WK2A 4R4FL 2UX7A 3L9EA 5IJ9A 3MRHB 4I0PD 4U2YA 1NSNH 3QEQB 4JO1L 1O7DC 1PV0A 1WAPA 2K78A 2P5EA 2Q6WA 2WANA 3T3PE 3EO9L 2COQA 4X62B 1KACB 2GC4C 4OZIB 2ITEA 3QBTB 1D2DA 2WYHA 5FK9B 3Q4HA 4FZ8L 1ORQC 5T5NF 2X42A 3V0FA 2X2UA 1K8IA 5KHKA 4OVVA 2Z7WA 5EUOE 3RYIB 1V55B 1ADQL 4OI9A 4JI4B 4H1LB 4O2FB 1FZKA 5F93C 2FTAA 3RZCA 2E86A 2Z1KA 1IAKB 3LKRA 1R5IB 4UTAH 4KQ0A 5F1KC 1NA8A 3D50A 3VXMB 1KPRA 3GSUA 2DLIA 3ESNA 2CKBB 4LCYA 3W11C 2F7IA 1SJXA 3ES6B 2K3TA 1GIGH 2CPCA 1A7PH 3GEFA 4FZ0A 3V5DB 5IMLA 4UILH 2ZOLA 5GSVB 2ZE7A 4AXWB 1ETJA 2B16A 3ARGD 3VU1A 1LE5A 5C0FA 3SKNB 1GJUA 1IZKA 3PWJA 1S77D 1CGTA 4KXBA 1R1BA 3MNWA 4JFDB 3ILDA 4QYAA 1RUPH 2AABL 4MNQA 2WA4A 2VZUA 1LUWA 3ZBHA 1VGEL 3VDAA 4HHGA 7FABL 2ATKA 1GSMA 3ZL4L 1JBJA 4E41E 3K0YA 4LF3A 4S2SB 2NR6D 4J2QA 3BE1H 2VE6A 1EN5A 3NK3A 3QDJD 2PTTA 1B0IA 3WELA 4LCUB 2B5IC 4NKOB 2DYRC 1S7RA 1GOFA 3F8UB 3EGSB 4R26H 5D5ME 5JO5A 1KDJA 2ILMA 5C09A 1J9RA 5D1QC 1K97A 3QNYA 2W0XA 4G6FD 5E5LA 4M8VA 2RFXA 3NOIA 3GSQB 4DN3H 1RU9L 3BP4A 5HVHB 5KVFL 2ITFA 3V4PA 4KROB 1P6WA 5JUEH 1ZLVH 2EADA 5D7JC 2X4RA 2ENPA 3V0VB 2KI6A 3U1QA 1R3HA 1HNWO 5F3HB 1U8JB 4NNPL 1CK0L 2VSDA 5I1EL 1RUML 3NA9H 5C0IA 3QFJA 4GT0A 1XSKA 1SKVA 5F1OB 3DUHA 3PWNA 2W95A 3MJ6A 3VXOB 5E1AC 3IDXH 1DVFB 4EZMA 3QS2A 4OIIL 2K4WA 2E46A 2X09A 4APQC 3RZCD 2QTSA 2OK0L 2V9QA 3EW3B 1E4XL 3F7VB 4PJEA 5C2UB 2UWEF 3SSGA 3FL7A 4NUPA 6FABH 4BAYA 1BLNB 5DJZB 4AEIH 1ZA6B 2AP2A 1IGCL 1IKOP 3QG5A 3L4ZA 1N0XH 5CMAB 4NS0A 4X7CC 4N24A 2PYEE 5CBEB 4F5CE 1H15A 3VWJD 3QORC 2DE0X 2EDHA 2CBPA 3KGSA 4NLAA 4K07A 3GDCA 3SDCB 5SWSE 2F74A 2DWEB 4BFRA 4WCEV 2A6DB 1MCEA 2BRQA 3T2LA 3M45A 2XN2A 1I7UB 3PCYA 1HNZO 4N8CL 2Y7QA 5F7EH 4WO0A 3FRUB 5DVLA 2WUBL 4UQEA 2I60H 3JSSA 4ZK8A 4MJHA 3WIFA 5T1JA 1NGZB 4B0MM 3BOVA 4Y4HD 3RTLA 2HVKA 2VRKA 1WHPA 1UWEH 3HI6H 3SCMB 5H2FZ 5F7DB 1OXYA 1D5ZA 1XH3B 2FECL 4BWUA 3FH8A 2C1OB 5LP6B 3B56A 4Q6IB 5I28A 5IOKA 3BQUC 4W9ZA 5KSBE 3UTSE 4M8UA 2GTZB 2EO7A 2NUPA 2AHZA 2AW9A 1T2XA 3BEVA 5B8CC 4HSQA 3RAJH 3VM7A 2Y2YA 2EIZA 4NC0B 1IC1A 2E59A 3CZNA 1SNRA 5J3HD 2VLLB 3G4SV 2ODMA 2XX0A 2YPLB 4LLUA 3S34H 1NFIB 5D70L 4JG5A 1AI5A 2LU3A 5CEXB 4Z7VB 1YY8B 3QFDB 2VDOH 3K6FA 2NNAB 5ID0A 4MJIB 3AADB 4Y5YA 4Z7QF 5GHWL 2AANA 3DSNA 4FNTA 1KC5H 1A6AB 3SOBL 5GZOC 5BXFB 1E28B 3OR6A 4FNLL 1L9MA 4OV6F 4G28B 2QADB 4Z76B 5CD5C 5IQMA 1KUMA 2G3ZA 3ATDA 4AT6B 1S7UB 5EU6B 5D7EA 2XPGA 3O0RH 5D71H 3U4BL 1H3VA 4LF6B 4QRSA 4MMXA 5LVEA 3Q0HA 4BW5A 4NKMB 1NKDA 4N5EC 5FA3B 3RNKB 1AJQA 2D7TL 3CZFA 4OFYD 2DQ3A 3KPRB 2D31B 1TQTA 4KQ4L 2GJJA 1BBDH 4O2AB 2B9AA 3C9NB 4NM8L 4NRXA 5LA6A 2F5BL 1KV7A 1UA7A 2Q7AA 4JY5L 4JJOA 2KERA 5E70A 4DCQA 4CRPA 4POYA 2OMUA 1PKQA 3ZDYE 3HCVA 5DECA 4AYSA 4JNXA 4TUYB 2OMZA 3N50A 3WEXA 3WUWA 3EZ8A 2AZ0A 2F58L 3HMWL 1F58L 1I1FB 4N2IA 4LSRH 4R2GB 1JFFA 3CG8A 2BIPA 2XCMC 4XPAL 2D7OA 2WQXA 4L4TA 1W80A 1K33A 1YMMD 1QASA 1BQRA 2HJFC 2YWYA 3MOQA 4XB7A 3KLAB 3NCBB 4LHQB 3VGAC 3ARFA 1CC3A 4IU2A 3NJFA 1M57C 2QPFA 4LLWA 5DQJA 2X3AA 4LEOA 3X14A 2IQ9L 1FBIL 4QO1A 4AGMA 3CIQA 2GVYA 4HUXB 3JQOB 3ETEA 3FH7A 3K2IA 1KLFA 3NPSB 3QQ3A 4I0XB 1OZTG 2ZWKA 1BG9A 3QULB 4UQ3B 4HUWA 4NLHA 4JE4B 5ALBH 4X65O 5DTFB 2HJLA 3CC5A 4MXVF 3HE7C 4KFZC 3C5SA 1CLCA 4WFFE 3KR3L 1ZOXA 2IAMC 2ZCLH 1EEUA 3L4CA 5T1LA 3V0DA 3CFJB 5C8YA 2GSIA 4D9RD 4UXNA 1Z5LA 4GKNB 3BKYH 5C2BL 3UBXG 3WENA 4EAEA 2ITCC 1ODUA 5B3JF 3MSPA 2X9YA 5DRWA 1QD0A 4QHLB 4TOYH 3SDAD 1XGYL 2XKUA 4M7LT 4GYBA 3IGAB 4F33B 3BKJH 3LH8A 4RWHA 4NQSB 1AP2A 2KKWA 4OCSL 1SDDB 5JIKA 4ZX6A 4RGOH 4JLRB 4N4YB 1N7ML 5ELIA 2V4DA 1ZS8A 8FABB 1MLCA 5KAQG 2A9MH 4ACTA 2JCCA 1JYNA 3S5LB 4OJYA 3WIHA 3KM1A 4I87A 4JEGB 5INDA 4H25A 3SE4A 1HCZA 5IQ7H 4IL6Z 2H9GA 3IAPA 5D7IE 2CGRH 1L0NH 5HGHA 4NCDA 1AHWA 4HJUA 1BM3L 1DDHA 4MTGA 4PJDF 1DVQA 4HAFA 4KHXL 2J8UB 2VXTL 3ZR6A 2YC1A 4K7FB 4C4KO 5I76A 4ELMF 4K3EL 2JJVA 2KHAA 4GPVA 4E9TA 4L4TD 4JFHD 4ECNA 3BP6B 3Q1EA 5T3ZD 3PHSA 1T7YA 3O4OC 3X2QB 4MA1C 3U0WL 3FQRA 5IMOB 5EYPA 1CN4A 3F58H 2B1AL 3NDYE 3ARFD 3H9SE 1J5EO 4XAKD 1X5FA 2EJ1A 4FFBA 3RYFB 1A6PA 4UQ9A 4UV7L 2FHBA 1FNEB 4WHYG 5IREA 1K6QH 5DEGA 5AZ2L 4NQEB 3S8GB 2NX5B 4YSPA 1C8PA 1HAWA 1BQSA 1YVLA 3F00A 4J3OC 4KTDL 4B6ZA 1QRNA 4I9WA 2X4OB 1OHQA 5JXAH 1N6VA 5JH7A 1K3IA 1RZKC 4D9QD 3O3AA 2EC9T 2IALB 3L3GB 2X0LA 4MJ6A 5T1LD 1IIKA 2CTWA 2ENQA 1FKAO 1X59A 1KXTB 2FVNA 3EDKA 3KHQA 4IHJA 4X7EC 4HU2A 5AD0B 3DBXB 4TUOB 3MI6A 1TMCB 3F5WA 3PWUA 3L3JB 3RX8A 2WXGA 5EBLB 5LMUB 2IDFA 4P5TC 3NCYP 1X9QA 1ROPA 4ONGH 3LSOA 2WXFA 3SGEH 2G3NA 1NEZA 1ACYH 2OL3B 3OE7G 4JFEA 3JASB 3D33A 4DKFH 1TUBB 1NVPD 4DV4B 3GZQA 1BG1A 2X4QB 3ESPA 4WGVB 4AVKA 3T1YO 4E0RB 2UUAO 2IDSA 4M56A 4F2ME 5IM7A 5K33A 3ECWA 4RQEA 2CRMA 3DO4A 3PHOA 3AG2B 3C6LA 4X66B 3DURB 3FUEA 1S9WB 4HAKA 4J3UA 4P4KB 1AC6A 1DN0B 3SBQA 2O26U 4WCYH 1ODAA 4G6KH 4HMDA 2C1PA 2OX5B 5EZOH 3EYUH 1NDGA 4AH2A 2LJ2A 4LCCB 3WFCL 3RWHB 2UUCB 1GC1C 2Y25A 3P30L 3BD5A 5I1JL 3HJEA 5DEFB 2P8MA 3M6DA 5K9JH 1WZKA 4UDUB 3S2AA 2Q76B 3R06B 1W0YT 1N64L 3LEVH 2FH6A 4O2CB 1TU2A 1KTLA 3QDJE 1CDGA 1JNHA 3NCCB 4RAUA 3EH5B 4DV3B 3H1IH 3LVEA 1JIBA 2VDPL 1YQVH 4NT6A 3TJEH 5MHSD 3JV4A 1PYWA 2PWGA 5KOVC 2JCWA 7PAZA 1OY3B 4ZUVB 1R5VB 3D0VB 1K9MW 4YDNA 4P2OB 5AB2A 1NCJA 1BWWA 2Q0ZX 4I9WD 4PJ9B 5ABDE 4L8JA 2YBRB 3WKML 5DZJA 4BZYA 2NDFA 1JGVH 3VDCA 5FKPA 3WUZA 4CBCA 3A6OA 3E22A 2WSDA 2P5EE 4B53A 1TA8A 2XV2A 4WU5B 1I94O 1MIEL 3C60C 3QP3A 1ZE3H 4I4WB 4I3RL 2DBLL 5AZEH 3U6XS 1EM1A 1NCIA 4N8VB 4HUMB 1HN1A 2AJSH 3CC1A 4JRXA 4NC1E 4OB5L 5JIDA 1MVUA 1XL4A 1BEYH 4PV9B 1NANI 4LSTL 4JFED 2AHYA 1WBYA 2JQMA 3TTSA 5KBMA 2QQLL 4ZNEA 5IP4A 1UWFA 1CYGA 3GXTA 4FJCC 3GUTB 3RWCA 2AGJL 4XMLH 1QQCA 3O3UN 4XHJD 3UO2A 1WF5A 4FADA 1NDMA 2H3NA 3EJZD 1XIWA 2UY7A 1WEJL 5F7LB 4PDRA 1Z3GH 2LW3A 1I3RB 5AVVB 2VAAB 3C6LD 4YHLL 2AV1A 1HNXB 1EEZB 3KPMA 4HKZA 5EC1B 5E2UH 3VW3H 1ADQA 4A7SA 3REWB 1RZFL 2GBUA 3B8NA 5EF0A 2H26A 4MNQE 4OH2A 2G4GA 1LGVA 1RM1B 4JZNA 3OGIB 4CMMB 4H0LC 4I1PA 1C5BH 2AVGA 1YF2A 1KGWA 1GAXA 3GJFH 5EC2C 5I24A 2BOBA 2WC7A 1N4XH 5FF6B 3ZS8C 1A9BA 1D3CA 2GUOB 2ZIOA 4NPYA 2AK4B 5KSUB 5H37G 3WS6A 1B4JL 3EAKA 4WJ5B 3DOIA 4NZFA 5C09E 4RQQA 4YHKL 3ZW3A 2VL4A 4PAZA 4WNJA 1HIMH 1OSPL 4L18A 3QR0A 1PG7X 3AGWA 2JQAA 2DWDC 3LN4B 1C7TA 1KLGA 5KAQF 4V2CB 4BQBA 1FPTL 3PV7A 4K5NA 3I6LD 4X5XA 3QCVH 2A5UA 3B77A 2BMKA 3OQRA 4YBQD 1DTUA 3UABA 3W37A 3O6ML 2AHIA 5L3FA 1KJ3H 3L72H 1NT2B 2QGBA 3DJZA 5DRXA 4JGSA 3QPQD 3TU6A 2ZT9B 3IGLA 2IGFL 1FIEA 2HB0A 2IDCA 4HIHB 3QFJE 4JRXD 3TO4D 1AXIB 3DO7B 1S7SA 1IU1A 4MMZC 4J3BA 1EV2E 4OQTH 4Z77A 1OTUD 4DAGH 3SPGA 1VFAB 3MROB 3OUSA 3B9KB 2XVBA 3KWTA 4NEHB 2EDXA 4PJEE 1N0LA 5EU7C 1XGPB 4ZFFA 1ULVA 3BGFC 1OQOA 4PY8J 1I8MB 3FKUS 4XO8A 3BP5B 4LF9B 1XIWD 2OJZH 1CBVL 3NP3A 4A6YB 2WVSA 4F8QA 1VSCA 5JJJB 2BWQA 2D4DA 3JT2A 1UXSA 2XYCA 3MRGB 4QYOB 4JI0O 1A7RL 4X6CB 4IMKA 2GEQA 4JHAL 4KK5C 3HA0A 2H8PC 4LOUD 4ELDA 3SO3B 2QM8A 1DBAH 1KLUB 4QRTB 2GIYA 3GIZL 5TE6L 2HRPH 1OAZH 3T65A 5DD5L 3MV8B 1I3VA 1FVDA 1FD9A 1PLAA 3TYGL 3ZTJG 2EVJA 5E1QA 4UB0H 1XCQA 1PZ5A 3VFPB 4PA3A 5EUOF 1WIOA 3NR7A 1GMIA 5IJBC 1GH6A 3CDZA 3ETSA 5F9WB 3CCHB 3CMEV 5F89A 3SJAC 1R3KC 4HIIB 1OOWA 1SDYA 2YRZA 4I50B 5FGBA 5EU5A 1OAQL 5CGYC 1QHQA 4DKEL 3K81A 4X1KB 3RT3C 4EN3B 5F6HI 4Y4FC 3OC5A 1K8DB 1EO8L 3BY6A 3HBQA 4PBXA 4L0YA 2YAQA 1EZVY 1V7NL 1JPSH 2KLTA 4J7ZA 1D6EB 3ABUA 5KW9L 3W39B 3SDYL 4BYHA 1XWVA 1V05A 4LFBO 4XVUC 4UZSA 3JBG7 4HJ1A 4DV5B 1CXFA 1QZNA 1T1ZB 15C8H 1DVSA 4QNPE 5BZZA 3DV6A 3HC3H 3CX5F 1JWUB 3AG4B 1MIMH 4P2ZA 1SJHA 1DQTA 3LNDA 2WYTA 1HQ4A 1LE9B 2HG0A 3QZOA 3TBBA 5F7WC 4CUCA 2KLRA 1B3QA 3MREA 1OPGH 2GSMB 2GIXA 4J3WA 1QVOB 4D9RE 1KPUB 3N40P 5KAIZ 3O8XD 3GMPB 2OCCC 1UWGH 2N4IA 1HHIB 5GQBA 5C6TH 1WWCA 3BP7B 2NDGA 4J23A 3LKSA 4M5YL 5IWAB 3VFGH 1T22A 5I30L 3ZHUA 3MGAA 4PWGA 4BQ6A 4N22A 1KIUA 1U21A 2PLTA 4GW1A 5CBHA 4GKJO 2AXWA 4CS2A 4AOFA 4AQEA 4O2BB 2VZ1A 3DIFB 3LEYL 4H8VA 3ZE2B 2I9LA 4S1DD 3F05A 3QIWB 4JFFB 4ZPVA 1FFNB 3L9YA 5DJXA 3TWCH 2LQRA 4OLVH 1ZAUA 1XH0A 4PRID 4FLRA 2GK2A 4IRSC 3IE4A 4EDWH 4LNUA 5EUKA 2O6CA 2V5MA 2X10A 5D1ZC 3FSAA 5T8IA 3VRLE 1JNNH 4XBGB 2NY6D 4CVWA 1F4AA 4YSQA 3FS9A 5DK0B 3HBZA 4DV6O 4RFEA 3L7EA 1PKQE 4ODUB 3NACL 1U96A 1DL7H 4W4NA 3IMVA 3PS6A 3HVDA 3QVNA 4BZ2L 1AJ7L 1UD2A 4O5LL 5DU7A 1QUNA 4P59L 1S5HC 5F71A 3CCLV 2R39A 2YS4A 3LSQA 3M7OA 2XQYG 1RUKL 3G80A 1LO3H 5T3ZE 4JI5O 4L4TE 4JFHE 1KY7A 3QG7H 1IEAB 3CHQA 5KTEL 1E5ZA 4CSTA 4XAKE 3RKPA 5IB4B 1PDKB 3FNKA 3UERA 1RK7A 1KV3A 1ETB1 1MHPH 2R1WA 2OYKA 4TL5A 1KNOB 2DYPD 1NGYB 3LKQA 2C3HA 1UB6B 4MHHG 2XFXB 4WRLA 1SQXH 2K0RA 4JI7O 5EULV 4LFAO 2AMUA 5F7MC 4D9QE 5F2FA 1SF3A 2PETA 3NJJA 3P11L 4UCUA 2GG1A 1DN2A 3UAJA 1UJ3A 3NJLA 4OJFL 2O5ZH 2XPZA 3ELQA 3HLAA 2ZWSA 5IQOA 5ABZA 5F3BA 4NENA 1QO3B 2V8MA 2MPAH 5IOPA 4YHMH 4WEEA 1TQBC 4R7NB 2FYYA 25C8L 1QSEB 2ZOKB 1FORH 4QHUA 4DP9X 3ML0A 1IILE 4NXNB 1MCPL 1H2GA 4TTGA 2CRYA 1JN6B 2RACA 3LS5H 4WHTA 1YCIA 2YXHA 4WDIA 5L8JB 1I9RL 3IEAA 4OUOA 2I07A 3NQKA 5AOMA 3WN5C 3GMOA 1VFBA 4DSYA 2GSGA 3AQZA 1ROWA 3OAAG 5JXEC 3FTYA 4GMSH 4YNYA 2JCCE 2DD8L 3IJYB 4GSQA 4J8RB 3TZVB 3UYPB 2ID5A 2LGQA 1I1AD 1IAOA 4B7EA 1TKWB 3IM1A 4MWFA 1QFWH 5I1GH 1JAEA 4TYUA 3N1PC 1SFDA 3CDFA 1M5IA 1K7DA 3N04A 4JM2F 4XMTA 3E8HA 1QKZH 1LP9B 4ETQB 4FQPA 4M62H 2WKLA 3P3RA 5EDXA 1MSPA 3H1JH 5BZWB 1EUTA 5DVNA 2OYMA 1KN4L 1M3IA 3D08A 3EBHA 4CGUB 4K55A 2XQBH 3II3A 1Y6NR 3WHE0 2ZOTA 1U92B 2OCHA 3DJSA 1BZ7A 4U4BA 4YQXL 5ESVB 1WZ1L 4YSTA 5MHSE 2WQAA 1P9MA 3GMLA 4X9QA 3ZY7A 2F7RA 2W8CA 4IM8A 2OMNA 1FNAA 2OP4L 3BVNB 3K2MC 3OKDB 3DRQA 3MRNA 1QRNE 3HB3B 4I9WE 1P5UB 3ZDYF 4U31A 1SVZA 4KZEL 4ZIBA 1M71A 1QEWB 5HJBA 1AQ8A 1G6RH 3FTUA 4DR4O 3CXCU 2R0WL 4HXBL 4FFYL 4JANB 3UAJD 1JGEA 2FLMA 3S6CA 2NYYD 1UD3A 2Z31B 3BXNA 1H6TA 3OR7B 1KB5H 5CLYA 2WLLA 3QF7A 4NXMB 4AGNA 1GR7A 4NAJA 1OCRC 2FX7L 4NYKA 1Y6XA 2I7SA 3QC5X 1TSHA 5IFAH 1Z7JA 4JI2O 1RZ7L 2IPTL 2PR4L 2P5OA 2WLMA 5IFHH 4TTDD 3C09B 4HEMA 1YLBB 1C5DA 2JELL 4CW1A 4JFEE 1I7RB 4OKVA 2X7RB 4BW9A 2YN5A 2A83A 2CUAA 2DQGH 4BFJA 1LD9B 2ICEC 5EHFA 1TVHA 5IZ7A 5EWIL 3BAAA 4I89A 2ZP8A 1PZCA 3CXHF 1N5YH 1NOAA 2JK5A 1OZUA 3BKCH 2XWBB 1U8PA 2VLKA 5DD1H 3TEUA 1V8HA 2HTKC 3NIFE 5G4MA 1SZTA 4B3MB 1CLOH 1VA9A 1BVKB 1XV8A 1QFUL 4QXUL 3FN9A 2IU0A 4BWAA 5DZAA 3VSUA 2D3VA 3NTCL 3HR5A 3QS3A 4RUEA 1BSIA 1FL6B 3OAZK 4Y88A 5HPMA 2GKIA 5I8KL 4H44B 2J56A 4P9OA 3I5DA 1IL1A 5B4MD 1HEJC 5JVDA 1NSNL 2K3HA 1HH6A 4PJGB 5LQBL 3S88L 3MUZ1 1FNGB 1RJYA 2W07B 3DETD 3BPCA 3LRHA 1BAGA 2CO7A 4NO0B 1G1YA 4I3GA 1ZSDA 5CS7A 4PRBA 3V10A 4ANKA 4EQ2A 4YMPA 1J0JA 1IBLO 3QWRA 1Q1PA 3V4VH 4MVQA 1TNNA 1M4UA 4IOFD 3ZRXA 3DC5A 1LEGB 2P06A 3P30A 1OCZC 2O57A 2GDSA 1HOEA 1JE6A 4RO2A 1IC4L 3LZLA 4JFOA 1JMXA 4PLKD 4B9PA 4FDWA 4G8IA 3U4AA 3IPEA 1OF2B 4UTAL 1B0RB 2BHFA 1NM9A 3O11A 4PWFA 5DHVA 1M7XA 3I6LE 4F20A 5D7IF 3SKMA 4LP8A 4U1MB 4FQCH 2AXGB 3I9IA 4BXVA 2R51A 1BMGA 2X44D 4X5WA 3DK0A 4E42B 4U3XA 3TEYA 4JRXE 3MV7B 1ZHKB 4GRWH 3CTTA 1F4YL 3SPJA 1JPEA 2X7LA 3H8NA 3D4YA 3NABL 2Y3AA 1RUPL 3VB8A 4ZNEE 2YEZB 1T2QH 2AQ3A 4FLZA 4NO5B 4UAOC 2J55A 2DYSB 3HKBA 2DQHH 5A2JH 1YI2V 3N1FC 3FQXB 5KMGA 3WB0A 4HUUB 2ZCZA 2O61B 2BSBA 4X7TB 4XDLA 1B06A 5K59E 12E8L 2BJML 1YDXA 1J0ZA 2VLKD 4UT7L 5ITBL 1F02I 1EAOA 5D7LD 3S2CA 4R83A 4N0CD 1NAMH 5FUCE 3LRKA 2EDEA 2XNAB 1QLEH 2J1XA 1GGYA 2NXYC 3GPSA 4PJ5B 4GKLA 4IRJC 4HW6A 1HDMB 4MQ7A 4PJCA 3OM3B 3P2TA 2R2EA 4H0GA 4QJFB 1PY0A 3SY6A 5KJRH 4FERA 4WW2A 1UCBH 3LQZA 2R8SH 5HHOB 4PV8A 5BV7H 5IVXF 5J56B 5J11B 4Z1VA 3BAKA 4L1LA 3QZWB 1KN2L 1CICB 5LNGA 2ADIB 5D5PA 3JVGC 3LMJL 3FK3A 1VQ8V 4HZLB 1A6UH 3ARUA 1QUPA 5TJWK 1JF1A 3VGGA 1CFSA 3QHZL 2DI7A 3IDXL 4TPRH 2GAZB 1UVQB 1JGDB 4Z2WA 4GO6B 2VJXA 3CN4A 4YHNA 4FG0A 5I1IH 5E5UB 3UTOA 4W6WB 3ARBA 1V9PA 2XVLA 5LWYL 1GOGA 1UZGA 1R33A 4AEIL 5LUMA 5FYLH 3KWUA 5KSAA 3NFSL 4MD4B 4HNAB 4S0SD 2IXQA 1WTLA 4HWBH 5JQ6L 2UXXA 3QNXB 5KANG 2WLZA 2PW1A 3ABZA 1PY4A 1QTPA 4LVNC 4F92B 3UKMA 2C8NA 2IBBA 3EJRA 4KMLB 4Y4KA 4CSPA 3N06B 3APQA 5KVFE 3TN0A 5IHWA 3ZL2A 5D55A 1XO8A 4AK2A 1AGCB 3L3HB 1M05A 1KCKA 3GI9H 2J5LB 4GKZB 2CM6A 5I1LA 3GF8A 3IJHB 5B3SC 2B3IA 1VQ4V 3CX5K 3T0EB 3TNMB 5GS1A 3CVCA 2ENYA 3ULVE 3MC0A 4XCNB 4B9IA 2IJKA 2QELA 3JTTA 2YD6A 4BFIB 5EA0L 5LGHH 2VIRA 2Y06H 5IJVA 4H1LH 4YR6A 3BVXA 2H32B 4H26A 4AYEC 4AQOA 4O4LB 4FLTA 4HJ0C 2VB5A 3ALPA 3U0PA 4TSAL 2PYJA 3ARDC 2NN4A 1I85A 1CGUA 1ZL8A 5FXCH 3QYNA 2CKBH 2OMVA 2ZXCA 2HKFH 4FX5A 4JDVA 5J13C 3RBGA 2OTUB 2YJLA 3DX6A 3L2NA 2EH8H 2ZYHA 4LGPB 5KBKA 3GB7A 1EVTC 1M9WA 3SBPA 3V5HA 2C9RA 1IGTB 3Q44A 5ESAA 5I1DA 3QNEA 1CG9B 1A8JH 3E1ZA 4FMFA 4HUKB 3NFNB 2N1KA 3G5XB 5CGBA 1QSVA 3EFOA 5CZRA 4UOZA 2YEVB 3DIDA 3TEXA 4WKZB 1SUHA 3VQVA 3MUJA 4Y5XA 4DO6A 1KT2A 2VLRA 2EDYA 3CB2A 1CFNB 5T33H 4YSUA 1YAZA 5LKNA 2P43B 3VFVB 1CFVH 1DUZA 3ARBD 3CMGA 3K8LA 4AYBA 1NKGA 2COVD 5KSAD 3L3KB 2MQ3A 3BHBA 3TH2T 3VJ6B 4DUYO 2NY0B 2EINC 3GMRA 5GONB 4IBQA 4LRNH 3W9DA 3E38A 1KZQA 3N0PB 4DRXB 3JSLA 1VIBA 2VMJA 4HDIB 1VF7A 3P0VH 1GPOH 4Y4KD 1PF3A 3V6OA 3TN0D 4YDJB 3JD4A 4Y5VB 2WP3O 4JTAB 5ES4B 3I9GL 3FCBA 3ZZ1A 5EIBC 4ZO9A 1F6AA 4JFDD 3P77B 3V6ZA 4MJ2A 2BPBA 1IIIA 2FWOB 2A2QT 1JZ8A 2GY7B 5B1AB 1N8RW 4LF7B 4OU3A 1Y66A 2H2PD 2Y4SA 2FJFA 4CC0A 1M53A 4LARH 5I0XA 1MJ7L 2A6JB 1MOFA 4F37F 3O6LL 1XEQA 4PGCB 5BW7C 5GRVL 1B0GA 3CQQA 5A7EA 5C0JB 2V17L 3MRCB 4W4KA 1NCWH 5B22A 5I1HL 5BJTA 4OLZH 5BS0B 3KPLA 2NNRA 5DS8B 2NQCA 5DI8A 4XDKA 4PJEF 2WLNA 4XN1A 3ILQD 1TEFA 2Q7GA 3BMVA 5JLZA 1SBBA 4R0LC 4CC5A 1WWBX 4NGHL 1SN0A 4OZFB 3RVWC 1N6QH 4OZHA 5HJ3B 2A73A 3ECVA 2Y3NA 4L5FL 4C4BA 1VACA 1RZGA 2VLRD 3BKYL 1K5NA 1IGML 1B6QA 3JYBA 1DVFD 2V7NB 2XXFA 1GM8A 1E0OB 2PUQT 1M93A 1FZOA 3DX7A 4J6IA 4Z18A 5DJ8A 4X4XA 4XNQB 4BZ2A 1WS7A 3HZKB 3IDNB 4IEFA 2YRLA 1JSYA 4FEMA 4UDTA 2A3QA 4ZFOB 1KJ2B 2F15A 3GS4A 4I0KA 4MJ5B 3U6XA 1D5BB 5LNEA 3SDLA 4QPJA 1YYCA 2BVOB 4NNYB 3QSKB 3E8FA 4B08A 2VDLB 3CSYB 3MRKB 2DWYA 3QUYA 4P2RA 2YUVA 2KS0A 3FF8A 3JTSB 4HIEB 2MCAA 2WV3A 4C4KT 2VERN 1IBGH 3ML9A 1VQPV 1KFAL 1A3RL 2WYIA 4BHUI 2YIAA 3STLC 3NIDE 1YN6B 2HT3C 5IQ7L 4LQ1A 1MG3C 2XN9B 1MCBA 3I6GA 5A16A 4QGPA 3VGEA 2CGRL 4JZOA 2WXMA 4QRAA 3BAIA 5KSVA 4QNPF 2WTRB 1AVMA 3O65A 2QFRA 3UZQB 3IDIA 1XNQO 4ZFGH 2ZM6B 1MCOL 2EIMC 3OKYA 1BFSA 4FKHA 3OKNA 3N91A 3W7SA 1N36O 2Q20A 3K2UH 4PJHA 3RDTC 4BZ1H 2Y69C 5GISH 3QUXA 4NYLB 3VXRB 5B1JC 3HVNA 3D3VA 3WE6B 2X53A 1BMFG 5EF2A 1OGAA 4A7VA 1MHHB 3VX1A 1K6QL 1INQA 3N2GA 3Q48A 4X6BA 4AEEA 4PP1D 5CCKH 3FFOA 3IU3B 3LAFA 5EBWB 4KJPC 3TBWB 4X6EB 3ZZLA 4JFPA 4W9GC 3HZMA 4B9FA 3KL0A 3Q13A 2F23A 1YJNV 3RG1C 4QXVA 1ENVA 4WFBV 2CSPA 3CXHK 4CU8A 2WPDG 2WINB 3OKLA 2F66C 1QFHA 4P46A 4F91B 2IGLA 3SGKA 3AT9A 3ZIMA 5D2LB 3DX9B 5FO7B 1OP3K 3WJMA 3PAUA 4FLXA 3FT2A 5HI4C 5JR1L 2GT9B 4WNQB 5I15H 2NY2C 5AVSB 4X64B 5BQ7A 2Z65C 1CLZH 2P7TB 2R0LH 1B0WA 4XCCL 3RY4A 4DPAX 3ULUD 4DKFL 2ZAIA 2EUZA 1RZIA 5DRZA 2QADD 3BPOC 4KQ3H 3G6BA 1DANT 1MELA 3H3PH 3RFZB 3PP3H 5EU6D 3DMMD 3MMEB 1XCXA 2A6KB 3O9OA 3CFCL 3QUYD 2N04A 4BK4A 4FA8A 1RP3B 1KIQB 1W0VB 3DA0A 5I73B 2A9HA 3V6FA 4QHNA 4TSCL 3M1OA 1K4CC 4WCYL 2VC2L 2OXHA 3QT2A 4J4PC 4AMWA 5HHXH 2HG5B 3ULVH 3EO0B 3HC2A 2X6CA 3EYUL 4L29B 4WU7A 3LDDA 2BS71 4HEME 3BZEB 1YJDC 1SMDA 5FLVA 2OCCB 1YDPB 1W72B 1RK0B 2HH0H 1SN2A 3QH3B 1MA1A 1AD9B 5HI3D 1H2NA 4MAYB 4KKAC 4X6FA 5D6DC 2Q68A 2NZ9D 1VEMA 1YEKL 1AOZA 4Y9CA 5D1XA 4G43B 4GS7B 4FMTA 1OW0A 4Q6GA 1HU8A 2MEJB 3D3VD 3WO4C 3FU9A 4R2GD 3U7WH 2ICWA 3LH2L 5CGTA 1ZCRA 4Q89A 4BIZA 2VLKE 3CRRA 1RL1A 1B88A 3IB4A 4M3KB 1P1VA 2XQYK 4X9FA 4APQD 2GFBB 3WNMA 4ORZC 3SR2C 1ZHBA 5GS3A 1BVLB 3BAEH 2QQKH 3MRRB 1LXMA 4BSVB 5KS9E 1P6AB 5BVJB 3QWQB 4LBEC 2CUGA 1JOYA 3FO0H 4APXA 3HC0A 1OHHG 5KYUB 5FW8A 1RIHH 4P46D 4XMXA 5IMKA 3HNSH 3QISA 1EFQA 1K4DB 5LGTA 3MNVB 5HDRA 2Q8AH 1T1WB 4WBNB 2CLVA 1XGRA 3VMOA 4CDHA 1WUZA 5HYJB 4YGAB 5EZJB 1MFEH 3ZE0B 1BWMA 2JCCF 1YEDB 1CUOA 4PYHA 3Q3GA 4Q8BA 3FD9A 3ETGA 4V11A 3HMXL 5CEZH 3S5ZA 1MNNA 4D2NA 4K94C 1Q81W 1T04A 2XBDA 1HNWB 1OAXL 1JPFB 2Y5EA 1RJCA 2F8XC 5B39G 3WN6A 1OPOA 1Z0NA 3MRDA 1Z3GL 4MAZA 3OF6A 2ZUTA 3WLBA 3CSFA 1RZ8A 4FLHA 2R1XA 1G7PA 2AC0A 4RDBA 3B8YA 3VW3L 4HKJA 2UVEA 4JRWA 1W15A 2OZ4L 2CIIB 4UTAA 3CNKA 4IGBB 5CP3H 4BGLA 3B7UX 5HXMA 3D9AL 3QVAA 4GT7A 5C0CA 3FO1A 2OA9A 1KXHA 5GGRA 2XTLA 2BNQA 2C3XA 4ICWA 1YG9A 2L7JA 1TQBB 4L8BB 4RGMB 4CVZB 2A74A 2BFGA 1QVFU 1O9ZA 3WL9B 3MLWL 3X17A 5KBLA 4TULL 4M03A 5FKAA 1NICA 2OL3H 1DJHA 4Y16A 4NJAH 1IC7L 4XVOA 4PJCE 3L70H 3HPLA