3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
3SPGA 3IGAC 3SJQC 3T4ZA 3ATDA 5EK0A 3AG3C 1G4YB 2P7TC 1R3JC 3UM7A 2HVJC 5BZBA 4PA6A 5EBLC 4CBCA 4G28B 2W0FC 2WLHA 3LNMB 2ZD9A 2IH1C 2Y69C 3K0GA 2HFEC 3AG4C 1R3IC 3ASOC 4GX2A 3AG2C 5B1BC 5CBGA 2GIXA 5KUKA 4XDKA 3VOUA 2JK5C 2ZXWC 3LUTB 3T1CA 1U4FA 2DWDC 2ATKC 2X6CA 3LDEA 4PA3A 2WLIA 2ITDC 2BOBC 4LBEC 4MVRA 2IH3C 2E4FA 4MTFA 1LNQA 1OCRC 3BEHA 2KB1A 4R8CA 4PA9A 3LDCA 2WLJA 3LDDA 4MVUA 4MVSA 5CBHA 1K4DC 1BL8A 4RAIA 3HPLC 5E1AC 3E8HA 4DXWA 4OXSA 4MTOA 4P9OA 4LCUC 4RUEA 3SPIA 4WFFA 1ORQC 5B3SC 4JTAB 2A0LA 2WLNA 4WFGA 4R6ZA 1XL4A 4HZ3A 4PDRA 3SYQA 2HG5C 3OR6C 5EC2C 4QNHB 1XL6A 4P9PA 3SPJA 2NLJC 3R65A 4MVQA 3T4DA 3SPHA 3RW0A 2WLIB 4JTCB 1V55C 2WLKA 4QE9A 4F4LA 2Q69A 1M56C 3AT9A 1K4CC 2EIJC 3SYAA 3AGWA 4WFHA 1M57C 3RVZA 4MS2A 4PDVA 4WFEA 4R7CA 3ATEA 2X6AA 3ASNC 4MVMA 3T2MA 3OR7C 3SYPA 1R3LC 3F7YC 4XDLA 4QE7A 3OUSA 2K1EA 3RVYA 3STLC 3ATFA 2DYRC 3AG1C 5EBMC 2DYSC 2X6BA 5CBFA 1JVMA 3K06A 3AT8A 3AUWB 1J95A 3K08A 2YEVA 1OCCC 2QKSA 3E8FA 3E89A 3SYCA 3UKMA 3ATAA 3TETA 2EIKC 3JYCA 3ABMC 4J9YB 3E86A 4MW3A 4PA4A 2ITCC 4PA7A 3STZC 1OCZC 4H33A 4PDMA 3E8GA 4I9WA 3FB8C 5IY5C 4KFMA 3VSQA 3E8BA 3ABLC 1U4EA 4MW8A 4BW5A 2HJFC 3K04A 2OCCC 2WLMA 2HVKC 3GB7C 3FB5C 3KG2A 2WLLA 4GX1A 4RO2A 2A9HA 4P30A 4P2ZA 3TCUA 3K0DA 4RUFA 3SYOA 3OUFA 3F7VC 2EIMC 3FB7C 1QLEC 3OGCC 4MVOA 4MTGA 4G27B 3ABKC 3EFFK 3F5WC 5B1AC 4J9ZB 4MVZA 1ZWIC 3PJSK 2QTOA 4GX0A 4PDLA 3SPCA 1N9PA 2H8PC 4R50A 1OCOC 3FB6C 2A79B 1S5HC 4HYOA 4TWKA 3ZRSA 4H37A 2EINC 2WLLB 5KUMA 4X8AA 1P7BA 4LP8A 5J9PC 4X89A 2Q68A 1V54C 1KKDA 4GX5A 3X2QC 3ATBA 2Q6AA 4UUJC 4MSWC 3K03A 3IFXA 3E83A 2DWEC 4ZBMA 4EKWA 1R3KC 3K6NA 4X88A 5EBWC 4JTDB 3RBZA 2AHYA 2EILC 3WG7C 2AHZA 5EC1C 3ZJZA 4XDJA 2BOCC 2Q67A 2R9RB
chains in the Genus database with same CATH superfamily
1J0KA 2CLRA 2IW5A 2WMPA 1GZHA 1CDJA 4G8AC 4WEEA 1NLBL 3ZTNH 1A9BA 2YAFA 3E1F1 4AEHL 1QPKA 3KYNB 3LHAA 3GDBA 1SQGA 4K71B 3RPBA 4DR2B 4PJXF 4A2MA 3U2SB 1XBRA 5TE4H 4QPJA 5DK0B 1KF9B 4YC2B 3KHQA 5KAQG 2KT6A 2XN1A 2JIXD 2EXYC 4QRFA 2NTFB 1OWRM 2X4UB 4QT5A 1GPOL 3F5TA 1AMXA 5D1ZD 5E5RB 3KPRB 4PRIB 4XZUB 3GXMA 3OKKA 2D31B 4I5SA 2OZ4H 3M1OA 4N0YH 3JUYA 5I6OA 3QRFM 2O61A 1AI1L 3F12B 25C8L 4OM1H 4L3EE 2BSSA 1DN0A 4FEMA 5D8JH 1QLRA 4P8QA 1R3KB 2R2HB 1V5JA 1JWSB 4OH2A 5DZOA 3S37X 2HUHA 4GO8A 3IFOA 2F53B 1AR1C 3RDTA 2V2WB 1ZKAA 2RALA 5DS2A 3UTTA 2N1TE 2P4AB 5I28A 4MNQB 2C9VA 1U6AH 3EGXA 5KW9L 2AANA 2FZ3B 2IO5A 2DQCL 1KLGB 4I7ZB 3RWJA 3W9DA 2X88A 3MXWL 5DMGC 2LW3A 1IXBA 4P06A 2ADJA 3C09B 5F6IC 5EBWB 3R7RA 5E4EB 3I6LE 3W57A 4LH6A 1KBBA 3LNGA 4BH7B 5T1JA 2CO3A 2MSPA 4J3OD 5HHQA 3L4CA 2YOAA 4JPVL 5HD8C 4JI4B 4LCIL 2Z31B 3MSPA 4JMXA 4XNMA 1AFVH 3VDCA 1IAOB 2AEQL 5EDSA 4H7VA 2DQHL 3CDCA 3FTSA 1BF8A 1PS3A 5K1XA 4MMXB 1CIDA 1AGCB 3GSRA 5T5FH 2OJZL 3R19A 1IM9D 3TYFA 4D9LL 4ODWA 4CSSA 3B5GA 4YJZL 2WXPA 3M7MX 4LR3A 2Z91B 3WFHA 3F04A 3QULA 3WDHA 2O26U 5EZOL 3SBWC 3B2MA 2UY6A 1KDJA 2W88A 2VDPH 3TBYA 1U8IB 1AR5A 3SD2A 3OUFA 4NNYA 5KJRL 2Z7UA 2LVEA 2XT9A 3S36X 5FYLE 1UXWB 4JRWA 1P53A 3D2TA 3SPCA 5DURB 2C1OA 3PXJA 2FJHA 2EC9U 3GBLA 1Y4MA 4NQEB 3FTWA 1DJGA 3CXDH 4KL1A 3O4OC 3OXRB 1SXAA 2DWDA 4A04A 2EAEA 5AOIA 4QDGA 4OCXH 4ANVA 4O5LH 4E42B 2VMEA 1WFOA 1M4KA 5E03A 1XDCA 1C8QA 5CGYD 1T66C 3W7SA 2XWEA 3CXHF 3I6KB 4RGMC 4AQEB 5AENA 3BLKA 4NYLA 3D8CA 4P5TC 4LNUA 3M7OA 5C07E 4L5FL 4GEJA 4K3JH 4FLWA 3O2WH 5L2KA 2J12B 2O57A 2BIPA 4OSUH 5IMLB 2W59A 4XWOC 2CTRA 4X2UA 3K0GA 3STZB 5IHUH 1L4IA 2IQ9L 4QKXB 2HFGL 4ZNCD 1T2XA 1U3JA 2F5AH 4I55A 2CAKA 1S5IH 4O4HA 2JGDB 1ZDQA 3LQZA 2JK5C 1O6VA 3W81A 3T1HO 3E8VA 2CK2A 1ZAGA 1MHPH 2XBDA 4MFHA 4AM0A 5EHFA 5I75C 1IAII 3O11A 3BP5A 2RCSL 3FT3A 3MNZB 5CS7A 5E2VL 1KGWA 3EZJB 4NT6B 4M7LH 4Y19E 3LVEA 4YHZH 5B39G 3PNWA 2DQCH 5GZNC 1NM4A 4OIAA 4GO6B 5CU5A 2VQ4A 2V17L 1MRCH 3IBOA 3NFPB 4PGJA 2V2XB 3IFPA 5HYJE 1FAKT 3AU0A 1DQVA 4B0MB 3RWIB 4X64O 4FF9A 4UIKH 1CEZA 2FYUH 1S7RB 2QR0A 4AK1A 1CBVH 3B6SA 4MCYA 5JLZB 3F7RA 1RJYB 1U3NA 1UXSB 2YSTA 4WI5A 1J8RA 3O4OB 3THML 2XVKA 1M56C 2VM3A 1NCIA 3ALWA 4XMKL 5DUBB 4GP8B 4MMYB 3CDYA 5E0QA 3GRWL 1R24B 1JBJA 5KTEH 3ULSA 2HJDA 3TBSA 1XD0A 1LE5A 3MBXL 1OLZA 5J6GB 1RULL 1P1ZB 3TA3A 1MCWW 5I1KL 1NCUA 4NXSA 3O9WA 4OIIH 4TSBL 2Y7MA 4UBDD 4YSSA 4EI5D 4Z1VA 2CBQA 2VRZA 2K3HA 3O3AA 3B3IA 3HAEG 3HB3B 2VDPL 5PAZA 4DETA 1UZ8A 1L7IL 3E89A 1ED3A 1YVLA 4C54A 1F6LL 2BVQB 4MAUL 1T5XB 1EWHA 1SUJA 2ZYSA 4PJIF 3FTGB 5D4HA 3VXME 3QEQE 4LLDA 5DUML 2K8QA 3UTPE 1KBWA 1I4FB 4DWHA 1AQ8A 4JUTA 4U1NB 2EC8A 3O0RL 1VQ5V 1G1KA 4NKDB 4G7SB 2GTZA 3J81N 3MJ7B 2HJFB 1Z66A 4X0KB 3FFQA 2WLZA 3E9TA 1PDKA 4Z18A 5LXGL 1YEHL 4J7KA 4D7PA 3FCTA 4XMXA 1OCOC 1IGFH 1A3LH 4KVCL 4F33B 4F9LC 3T8VA 3IAGC 4U1MB 4LP8A 3TGXA 1W72B 3MRNB 5IVNA 5DK2A 1AMYA 2B5IC 2OCJA 2Z64C 1IAIH 2X05A 1J9QA 1G9EA 4TNWK 5AKTA 1N59B 1LP9B 5PCYA 1A65A 5FFGA 1NFDB 5AG9A 1HSBB 3NJVA 5FYKE 3VB9A 2NNAB 3U4AA 4JDEB 4JRYB 1YEDA 4PJAE 4AKPA 1I1FA 4NHCL 1IGJB 3VSTA 4K0KO 1FIGH 1V3MA 3O6KH 2CKBA 1SA0A 4KK6D 5FUZL 2XLLA 4TTDD 1R3IC 1ZLEA 3DJRA 4AIEA 3IMBA 4WNQB 1EX0A 4FLYA 3LIZL 4HJIA 3UDWC 3C8KA 2GTQA 2AW2A 4R97C 4MZ2A 4DV6B 3BLBA 5CA1A 2FD6H 4YSAA 4UILH 4HLJA 1KB3A 5JOFA 1XB3A 4P2QE 5DJYA 3UYPB 4JI6B 2BCMA 3VFGL 1EO5A 4HXAH 3LPGA 1ETA1 3WO4B 5M7QA 3Q43A 4APXA 1S78D 2IPKB 2QGNA 2DDQL 4KI5E 3WOVA 3CXDL 1NGXA 3L3OA 2Q20A 5EU6A 4GG6A 1X4TA 3RIAK 5I8KL 1FXKA 2WIIB 4K94L 1YNKH 5JJJB 3V0GA 3RWGA 2B0SL 3M1BB 1OPOA 2FH8A 4OIIL 3H53A 3QIUB 1CXIA 4WY7H 3SO3C 4IK6A 1TLMA 4M02A 1BS3A 4PWJA 3ZRFC 2KPWA 1JA8A 4JK0D 2P06A 2ATPA 4GRWH 3QUZD 5KOVC 4U6XB 3M1BA 4U6TA 1R34A 1J10A 5ESVB 4ZYKA 2ICEB 4NC1C 3LIZA 5HDLA 4L8CA 1WB8A 4GINA 2X7LB 1R3LC 3DMMC 4U6YB 1I94B 2CM5A 3UTZA 1BFVL 1UZGA 2GJRA 1PZUB 4L1BA 4RWUA 5EC1B 2QJ1A 3BIKA 3RE0A 5DSCB 4APXB 2E3VA 4DW0A 1DDHB 2JJSA 4ABWA 3WIHA 2J1KA 3BAJA 1FNFA 1I7ZA 2Y22A 5JOFB 4H2AA 1XF4B 4YXKL 5L88L 1O6TA 4DR4B 2QGBA 1U6AL 2NNCA 4ZMWA 5KW9H 4LVHB 4MT8A 1ID2A 2LQRA 3E2HB 3PIQB 3QORA 2G4EA 2NZIA 4YDJB 2P49B 4ZNEE 3ULVE 3MGOB 4KNTA 5KVFH 4X6DF 1QLEB 2XTJD 4ZSOB 3ABKB 2D7TL 3AM8A 1TTFA 2Y6SC 2ZD0A 3BAIA 1TXKA 3MJWA 4I9QA 3K5NA 4JRYA 3H6AA 5GS2H 3CIQA 4LOEA 2UVEA 4KKAD 5FUOH 1BXAA 5KYXA 1OD9A 2HVKA 4KMQA 5KVDH 1RZPA 3ZRSA 1IC7L 3GMRA 4PJCE 2JXMA 4DR5O 5IV2A 4C56E 5C0RH 5I23A 3LEYL 2WO4A 1AZVA 1NL0L 5L3CA 2L0DA 1E50A 4PR5B 4JV5B 1C5BL 5DZNA 5CJ8A 4BQBA 3VM5A 1VB9A 5D70L 1ORSB 5C70A 4HVBA 1DE4B 2NY6D 4YSTA 1MFNA 1RVFH 4W4KA 1WA8B 3RU8H 2XQBL 3CPLA 1ZSPA 1PDKB 3HLKA 1X7QA 1GGIH 1XSIA 1OM9A 4XXWC 3UAJD 4PRAB 1CXHA 4J4PC 2AXFB 5BZDB 3B2DC 3F85A 4LAQL 1T0NB 3LQAC 3MJ7A 4NQDB 4AVHA 4JYBA 2JWYA 3W9EB 2OZ4L 3AREC 3QQ3A 4DW1A 2A4EA 4LE8A 3R1GH 2JCCE 4JE4B 2D7NA 1BF5A 3HUJB 3QDMD 3ZKQD 1SM3L 1SZXA 4DV1O 3BAEH 1JRHL 1XMWA 2HT3C 1AI5A 3OBAA 4D9RD 4IL6Z 1MWAB 3VAEA 1ED3B 2ATKC 1HILA 1CG9B 3ZDXF 3JQOB 4UVAA 4AQYB 2HTLD 2V3EA 1RPUA 4B3TB 2WVTA 3GXPA 4ZPTB 4U1GB 5IB1B 4P9OA 1EJ6A 1RSOB 5J6GA 4G9FA 2WIMA 4WW2F 4O58L 2EC9T 3KXFD 5I1HL 1I1RA 4XN7A 5I8EB 2IH3A 3BUQA 2C2AA 3GSNL 1M93A 2CJSA 2ODHA 1OGTB 1FFOA 3BWSA 4TQPA 5B66Z 5DR5L 3LCYA 5B1CA 1I8LA 4A6YA 1WTGT 2NY2D 3Q01A 1WISA 4UV8A 3CLEH 3RY5A 2EADA 1GYAA 2NY5C 4XGZA 3EOTL 1GR7A 3P73B 2FWLB 4NHCH 3RVZA 2W0XA 1CD1A 2AAVA 4NP4H 3FHEA 3H7BA 4OZ4A 2NY3B 1OF2A 1EXGA 4WVRA 3JAWB 1B0WA 2AK1H 3CX5F 1UTDA 2EDHA 2OR8A 4KI1A 5E56A 3MA9H 3S5LA 1J5EO 1EXUB 2VXQA 3QE5A 4O02A 3DO4A 1UJWB 1ZE3C 4OQTL 5EOQH 5F0LB 5F7MC 5EO9B 4NQSA 4M6NL 3EOAA 4AQZA 1ZHLB 4UQAA 3RTQD 1N2RA 3JALA 3AG4B 4X9HA 2QLYA 4CN6A 2VN4A 3F7LA 1LK3L 1BX2A 2J5LC 3AS3A 3ZE2B 3ABLC 5D1QB 1FBIH 1ZT4A 4WW1A 3VQXA 5DRWA 3U1SH 4URKA 2VISA 4ONHB 1HVXA 4O4JB 2X1WL 4AYFA 4BHUA 4N23A 3ECWA 3OGCC 3IU3B 4D0DB 5DEZA 2QTOA 3G04B 5DD0H 1BD2E 1DO6A 1NLBH 3ZTNL 4EB6B 4HKJB 1ZAUA 4CADB 2OW7A 4G6JH 4TVUA 2V5RA 4XXCA 1XR8A 3AS1A 4ZX6A 4QEGA 5SWZB 3V4VL 1M05B 2WY3B 4TOYH 3VXRA 3OXRA 2VR5A 5IHLB 4X88A 3G9VA 3K91A 3MCKB 1E9OA 1SM3H 3ZR6A 5D9SA 3UAEA 2WWKT 4LF7O 1N4XH 4K3HA 3CCHA 4AJ0A 2CBMA 3H42L 5INCA 4LRNH 2Q67A 1QFUH 4BZ1H 2HTKD 2AJ3A 3Q44A 3QFGA 3L9BA 4F7TB 4HX1A 1UFGA 1VEPA 4N8CL 5LBVA 1B3JA 5C08A 2AK4D 4GYBA 3FMGL 2KKWA 1JOYA 2KH2B 3SQOH 3IMSA 2QPSA 5ABAA 5ICYA 5KAFZ 5B1BC 1N0XL 2AQNA 5EBLB 3GSRB 2MTPA 4UZUA 4BWUA 3BZEB 1SLUA 1WG3A 4Z7OB 1U96A 1A6AA 1YO4A 1IAKA 4RMRA 4M48L 3UGXA 2E76C 4M7KH 4PRPA 5CCGE 1UCBH 4OFYA 1IAOA 1ZV2A 2XFGB 3ISWA 1JFHA 1UQSB 2HJLA 4OD3H 1E4HA 1A7RL 1RFDH 5CB4B 1UD4A 2PR4H 4Z6AT 3SJBC 1NAMA 5FUOL 1ID5I 3BPLC 2XAQA 1WT5A 2RA1A 3D09A 4H4NA 2O5NA 2XICA 4L4VA 1DDTA 1N32B 1VZGA 2WXNA 3BSGA 4MTOA 4YEFA 4GMTL 1I08A 3IJ4A 3WY2A 5IWAB 2XX0A 2W1NA 3U2IA 4HHAB 3EYSL 4MJJA 3QDJD 4L4VB 1G7HB 5AKSA 4QGYA 4OM0L 5AYUL 5AOJA 2HSIA 3QDJB 5F96H 4Y5XB 5GONB 3S88H 2W80C 4HU8A 3DIDA 3D52A 4PB9L 1UQSA 4PY8J 5E0FA 2O6CA 1J5OL 4PRPB 2RNBA 4ZW7A 2UXCB 4WSKA 5FL7G 3MYZA 1N18A 1HFUA 2YK1H 4MQXC 2DW5A 4FLZA 1NKRA 4NXMB 3D18B 5EZLA 1VKXA 4OX9O 5L9DH 3NCXA 1J0JA 5EF0A 2QWOB 4P2AA 2OYLA 3OKKB 3ABMB 1FH5L 4DGUA 1HKLL 5EU4B 2X7RB 5L3FA 4YDLC 5I6XB 3U79A 1D5AA 5AW9B 3R4DA 2H9GA 5CINH 3SGKA 5FK9A 4PS8A 1JZGA 3EZ8A 2NTFA 3CCHB 3L4XA 2QTVA 4PV1C 1AQHA 4FI6A 1ZHKB 1G6RL 3TASA 5I26A 1PZ2A 2WKOA 4ZMLA 2I9LA 3A67H 4DUWA 5HYFA 3OX8A 1NCOA 1KXQA 2E9IA 2NXZB 4DV7O 3KXFA 5IJVB 1KC8W 2OMVB 4JO3H 2B0SH 1EN5A 4Y2OB 4CJ0A 5DZAA 5B39A 2CLRB 5KS9F 1AKJD 5E23A 2P4KA 4DVRL 3CD6V 4U2YA 5JQGA 3V4UL 1ZK9A 2WO2B 2ZXQA 4IKIA 4BR6A 4J8RA 2VXUL 2WXKA 5EF1A 1RP9A 1HHJA 1MDTA 2XTJC 3GRGA 2ENYA 2V5MA 1HNZB 1D5MA 3LKRB 4HJ0C 2A38A 4QRAA 3NZSA 1EGJH 4HGWB 4DJMA 2B39A 2Z7WA 3EW3B 1AP6A 5BOZG 1H3GA 1G7MB 4P4RA 1T4KA 1H2GA 4LDEB 5I1AA 4ZUVA 3V5DB 3H1HH 4MZIA 1XH2A 2F43G 3C2AL 4NQSB 3SDXE 2BZDA 5DHEA 3W5MA 3QHZL 4XVTL 1IE4A 3ZE1E 3OPUA 3KAAA 4AV5A 1A6WH 1JTOA 2DQTH 5E4EC 5F1SA 1NLDH 3OAUL 3JAWA 4F5CE 2NY6C 3ESVF 4TUJA 3U0TA 4YHOH 1B04A 1WICA 1IAIL 4GRWB 4JFDB 3WEOA 3H7BB 4AYID 4GUPB 5KVFL 3ZRWB 2AK4A 4JANA 2Y0SA 3P73A 1JR9A 1MLBB 2H1LM 4ZAKD 5GGTL 5I73C 3WB1A 3DROB 2WM0A 3SJVE 1MHHB 2HFFB 2LT9A 1OGTA 3B8YA 4LCUA 4DQAA 2RB8A 3R0NA 4Y4HB 4QGPA 3I02B 3SB3A 2BXYA 1A6VL 3KYKL 5E6IC 2ID5A 4M1DH 4GS7B 4KK8C 1H19A 4G9FB 1RSOA 5IQ9A 2KQNA 1A4KB 2HKAA 2DMXA 1KYOF 1JNNL 2IC2A 4P9PA 4NZUL 3WTXA 2FQFA 3TU6A 1UM6H 2DEWX 1RHHB 5FYJD 4LRNL 4WK0B 1VF6A 1CFQA 3HCVB 3LXBA 4YXKH 2FIKA 2VSDA 3GBNH 4X5XB 4F8TA 4MVBD 1U8NB 1XGUA 3ZCCA 3GSXB 2A6JA 5DJ6A 1FS0G 5C93A 2R4SH 2WBXA 2MPAH 1MAJA 5CA3A 4DP8X 2K6YA 3EJYD 2Z31C 1YNKL 3WUWG 3T9WA 1OD7A 1BSIA 3CP1A 2ZIOA 1XSOA 5E70A 4OY9A 4WW2B 1BHGA 4NQDA 1QZNA 1KPRA 1UCBL 3UMTA 2IGLA 3ETBF 1O9WA 2AXFA 1FLRL 5SWQA 1FFQA 3QRGH 4LDOB 4XB7A 4PA7A 2UVFA 4WFHE 4MKMA 5FYKH 4Y2DC 1S7UB 3P3NA 1UEYA 2FQGA 4BFIA 3L9DA 3RFZC 1ETJA 1MZYA 4E9XA 2JXMB 3AK1A 3BN9D 5BRZD 2Z35B 3PU7A 2IOIA 2X2JA 3GXNA 2EZ0C 4CH4A 5EUKB 4HAGA 4HS3B 1HHIB 3JV5A 4QRPD 5CZVH 5DD3H 4GW1A 4OF5A 5KOMC 3VI4E 4QRQA 5I30H 1W8OA 3U4EA 4BM7A 1DTOA 3OMZA 4NQVB 5D7JA 4CBZA 1XF5A 1R5IB 3LIZH 1DQKA 3PIQA 4QTHA 5EOCH 1MFCH 2PYFA 3QJFA 1FO0A 2E7DA 2NLJB 5E6ID 3RBZA 4WKZB 2QGEA 1UXMA 1MW0A 1HESA 5CBEB 2VDNL 1R3HA 3BVNA 1NJ9A 1AJPA 1DJHA 4K4KA 5ISZD 4YIQA 4PG9A 1JGEB 4WI0B 2CO6B 1MSWD 4HCRL 4YSCA 4S1SL 3HHSA 3ARFB 3C5SA 1EAPB 3VD5A 4F7EB 2GSGB 4GRMA 2FATL 4B7LA 3QP3A 2ICEA 2HTKC 2V3DA 3F7PC 4QHMB 1GCYA 2OTLV 3H2WA 4X62B 2UXTA 1H3UA 1AZZC 4N68A 3K6DA 3X1EA 1ZUQA 3X11A 5F1OB 4H1LH 4PJFB 3TN0A 5GTHZ 1WV7T 4Q4EA 1U95B 1WZAA 3MRIA 3QIUA 5GJTL 2AERT 2DQIH 3U4BL 5C3LD 5F97E 2V7HA 1F4YH 1Z9OA 4MYWB 1I8LC 2HR3A 1WJ3A 4NTWA 5KYUB 1VF6C 3VFPA 2R4SL 3DX0A 3HNTL 3CHQA 3WIFB 4F27A 1D5IL 2CK0H 2J21A 5LP6A 2JI1A 3AJ7A 3NIFF 1T7VA 3GMNB 3O6FA 4JYAO 2WZ0A 2J72A 2YMTA 3VI3E 3ME0B 1M7DA 5E9DD 3GJEB 3OJDA 3TIEB 3BVDB 4W68A 1U8PB 3NG5A 3RZCB 4BSWA 3FFCE 3OSKA 3T4AC 2VERA 3M17B 1JL8A 1IEHA 1MRFL 1XMOB 4ZMOA 4I4TB 1BBJB 3KL0A 5E5UB 1BZ9B 2Z92B 2EKSA 1TTGA 3B9KA 3OUSA 3C5ZB 1SA0B 5E95B 5FWRA 2Z7YA 5KSUA 1TJIH 1T22B 3WEXA 2IG2L 4J80A 4WHYG 4Y2DA 5JQ6H 4FRWA 1D2DA 1UWEL 2YC1A 1ECZA 4JFZL 4WF9V 1W0VA 5IEKA 1ZLZA 4DSYA 4CS2A 1U8JA 2Z1KA 1QSEE 3BGMB 3MGTA 2V1DA 1VGEH 3EOTH 4MQXD 3DRQB 4QRRA 5HVHC 1F90H 3CC1A 1FBIL 3NZHL 4MW8A 3VGAC 2OI9B 3FONA 2WLMA 5KA5A 2TSAA 5EZYB 2ZXCA 4Z7UB 2EIEA 1FNEA 1BQHB 1JK9B 3D50A 3JD1A 1QUPA 4DGWC 1PV0A 4X20B 2XQBH 5C0EB 5EOQL 3TBWB 3ZL2A 1KCKA 2PTTB 5FYLD 1UA6H 2JSFA 3EYUL 1T1YA 3TBVA 1NIBA 3MC0A 1G87A 4CKVX 3AXLA 1S3JA 2HJFA 4Y1AD 3ZIAG 3DYPA 3OFNG 4TWKA 1AZBA 5JCOA 2J57A 4RZKA 4E41B 5LWYH 1BFSA 1I4FA 4JFFD 3U7WL 2NMSA 4P5RA 5HGDB 4ZBMA 1PNCA 1WS8A 3MRMA 2VL5A 3L5XL 1O6SA 4H1LG 3VXNB 5IHZA 4QHKI 1IZKA 1CGYA 4UZGA 5D6CA 2BVQA 3KLQA 4U49A 4XPHL 1C8PA 1TNMA 3ML0A 4HIIA 3JVGC 2XVLA 1AGDA 1UZ8B 3QUZC 5I1JL 3B3IB 4CS3A 3ZOAA 3ILEA 4G11A 4YE4H 3JD0A 3VXMD 1JNHA 2WLHA 1EVUA 1BD2D 2JKWA 1F4YL 3C5ZC 3C60C 4O58H 4RLDA 4HFUH 5IJKC 1JJOA 4J2QA 5E9DA 1HN1A 3C12A 3DTDA 1X5ZA 3DX7B 1BQZA 4LMQE 2KI6A 4M48H 1E8YA 3QG7L 4MMYA 5F7WC 3DMMA 3KZIZ 3KH3A 4J1UA 3DX1A 3HZVB 1OO2A 2ADGB 1JV2B 4CH3A 5IDJA 3GUFA 4FJZA 4FLHA 3LKSB 1S7RA 1HWYA 4PA9A 3ZDZF 3JAMN 1PW3A 2UZIH 3ZT7A 5LMUB 1MZFA 1SOXA 2V2XA 2VGLM 4NRYB 3TA4D 1UWGL 2J6EL 1HW7A 2V37A 2W91A 5IYBO 3WKML 4J5VA 2VLKA 3VE0B 2O4EA 3BGFB 1U58A 2KYIA 3A4FA 3ILDA 3NCCB 4I0PD 3PNWB 1OANA 2EEBA 1ZSHA 4X7FC 1YECL 4NRYA 5EN2B 2WQRA 4WO0A 1YPZE 1PLAA 2G4GA 3W39A 3WIAA 4N6RB 3MNZA 4TXVB 3T4DA 2UWEB 5ISZE 2BP3A 3VNYA 3D5OF 4MDJA 5CWSA 4K8XA 3DK0A 3TV8A 3BN3B 4N86A 4CVXA 2JJTA 3DMMB 1R5WA 4FHKA 1JGVL 4UI2A 3MJ9L 3LEXB 1HXKA 2EDEA 3IWVA 4IRZA 2WVVB 4O4HB 1HXMA 1WT5C 1NTDA 1V7NL 2AC0A 5I5MA 1CF8L 3FUKA 2XPZA 4MAYA 5EH1A 3ARSA 4DV0B 4FM0A 2CXGA 1IGMH 3F58L 2GUZA 1M1SA 1R3LA 4HDIA 4KUCD 5EULV 4BCXA 1NPNA 2IOOA 3CVHH 2ZXAA 4XPFL 2XTLA 4AWJC 3FBQA 3E38A 1MQ8A 1AGDB 1INQA 1E6JH 4U7NA 3PP4H 2ZUYA 1SYVA 1FZOB 5IHZB 4W9HC 4KFMA 4Y5YC 3ARRA 3K2KA 3DDGA 4BFKA 1XAKA 2QZ5A 3MNMA 4JN2B 4UTBH 4GW5A 25C8H 3PQYD 2DWDB 3FB7B 4O5LL 3P4MB 4E41A 3LSQA 3AXLB 2C1OB 2I32A 3GB7B 1SPDA 3CEIA 1MFUA 2FO4B 4TV8A 5B1AC 3KYOB 4HIPA 5E9DE 1SHXA 3TBWA 1G43A 1TUBA 1JPFA 4CSPA 2IDQA 1BQHA 3LHPL 1Z5LA 5B7FA 1B90A 4RH4A 4JM2C 4N21A 2VERN 4KGJA 5T8IA 2BVYA 4R4FL 3ECBA 5A6MA 5EBWC 1E2ZA 2ZWSA 4APQD 1J5CA 3LPPA 4OLUH 2XOKG 1GO3F 3DHUA 4K9EH 3KYMB 4OX9B 4PEEA 2R7EB 4UTAA 4X5RA 2XZCH 3NP4A 5H5NA 4LF4B 1W0VB 3BYYA 1ES0B 2YC1B 1KD1W 2AEQH 3VXSE 2NW2A 5AW0B 3EG9B 5F1IA 3HPLA 4DYLA 2VZ3A 3FULA 2GB2A 2EKSB 2CHZA 2CSPA 2R59A 3KYKH 1E30A 3QGVA 1CCZA 2H6PB 4RWYH 4XP4L 4YHZL 5J11B 1HI6A 1RQ5A 4RQFA 3ESPA 4YIPA 2FZ3A 4BSWB 3RZCA 3TIEA 4OZHF 3GJEA 2CJUL 4PA3A 2FWOB 2QVKA 4I48A 1VEMA 3IFOB 2ZUQC 1VFBA 2YPVA 4NUGL 3N5AA 2BOCA 1DSYA 1QLRB 4MXQD 4JFFE 1LUWA 4LL9A 2BO0A 5IYCO 3GRWH 3UJJH 1XWVA 3AAZB 1MZZA 5IFAH 1PD3A 4WFGA 1HXYA 2VW6A 4PRIE 1IRAY 1E0OB 3AFLA 4Y4FC 4DGYL 3S37H 2J1XA 1AE6L 1MPAH 1MEXH 3FSAA 5JNYA 2Y4SA 3KPRA 4JG0L 3TN0B 4Z3IA 3RUGE 4U1JB 4RGMB 3CC4V 5C09B 5DVPA 4DK1A 5JOPE 3N55A 1BZDA 4F37K 4G2KA 1ASOA 3UFIA 3GF8A 2AGJL 2VQFB 3ATEA 1PCSA 3N44B 2WYTA 4TSCL 2GC4C 3BP7B 4NJAH 3LZFL 2OS7A 3G6JB 5CCJA 1MHEA 2VJ8A 3KPTA 3L16A 2B9AA 3LNNA 1DVFD 1S8DA 2YQBA 3GMOA 1QP1A 3V4UH 4HBCH 2A6DA 1KGCE 2JH2A 1N70A 3JYCA 1QYGL 1QR4A 5F72S 4Z7IA 5FYKL 3QBTB 1ZXKA 2PYFB 3IM1A 3QJFB 3R8BB 1HNWO 1DBJH 4J23A 4XVJL 1ZHNB 2OR7A 3VM7A 2V8MA 1SF3A 3QZPA 4WV1A 3K0YA 1CZ8L 5E5MA 1UUSA 3X17A 5GQBA 2WINB 4QRQB 1SQFA 4N8PA 5C7XL 5T1KD 5CD5C 3MRFA 4WTZG 4EEEA 1S72V 1Q6HA 1Z6JT 3FZUC 5DQDL 4CSZA 5DJDA 5DO2D 4UDTA 1V9PA 4LKCB 3MYJA 2X2IA 3HKCA 2EJ1A 2LW1A 1YY8A 2M2DA 4B9FA 3U46B 3LD8C 4N2CA 1XV8A 1HDMA 3VWJD 2JK5A 3LEYH 3QWRA 4BFIB 4FNRA 4BFGA 2VDMB 4HFWA 2VZUA 5L8JB 2F1BA 1NIAA 3GXTA 2EDRA 4XTRD 4G9FD 5ECGA 4X1IB 4UIKL 2KZWA 5BRZE 1JTTA 3LRMA 5ITFB 2ODIA 1D9KC 5I1LB 4XC1L 1OGAD 1L7TH 1TUPA 4U3SA 4WW2A 1G4YB 2OMWA 3CVCA 5FO8B 3JV6A 3IN2A 4UTAH 4YDZA 5EBLC 5B1BB 2NY3D 2YJQA 1TGOA 1YEWA 1A9EA 2ERJB 2FX7L 1ZT1A 2VDQB 3GZKA 3V5HA 3EOYG 4FK5C 3ESOA 4ZOCA 2CCWA 1IBKO 4KC3B 1JNNH 3GK8L 4P3CL 2VUKA 5IROD 4KK6C 1XNQB 3CG8A 2F23A 4UT7L 3HCVA 2BNQE 1G7PA 5KHGA 4ERSH 2OMZB 3WL9A 1HZKA 4HIHB 1WFNA 2NZ9D 3TTYA 1RHHA 1A21A 2OXGA 2XRAH 2VKXA 4PMEA 3FU7B 4NQQA 3UTSD 1A3QA 1NEZG 1GGBH 3BZ5A 1IC5L 2W60B 2HKOA 3LEVL 5E8EB 1S2EA 3WO4C 5C07A 3SGEI 5ICZB 1SDDA 1XGTA 3C6SA 3AITA 2QM8A 1I1CA 4FQQB 1K8IA 1OAZH 4JGNA 3O0RH 2GFBB 4Y4HA 4FABL 4HJJL 1TJIL 3FXIC 5TF0A 5GS1B 5HHPB 4H8HA 1ZIAA 1CFSB 4K9EL 5MEND 3QIWA 3DROA 3QRGL 3U25A 2CO4A 1FXKC 1NMAH 2C1PA 4XPTH 5DYOB 5JR1H 2GBTA 4PDVA 1CYWA 1RZKH 4NKMB 4X99A 3EDJA 4KNQA 2DQ0A 2UXDO 4BIOA 3H85A 4Q14A 2IPTH 2OTUA 3A3YB 2ALWA 3RVYA 1UD8A 1F4AA 1RL1A 4ODXB 3D3VE 1PG7H 4KO9A 1D9KB 1YJDL 3QEGH 4P9HL 3T4AA 4LEOA 1JOIA 2AVGA 3EJZD 3MV8D 4P5TD 3VGHA 2OR9H 1IE5A 1H3PL 1UVQA 2Z4QB 2CE4A 3IFLH 4ZKIA 1BF2A 1G9NC 2X6VA 2QE7G 5D6DA 2YA1A 5LGJA 1B2YA 2Y23A 2X89D 4Q6IC 1IX9A 1L9TA 2BSDA 2HFTA 4HEPA 1XAUA 3S3PA 1AXSB 2V17H 2JS3A 1K5SA 1DLHA 4PW4A 4KOCA 2O5YH 3GKWH 1K4DA 4WHYH 4ZO8A 4E5XA 4YO0B 3ABKC 4ODVH 1E5YA 3WELA 4JLRB 4ZPVA 3CFUA 3PP4L 1P49A 4AE0A 5E6IA 3K71A 2X9XA 4M8QB 3GZQA 4ZOLA 4TSCH 3TWYA 2FRGP 2RH0A 2IJHA 5FCSH 2HG5B 3E83A 2XG4B 3VNZA 2EZOA 2GTWA 3D9AH 3I2CH 1WFJA 1P1VA 2WOYA 1KPVA 2EE2A 2G5BA 1TQUA 2X41A 3ZGHA 3BHPA 2V9TA 5HSFA 4KK5C 4GKZB 1JGLL 1I8KA 3X3GL 4PA6A 2WGXA 3D51A 5I1GH 1W6LA 1IC4H 3N50A 1BFTA 3WKMH 2NT1A 2LTQB 3IXTA 4N8CH 5EF2A 5D7IF 1VKXB 1KZQA 1HJBC 4L2YA 2LAGB 3ZYJA 3L7FA 3O6MH 2ORBH 3JBG7 3L75H 3W37A 1A1NB 2C3GA 4PJAB 3S4SB 5LG6A 1BEYL 3FQRB 5KJ4A 4H13C 4OKVB 5CP3H 3QH3A 3LKQB 4EQ3A 1NTZH 2BRRH 4Y5XA 3BEVA 3DX8A 4UMSA 1JFFA 5DHVB 3WD5L 2FX9H 1Y1DA 5E6SB 3MOQA 2ADYA 4MD5B 4KJPC 2ZZUT 3U9PL 3KCWA 1NH2D 1F6AB 3QUKB 3T6XA 4R4FH 2GJZA 5EEXA 3PGFL 4QRTA 3KS0J 3MLZH 3QG7H 2I07B 4K9JA 4Z77A 2E75C 1E3ZA 1OGAE 5FOBA 4YBHA 4PWHA 4QO1A 5FHBL 2JKNA 3WFCH 5C0AB 3KWXA 4NQXB 1A6AB 2ZOOA 2QVTA 1M1XA 2LE9A 3IJ9A 5GZOA 5FR3A 1XGQA 5D1XC 5JCOC 1RULH 4UIMA 3TF4A 2D0HA 3RJOA 5K9KB 4R8WL 1IKOP 3STLA 1N5AA 2OMNA 3IXAB 4HWZB 5C08B 1YJWV 2Y1ZA 3D6GA 4YDIL 2W38A 3D85A 3GHPA 2H94A 1QFPA 5EBGA 1F97A 3SKMA 4BFFA 5L9DL 4AUJA 5DZJA 1C16A 2AJ3B 4Q9QH 3EHBD 4KKZA 1VQ4V 1YYMH 2EO1A 5CA0A 1JGVH 2XASA 5A43C 5D9SB 5KS9A 3NT0A 1DF5A 4FJ6A 1XIWC 4U1GC 1H8EG 4DR4O 1KCWA 3BSZL 1BOYA 1XR8B 2PPEA 5LDSA 1VADA 3IMUA 4HK3J 2R0LH 5CAYB 1IQWL 5D1QC 4HK0A 4QHPA 5FA3B 4Q9RH 4HK3N 4L3EA 4XCYA 4M6AA 5AOMA 4OZIF 3ZR5A 3AREA 5KYWB 3CE1A 4AC4A 4B3MO 4WNSA 4RFEA 4LU5L 3VH8G 3WFBL 4Z5RB 4O4JA 3NUKA 5E7FA 1TYJA 2CG9X 5JW5A 1EZJA 4NP4L 2XKNA 3FQ4A 1IVSA 3K72B 3QHFL 3N1QC 5AAWC 2WXHA 1YRKA 3CHXA 2JMRA 4H8WL 3GIZH 4NN5B 1U91B 3OC8A 1IL1B 5K9QG 3SY0B 4OLUL 2GI0A 3K6OA 5IREA 2ROYA 5DRNB 3JALB 1GOGA 3BQUA 1J0ZA 1GJWA 1ZLWK 5T5NF 4FQPA 3CCUV 1EIBA 4HZLB 1QFUL 2H26A 4KDTC 2YICA 4LLYA 2P7TC 1EXUA 2E74B 3QAQA 4KRMB 4Z3JA 5IWLC 2GJ6E 1BYNA 4FPPA 2VMFA 3DMMD 5IY5B 4GBXA 5C92A 1TQSA 3ABLB 3MAWA 1KTKE 2SEBB 4AEFA 1W0YT 2H1XA 3X1GA 5DM6V 2QFPA 1H5BC 3QO1A 3QNYA 4FQ2L 1U41A 4XGZB 2HT2D 4YHPB 4EOWL 1DQQA 1SN0A 4WTWA 1ILUA 3GLZA 3QQXA 2NYZA 4LCIH 2CBPA 3WS3B 3QPQD 4UCSA 1ACCA 3K2UL 3QUYD 4I13B 2IH3B 4A67A 4Y16C 1CI3M 3BX7C 3H9SD 4B9JA 2KDYA 2H45A 1GS7A 4BH8A 1AY1H 2PI4A 4KHXL 4ZPTA 5C0BA 1O5PA 5SX5H 4MJID 3APOA 3QS2A 5E00A 4A2FA 1KTJA 3ARZA 2IDFA 3MD0A 1MVUB 4MLIA 4R4BB 2YD4A 3ML8A 1WIOA 4WWKA 1CFBA 4BSJA 5JIQA 4NCC1 3WMPA 5GISH 3MODL 3MV9D 5DRXA 4CZZA 1IC4L 3LRLA 3IKKA 4NJAL 1C5DA 4YL9A 4BQCA 2XBTA 4MNGE 4R7NA 2A9ML 3BSZH 2X0UA 4B3RO 1NUNB 3QCVH 5T3XH 2X4QB 3W9EA 3L3OC 1COWG 4M03A 3ZMSA 1T0NA 4B9IA 1BEYH 4PN6A 5CO1A 1YAZA 4JI1O 4XRCA 2GJ6A 2E74C 2BSBA 1X7QB 2VDOB 3HG1E 1IM3D 3UKMA 2HYMA 3D85D 3L2MA 3NK3A 1KC5H 1BMFG 3MV7D 2XZQL 1YNTA 2QQLL 3OHXB 3PL6A 3D2UD 3VGAB 5B3JF 4FAAB 3JD4A 4I0PB 2YXMA 1QHOA 4L4JA 4LP5A 3KLHD 2OCHA 3P40A 4NKIH 5IT2L 4ZFFB 3GHEL 3VGEA 5HY9B 4PR5A 4FZ1A 2P43B 2ZKHH 2IM9A 1H5BB 4JM4H 3MACH 5HYSB 5GRVK 2WTRA 3GSNH 1JHTB 1OP3H 5E99L 2ZF9A 1XZWA 2HVKB 2ESVE 4IYKA 5DQDH 3L3DB 5IB5B 1NFIB 2HT2C 1TJHH 5FHBH 3C2AH 4JPSA 4EAEA 2VJ0A 3P11L 2IXQB 5D7JC 4E4EA 4JI0O 3MMEA 3L3GB 2PWEA 4IOIB 1S0VA 4X6CF 5T3ZD 2ZOWA 5GGVY 1Y76A 3CHOA 4YHYC 1AQDB 4PD4K 4NM8H 2B14A 5ICXB 5H2FZ 3CMEV 4AX3A 2ZOKB 2FBJH 5LAXB 4UNVA 1YJDH 3IJYA 1FH5H 1XF4A 2O5YL 3LXAA 3BE1H 4M9OA 2D7QA 2HUEA 5DDHA 1HZHL 4TVPE 4B53A 3SJQC 5IJ9A 1O7DC 3GZPA 3N44F 3EXJA 3HEIB 2OX5B 1Q94A 3K2UH 2HT4D 3O6FD 4W9GC 4DUZB 3ABTA 3UGUA 2HXAA 1WZLA 2EXWD 1UD2A 3IYLW 4G1MB 5HHOA 5IP4A 3L1FA 2XJLA 4FLOA 2OYMA 2OTWB 3DOIA 1JHKL 4ZYKB 5ESVA 3GBMH 3PHOB 2H32H 4J7ZA 4F7PA 5I66A 1PSKL 1XD1A 3JV4A 3NVQA 5L8LB 5AW4B 1NUDA 1AAJA 3DUSA 4CU8A 2ATPB 4POZD 3V0WH 2A0LC 3IAPA 4LESA 4KZ0A 1KBHA 4WWKC 4Y5YB 1TVKB 2D3OW 4MXVE 1I53A 3MLTA 4NTYA 3D0LA 5JDSB 5I1EL 1CL7I 4BIKA 3FPYA 1HSAA 3KCPA 2WIIA 4FZ0A 3NJNA 4ZTPH 5A2AA 1KBKA 3P54A 5C8YB 5CEZD 1UZ6E 1GC1H 5T33H 5IR1B 4O2BA 1J9SA 1GK9A 3B9AA 3ARWA 1OP3K 5B22A 4GS7C 1YQ2A 3NH7L 4KJWD 3NYKA 4AOFA 5LA6A 1RMFL 3DURB 4XBFA 1HH9A 2BNQD 3DBXA 3UJTH 4AJVA 5JPNC 2ARJB 1X6LA 3X3GH 3C8KB 2HCZX 4MD0A 2WW8A 1QR1A 4I50A 4LGSB 3IMWA 1G1OA 1H8LA 5DMIL 2WCGA 2AK1L 2YXYA 1SN5A 2V4LA 2YXLA 3WKNA 3EH5B 2IBZX 5DJ8A 3KPNA 3ILQD 2Y2YA 1UJ3A 2AJXH 2NUPA 1TEGA 2YD6A 3MNWA 1F3RB 4PPTA 3K06A 4R9HA 3RN4A 2K6ZA 2NX5B 2YA0A 1Z2KA 1YQVL 1ZS2A 1FN4A 1WB7A 1WAAA 5H8DA 4J9YB 3GTTA 1NFDA 4QGTA 6TAAA 2HPOA 3NQIA 3WS6C 1N59A 2Y5QA 4X9GA 1A25A 3LNEA 2R23B 5E4OA 5KVEE 1CFTA 4S10A 3BQUC 1UKSA 4PVBA 2VITA 3GB7C 2YSSB 3FT9A 3BUYB 1EFRG 4HALA 1Y67A 1B3QA 2IAND 1HL9A 3FCTB 1NC2A 4FHBD 4DVBB 4HKXB 1OGPA 4WKXA 5DD0L 1WAAF 2JKSA 1AYOA 4UILL 4QMEA 4UANA 2PYJA 1LM8V 2C26A 3EYUH 3GTNA 2Z34A 3L48A 3WBDA 1F86A 3NCBB 3BMWA 2Q3XA 1YMMB 1FZJA 2OJZH 4A2EA 4CGTA 3BWZA 4KXDA 3DC5A 1J5DA 1FVDB 5CFHA 1OTTC 4TLTA 5CGBA 3V52L 1T5XA 4JHBA 2PP9A 4MQ7A 1MCPH 3QF7A 3OLDA 3P9LB 3EYVB 4NLAA 2HLDG 3L7EA 5J2TB 3FSVA 3HG1D 5H2BB 2QPFA 4R0LB 1AO7B 1J5EB 2YPKA 2ZJSH 5F7UA 4N2AA 2AFNA 5EUOA 3Q4HA 4DV5O 5I1DA 3G5WA 3WTUA 4HKZB 1OKEA 3E6FB 1BM7A 3KPSB 1LEGB 4R7XA 2CRIA 5ITBL 3CRAA 4MJ4A 1WD8A 1YEFL 3BYTA 1PTZA 1XF3A 3MRRA 2QZQA 3A6CL 1K85A 3P0YL 5CLWA 1R24A 2DH2A 4F2MB 1CICD 3L3KB 1GC1L 1KLFA 2L04A 3AWEA 1RJYA 5KSBB 2X9WA 5BMVB 3B6SB 1MJJB 3QAZB 3AT0A 5CZVL 3FQXA 5F93C 3QORD 4GRWE 4MVSA 4MJ2A 4IHJB 3O2WL 4PJHA 1FI8C 3JV0A 4R90H 3WFZA 1HHGA 2FBRA 1KB5H 1EJOL 1MVFA 3T6WA 1MCBA 4CVZB 1F41A 1OL0A 1XEUA 2YO3A 3BSHA 4G1EA 4RESB 4C83B 1C9SA 1ROCA 4HUNB 4EI6B 4NBZB 4EOWH 1UHVA 1JPSH 2OR9L 3RWFB 2XPYA 2BSTB 1SMDA 2RQ8A 4LCWA 4RBPK 1GN4A 5HYQB 1WA2X 2WQSA 4GNKB 3CMOH 1R6KA 1NT2B 2JGDA 3LQZB 4KKPA 1UWXK 4KX7A 3TIDA 1JZDC 2BNQA 4O2CB 4G8EB 3ZDZB 1OEZW 1WDAA 2FATH 1AY1L 4MQSB 3GUTA 4CNIA 2DWTA 3HJEA 3VJ6B 4KUZH 5IMLA 4TSBH 4C55A 1YMHB 3V6ZA 4IGBA 3BY6A 4NZRH 1AKJA 4G7RB 3J80N 4EZJA 4BKLB 2E47A 3FRPB 3B7RL 4G8GB 3G6EV 3PUCA 3S3WA 2MRYA 2NNFA 4AGPA 3W1ZA 3EH2A 3S8WA 2NNRA 1UYWH 2XKUA 5SV4A 4E42A 1AS8A 1G7QA 2A9HA 5LBQA 3AADB 4EMZA 4N0UA 4UT6H 2W92A 1M9NA 1T83A 4IRJB 2NX5D 1XF1A 4HWUA 1DQIA 1UXWA 1OSPL 5KSVB 1FPTL 1OAXH 3QJHB 2ZAGA 4PGZA 1IUZA 2PCPA 5DUPH 1W6WA 1TJXA 4XHQA 4ADGA 3CCJV 4FYTA 2CK3G 4IU3B 3WFHB 2LGNA 4DP9X 2GBOA 3NCWA 2GC7C 4FG6C 3IFXA 4ALAL 1SYSB 2O6EA 2Z0AA 3CFKA 4YK4C 5LNEA 4RNRA 3DA0A 3QCVL 4NZ8A 3VI4B 2DQFB 4NXMO 5ALCH 4ZMNA 4GXFA 1NSNH 3H7LA 4IEFA 4GJTB 4JO2L 5KN5A 3VXPB 2CKBH 5JW4M 5KANI 3QHZH 4WHTB 4XVTH 5I5IA 1J8SA 2OTPA 2VLRE 2NSXA 4G8FB 1KJ2B 2WXRA 5EORL 2AQ2A 4PIBA 5J13B 4H8QA 4FNQA 5F89A 3O0LA 1N0LA 1EANA 3F05A 5BXFB 3NCFB 4LF8O 1D5BB 3FTXA 5C0AD 1MHCA 4EPSA 3NZHH 2J1WA 3FO2A 5AUMB 3NFNA 4NCDA 4NIYE 4YLCA 2VMDA 1AD9B 3BUDA 3DO3A 4K35A 3F3HA 4XMWA 5JW3L 4NTXA 1A0QH 1MCQA 3LS5L 2YD8A 3EBAA 5FHAL 1AYRA 1FG2A 3LKPA 1HL5A 3NCYP 2EVFA 3IVKB 4LEBA 5JW4N 1X9RA 2BHYA 1QASA 3QB7C 2FX8L 2Z7ZA 5F2FA 1Q9WA 1P84J 1KT2B 1DN0B 1K5QA 4P2RA 5EUOE 5LCVH 1XZ0B 4IJ3B 4CN1A 2KDGA 5JORA 1R46A 2BS9A 3RVWC 3T3PE 4AT6B 2O61B 4J10A 2G5RA 1GM7A 3KJ6H 4J4PA 3B4NA 5C0GB 3BFWA 2EYTA 1SVBA 2HN7B 2R1XA 2YAHA 4Y5VA 1CTMA 4JRXB 5I17B 4ICXA 5F3HA 5BUAA 1NGYA 5D71H 1E4KA 5K1PA 3K7UA 3PWPD 4J3OC 3L1EA 5T1LD 2BY1A 3S3CB 3U83A 1IZ3A 1U8MB 3PWPB 4ABVA 3HZ3A 2UZYA 1UKQA 1PZ5A 4AIZB 2LAAA 3QDGA 4PJXA 1JGDA 2DIAA 3U7WH 2AZUA 5L0QC 1T6WA 4NPYA 5CIPH 4K3EL 3U2SA 1XMOO 2A74A 1EZVH 2VLMD 4QCIA 3CDGA 3ASNB 5T33L 1FYJA 3TNNA 1F18A 4HPYL 4LARL 4DZBA 3V4VA 2AITA 4M8VA 3W38A 4PHZA 1CXFA 1VFMA 5HYIA 4XAKE 3JSSA 4QHKJ 5BR8B 3HR6A 4AJWA 1FLTX 2Q8BL 2QELA 3CZKA 2P24A 3ETGA 5LOVB 4OZHA 3P30L 3HZYB 3MFFB 3PCYA 2OMUB 2HJFC 3MV9E 3OTOO 2YEZA 1I9JL 1L0YA 3IDIB 4FA8A 4CSTA 1JYVA 4P4KD 4CU7A 4L5FE 5E99H 1UOVA 5FFOA 3P3SA 2PW1A 3LNHA 1FFRA 3LSOA 4N20A 1YSOA 2BNRA 5IWLA 4W4OC 2XWTA 3K5MA 3LKNA 3V4PL 1JNJA 4GYCB 1ZWIC 5E2VH 2PABA 5H35B 2MCMA 3ZE2F 5IVXF 2PWGA 4FN0A 4G6AC 4WAFA 1CLOL 1MCWM 3FU3A 3S2CA 4GZRB 1KIPA 3IN0A 4O4LA 3H1IH 5HFLA 2OULB 2IMMA 3GBML 4KX9A 4X9YA 1T7WA 3OLEA 3O9WD 2BFGA 4I77L 3TYGH 1KB9J 1U2HA 5BMFL 4B3RB 5FLXN 2D8KA 3RGHA 1FAIH 2IJKA 2I5YL 1Q3EA 3HNVL 4YX2L 3MLXL 3JASA 1KNOB 2CUHA 3JAKB 1F1GA 3DVFA 4MCZA 1XB8A 1H2KA 3MJ9H 4NO2B 5HGHB 2QSVA 4AGOA 3V4PB 5KTEL 4OCSH 2LO1A 1G4RA 2V9UA 3DOHA 2PW2A 4QOKA 5H94B 5T1LA 5D1XD 2H2SC 2YK1L 2OCCB 2C4FT 3KLAB 4A37A 4IIJA 1EM1A 2DWDC 3C6LC 4MA3A 3TCTA 1I8IB 4YC2C 3VU2A 1TVDA 1MQKH 1CGVA 3FQNA 1S5HA 4X5WB 3ZE1F 4XVUD 3V4LA 2CALA 4J3OF 5EOTB 3CFEA 4DK5A 1FNHA 1FVEA 4MNQD 4N8UA 3VYPA 2VIRA 3CVHA 4L8DB 3D69B 3E80A 4RBPH 1R1BA 4TPRH 3AMKA 5B8CA 4IIQA 4WI4A 1A2YB 3JARA 1AGEA 5FPIA 4TF4A 32C2A 1AGBB 1DEEA 1YZBA 4JM2B 3GSVA 4OKDA 4XBEL 5GS3A 5C0IB 4RQEA 3A0BZ 2A73A 5T3XL 5E1QA 4BWAA 4ANUA 1WWAX 3IC9A 5EEWA 3QYCA 3RVTC 3NJKA 1DVXA 3UJTL 1J87A 2R39A 4KTEL 4FDWA 3IRCA 1BG9A 3TXAA 3H0TB 4OI7A 4LFAB 2NCEA 3DXAD 3VFUB 1YNLH 4R7CA 4JI2O 5IJ0A 2RACA 4KNUA 4OGAD 1KWKA 1QBAA 3R18A 4AW4A 1HHKB 2XQYK 4FNLL 2UWEE 2APTA 4O9HL 4BD4A 4L8SA 2B4CH 4LVEA 2VRAA 4F7CA 1LGVA 2OL3B 4X50A 1Q9LB 3QDME 3WSQH 3PP3H 1JVLA 5EA0H 5AZEL 2VLLA 4LVHC 1VLXA 3QUXC 4W9DC 3ATAA 1PNDA 4XO5A 1LWHA 2YIBA 2JTYA 3GSUB 3V55A 3SO5A 4Z7OE 3UG3A 4L8BA 4CMHC 3WFEH 3BA8A 3O3EB 5FM8A 4LASL 4YAQB 1I7UA 2WP3T 1MI5B 1I85A 2E59A 4RCAA 4XH2B 4B50A 2N1KA 2XWBA 4PJGF 1R75A 4FL4C 1E6OH 4W9EC 3K81A 4FQCL 5JQHC 2KZ1B 3TH4T 3T8XB 3ZKND 1RUPH 5FKAB 5JIKA 4ZS7H 5SWSA 3T6QC 1WFIA 2WWWA 2ZJSL 2IU0A 2ZE5A 1MCKA 1MJ8L 3EUDA 4G43A 4PRBB 3IMVA 4EUPA 1KJVB 2A79B 4MWFA 2B15A 2CMRH 3VACA 5LUMA 3QHTC 4IOFD 1B0IA 2HWZH 1JRHH 3QR2A 4ORGA 4DUYO 2R51A 3PHAA 1BAFL 5FA4A 4U3JA 1KIQA 3NJLA 4NZFA 4PRPE 4DO6A 3ARDC 2QKIA 1KENH 4F2EA 1CTNA 4J6RL 4U1LA 1H9DA 4PHXA 1NBZB 5FUCE 3B7SA 5K9QI 3ZSSA 4ADIA 1QTSA 5DHVH 3EJRA 4TNEA 3F65A 4GG6F 3IF1A 4OLYH 3MROA 4DIXA 4WBNA 4TSAH 2Y7QB 3PNRB 1D5NA 4M3JA 1IC5H 2OJEB 5FEBA 3VVWA 5I1GL 3AG3B 3ETEA 2LU5A 2RD0A 4F3FB 2J55A 5I0XA 5IIEB 4K23L 5D2NE 2ARWA 3ARBB 4Y2DD 1RJCA 3VOUA 4PBWD 1WAPA 1KLUA 5CHNB 3NGBB 4YXHL 3KLKA 4OW6A 1ZANL 3BEHA 3VGFA 5L2KD 3CDZB 1JIBA 3MRHA 4LNRA 4X6CE 1D5XA 5ESQB 2NR6D 2FX9L 2RHEA 1KN2L 1ZXQA 2VRQA 2Q7EA 2XDHA 3WIHH 4X83A 2E7CA 3MO1A 4FQJL 3T1WA 4X98B 1M53A 2VLJD 4YHLL 3RWEA 1PPIA 3WHXA 1E79G 1IKNA 1MIMH 4FNLH 4PJDA 4DGIH 4AK2A 7CGTA 1KZYA 2QSCH 4EE2A 2RJZA 4HPHA 4X6DB 4M6NH 4ENEC 4N22A 2AXWA 2IPUG 4GG8A 2C3WA 5C0CA 4WSJA 1ORQA 1AILA 4LKXA 2Q69A 5EIIB 4E0RB 1F3DJ 2XQYA 4NKOA 3NDYE 3RT3C 3FFCD 1RU9H 4YHYB 3HKEA 3TT3H 4AZ8A 4P5KB 2WA3A 1AO7E 1D5ZA 2VJXA 2VDOL 3CH8A 3SDXB 1QLEL 5DECA 2B5UA 4D0CA 3KJ6L 1EFXB 1EEUA 1LEKB 5IJDC 5HPOA 3L74H 5MEPA 4XO9A 2ITEA 2VZSA 4YJ3B 1JERA 1RUML 2FYVA 2QHLA 3P3RA 3UBXB 1CFNA 3HW7A 1JPTH 4UVCA 3KDPB 1NH6A 3RWDA 1HNYA 1BQHG 3DETC 1THCA 4LFCB 2FX8H 4UOW0 4F2ME 3V95A 5A3ID 1OF0A 5GSRA 4AZUA 1T4WA 4Z9KB 5F88A 4RWHA 3H9SE 2X4OA 4NAQA 3RGVD 2YPLB 5EIQA 1E9QB 2CMRL 4DN4H 3O45A 2UXVA 3QCTH 3GBEA 3BAEL 5HI5C 4GMSL 3O8XB 5TE4L 4H0GA 1IEBA 1ZEAL 3OC5A 3HBZA 2XN9D 4PGDB 3K0DA 1U42A 1LMKA 4YHNA 1RK0B 1U8CB 4XNAA 1KENL 3LAFA 3MX0A 4BZ1L 1BLNA 1L3NA 2EACA 2ADQB 4F6RB 3WIIL 4N3TA 1FGNL 1VFOA 2YAOA 4G9FE 3PWVA 4POZC 1FV1A 4PLJC 1TVHB 5EORH 5IW1A 5MEOA 3V0DA 1JGLH 3OR7A 2ZIDA 5TGBA 4ABMA 1IAMA 2GY5A 4XXWA 3ZKMC 3FN0L 3WHE0 4YS4A 4PV9B 3TO4D 3ATBA 1WF5A 3SE8H 3PRZA 4BA8A 1AG0A 3D9AL 2XNDG 3I2CL 3QC5X 3MJ8B 5FB8B 5FHAH 2BWDA 4ZD3H 5ID0B 1C5CH 4U3HA 1GGTA 2HT3D 1CS6A 4LSDA 2YBRB 1KACB 4X6CA 5JHDD 4NQCA 1HWWA 4ODHL 4N9GB 2DWYA 4AQ8A 2F54A 1JPEA 5HGAB 1KSRA 4DK0A 1AKPA 3WIHL 3MXWH 1RZKC 3RYHA 2BOBB 1JXDA 3BPCB 4I0XB 4LSRL 4YFLI 2CHNA 1U4FA 2AJZA 5FECA 3FQUB 1JV5B 3INUH 3KVPA 2CJUH 1G6VK 3J27A 5EU5B 5C0JB 3MRQA 5IB2B 3NQKA 1G9HA 2D73A 3KVQA 3QJSB 3IMRA 1CF1A 1N5YL 4FXKC 3PLYA 1XH0A 4EN3A 1W0WB 3QNZB 4MMZB 4UMGA 3PDDA 2GEQA 3O6LH 2CA3A 4AGQA 3MBEC 5L2JA 2EUVA 3FW6A 3BQUD 4RETB 2H7WA 3O8XC 5GS0L 4GMTH 1AI7A 1FHNA 3U7YL 3MV7A 4MSWA 1URFA 5DVMA 1AR1B 5LGYA 2HG5C 1F1AA 1XL6A 1LK2B 4PYGA 1TU2A 2ROXA 2X28A 3UMNA 1I1AA 2ZKMX 5AYUH 5CEYA 3ZHUA 4D7SA 1R33A 5AVVB 1S7SA 4PJ0Z 1A6TA 2Y2TA 3RVXC 1W2BU 2VXSH 3T2QA 3S3XA 4UQ2B 1P7KA 2E75B 1JUFB 3GSWB 3ZIYA 3LX9A 1K6QL 4UTAL 3WFCL 1RZ8B 4NUQA 1UYWL 4AGMA 1TYRA 3VMNA 1T1WB 4TPRL 4TSAL 4WGVB 1VPOL 2BP8B 4L4TA 1ZD6A 1KMGA 1ANUA 4X4YA 1ZCRA 3DV4A 4OZFA 1YJNV 5J89A 1ZTXL 3UZVB 4PGEA 3DK2A 5GGRB 4J41A 3VXMB 5D1XB 1JZFA 4P57A 4O2FA 4DVRH 2H0FA 1NZRA 2I7SA 4C58B 1FNSH 1RP3B 1F11A 1RY7B 2Y0IA 3TEUA 5KJRH 4XPHH 2C3VA 1SLXA 4L1HA 4KHPB 3FUFA 2DIBA 1CP9A 4I4WB 1KOAA 4Q52A 3E8GA 3MNVA 1VF7A 4U6HA 5FDWB 4DF9A 3G6AB 4DZ8B 4JKWA 2LU7A 1I8MA 3TWCL 4QRUB 5DYFA 1T5WB 5F9OL 1TYEB 4Z7WA 3TV3L 4Q20A 1RZIB 1E3FA 3S48A 4UQDA 4DOHE 1QG3A 3V6FB 1MG1A 2QTEA 5DJCB 4M3KB 1QNZH 3LZPA 1S5IL 4IGBC 2DBLL 2CIIB 3D1MC 2QSCL 4Q9RL 1E1QG 1NCNA 3V4PH 3SN6N 5AD0A 3TPUA 3ZUCA 2IWFA 2R2BB 3JWDC 3MRLB 1VENA 3QT2A 1N9PA 4R50A 1HQ4A 1OSEA 3UT5A 1QA9A 1U21A 2AKRB 2XG5B 3CPWU 5GIRA 1RU9L 1T03H 3ZE0B 1B4TA 3B09A 2YDEA 1UH4A 5B38G 1N0JA 2H3NA 2D2OA 2Z8WC 2VQFO 5AQ0A 4EN3D 1DJYA 3CCSV 1QMUA 5GRXG 2KKQA 3UPRA 4R0LC 2C8NA 1A6ZB 2P8PB 2WWNA 5J4MA 1Q0EA 1X5FA 2ZCHH 5EFIB 5F96L 1CPYA 4MZRA 1RUPL 2DWEB 2HVJB 3EDFA 3QUYB 2ATKA 5EWIH 4AYGA 5IQMA 5J6HB 3L3HA 2YEVB 1L9NA 2UXBO 3EHBC 4U7SA 4GAFB 1YYML 1L0PA 2Q5ZA 3L3IA 4JAAA 5EU3B 4BIUA 1SY6L 5DEDA 2OXHA 3N42F 3VH8A 3EXLA 3B7UX 3SDAA 2ITCB 4P2QB 3OZKA 1JYWA 4MXVF 4XNUL 5E9NA 5IFHH 1QSEA 2G9KA 2R2EA 4FG2A 5GW7A 1Q4NX 2ZIMA 5DC9B 2EDWA 2GIXA 4NO5B 1T04A 4OFPA 3MBXH 1QVFU 3VWJB 3HKDA 3EYOA 5AWNH 4DPAX 4NO3B 4YJ2A 4BRJA 1D6VL 1NCBH 4DR6B 1QLNA 3EJZC 3T65A 1XILA 2EQDA 5DFAA 1F8TH 3V7MA 2DIEA 2J3SA 2PYEA 5MI0C 4L37A 1O7VA 1ZLSL 3L9RB 2BY3A 1E65A 3MLWL 3NACL 2JJWA 5F6HJ 1AS7A 1YNLL 1HDJA 3IJHA 4P46C 4M8UA 4W6WB 3QG6B 4NR1A 4HUKB 3HI6L 5B3SC 3OHMB 2OW6A 2OZ4A 1Q8IA 4I9WD 2BS8A 3CJJA 3WUZA 2NY7H 3QIBC 2Z93A 4IBSA 4KP4A 3I3BA 3POCA 4P4KB 4NSKA 4WI8A 1FFNA 3N2GA 1JD7A 1TT6A 4F8QA 3F7KA 1XNRB 2AJVH 1TZAA 2K0RA 5D7LD 5HYJD 3SHSA 5F0JB 2UUAB 1FG9C 2E56A 1WA0X 1BQLH 1TVBB 5IYZA 3ETDA 4QE7A 1PQZA 4PJCF 2F5AL 1R4XA 2ICWA 4UCTA 4WWNA 3M45A 1NCAH 4FQHB 5D7IB 4PW9A 4FADA 3TEYA 4OB5H 2AJXL 5IOKA 4R7DB 1PY4A 1UGNA 3D4GA 2AV1B 2I24N 4FFKA 3AWFA 1KGCD 2BRRL 1XGRB 2ITCC 5F0PB 1A3RH 3UZQA 5I2IA 3FO1A 3E6HB 5BQDA 4YR6B 2P8MB 3ZKMD 3BIAX 1U4EA 3QWOB 4KI5C 1HU8A 2CIKA 3N40P 5DFTA 2AHIA 2K1MA 2Y36H 3TPKA 2C9UA 1TF4A 3VFOA 3RVVD 3H1KH 1NAML 2GUOB 2QV4A 4LBEB 5F7NC 3VXRE 1YCIA 5BMFH 2GDSA 5J3HC 4DV7B 1IO4C 1OTSD 4IBUA 4H5SA 1Q9KB 3HVNA 3ZMUA 3BVVA 3ZMEA 4EI5B 2WQVA 2YXFA 2P67A 5C2BL 1Q43A 2G2RB 1SBSH 1CICA 2FUTA 1DQDH 3ZDXE 2ZG2A 2VQEO 2M8XA 1S6NA 1ADWA 3H1LH 1KFAH 5J9PC 1BW8A 3QVAA 1SQXH 2YMXL 1ZGLA 2ZCLL 4N2FA 1X44A 1N8ZA 3TTSA 4OZIB 1NGWB 4YBQC 3HHRB 1GA2A 1VDGA 2HFEA 4YDIH 1GIGH 2LQTA 2ISDA 1RUAH 3CMGA 4LLVA 2R56H 5D72L 1QFWM 1Q5OA 4MTXA 1FFPB 3JWNH 2R9RB 5F3BB 4ZTOL 3ETSA 4Q9QL 2MQCA 3N1GC 3I75B 4ISVA 4RRPA 3UDWA 4OLYL 4I85A 3MU3A 4N87A 4I0KA 1R6NA 4P46A 3L3JB 1NR1A 2ZNJA 3T1HB 2MPAL 1P2CB 2PF6A 3CRRA 4WWID 3G5YA 3N43F 4IKJA 2FLMA 2FEEL 1PPJH 2IAMD 1AB3A 2P5WA 3QZWA 2KQMA 4AMKL 1OSZB 4TLKA 2WLIA 1P9MC 3OWEA 3TA3D 2VN5A 1YEGH 3FSWA 1WWBX 4ZK8A 5K1JA 4JHZA 2WXMA 3RYIA 2ITDB 4U1HB 2N74A 3W11D 1OCRB 2EDXA 2FJFA 1XIWD 3LN4A 5F8RC 4XMVA 1D6EB 1VERA 4FQXC 1TQWA 3CC5A 3GIZL 3FAVB 2MNJB 2ZX5A 3T3ME 4UQ3B 4PRNA 3V79C 1OK8A 3FQTA 3ECUA 3P2TA 2ZWKA 3WN5A 4TQFA 3E3QE 1JPSL 2M26A 1BMGA 2VR9A 4KQ0A 4UQ3A 4O4IB 2JF1A 3S35X 3OPZL 2KSDA 5DJAB 4LASH 3DSNA 4P07A 1FIGL 1L8DA 3O6KL 3ASNC 3DO7B 2DI9A 4DR3B 1GGYA 2FJFB 3CIAA 2F53D 2YSUB 3RYIB 2ITDA 5D7EA 1I5YA 4YBLC 2A6KB 1IGML 2WSSG 4I2XB 4OCWL 4V33A 4PJHF 1ULVA 3ULUF 1H15B 2HMID 4NHUA 1JMZA 1G7LB 3R06A 4FNTA 5K9JL 1OSZA 3T0ED 1EHNA 1UM5H 3C3SA 1NQBA 1S9WB 4UQ9A 2R83A 1NKOA 1QAWA 4F5CA 4YDLB 4J3OG 1NEZA 2X4PA 1NCDL 1IBHA 3EOBB 1NAKH 4KVNH 1L9RA 1QRNB 3DIFB 5FKPB 3QNEA 3VI3A 1JXFA 2VXTH 1NVPB 1CYGA 3DPBB 1VF5B 1UT2A 4LB8A 4M1GL 3BZ4B 4PP2B 3KG2A 1IV8A 2HP8A 4KV5E 3AROA 5IMOB 3KM2A 2HKFL 4UUJA 3I75A 2BJML 1ZVHA 3WTTA 2ZM6O 4HUXB 3QUGA 1S5LZ 4B9PA 4O51A 4AI8A 1QI4A 1QTYT 1WPXA 3RGBA 2XVGA 3KDMA 4URTB 5KX5B 4QI3A 1BVNP 4XVUC 3QQDA 1WIUA 1COBA 3NJXA 3QWRD 1Z9LA 5DTFB 2F1MA 2WLLB 1N8ZB 4OU3A 3ZY7A 4EDXB 3ZRVA 1WBZB 4FQXB 4ZQTA 1QUNA 4I7ZC 3SE8L 2OL3H 1PCXA 2X3AA 4UCVA 1MSDA 1A02N 5E6YA 1BZEA 1BD2B 1CICB 1VJSA 3PGCB 3P9WB 5FV1L 2D3NA 2Q3ZA 3P9MA 1JCKA 1XR9B 4FTVD 4XDJA 2XV3A 4TNFA 1HE7A 4WSGA 5CKAA 3KWWB 1XEQA 4HKBA 2AAAA 2A4ZA 3MBWB 4NI6A 3HS0B 3T4ZA 4DP5X 1FGNH 3WFDH 1EK3A 3CRQA 2K4AA 2AEPL 4FZ8L 3VFOB 3WNMA 3L4WA 2K6WA 3P77B 3OKOB 5JR1L 3L71H 2F7IA 3HG5A 3TEXA 1ETZA 2M83A 4F80A 3FTVA 3AG2C 4XPAH 3V9FA 1W91A 3SDDD 4JI5B 2ZOTA 4HCRA 4KJPD 1NWPA 2YPVH 2J1YA 3IU4H 3JWNE 4ZUSB 3CE2A 4XN1A 4JGSA 4J3WA 3S35L 3LS5H 3VW3H 1WFMA 2IQAB 4Z7QF 2HMIC 2AEWA 3SGDI 3ZTJH 4OPHA 3AUVA 1OPGH 3BKCH 3AQZA 1VGEL 4OLXL 4ZODA 1ZLUK 1DQDL 1Z9SB 2H3KA 3OXSB 4KJYB 1JTPA 2W07A 1TVBA 3UG4A 3TBTB 3D33A 4FFZL 5CN3A 5IFHL 3MUY1 1HKFA 2P7TA 2NY4B 1L6ZA 1X5YA 1YN7A 1Q90D 2B4CC 1T0MB 2DH3A 1EEQA 3ZW3A 3DX6B 5EU6E 5DVNA 4GG6E 3CN3A 4BKTC 4BELD 3DVNA 2YFOA 4P4KA 2H41A 1FIEA 3BISA 5KYYB 3SCMA 4ODVL 3FB5A 4P5MA 5HHNB 1FORH 4HS6A 2GCYA 2WXQA 3S96B 3UTQB 4L4VE 4AV4A 3BZDA 1DQJA 5C0ND 4B3EA 4YPJA 3OR7C 1IGYB 6PAZA 3KR3H 1CE1H 3Q1SL 1TO4A 1P4IH 2D0GA 2ICCA 5D1ZB 1A5FL 1IKFH 1NUFA 5JIIA 1U3HB 2GKIA 1XCTB 4XAKD 2CUAA 2MQGA 4HPYH 4UT6L 4ASUG 3JATB 1R3JB 4MX7B 1BMZA 3GMLB 4P23C 1YEGL 4P0DA 3ZHVA 1K6QH 3N2KA 4FTVA 3CCEV 4AENB 4HIEA 3QISA 5JUEL 1BFOA 2O93L 2D2CB 1WYJA 3KG5A 5DGQA 4ACPA 3BOVA 1UJTA 1O9VA 1FHGA 1MWAL 2GY7B 2HLAA 3BFQG 3LS4H 2DTMH 2ZCZA 5EU3A 1NI8A 3K1DA 5F21B 3TFKC 3RDTC 1UFIA 4YHKH 3KJ4B 3QXDB 4GRLA 3A24A 3CJHA 3UH8A 3T0EB 3I9GL 4X6BA 4KU1A 2CH8A 1N36B 3BJ91 4V1DE 1A6ZA 4ZMYA 1J1PL 2Q0AA 4HMCA 4R90L 2AMGA 3MRCA 2N0MA 4WUUB 2WNGA 2F53E 4NUJA 5IG7B 4RGNC 4K8ZA 2AP2A 2ZCHL 4YZFF 3VX0A 4J7JA 1H3XA 1B6DA 3TEWA 1JX9A 4OQTH 2CUMA 3TPUB 5AAPA 3LDBB 1LEIA 2CIIA 1FC2D 2V33A 1UM5L 3TO2A 4A38A 1MCNA 1LD9B 4WJ5B 3V6FA 5KVDL 1T89C 1J5OH 2V5YA 5I15L 1CDHA 2XI9A 5GS0H 1T5WA 2AQSA 3UCQA 4Y9EA 1XO8A 3NGBC 3WDJA 2Y36L 3EGDB 4PJ9A 5CSZA 1IC1A 3Q1EA 1QO3B 3RPKA 3IS0X 3E9UA 3RWCA 1DTUA 1NBYA 1SOKA 2HRPL 4J3XA 4XI5D 4LPYA 1FZKA 5DJ2B 3O9OA 1O9HA 2G5UA 5TF1L 2EIZB 2TRHA 4BBWA 3UC0L 1XMQB 4LFBB 1HOCA 3B34A 4NENA 4PGEB 5DUPL 4JHVA 1W2KT 4NZJA 4H26B 2RAMA 4HV8A 5GS0C 5AG2A 5C9KA 4X4YB 1IJNA 1I9EA 3HJ0A 5D5MB 1I1AD 2IWEA 4QWWD 3KEHA 1CUOA 3P4OA 1RFYA 4G8IA 4G7YL 4RX4A 4BDVA 4JJ5A 3L17A 4QNHB 2JKLA 1EBPA 2E7BA 3NH7H 2ZE0A 4XN2A 3RBSA 1EA9C 3S37L 3R65A 3ZE0E 1Q90A 2CKNA 3QDAA 6PCYA 4P23A 1DBBH 2QQKL 4J12A 2E9WA 2UUDH 5FV2A 3UJIL 1KIRB 2P48B 1HNXO 3AW5A 2YXHA 4UCFA 1NU1H 4Z7OF 1BXVA 3RHWF 2ESVA 1FL6B 4NQDD 5HI4D 4AYDC 4DUZO 3DXRB 3PE9A 5KYNA 1R5VB 3TO4C 3QDMA 4K3EH 1AD0A 2J44A 5C9JA 1YEKH 2GAZB 4JCWA 1GM8A 4EN3B 1JZ2A 4K7PL 1SXCA 4FFYL 1PG7L 3UROR 2MCPL 1NC2D 4JFSA 3VFWB 4G8GD 4BXVA 5LBSA 4JY6B 2EH8H 4XBGB 5D7LA 5IBTL 5C0JA 2AJVL 1WNSA 4K73A 1U92B 5L2KE 4Z76A 2ZR2A 3GKZA 4N2KA 4X7DC 1LDPH 2NXZC 2VXUH 3THOA 4YXWG 5G4NA 1KJMB 5F7YC 3WFEL 5BVJB 4R3SA 1NL0H 3DBSA 3HNSH 3Q6FB 5A16B 4OLVH 4I1PA 1TKWA 1EH9A 4PI2A 5K93A 3GZOA 1NA8A 3U36A 3ROLB 1E6OL 4MVBC 2QMKA 3N0AA 5DMKB 2GG1A 4IU2B 1QLEC 4MTGA 4X1KA 2DQDL 3K58A 3HMXA 4Z7AA 4J9ZB 1SBSL 4JDZB 1Q1JH 4LAQH 3ZIMA 1OOAA 3FOLB 4WU7B 4B95C 1BXUA 1JMKC 1MDAA 1NKGA 1CGWA 1AXIB 1M71A 4ZDHA 2DJSA 3VD9A 3DOSA 5BW7C 4QHNA 1SLWA 5C0AE 1LJMA 4HUWB 5ESAB 5E2UL 3ULVD 5F1NA 3CCQV 3MJ9A 5EC1C 1LWJA 2BJMH 4BFBD 4WCYL 5F9WC 2Y7OA 1S3RA 4KX8A 2A99A 1NWOA 5C2BH 4JO8A 3CFQA 2IANB 2QKAA 4TVPD 5AW7B 4XC1H 3T1FB 5C08E 4AKOA 3K74B 1KMIZ 3O2VL 4C59B 2BCCH 1XQ4A 3CVDA 1TDQA 3LNMB 2MPVA 2JS5A 2X4OB 3EADA 3BEWA 1ND0B 1IFGA 2VXQH 4KZEL 2E6PA 3BKMH 3MOBH 2JIZG 4NNXA 1I9JH 4UOW1 3W82A 3KW8A 3ZK0A 3K6SA 3C60B 4OUUB 4GY4A 4U0RB 4HUUA 4L3CB 4O4YH 4IYIA 4QF1B 2J25A 2E0PA 4CRPA 4IHBA 2N56A 3MRBB 4YXHH 1NMAL 4PJGA 5MEPB 3ZKXB 4IKKA 1YXBA 4JKPH 1RLWA 3HE7C 4XPGH 4L29A 1YUHB 4LF3B 3HN3A 3HPJB 4AZ8B 5F3FA 3U9PH 3PV6B 3APQA 1YJ9V 1CLYH 1G1YA 1CZ8H 4Y4KD 1UATA 4XHJD 4JI8O 4A7GF 4X66B 2J56A 3AQXA 2D0FA 4Y7OC 3DYMA 3M6DA 1ORQB 5C7XH 4RZCB 1NDMB 3FYEB 2VLME 3MV9A 2P5OA 2WYZA 4C7UA 2OJ1A 4HGKC 4TKWA 1NGQH 4QNPF 2W94A 3EF4A 4M7JL 4OCRL 1LK3H 4ZX5A 3ZHRA 3PV6A 3RWEB 1MH5A 3KPOA 5DVLA 3P4NA 3OB0H 4U2ZA 1TA8A 4LSSL 5ADPH 4FJCC 3RX5A 1SMOA 2DLEA 3IDYB 2COQA 2RFXA 4L29B 5HJGA 4HPOL 3KXFE 1YC7A 3PPSA 3FFCB 5JHMA 2HLEB 5DJZB 3JTSB 4M8RA 2MIZA 5KS9E 2WZ5A 4X7TA 1PX8A 2BSRB 2WBKA 5HDBE 1MW1A 1S9VB 5F8QC 1ZOXA 3WNOA 5BR8O 2ZUTA 2IGTA 4NNXB 1Y0LB 3NSXA 5IHWA 2WXGA 3CZJA 3BCCH 1C08A 2YFNA 3D4ZA 2X1OA 1T1ZA 5BVPL 3VWJC 5C07D 4U0RC 3PWLB 3SQBA 4G82A 4NXNO 2WB1A 1NCWL 4OV6F 2J5LB 1L6PA 5ABZA 3QI9D 1IKFL 2WVSA 3CFDB 3ZHLA 2R56L 3FT2A 2CTWA 5K39B 5J2UA 1IT9L 5E7BA 2KZKA 1YSCA 5KMGB 4QNPE 1NBZA 1MFBH 5CIPA 1MCFA 2IV9A 1E8WA 1G94A 2QKIB 4LHQB 4ZI7A 3Q5OA 4OLEA 4M5TA 3I9AA 5FA4B 3W7TA 2E8YA 3MRJA 4YVNA 1JWUB 2WXIA 4L9LB 4JPIB 4DCQA 2D03L 2EZPA 3K03A 2JELL 5CUSH 1F02I 5BRQA 2ZQMA 1PLCA 1CXLA 1MWAH 2CO1A 3QO0A 3QWQB 4MNHA 1FYTB 2VYRE 3L5HA 3FOLA 1LO3L 3WG7C 2Z5UA 1Q0XH 4G43B 4OBRA 2Y1AA 5SWSB 4FA6A 5DMKA 1BWWA 1NDGA 1S7TA 3NSFA 3IKCB 3WFDL 2PCFB 5EK0A 5HD8D 2GK2A 4DFHA 2DJ4A 3GMMA 3DJSA 4YZWA 4C57C 4NDMB 1OT2A 2YQ3A 3KPLB 5H37G 1DFBL 1X5IA 3GSNA 9PCYA 5I71B 5DI8B 5KZCD 4L2LA 5BVJA 4HNAA 1AACA 3GSOA 4OCYH 4PJ7E 4RGOL 5L3DA 4CC4A 4L8BB 3C5XA 2YPVL 3ARGD 4XBPB 4B7KA 4Y4HD 5EZPA 3BUBA 2KL6A 4ZW6A 3UABA 1FA4A 2ADIA 4FQ2H 3GXDA 5MENA 3DUHA 1LO0L 1ZVSA 3TFBA 2B20A 2CDFA 3OGCB 1PNLA 2FHCA 5DU7A 3BRFA 3H3BC 1WBXA 2CAZC 2OL3A 5F7FA 3ZO9A 1A47A 1U93A 1VFAA 4PWGA 1R5VA 4JFOB 4ZHQA 2R0WH 4JFHD 4DKTA 4MZ3A 1HHKA 1WLHA 5GGUB 1QQDB 4R5TA 5E8PB 2WNKA 4HBNA 2L7QA 2ED8A 2HWZL 4MB3A 3SYQA 3KL5A 4B9YA 3ZMTA 2JB5L 1JF6A 3QEQD 1OTSC 4BSVA 3APMA 4LLUB 2BTQA 4WCYH 1F2QA 2WXOA 4JQXA 4PRHB 4I5BA 3HS8A 4PSPA 1AR1D 4WUKH 1KPUB 2EXWC 3SJVA 3TXQA 2IFGA 1MWOA 1EERB 4BYHA 2B2XL 1AGEB 3A2FA 3JARB 2XHNA 1CE1L 1KV7A 1TZ8A 2JCWA 3OR6A 4FFZH 3RY4A 3TT3L 3U0PA 4HSAC 1K9MW 4H26A 3U9UB 1RJLB 4H8WC 3F2LA 2PY5A 1HOCB 2VIRB 4L8DA 1UB5B 2WLYA 1NFKA 1JXKA 3AUWB 2WSPA 1BQ5A 2FR4A 3KWVA 3HUJE 4XX5A 2BSCA 3ZBHA 1I8IA 1P7HL 3OGOE 2AEOA 3TK1A 3NN8B 3WFVA 1XIWB 4IIJB 1YN6A 3NR7A 2VRKA 1B0GA 2XZQH 5IY5C 3EGDA 3ECQA 3L81A 4KPHL 2FSEA 8CGTA 2DQMA 1TMCB 1WE5A 1XVSA 3TWCH 5KWYC 1EGJL 3WGUB 1UACH 3QZMA 4UV7H 5E1GA 1VIBA 1UT1A 2KLRA 2VB5A 3A6CH 3X1BA 3O3BA 4HH9A 5INDB 3GO1H 4WO4D 3TO2B 1EEZB 5DLLA 3ES6A 5LGTA 2MCPH 4IOSA 2B3RA 4LVNC 4ZD3L 1KCUL 2ZX9A 5CZKA 3W56A 4OZHE 1Q72H 4NNPH 3Q48A 4NN5C 3WLBA 1DANU 4M7JH 4OCRH 2Q68A 4XAWH 1S3KL 4XPAL 2JFCA 2W9LA 4W81A 2OBGA 4MJ6B 1K8DA 2Q8AH 2EBOA 4JTDB 1HT6A 4FXKA 5JXAH 4HZAA 4HPOH 4H40A 5CR8A 1KXQE 3VWKB 3O4LA 1WTLA 3FX7A 1YY9D 2BOCC 3US9A 2BNRB 3GLAA 3MLXH 2DMGA 4WU5A 1O9ZA 4HSQA 4LQFH 1HZHH 4DO5A 3W0WB 1H8SA 4J42A 1KXVA 4MS8C 2OK0L 4W9FC 3UEQA 1FNGB 2Z1PA 2WZ6A 1A32A 3VXTB 2Y72A 4W9IC 3DI2B 4RAUA 4KI5F 4YPGB 3VSUA 1KGJA 4XWOD 3C08L 5B38B 1QPXA 1RURH 4HIEB 4MYPA 3P30A 2ETWA 5JIDA 2VH5H 2W0LA 4A7UA 5LOVA 4EIUA 4GUNA 5KG9A 4KKBC 1WGVA 1U30A 2O1AA 3MRPB 4MX7A 2XACC 5TF1H 2ITDC 2BOBC 2HRGA 3QUXD 4LHUD 2CE6A 4JG9A 4R8CA 1NCTA 4XPFH 3V4VB 5JXEC 1OB1A 2WJ7A 3HG4A 1K7DA 4X7SL 5D1ZA 1PKOA 2X42A 5I15H 5TDNB 4P2OA 1CXEA 2XTJB 1TQBC 2GCYB 1BQ0A 4IRSD 5B1KA 3PUUA 3CX5K 2F1EA 3JWNG 4PDRA 3S96A 1FWXA 3SCMB 1F56A 1SQQH 1N8OE 2H32B 1PSKH 1YMME 3I6LD