3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
b'NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
3SPJA 3SPCA 3AG2C 2R9RB 1V54C 3SYCA 1U4FA 3LDEA 1ZWIC 3ATBA 1XL6A 1QLEC 4EKWA 4G28B 4DXWA 5EBLC 2AHZA 3OUFA 4PDLA 3AT8A 4MW8A 4R6ZA 2Q67A 5CBFA 1U4EA 2BOBC 4P9OA 3K08A 4J9ZB 4WFHA 4MVZA 4MVRA 3T4ZA 2HJFC 1S5HC 2QTOA 3ABLC 4G27B 4XDKA 4F4LA 2ATKC 3ATFA 2HG5C 4GX2A 2EIKC 2JK5C 3ATAA 2Q6AA 3BEHA 1OCRC 3SYAA 2DWDC 4PA4A 3LDCA 2GIXA 3VSQA 4P2ZA 2AHYA 4PA3A 3T4DA 3X2QC 4GX5A 4MVMA 2H8PC 2BOCC 3RVZA 1M57C 2X6BA 5B1BC 2WLIA 4RAIA 4MVQA 3E89A 4MVOA 4RO2A 3LNMB 4J9YB 4R7CA 4CBCA 3ATDA 3T1CA 1R3LC 3ZJZA 1K4DC 1V55C 4WFFA 3RBZA 3AG1C 3RW0A 4XDLA 3K03A 1JVMA 3KG2A 2WLLB 3E8GA 4OXSA 3E8FA 3AG3C 3LUTB 3K0DA 3OR6C 1P7BA 3AGWA 3ASOC 4BW5A 3AUWB 3SPGA 2WLMA 3STZC 3R65A 4MTOA 3UM7A 2QKSA 1KKDA 3F7YC 3SYPA 2HVJC 2WLKA 3FB7C 4MW3A 5KUMA 3GB7C 3SPHA 4MTFA 4P30A 3OR7C 3ABKC 4PDVA 2A9HA 4JTAB 2EILC 2DYSC 1M56C 4PA6A 2W0FC 4LBEC 4PA7A 2P7TC 1OCOC 4R50A 3IFXA 3JYCA 4JTDB 4QNHB 1XL4A 3TETA 1N9PA 3E83A 5EK0A 5KUKA 1OCCC 4ZBMA 4QE7A 3VOUA 5BZBA 2IH1C 2NLJC 2ZXWC 3E8HA 3FB6C 4P9PA 5EC2C 3UKMA 4GX1A 3E86A 2A79B 2YEVA 2Q69A 3ZRSA 1R3JC 3IGAC 4X8AA 4X88A 3FB8C 2DYRC 3ATEA 3SJQC 2Y69C 1OCZC 2OCCC 1K4CC 4XDJA 2IH3C 3STLC 2X6CA 4H37A 5EBMC 3PJSK 2ZD9A 3AT9A 2WLIB 3HPLC 3F5WC 3E8BA 4UUJC 3T2MA 2KB1A 2HFEC 2K1EA 2ITCC 3K04A 5B1AC 3RVYA 3WG7C 4RUEA 5CBGA 5J9PC 4PDRA 3OUSA 1R3KC 4KFMA 5EBWC 5EC1C 2Q68A 3F7VC 2X6AA 4WFEA 1R3IC 2EINC 4LCUC 3K06A 1LNQA 4MSWC 4MTGA 3LDDA 2EIMC 5CBHA 4RUFA 2WLNA 4R8CA 4TWKA 1J95A 1G4YB 2WLHA 3K0GA 2ITDC 2DWEC 2EIJC 3K6NA 3SPIA 4MS2A 2WLLA 4H33A 4MVUA 2WLJA 4MVSA 4HYOA 2A0LA 3OGCC 4PA9A 4QE9A 5IY5C 3SYOA 2E4FA 4PDMA 3FB5C 5B3SC 4LP8A 5E1AC 3EFFK 3ABMC 4WFGA 1BL8A 3AG4C 3SYQA 4I9WA 4X89A 4HZ3A 4JTCB 2HVKC 3TCUA 4GX0A 1ORQC 3ASNC
chains in the Genus database with same CATH superfamily
3ZS8C 1KNOA 3H9SB 3KGSA 4JKPH 3FAWA 3ZDWA 3T1FB 4JGNA 1FN4A 2BOBB 4Z1VA 2Y7SA 5AAMC 4DXWA 2HUHA 2XIBA 4D0BA 2Z91A 3BZ4A 4FFYA 3ZKQD 2V9RA 1AACA 3EIFA 3HKBB 1E42A 4LH7A 1TETH 1VAHA 2XCMC 3L7FB 4G7VH 4PJ5E 2RA1A 5AQ0A 1WSST 1T0MA 1B3IA 3SDAD 4X7SL 1INEH 4DO5A 4NQTA 1FSKC 1GYWA 4FLOA 4PRAB 4U1JA 5GHWH 3TZVB 4O4IA 3VGGA 1SY6H 4XOBA 4OLUH 1NSNH 3GMPB 3ARDC 1OARL 2WLIA 2Y7NA 2EZOA 3F7VA 3EVKA 3MTXA 2FNBA 4FLHA 4MB4A 4X5RA 4H13C 3DSNA 4JY6A 4LHUG 3WCYA 4PJFA 4R8WL 5HHVL 3QUML 2BSCA 4JKMA 1NCBL 1P5UA 4TNGA 4FZEH 4KKLC 3S36H 4FM2A 2XTSA 3L71H 4HFUH 2BXYA 3BKMH 3MI6A 4PGDA 5G5DA 3AB0B 3BQUC 3JV5A 3HVDA 2P5WE 5GIRA 3TIDB 3G4SV 5CEXB 5E1AA 3A8TA 4DKTA 1UOWA 3W7TA 2OX5A 2W60B 3NFPB 3RG1C 1FNEB 4R7VA 2OBGA 5DLML 2QWPB 1GZQA 1GZHC 3QHFH 4JZOA 3D36A 4H1LB 4HUCA 3W39A 4A7UA 2Y0IA 4S1RL 3DBXB 1NS1A 1OCOC 4J6RL 5CJBA 4F7PA 3KYNB 1S0VA 2BWQA 1I7ZA 3MLWL 3V0GA 1E9QA 2E7HA 5IB3A 1D2OA 4CH5A 1H3GA 1N0LA 1UWXK 4PGEA 1PCXA 4OV5B 4UDUB 5TF0A 2YA1A 2FIKB 3KVPA 5E23A 5I6PA 1FXKA 4QLWA 2ITDA 4U49A 5JCOA 3PP4L 4ANKA 3VO0A 1TCRB 4JFTA 3ZRFC 4Y5VC 5K9KB 3KS0H 1BAFL 5KVDE 2BS8A 2AS5M 2WZPA 4RFOL 4NRYA 4Z23A 3HZKB 1EA9C 5TK2A 1TA8A 2QPFA 4P2QE 3CJHB 3MLYH 4JZNB 4NFCA 35C8L 3S88H 3DO7B 4JQVA 5T5FL 1X4XA 2PNDA 3FSZA 3U4KA 1NIEA 1TTAA 4E4EA 4JPQA 5EU6A 1VESA 1JGLL 2PR4L 1SQPH 2UXBB 1IIKA 1PLBA 3M6DA 4JAAA 1N5YH 1JAEA 4FG6D 3LN9A 3BPNB 1IL1A 5CILH 5JA9A 1QR9A 5D71H 3MLTA 2JJVA 1BFSA 3K7UA 4XE0A 3WY2A 1QACA 3CCUV 1NCIA 3IGFA 3IPEA 4MJIE 3S37X 3AU1A 3AGVA 4UQ2B 4FXKB 1QLEB 1O9HA 1BXUA 1R3KB 2AEPH 3HG1A 4OD1L 4V11A 4Y2DD 2OA9A 5EULV 5L88L 1GN6A 1IKOP 1IMHC 4JI6B 1YEWA 1OM3L 1KYAA 4JO1H 2BE3A 2VL5B 4W9HC 4F33B 1N7ML 3BWUC 3EKCA 1KSRA 1WTLA 2XV0A 1HZKA 3T1YO 3O41A 4QRQB 1HKLH 5JYLA 2ZF8A 3VU2A 2LVEA 1LK3H 5IMKA 1AJQA 4Q6GA 1OB0A 2N59A 2Q4PA 1YZZA 1ZGLB 1SQBH 1DL7H 2BVTA 5H2FZ 5CZXC 1A6VL 2AI0L 4MCZB 1A6ZA 2SEBA 5A2KH 2F58H 3FSOA 1GOGA 3KBEA 1T20B 1I8LC 2CDFB 1CFQA 1H8NA 1QYGH 2IFFL 1A14H 2NY6C 4KZCA 4ZYKB 4BFBD 3O2VL 1XV8A 5TQ0L 3ZRCC 1WICA 4X6FB 4XPTL 1H2KA 5D7IA 5D6DC 2FQFA 2OSLA 4CZZA 4BE5A 3JD0A 3SBWC 3ZOAA 2GB2A 5JDJA 2Q7NA 1D5XB 1ZT7B 2F8VA 4YXWG 2Z92A 4LPTA 3U46A 5I19L 1OTTD 1Z5VA 4MMXB 4FOMA 3B9KD 3H55A 1CI3M 4XO9A 4UF7C 2LLGA 2PXYA 1VMGA 1HHGA 2WXKA 4KH9A 4XI5D 4PJXB 4Y19B 1YSCA 1OP5K 3TIEB 4PQXA 4ZRGA 4TRPL 4KDTC 4WNJA 1T7XA 3BMVA 4H8QA 2FZ3A 4OLWH 2GTZB 3G6DH 1FXHA 5JUEL 3GZKA 2V2WA 4FZ8L 3NZHL 3GXUB 2JGUA 4FJYA 4MAYB 3CU1A 3Q43A 1IEBB 5IK3B 2EICA 1MVUB 2XQBL 4LU5H 2HJKA 4XBEH 3HTLX 5D1ZA 1Q9LB 4L4VD 1UJ3C 2GJRA 3FOMB 1MVYA 3QPQC 3MAQA 2EKJA 2EO7A 4IOIB 2ZYIA 1IKFH 4NZTL 1QBMH 4Q20A 1DR9A 1UXSA 3ETTA 4MJ4A 2XA8H 3T65A 5E8OB 3TEYA 1OWRM 2VDQB 1HNXB 4NC1E 5CO1A 5C0BB 4Z78A 4DWHA 4CN6A 5EIIB 2QPSA 4RMTA 1XF4B 4L2LA 4GKKO 3SCMC 4F7TA 4CSPA 3ETQA 4FULA 3TASA 2IADA 2BX5A 4FLSA 2QV4A 4OZIA 4NTWA 3IDYC 3IGAB 4ZTOL 5MEQA 3WNKA 4LFHG 3NJMA 4DPRA 4YHZH 1QQCA 2HWZL 4AILC 2DD8L 2X4RA 2WLHA 1Q1JL 2DLHA 3SKJH 3KLLA 3PQYE 3RUGE 1U8JB 2VOTA 1BD2B 3PDOA 5IYBO 1TO5A 4X65B 3UCQA 2ADPA 1OAJA 4LSRH 1R1BA 3JASB 3W7XA 1LL1A 2NPLX 1LK2A 3W37A 4YDVB 3FQNB 2WN2A 2WXIA 1I1RA 4MBOA 4YJ2B 4U6VL 5L3GA 4NUQA 2YHGA 5I15H 1MZZA 1FORH 4M7JH 2X3AA 4HJEA 2ATPA 5GISL 1IUZA 1J1XL 3L1FA 5CA1A 1L4IA 4DHLA 1T83A 5CB4A 3UXFA 3H1ZA 3H9SD 4CC6A 4LCWB 3PXJA 3BDXA 1XCWA 3WDJA 1LNUB 3W11C 4LDOB 2NYYC 4WI0B 2NSQA 1CXEA 3U2JA 1B9ZA 4FI8A 5INCB 3N42B 2IW5A 3MNDA 4XPBH 5KBMA 5AOIA 3GMOB 2Q6AA 1IBHA 3NCWA 2H41A 5AW2B 5ADPH 1NCCH 2GITB 5GZND 4LL4A 3Q2LA 4A38A 4WI9A 3A4DA 3UPRB 1BAGA 1KENH 2YICA 5E5LA 5J2UA 4Y2NA 1MW1A 2NQDA 1BMGA 1CVRA 2CCWA 4TPRH 4PJAA 3QFDA 3ML9A 5CS7A 2OT5A 5C0DA 3RBSA 3T71A 3GBNH 1HAWA 4WNQA 2R2HA 4BW5A 3ENEA 4GKNA 1NBZB 1T0NA 1T0OA 4JDVA 1MNNA 1JRHI 1NAKH 3SYPA 3JAWA 4NTYA 1I85C 2UXDO 2YUZA 4TOYH 1MHPL 5F96H 2FTAA 4AYDC 1FIGH 4L4TE 3RVWC 4BCZA 3TA3D 2PYEB 3OWEA 1CDYA 4PIRF 1EEYA 3P3TA 4P9HL 4Z8FL 1OXYA 2EP6A 1C9SA 1EZLA 2X4UA 2VLLB 3E83A 3KL3A 3NOIA 3TEZA 1P53A 1G1CA 4YZFF 2WWKT 1AY1L 4N85A 3FB6C 3FUJA 5D6CB 3H2PA 2FLRT 2QHLA 1IE4A 5JPMA 4C4UA 1MFBH 2N7AA 5GRUH 2ICEA 3ABUA 4JAVA 3FQ2A 4R90H 3O2DH 4DEPC 4H25A 2H1XA 3KM2A 3VNYA 4EO5A 4HH9A 3W5MA 4HCRL 5C6TL 3I9AA 3QJSB 3WN6A 4NAQA 5DD0L 3E8BA 4NTXA 3IDJA 3PHSA 1N2RB 3O6MH 3FTUA 2VUKA 1GKFA 1UM5H 3ARTA 5FL7G 2ZM6B 3GNMH 3H0TB 3N3EA 1HNZB 4I9XA 2P5WB 3TCTA 2FO4A 3MRGA 4FL4B 2VAAB 1P4BL 3JD3A 1NEZA 5DJ2A 3PIQB 2DE0X 5DFWH 3STLB 1VFBA 4CC0A 3H9HA 2I27N 2EXSA 4GSQA 4AQAB 1JPTH 4YUEL 4GXFA 3LHPL 3U4BH 1G7QA 2NXYD 2KH2B 1IGMH 1SESA 3ZJAA 3V4UH 4FNRA 4ZQKB 4LB8A 5JNYA 4I0XB 1TQSA 5I1AB 5DTFA 3SPJA 3BUIA 1KC5L 4DK6A 2J4WH 4JYAB 2G5RA 5AAPA 3TBSA 3C6LA 5EZOH 1FD9A 2H3NB 3PWNB 1A1NB 2F1EA 2C9XA 4XPHH 2LVCA 3LZRA 3EOBB 1E5ZA 2JK5B 3SKMB 1F13A 3FZUC 5AD0A 2Y1VA 4KWUA 3PWVA 1GJUA 4D9RE 1GN4A 1DO6A 4U3JA 2HAZA 2YA2A 4GRLB 3EHBB 2R69A 3BVNA 3TXSA 2ZDIC 1C5BL 1US6A 2H2PC 4DV3O 4N0UE 3GHEL 2JJSC 2H8PC 4J80A 2PZSA 1E2ZA 3QJUB 5ENWA 1FJGO 2AJXL 2V6HA 5EO0A 3WSQL 4B3TB 5D2LE 3ZMZA 3L4WA 4UV7H 5DHVB 1NKGA 2CSPA 3I74A 4A2MA 5CIPH 4WGKA 2ZUXA 3MV8A 4J3BA 2FHFA 3C09B 1W0VB 2V3FA 5C08B 2UXNA 4NZUH 2ITEA 2YBGA 3IPBA 2DQTH 1DUZA 4OZFB 3BD5A 4MXVF 1IX2A 2DM2A 1VQNV 3R65A 5ICUA 4PRHA 1I1FA 1E7UA 5FDWB 1G43A 4ONHB 3KLHD 1XBLA 3LRHA 3LZNA 2EDBA 1DANU 3OR7C 2D7PA 5J3HC 5DDHB 2NTFA 3PHQB 3KH4A 3FQRB 3IKKA 1VHPA 4F8LA 3IFXA 4BSWB 5DUML 4QOKE 5D4JA 2FHCA 2GCYB 4ABWA 4IRZA 1TJGL 3EJCA 3L3GA 4I4WB 3BISA 2MNUA 4N2NA 2MTPA 5BZBA 4U6XA 2NLJC 4LVOC 3BZEA 3HMXA 3E22A 4GO6B 4M3KB 1C12B 3CXDL 3ULUF 2J55A 2VDRB 4ZUWB 3G5XA 2F7RA 1CFNA 3DGGA 3PWUB 3HN5A 4M56A 3VTAA 5FO7A 2HG5A 4B97A 1LLAA 2DWDA 2YAEA 3DI3B 4PJDA 5DC2A 3T9WA 3VXMD 1HL5A 4HSCX 3RVXD 3OJDB 3A4AA 1BXVA 2Y48A 2IGTA 3RPIA 2Q9LA 4AVIA 3X11A 4X1YA 4YSCA 3CQPA 2VW7A 2VE6A 4GQ9L 4MZRA 4FLTA 3GSXA 3BIKA 4EZLA 4P2YA 3AXIA 4NWUL 2HMIC 1CTMA 5I1IL 4XPGL 1JR9A 4YJ3A 1ACYH 4XC3H 2E74B 3PYCA 4MD4A 2Y9RT 1FFXB 1LQBC 3VI4F 3IMRA 2JQMA 4K3DH 4HUVB 3EGXA 4NQDA 1F6LL 2DWEC 2F53B 2VUYA 2NR6D 4OJFH 1I1YA 2OP4L 2IF7A 4F9LC 1H5BC 4HX1A 4JO2L 1QUPA 3WDHA 2PW2B 2VQ1B 2E7LC 1HCFX 5F0PB 2B1IA 1BD2D 1H3PH 3QULB 3VACA 4CAGA 1S7UB 2BZCA 2H26A 1HI6A 3BAJA 4LL9A 4HKZB 2A83A 1QABA 1GMEA 3DGEA 4YDNA 4BE6A 2C34A 1ZL8A 4R26H 1EBOA 5FK9A 3ZR5A 5IOPB 3WXWL 1BQHA 1SGKA 3TJTA 3FCTA 1AG6A 2A06H 2CO7B 4DKAA 2YD2A 4L4VA 1WAAE 4K9EL 1MFAL 3RYFB 4LASH 3QFJE 4LVNB 3D09A 5FM8A 3ZTDC 3RI5K 3A23A 3SKOB 5D70L 1ZCRA 2HHHO 5C93A 4JMNA 4U33A 4ZIBA 3TWCH 4GFXA 1P4UA 3GINA 4XGZB 5LA6A 3S2CA 3SDYL 3EJYD 1BX2B 4CDHA 4ZXBB 4DO6A 4A6YB 1KB9J 2XKUA 3K1KC 4LLVB 1WAPA 1CR9H 3B3IB 3JCUZ 3PQYB 2OYKA 3RUGB 4GP8B 1MABG 2F93B 3DVNA 4JI2O 2WP3O 3VWJC 3VXOA 4QRTB 3C60B 4GINA 1OAYL 4RQQA 4CL7A 2EUWA 5FUOH 4LZKA 2BTQB 4JJ5A 3Q8FA 5JIMA 4WFBV 3AG3C 4HPYL 2AV1B 1MIEH 3LQZB 2Q9OA 4WLCA 3UG3A 2B14A 2C7UB 4O02L 4NSKB 1JHLH 2ALWA 5MHSD 5E2VL 4HS3A 2EC9U 2PW1B 4B3MO 1KBGH 3HMXH 4B9GA 1UYWH 1FFNA 3ESNA 4R50A 2FJHB 5EYPA 1PX8A 3BJ91 4MNQE 4Y5XB 4DR5O 5ACMA 3V7AE 3ULUH 3T1FA 2P48B 1AZZC 2BOBA 3ZIMA 4GYCB 4P9PA 3V6OA 1G6RL 3AG7A 3W82A 2VQEB 4PJFF 5FUCC 3UYRH 4X62B 3SE8H 2BVOB 2FHBA 3CLWA 4TQEH 4AEEA 3HKBA 1QRND 4DR6B 3L7FA 3T6WA 4IKKA 4J2XA 3NJGA 1KXVC 1KDJA 5EBMC 3AWFA 1ADQH 4ORZC 1QZ1A 4PRAA 2XWCA 1HC1A 4KO5A 2IPKB 3RPKA 3TZVA 3CHPA 4ODSH 2KQXA 2QDVA 4PJBE 5IVXB 2RFXB 3VVVA 1PVHA 3GMPA 4FQCL 5IROC 4YHKH 2X6AA 4KMTL 1NCAL 3DX3A 3HE6C 3N6YA 2FWUA 1AZNA 4NRXB 5D7HA 1MJUL 2DQCH 3AMLA 1CFBA 1WBXA 3CVIH 4UQBA 5LGKA 4U1GC 2FDBP 2DMCA 2H3KA 3CX2A 4IBYA 2WJ7A 2WTPA 2HJDA 4KHXL 1F41A 5I71C 2E4FA 3O3DB 3LKQB 3WKMH 4YY3B 2PKDA 3FPYA 1M9NA 2YD3A 3O3BB 3QUMB 4NUPA 5DEZA 3TIDA 4I9WA 3TV3L 5CEXA 2EDFA 2W60A 3NFPA 4ZAKC 1FNEA 4PJ9C 2WXNA 1TEFA 4N5ED 2Z7UA 4XO4A 4H1LA 4Z3IA 2WAHA 5LGHL 3IE9A 3DBXA 5I1DB 1W0YT 3KYNA 4FFZH 3VB9A 3GUTB 2CXKA 4N2KA 4PW3A 3FTVA 4JL2A 1VDGA 3MCLL 1PKQE 5ADOL 2O5ZH 3CEIA 4OV5A 4IYHA 1IC5L 4UDUA 4J3VA 2X7LB 3RHWF 4DW0A 2FIKA 4M8QB 4JDTH 1ET7A 3K2KA 2FX8H 1T89C 3VH8G 4BWAA 3II2A 4KKAD 4Y5YC 1TCRA 1AGCB 2H0EA 3NDYE 3WV0A 2NRDA 4QKXB 4Y9BA 4IKJA 4B7LA 4PCTA 3VSQA 5L4MA 1NC2D 3HZKA 2WW8A 3TJEH 2Y7QB 2LAGB 3AREB 1JGDA 4Q74A 1LR1A 3CJHA 1A66A 4JZNA 5I6LA 3AS0A 1YRKA 2YPVL 3DO7A 2ZJSL 5C09E 4UBDD 4PS8A 1UOKA 2R72A 2WN3A 4NNYB 3CXCU 4BSJA 1IGFH 2H0FA 3N0AA 1KGCE 2EKSB 3FO1B 2DJUA 3ARSA 3IU4L 2Y25A 3TEUA 1XWVA 3G04B 3JVFC 3LS4L 2O5XH 4M6NL 5C08D 1F6AB 2WBKA 5IHZB 4HA1A 5BRPA 3P0YH 1T1WB 4J3OC 2B1AL 3S35L 3S5LG 4KZ0A 2KYIA 2B9BA 1ORQA 3K0YA 5GJSL 4X8GA 3JV4B 2LU4A 3LB6D 2BDNL 3TVMC 1T2XA 2P4VA 2C5DC 3KLAB 4UQ2A 4FXKA 5B21A 3K6OA 3WN5C 5F0MB 4IOFC 3UT5B 1KUQA 3V4PL 3KLDA 1CBJA 3KPRD 4BH7B 4KUCD 3FX7A 3UJJL 3WNOA 2VL5A 4I5SA 4N0UB 1I3VA 2QQNL 4L3FA 5D7IF 5JHAA 2EE0A 4QYAA 5TE6H 4A39A 1EN4A 2XICA 4QRQA 5D2LB 2Y69C 4XPFH 5AVRB 3I3DA 4P0DA 3TBYB 1DQLH 1OE2A 2RQEA 4M1DL 1XF1A 2V4LA 2H32B 2JJ2G 1ZGLA 4WKZB 3AM8A 1MIMH 3A4EA 5K33A 3T0EC 3MRJA 2CRYA 3OAZH 1GIGL 2O61B 4DR1O 2NY5C 4L5FL 1T20A 4PJEE 2CDFA 3JTBA 4X6EB 4JFWA 2EIJB 3LZFL 3P4MB 2D0FA 2V9QA 4YZWA 3K5SA 1RP3B 4X6FA 3K4ZA 4B7KA 1INQB 1QKZL 2V3EA 2OIGA 1FRGL 4NP4L 4XP5L 4YDIL 3RQ3A 3CB2A 1G5GA 2OI9B 1JI1A 3MV01 3ZMUA 2R9IA 1D5XA 2LHAA 3MJ8A 1ZT7A 3RILA 5I73B 1X5LA 3LRSB 3B9DA 3TF4A 4MMXA 4U7KA 4NQCE 4DR4O 3ZDXF 5I1KH 3L4CA 1B0IA 3AACA 5HJ3B 1BM3H 3QQNA 1PZDA 1URFA 1QHQA 3VRIB 1A32A 1CXKA 5DS1A 4KVPA 4PJXA 4Y19A 4WWPA 4B9FA 3TIEA 4M62H 1SQGA 1V10A 2DTSA 2VXQA 3QZOA 1OCWL 4G8EB 2HJFB 2GTZA 1I3GL 2IQAB 4AHCA 4FFWD 3RX9A 4MAYA 4RLDA 1H3XA 4OZIF 1Q0YL 2MOGA 3EXJA 1IEBA 2DF3A 4MAZA 5IK3A 1EZVY 1MVUA 2UX6A 1GN3A 1SMOA 2WINB 3FHEA 3BE1L 4DSYA 1Q9LA 3FNKA 2ADJB 3H6JA 4KJWC 1OZUA 4PJ6A 3FOMA 5IJVA 5FFLA 4RMSA 4NC2B 5F9WB 1I8KB 5E8OA 3CFMA 3EJPA 2AANA 5C0BA 4P04A 4J28A 1CT8B 4OVUA 1O6TA 3SE3A 3LX9A 5IHBA 2PP9A 5EIIA 3U1QA 3EJJX 5DJDB 1XF4A 2HRLA 3I50L 4HZAA 4OCLC 1GHFL 3BP4B 2M8XA 4OXSA 4MMZC 4UCFA 3IGAA 2NR6A 4YDLB 1RQ5A 1VIBA 3IVKB 2PYLA 1U8JA 3WMPA 1BD2A 4U0QB 1I9RH 2AK4E 2VXSL 3EGSB 5GPRA 1T21B 2GI0A 3ARZA 3JASA 3C2AL 3U10A 2JRIA 4L1TA 4YDVA 2WQVA 2KG7B 3FQNA 1P7QD 3JYCA 4YJ2A 2ZTBA 3QFJB 2D03H 3UTTD 5T1LD 1HJCA 1OTSD 2BNRD 3FB8B 3NCBB 3NXSA 2ZXWC 1U2YA 5KBNC 2C3WA 5FO8B 1HS6A 3UKMA 4HK3N 4LCWA 1ZLVK 1QA9B 2WGNB 4UT9L 4XNXL 2P4AB 1LNUA 3HB3C 1DO5A 4PJAF 3OGIB 4L8SB 4WI0A 4AL8H 4KDWA 3CGTA 4EFEA 1CL7I 5INCA 3EAKA 3MVSA 3VI3F 1TYRA 4GQRA 4WRLA 3ESOA 4IU2B 3GMOA 2CTWA 1CICD 1KBBA 2AJZB 3FQTA 3B2UC 2DQEL 3CZKA 5EU4B 1OT2A 2GITA 4G9FE 4KFMA 1XHZA 2FGWH 3UPRA 4N2FA 3OXSB 3H56A 1A1OB 3DYMA 1P1VA 5F21B 1ETZB 3MMEB 3OAUL 3RB5A 2XG5B 3GBDA 1CXIA 5E0QA 2NN4A 2E46A 3K0GA 3GHBL 5CGBA 1AS6A 3LQAC 3O3UN 3PGFH 4MNQB 4QE9A 3DJTA 3MX0B 4ERSH 1FGVH 3ZPDA 2X1OA 1NBZA 1A6WL 1QLFB 1FPTH 3JWOH 4WEMB 3KDPB 1N70A 2PUSA 4KKQA 5BXFB 3U79A 5EFIB 1S9KC 3IF1B 2O72A 5DLLA 3VXTB 5EOQL 5JJEB 5J8OA 2CK2A 2VLRB 2PYEA 3NEOA 5ANMB 3ZVVA 4LEXL 3DRQB 5B39G 1DBBH 3B7YA 4DR3O 2VLLA 2RCSH 4BZ2L 2G9KA 4MDJB 5HVFB 5LDSA 1NZRA 4YIPA 3QEHB 3VSUA 5D6CA 1UFIA 3IS0X 4H8VA 2ED7A 3H9VA 1G94A 4BQ9A 1A7BA 4G2AA 1FF5A 1XD1A 1XMQO 5E70A 2W07B 1IC7H 1TIUA 4M6OH 1PY4A 4DAGH 4KY1H 4X7DC 5CHNB 1M57C 3CCSV 2VSDA 3D6GA 1JBJA 2QLYA 3HEIB 4FQ2H 1Q6IA 4LP5A 4DGIH 3T0XA 1DVFC 2HKOA 1QI5A 1DQTA 1N2RA 5A40E 1NL0L 1UH3A 1Z9OA 3BAYA 4ZOBA 2OR7A 3KG2A 1RPRA 3H0TA 4JREB 2P5WA 4UV4H 5F1OB 3HI6L 3KEDA 2VAAA 1N6VA 4LRNH 2BRRH 3BAIA 1S46A 3IWUA 2BCMA 1EFXB 2J7LA 1NBYB 4A7VA 3PIQA 4BUHA 1FYJA 5CUSH 4OI7A 4CJ0A 1IBYA 4DGYH 5LGTA 4J4PA 5H8DA 2I85A 1TTBA 4XCCL 4A04A 1SOQA 1RI8A 1XDCA 1PZ3A 5E5MB 3T8MA 4ZJ9A 4RQEA 4YHHO 4X9GA 3RDTB 2K8QA 3KHQA 4LPUA 3ZKXB 1PKQB 4UI2A 5AYTA 2AQRA 4NQXB 5DRXB 3WNMA 1CJYA 1LE5B 2ZE5A 3KL5A 3QUZD 4KK8D 4TSBL 3CSTA 4ZQKA 1AXSB 1T2QL 4N3UA 1JZ4A 5JQ6H 4I0XA 2CG9X 5JIQA 1Q3EA 4MT8A 2WUBH 5I1AA 5DHEA 1ZS8B 1K5NB 4AE0A 2Z1KA 4H7VA 1U2CA 1PLGL 2XRAL 3L5XL 2H3NA 4DRXA 3PWNA 4GX1A 3ET9F 1A1NA 2WXHA 1WE5A 1CD1B 1RUMH 2NY2C 2XWBB 5KAQF 3QORB 2JI1A 5TPWH 4OR1A 4JI8O 3EOBA 1SUJA 2JK5A 3SKMA 5T1KD 1IRAY 2Z31D 4I0PB 3ULVH 2EO9A 3MZGB 4MYPA 2GBVA 2B9ZA 2Z93B 5C09B 2YRBA 1FE8H 4GRLA 1L0LH 2QSCH 5FHAH 2PYJA 1RZPA 4Y4KC 2N0MA 2X4SB 5CFAA 3L3OB 1B2YA 4F7CB 1MCRA 2FB4H 3ECWA 3R4RA 4XMKH 1JOYA 4EKJA 1G4MA 4B0MM 2MMXA 3OGOE 2F08A 1UHVA 3Q8CA 5DHVA 3V9EA 5HSFA 1SEBB 2J6EA 1LD9B 2BP0B 3B6SB 2FATL 2F18A 2XFGB 1NUDA 1W0VA 3VQXA 3BKJL 4HMCA 4XP6L 5FFOA 4PRDB 5I2IB 2X1WL 4OZFA 4KJYB 1TPXB 2XTJD 3A5VA 2H94A 4NXNB 1PV0A 1ORSB 4K4KA 1Q82W 2VDKH 3HC4H 1AR4A 4FRWA 5FDWA 5HBBA 2FEJA 4YMPA 4ONHA 4PJDF 2E9GA 3UZEC 1AI1H 5DDHA 1AQ8A 2R9RB 2FJGB 3PHQA 4L5FE 4LGRB 4Q9BA 2QM7A 3T1HO 3FQRA 4Q6YA 4WJ5B 5BZWB 5KSAB 3UIZA 3X3GH 3CCEV 4H40A 4BSWA 3QXUA 2GCYA 3TH3T 3L3DB 4I4WA 1FAIL 4LEBA 4MWFB 3RIFK 1SMDA 5I24A 2Y0SA 4J9ZB 5JXEC 4JW3A 4J1UB 1C12A 2A74C 4GO8A 5FAAA 1KF9B 1OP4A 4U2YA 4ZUWA 4AGLA 3PWUA 1KXTB 3PL6D 1Q5OA 3DETD 1ULVA 4X4YB 5E1IA 1ZV2A 1Q0EA 2Z0BA 3L3HB 4JPRA 2HFTA 1YEJL 4UILH 3W56A 4CVWA 3IFLH 2VN4A 3OJDA 4PBXA 2F54B 2DLTA 4FA7B 4JHWL 4LF4O 3U7YL 4QXWA 1CLYH 2DDQL 2JFCA 1OSPH 4ONGH 3V9CA 4YSUA 3UAAA 2J5WA 3MRQB 1OV8A 2B1HL 4XNDA 2VDLH 1E90A 4NQCB 3RFZC 4CU6A 3CNKA 4TSAL 1FFXA 3NK3A 3MNZB 5C2BL 4HUVA 2WXOA 3UM7A 3LVEA 3TBWB 2F53A 2HLFC 3HNTL 3BN3B 3QI9C 5EBGA 1TEGA 2PW2A 2VQ1A 4L87A 1WCQA 4ZDHB 2XZQH 3G6JE 3QULA 2R0KH 4KXDA 1S7UA 1R33A 4UZSA 1YA5A 4HKZA 2QADC 3BAAA 5DT1L 4G7QB 3KPQB 5BMVB 3LH2L 5IOPA 4UCRA 4ONFL 4AVJA 5I17B 4BHUA 1SN5A 3V0DA 3MBXH 1OTUD 4AVKA 4JPVL 4R7DB 1OPOA 2CO7A 3JAKB 3UBGA 4HGWB 3RYFA 1TZOA 4RGNC 4XNUH 4AGMA 3FTZA 3K6FA 3MUJA 5DD3L 4OGXL 3SKOA 2J88H 4OLXL 4YN3A 5IGXL 3QHZL 4PTTB 4S11A 2YMOA 1LWJA 2YMXH 4XGZA 1KYOK 3MREB 3ARWA 4GKLA 2K1EA 5ALCH 1BX2A 1J8HB 1I9JL 1QSED 2R0ZH 4A6YA 4ZXBA 1HYSD 4LLVA 3U30B 4DUYO 3VW3L 3B3IA 4R97C 4TVPD 1GYAA 3DI2B 5LP6B 2J8UE 3PQYA 1ZLZA 3RUGA 2ZXEB 1QG3A 3BGFC 3LDDA 3OGCB 1UA7A 1MXDA 1TKWB 3G6EV 1EPFA 2AK4B 3C60A 3BHPA 5B3SB 3AWEA 3D4GA 3QNXB 4Y7MA 5KYNA 1XDTT 4L0PB 2BTQA 2EDNA 2LLLA 5T3XH 1G6UA 2AVGA 3TN0D 2AV1A 1TITA 1UURA 2FD6L 1ND0B 5CLYA 3GI9H 3UC0H 4JBSA 5JOPE 3LQZA 4PG9B 5D8JH 5J06A 2XAFA 4S1SH 1NGZB 1RK0B 2C7UA 3QCTH 4NSKA 3HNVH 3MLSL 3NA4A 1JGVH 1V9PA 3V0EA 4HULB 3QYNA 4I88A 4NNPH 2PW1A 3SBPA 1AC0A 2WQXA 3OBAA 3PCYA 4K71C 3WMQA 5BMFH 2FJHA 5KOVC 4O02B 4Y5XA 3SOBL 1QO3B 1E65A 2P5ED 2VLRD 1F45A 2EH8L 1IU1A 2VDNH 2YOAA 2YC0A 5G55A 2N4IA 4FLWA 1UZ6E 5JO5B 5JXAL 1J5IA 2GTSA 1RUPH 1JD9A 3ARDB 2BVOA 4NM4L 4CVXB 5KJ7E 1P7KB 1NCNA 3FOLB 4JFZL 5F7NC 4W93A 4H13B 3CG8A 3DVFA 1G6RB 1VB9A 2IU3A 3CCJV 43C9B 3GDBA 4LOUC 1EHAA 2IPKA 4W4OC 4YSPA 1DVZA 1COBA 3WHXB 5KJRH 1L6ZA 5IVXA 3TT1L 2RFXA 4AJVA 5T5NF 3EZJB 4QEGA 1NPUA 3BQUB 4JO8A 3LEYH 3TF7C 3BAXA 4AY0A 3CMGA 4ODBD 2E27H 4NRXA 4JFPB 3RTQC 3AGWA 4PWJA 2MK3A 2XHNA 3UO8B 1M2OA 4MTOA 1Y6KR 1YNLL 3COOA 3CMOH 5KS9E 5C0JB 3MLRH 4DV4B 4K0OA 4R9HA 2ZX6A 4N20A 3O3DA 3LKQA 3VQMA 1MCQA 1OT1A 2EIDA 3O3BA 3QUMA 4KJQD 2CGOA 5C0EB 1XL4A 1E5AA 2P47B 5I18L 4YHLH 3BPZA 2XQYK 1AZRA 1MF2H 5FUZL 5E5RB 2QQKL 1EEZB 2C3VB 1DJXA 4N22A 5HI4D 3NABL 3O6FD 4Y5VB 5I1DA 5HGBB 1DANT 3O8XD 1P49A 3GUTA 4YS4A 1H6FA 2DM7A 3CDCA 1ESOA 3K2IA 5TFSL 4YXHL 4G82A 3J80N 3ILEA 2X7LA 3H1HH 3GEWB 4M8QA 1UH4A 2AXHA 2JV6A 3QORD 3ZKMD 4JPKH 2PCYA 3LTVA 1Q81W 2ZPKL 3LN4B 4GAGH 4PRPE 1T03L 1AGCA 5B1OA 1L1FA 2JMRA 3O6LL 4XMVA 5CN1A 2ITCC 1BIIB 3QH3B 1DVUA 2I32A 3MLZH 5LQBH 5G4OA 2VM3A 2Q68A 2Y7QA 4FQXD 3AREA 5IHWA 2UVFA 3I3BA 3KS0J 1FWXA 1P5VB 2C7FA 1CCZA 2VZUA 1S5LZ 1OKEA 1MCHA 2G0LA 2E6QA 3ARYA 2QKCA 2YRZA 2BPBA 2ODMA 4NNYA 1ICTA 5B1KA 4TLKA 1GM9A 4MVUA 2PO6C 2EKSA 3FO1A 4WY7L 5JQHC 3LPGA 3G04A 2A9ML 1A64A 1F6AA 4AITA 4DTGL 4JO5A 5T5FA 1QNMA 5BCAA 1D7FA 5IHZA 4Y88A 1UB5B 5BOZG 1T1WA 5I30H 2XFXB 1X5HA 3STBA 2EJ7A 4HV8B 3VDAA 3O45B 5DECA 2IALB 2IPTH 1ZWIC 3JV4A 3WEOA 3GIVB 3L08A 3KLAA 5DCCA 5LL6Y 3BKYL 1IBLO 3UT5A 4G72B 5KSAD 5LKNA 2LGQA 2G3XA 2Y23A 4G8GE 4Q14A 5F7FA 1JXDA 2WV3A 3TH2T 4BH7A 1YMMD 3RWEB 5LNDA 1LP9E 1AFVH 1BOYA 4FVMA 3S37H 1DE4B 2HKFH 4N0UA 1NIFA 3V4PB 1MFUA 1JF6A 4GXUN 2NY6B 2KPNA 1OCRC 3GZOA 5D2LA 1SM3L 4GXVL 5TE4L 3TBYA 5FYJH 5J89A 1YEGH 4BJLA 2H32A 3BY6A 1BVNP 5IQ7L 5DYFA 3MXVH 4M6MH 4WKZA 1RZFL 2E56A 2ATAA 1JZ2A 3ATDA 4Y9FA 2OYMA 2MOVA 2KDYA 2O61A 2D2CC 2W9EH 3ARFC 4PJXF 4GUPB 1N6UA 2F54D 2O6FA 1R47A 1EUTA 4X6EA 2CNYA 3ARVA 3P4MA 4OQTL 2Q3AA 3V6BR 4JHAL 1EDQA 4JPSA 2UZXB 2DQIL 3ZL4H 3CCVV 4N90E 1INQA 1PJ9A 3QNYB 3UBXA 3GWOA 1E6OH 2Q7AA 4RMUA 5FFGA 3ULVD 4KO6A 1RCYA 4QOKA 4KTEL 3LRSA 4KO9A 3MLVL 3NQKA 4BRJA 2VLME 4HOXA 1IFHH 1BVZA 1IGCL 1CGYA 5HJ3A 1NOFA 3W2DL 3BH9B 1UJ3B 4ZKIA 1VPOL 2WNXA 1BZKA 3KVQA 3LZPA 4G7YH 1SJEB 5KW9L 2ZXCA 4AEHL 4MJJA 1WIOA 3JSNA 2EC9T 1JHKL 2YUWA 2HJFA 4G8EA 2IQAA 3V5DB 4X88A 2Q0ZX 3SJQC 1G9NC 2B59B 4E5XB 1X7TA 2WINA 15C8H 1EGJL 2ADJA 3SCMB 4AGQA 3WJMB 1IGIL 3OB8A 3DX7B 2J56A 1NJIW 3IDYB 1GOHA 1JGUH 5DHMC 1QLEH 1I8KA 1AILA 4WBNB 3WLWC 1CT8A 1J8HD 4O4YL 4R4BB 5E2TL 2XNAB 4WEBL 4BIUA 1S9WB 5JJJB 4IIQB 3BT2H 5DJDA 3BP4A 1H2SB 4IRSC 4OLVH 2P8MB 3K74B 3MPCA 3KPSD 4P5TC 1J18A 2OV0A 2BFVL 2L8AA 1SPDA 3FBKA 5DMGC 3IVKA 2ZOTA 2VQUA 2FBJL 2Q10A 3NCMA 1E3FA 1T0PB 2YIAA 2E9WA 2ROXA 3U11A 3N42F 4LAQH 4UOJA 5DA0B 1EHLH 3EGSA 4JPWL 4Y4HC 2BSTB 1T21A 12E8L 4FEIA 2KLTA 4BCXA 2A7BA 4EKWA 2KG7A 3BAKA 4XCYB 5EBLC 2NXZC 4K0KO 3QFJA 2XAQA 4M02A 4B3SB 2AEWA 3OB0K 2Q67A 2O30A 3NT0A 2LQTA 5DUPH 4WFFE 5IY5B 5AUMB 3FB8A 3WFCH 4PMEA 1TYEB 1XF2B 2WPDG 2NY0B 2W59A 5FO8A 5FUCE 3D39D 1QA9A 3ES6B 1BREA 3LQAL 4B53A 4ZMYA 2EDKA 4L8SA 4LVEA 2XJKA 2J8UB 1A0QL 1NTMH 4JVPA 3SDDD 5AVXB 4DFIA 2UXBO 5I1CH 4AYMC 1LE9B 1Q9KB 4P4KD 3EFDL 3E0GA 4IU2A 2W95A 2AJZA 1OGSA 3LHAA 4WI8A 2Z0AA 1MHEB 5EU4A 2QFRA 1N3NB 5IFAL 2ADFH 3CP1A 1U3NA 1NUFA 3OXSA 1MW0A 1A1OA 1ETZA 3K6DA 3MMEA 1SFHA 5C0FB 1PEZA 5KX5B 4JI6O 3DX6B 4H20L 3F7YC 5IOKA 3V2AR 1CFMA 2W9DL 4PBVC 5CP3A 4MNQA 3MX0A 1IKNA 5PCYA 4YEEA 4PS4L 2X6MA 1XIWC 5C0AE 1QLFA 3QF7A 2F7QA 2WQ8A 4FNUA 2AJVL 4XCFH 2VDQH 1KTKE 5DR5H 3FB6B 5FCUL 5BV7H 5BXFA 4BBWA 3WJLC 5EFIA 3IF1A 3VXTA 2R0WH 4XH2B 5HHQB 5K9OB 1Y07A 4NUGH 2VLRA 4N8VB 2ITFA 5ANMA 2RAMA 4DEPB 5IJKC 1KGYE 1CQKA 4JM4L 3DRQA 2LOEA 5DZPA 2YA0A 2CM6A 4UZGA 1SN2A 1IAMA 1ERNA 5I0XA 1MHCB 2QKIC 5HVHC 1TVBB 4MDJA 4LF7B 3BFRA 1UD4A 2IH3C 1I7UB 3FFOA 3FU7B 3QDGE 3QEHA 5T3XD 2OCFD 2JGDB 5L8KB 1N0NA 2DW5A 4DV6O 1TSHA 2WNGA 4Y0GA 2CUHA 3C9NB 3FMGL 3LEVL 1A22B 2W07A 3RBGA 4GQZA 2VZOA 1LHZA 1NANH 1YY9D 5EC1C 1BLIA 3GQFA 5CHNA 4DP9X 3KYAA 5EF0A 3K8LA 5KS9B 3EADA 1BG1A 4G80B 5BZDB 4HCRA 3M88A 2IWEA 4TNEA 1JDCA 3FO9B 3IDNB 4Z7IA 5CSZB 5DM6V 4GRWE 2QPDB 2F7OA 4QD2E 1EFXA 2AV7B 1NBYA 5GSVB 2RMNA 1JNLL 1GS8A 3QG5A 3MRIB 2N7SA 2YK1L 5E08H 5E5MA 3MCKB 2GPZA 4LCCB 4PSRA 3RDTA 4AGNA 4F8NA 1PKQA 4BR6A 2D9QB 4NQXA 1LVEA 5DRXA 1N4XH 3CV5A 4F8QA 1JOIA 2ZP0T 4PDLA 1EANA 1AXSA 1VF6C 1DBML 3LRKA 3P4NB 4YSAA 4WTWA 3OL2A 4K3JH 1BQHG 1K5NA 1ZS8A 1OHZA 1FH5H 4PRPB 3X1EA 4MDRA 2X4PA 5LXVA 2CE6A 4D7TA 1V3MA 2XWBA 1CD1A 3MR9B 1HEJC 3QORA 4I18C 2M26A 1Y0LB 2FKXA 3SYAA 1LO2L 3SY0B 1KGUA 1S7QB 4I0PA 4YDJB 2Z93A 5C09A 1HH9B 1YCSA 4M43L 1I8MA 2CGRH 3QTCA 4I9QA 2X4SA 1NTZH 3L3OA 4F7CA 4FI7A 3T0EE 1MCSA 4X65O 1USZA 2FNWA 4HIXH 5EA0H 1KFGA 2N0KA 4JGMA 4POUB 5EZLB 1E67A 5JHDB 2BZDA 3IN0A 2ESVD 2FVNA 1SBSH 4TULH 2Y1ZA 4EOWH 4LCIL 3CFKB 5DD5H 1AR1D 1SEBA 1E30A 2WSDA 2BP0A 3B6SA 5DQ9B 2VDPL 3ZBHA 3ZRVA 3UABA 1TJIL 1UWGH 4AKQA 4EN3D 4PRDA 4DK0A 3ETDA 4KJYA 1EAJA 1ORSA 1W6WA 4I1NB 5GGRY 4G8GB 5ITBL 1MG1A 2OW7A 4LLWA 2NLJB 4LVOB 1HOEA 2OMYB 3HBQA 4TOIA 5KBLA 1QHPA 1ITBB 5CJXA 2J1YA 2R23B 3HUJE 4GEJA 4NZJA 2FJGA 4WK0B 2ENQA 5KSAA 3OR6B 4WJ5A 4MJ2A 5BZWA 5JVDB 1AJNA 4JQIL 4O4HB 5I6NA 1XR8B 4GT0A 3L3DA 2Q69A 1N12A 1YAIA 4A63A 3OC5A 4MWFA 3UGUA 1JXKA 4G71B 3N85L 4J1UA 3QQ4B 3SJVD 1SHMA 3N0PB 3UTSE 1B0WA 1BZ9A 4IM8A 4Z7NE 1CQYA 1KXTA 2X09A 2PPCA 1P9MC 2CR0A 4P57B 4RNRB 3T08A 4X4YA 4YR6B 5GS3A 5HHXH 3L3HA 2Y72A 5FWQA 3R18A 4GAYB 3RGVC 3VFPB 2DWEB 5T1MB 2F54A 4LKCB 1VQMV 5HHOD 4D9LL 1H5BB 4CILA 5KVDH 4X4ME 5JR1H 3PS6A 4Q89A 3MRQA 1PMYA 2MJWA 1MAMH 5MEND 1FLRH 1KUMA 2Y6SC 4NQCA 5C0RH 2CDEA 4JFUA 5I5JA 5I9QC 2A9NH 2EDQA 1MXGA 3QP3A 3GXTA 1P7GA 3MFGB 2ADYA 3MNZA 3OAWA 4LAJH 43CAB 2X0VA 3TBWA 3APDA 4K8RH 5IHUL 1PL4A 1UQSB 1SXCA 3Q1SH 4Y16C 4W9IC 4PY7B 5KVFE 5FYJD 2APBA 3S97C 4C57C 1BYPA 4GBXC 4ZDHA 1U36A 3IMUA 2OYLA 4N8PA 5I0VA 1WP7A 4BK4A 1QTSA 4PELA 5T5NG 4ZW3A 1EN5A 3MV9E 4H1LG 4XMWA 1ZE3H 4LQ1A 5DHVH 4R4ND 1CLZL 4P4RB 4HWBH 3BH8B 3KPQA 5BMVA 3RUGF 2JE8A 1XH2A 4DK1A 1BEYH 1WQVT 4CADB 2IQ9H 4X6BB 1E4WH 1PZSA 4XB7A 4Y8AA 4NYLB 4OZFH 2VC2L 2K9UA 4R7DA 5MP6L 1I1CA 3LH8A 3JAKA 1QW8A 3CK0H 2NY0D 4HGWA 4KMQA 1BZQK 4WWKC 3BT0A 4OI9A 3IJ9A 3NIGB 4PHXA 5HYIA 3T2OA 3T5WA 2QJ1A 3EXLA 1N64L 1O6VA 4LF3B 3VFUB 2H5UA 3BFQG 5L6YH 5SWQB 4RAIA 1LEKB 4PTTA 1TXKA 3K4AA 3OKKB 4FYRA 4Y8DC 2QTVA 3MREA 4OCXL 3AG3B 1J8HA 2WBJD 5ITZB 1SVCP 3FU8A 2EACA 4HCIA 5DURB 2WLLB 5LP6A 4L0YA 4RWHA 4F7KA 4GP5B 2Q7GA 5E94B 3HR6A 4FYTA 1DQDL 3OGCA 1KN4L 1TKWA 1X6LA 4JYAO 2AK4A 2WYHA 4DKFH 4BZ1H 3P3SA 3QNXA 5A2FA 2VDRH 3U83A 2W94A 5GGQL 4FNLL 2P6JA 4UT7L 2EEXA 1ND0A 4MZIA 4PG9A 3OTOB 2JKLA 1RK0A 3ALXA 1KCWA 1S9VB 1SOSA 4MNGE 4X6DF 5AAMA 4AT6B 2NY7H 5HGGS 4EAEA 1BQKA 4S1DC 2RJMA 4PWFA 2APFA 3QXWA 1TU2B 3S4SG 5IVXF 1SLUA 2NT1A 2PTVA 2R1XB 4O02A 5EBMB 1QO3A 4B3TO 4I48B 1HU8A 1BXXA 2ZX9A 4EI5C 1UCBL 4QRRD 1H6EA 4LSVH 2JVDA 2GY5A 3FULA 5GGVH 3BI9X 1Y4MA 5JO5A 4PHZA 3ARDA 4CVXA 3CVDA 4G42B 1P7KA 3WGVB 3FOLA 3HE6B 1IBGL 5E7FA 1R24B 4H5SB 5I1EH 1WNSA 1VARA 4U1SB 4Z76B 1G6RA 2DYPD 43C9A 2B5UA 4KHTL 5D5PA 4UCUA 1AR2A 4MQSB 3F85A 2WWKO 4HC1L 5HHMB 2F23A 5DFAA 3D51A 3WHXA 2J72A 5I71B 3UZQB 3KVDD 5MEPB 2OZ4H 3BFOA 5H4YA 3BQUA 2ITDC 5JCOC 4ODWB 3OG6B 5C0AB 3GTNA 1QASA 4QR7A 4ZAKB 5CD5D 4PJ9B 4JFPA 1GZHA 2RACA 4K3HA 3ECBB 4BFGA 2AJYL 5C0JA 3ASNC 1DFBH 1RZGB 1MLCB 1VF5C 1ZV5A 3TONA 4A6YH 3L74H 3GGWB 4IIJB 4PLJD 5IQLA 2EO1A 3PREA 5C0EA 3UFIA 4W4KA 2HKHL 4XNYL 3QDGB 1HT6A 1WUNT 1E9PB 5AYQA 4L1BA 2ICWI 5KSVB 1MCKA 1RZJC 1EEZA 1K8IB 2C9RA 4Y5YB 4Y5VA 5HGBA 1N6QH 1LO0H 3PFUA 1YHQV 2HVKB 2AXFB 3ZT7A 1FP5A 3MLXH 1AP6A 1KCUL 4DP7X 1IM9D 3O0LA 4DF9A 5SV3A 3FONA 2V17H 3DK2A 2ZUYA 3QEGH 2PLTA 3RU8H 3LN4A 1BIIA 3QH3A 3UO1L 1T1YB 2EYSB 3KZ8A 2QVMA 3QJQB 3MHSC 1JCHA 3B8SA 5EIIG 2WYIA 2ATKB 5A9GA 1WEJH 1P5VA 3PAYA 5BOJA 4YHNB 5KZCD 3QR0A 1XREA 2FUTA 3DJZA 1F4AA 4M48H 1JFHA 4R4FH 3TVMB 1TUBB 5AZ2L 1NR1A 1U8CB 3OJ2C 5F9DC 5IZ7A 3WN5B 2O6EA 1XCXA 2YPVA 4JG0L 1Y6NR 2WQAA 4U6HB 2XWRA 5D2LF 1MH5B 3RL2B 1ZPLA 2DLFH 1UB5A 2XFXA 3UJIH 1FL6B 1XH3A 4UOZA 4ZFOL 4HV8A 4CJ1A 1FGNL 2X9WA 4C4KT 3O45A 4Z7VE 2IALA 3MNVB 3LPWA 1AP5A 1I4FB 3TM6A 2FEEI 3GIVA 4R7XA 4DH2A 1WPXA 2Y69B 3E9UA 2ZUWA 3D08A 5TQ2H 1NCDL 4IJ3C 5D5ME 3ZHRA 1TZGH 1U3JA 1W59A 1B4RA 1DLFL 3AC0A 3MOBL 3E9TA 5J6SA 3RWEA 1RFDL 2JI2A 1OARH 2G38A 4DGVH 1XGTB 3PJSK 1DE4A 3CSYB 1MRCH 3EUUA 4K55A 1NGPH 4N3TA 5KMGB 5F0JB 3V4PA 1RY7B 5KYYB 1KZQA 4OTXH 1HIML 3EH5B 2WA4A 4R8WH 1UWEL 5HHVH 2K9FB 4WFGE 1N36B 1QFWL 3O4OC 1GN2A 2VWKA 4EQ3A 1HWHB 5IWLC 3DSFL 4BIOA 2NNRA 4FI6A 2KLRA 3SBWA 1JXFA 1RIUH 5DRNB 5J1AB 2ZKWA 1IJNA 4NR1A 4GUPA 1AQKL 1V8HA 1VF7A 2CMRL 3CN0A 4N0YH 1E4KC 1L9PA 1AI5A 4YE0A 3MV7E 2UZXA 3GIZL 3HUJB 4WENB 4MLSA 3TWYA 2YSSB 1XHXA 1MCLA 3QNYA 4TV3A 3MLWH 3MRMB 1G9NL 1JL8A 2G2RB 3WUWG 4KDTA 4X62O 3D3VE 3FN0L 2D3LA 5GZOC 4ZK8A 1Y66A 3LDEA 3ARBB 1EZVX 4I5BB 4XZUB 4ZS6C 4NB5A 3QDJB 2Q1EA 4NUJB 1CLOL 2GTWB 2VISB 3QGVA 4POZC 1JS4A 5D7EA 1YAZA 1GGCL 1BAFH 3BH9A 3F5TA 1UJ3A 3UTSB 2XI9A 1ROPA 1TZ8A 2EXYD 1WN7A 2CLZB 2VMDA 1NBVH 4OFYD 1SJEA 3IMSA 4RDQG 3S2AA 4J5VA 2GHYA 4B9ZA 5JHMA 3V5DA 4R5XA 5CXPA 2V8MA 1UM6L 2QT6A 3GWJA 3AXLB 4JG9A 5HHPB 4HWEL 2B59A 4RGNE 3GMQB 4LSDA 4NN7C 2OMZB 1TUPA 4XAKD 2WY3B 4E5XA 3NCEB 5IB5B 1XMEB 4OIIL 2N1TE 3SCMA 3KZIZ 4UCVA 3WJMA 2HA1A 1A65A 3HVNA 4KI5D 4YY3O 4Q58C 4JQXC 1H2NA 3ZMTA 1XAKA 2EAEA 3HZVB 2OJ1A 4WBNA 3OWRA 2JJ1G 3JUYA 1KJ2L 1PW3A 4R4BA 2XNAA 3S6CA 4BWUA 4JFDE 5C1MB 1S9WA 3PWJA 1R6TA 3I84A 4IIQA 4CSTA 4BM7A 3S3WA 4OD1H 4XT1C 5AVSB 3N43B 2J5LB 2MW2B 1U6AH 3GB7C 2WWMD 3HZ3A 2VJ8A 3DXAD 3MV9B 1OM3H 1AGFB 4JL1A 2H32H 2ZXWB 3RP1A 4K2UL 5DEFB 3N2JA 3KPLB 5HDWA 5LB1A 1YYCA 2BFGA 1N67A 2BSTA 1KG0B 3HB3B 4D3CH 1V3JA 4E42A 3EJTA 3E8HA 2VXTL 2ZXGA 4NOBA 4XCYA 2X89D 1FBIL 1DEDA 3ZRSA 2PPEA 2AI0H 1OAZL 3GKWL 1KPUB 1XMOB 1KEML 5AUMA 1MW2A 3WHE1 1ZHNB 2AJSL 1XF2A 2IFFH 3E1ZA 2WA3A 1H3WM 2DJSA 2X1QA 4P2QD 2CXGA 3ECUA 3ES6A 3O2VH 4G1EB 1DEEB 2A9CA 4BDVB 2XVGA 3EJSA 2J8UA 3RI5F 4Z95H 5IROD 4M7KL 1ZKAA 3TP4A 1Q9KA 5CFHA 2TRYA 4UT9A 4XC1L 1F90L 5F2VO 1L7IL 5I19H 4TLSA 1SQVH 5C8YB 4OCWL 3MC0A 1MHEA 1N3NA 4U4IA 4UM8B 5G2NA 1BAWA 5HHMD 4FABL 3NACH 4DO2A 2F43G 3SDAC 1I85A 1E28B 1NLDH 1FPOA 4MJID 3LOWA 1JNNH 5C0FA 5BO1L 3BOVA 5KX5A 3Q5YA 5C07E 3DX6A 1UENA 5C6PB 3V4VL 4CC1A 4OZFG 4R6UA 2QVIA 2OKMA 1OAKL 5JUEH 1BHBA 5DJXB 3NZHH 1J86A 4JCWA 4OF0A 2HX7A 2EE2A 4UOW1 1S72V 2BW4A 5L0QC 3FB6A 4UTBH 4AQ8A 1N8RW 2KKQA 3N1MC 2VTFA 1QU7A 3ZHDA 4FHJA 4MJHA 4V1DE 4XH2A 5HHQA 3MCYA 2OTJV 3BUPA 4N8VA 4UXNA 3F7LA 5FW8A 5LCVL 4Y9CA 4E0RB 4LIQL 2O6DA 4KKPA 2ZR2A 1DJGA 1K72A 1MHCA 1RJLA 3T4AC 4FQPA 1HESA 1TVBA 3QRBA 2OIEA 3B8MA 1DVFB 2BM3A 3LKSB 1I7UA 3FU7A 2JGDA 4Z3GA 5FV1L 3WDIA 1AS8A 2BS71 4DIXA 1QEWB 4ZTOH 4BZ2A 1R3IH 3GDCA 4JO4H 1HCYA 1PJWA 2DQDL 2HWZH 3CTTA 1Q1JH 3FTGB 3E2HC 1L6XA 3K59A 2EDXA 4RGOH 4AIXA 5CLWA 5KSUB 2FX9L 1XNQB 3PF2A 3QO1B 1UA6L 5KS9A 4G80A 4F6EA 5BZDA 5FYLL 1CDHA 3IS1X 4WWID 3IJHB 3VQ2C 3FO9A 2GBOA 3IDNA 4U6VH 5K39B 3N44B 5A2IH 1BZDA 1JV5B 5CSZA 4P30A 4YAQB 5GISH 4WHYH 1J1XH 1F4XL 1ZVNA 4D94A 1KCSH 2KLSA 2AV7A 1MFNA 3O3AB 4GIOA 4QRTA 4G3YL 5GSVA 1CIUA 2A5UA 3QDME 5HDLA 4IGGA 4HXAL 4EI6B 1EHNA 3MRIA 3OPZL 2O5YL 3MCKA 4W4NA 4B0MB 4LCCA 3I2CL 1W0WB 2FWOB 4LVHC 3BABA 2ZWLT 4PMFA 3GSUB 3U1SH 1NQBA 5FGBC 5CM1A 1ZS2A 1LO3H 2Q5BA 1CB4A 4Q6IC 2BLFA 2HTKD 3P4NA 4PJ8D 4LWSB 4DP2X 2VR7A 4FG6C 4F9PC 3LVTA 5GGTL 4PRPA 1AROP 3SDXF 4IDLA 5GQBA 2ZDIA 1K3IA 2EDWA 5E6IB 5CP3H 2JJSA 3AT9A 3MR9A 3FT2B 1Y0LA 3SY0A 1S7QA 4RFNC 4XN9A 4Y2DC 1JDAA 4BXSV 3RVYA 5L2KD 3LRGA 4YDJA 2FB5A 1SDAB 5AVVB 1HH9A 2VKXA 2VR9A 3Q2NA 5CMAB 3CFCL 1UXWB 1DLBA 2EJ1A 4I89A 2NZ1A 5FHBH 3ZLQC 1F1GA 3HG4A 3CRMA 1QWUA 2CALA 2BMKB 2UUDK 5DSCB 1QATA 2XQYA 5FYKU 2BNQB 5ESQB 1RUAH 3CLEL 1VEMA 5EZLA 5CN2A 4EIUA 3ARRA 5JHDA 1KBHA 1PTZA 3CFKA 2PTMA 4PGZA 2Y2YA 3HC3L 2VXVH 5AKSA 4O51A 3T6ZA 4EQ2A 1T1ZB 2VLJE 3J07A 3SJCC 3H42L 4Z7VB 2WO3B 5DQ9A 5F3BB 4Z8FH 2DRUA 2ZAGA 4LEOB 4W9ZA 2HSIA 3E8UL 3VGBA 1KB5H 1TTCA 2YAPA 1AY1H 4G8GA 3CPUA 3WFDL 2VDPB 2NLJA 3QG6B 2OMYA 4FXTA 2R23A 1GYCA 2A74B 3ARBD 5IQNA 5FO2A 2F7IA 3K5RA 1AD0B 1JP5A 3TT3L 3UADA 1Y6XA 1A5FL 3L3JB 3D2UD 1MWAL 3OR6A 5JVDA 3BESR 2F5BL 5C6TH 4AZUA 1E5CA 4O4HA 3H1LH 1LUWA 1L0XA 1OTTC 3Q8AA 5JHBA 3A2FA 1XR8A 2G2PA 4QJ4B 5IVOA 3B9KC 4NZFA 3UAFA 4HPOL 1D5RA 4TQPA 4JR9H 4X8JB 4OGZA 1IAIL 1KELL 4XI5C 1ETJA 3EYSL 3DIFB 3QQ4A 3D52A 3RKPA 4BKTC 3GJFH 2ZIOA 4LGPB 1WZAA 4P57A 1W80A 2IJJA 4RNRA 5LJYH 3KYMB 4YR6A 5IEHB 3RFZB 1CGSL 1FVDB 3MV7B 2AJ3B 2QGDA 3FYIB 4XVUC 4YUEH 1DTUA 2JJTC 4GAYA 3VFPA 2DWEA 5T1MA 3UG5A 2R2BB 4K7PX 4KK5D 3QI9B 4LKCA 3LUTB 4F9LA 1H5BA 4E9YA 4GFTB 3SGJC 1AGDB 2WLMA 2E7LA 1AO7D 1PD1A 2I24N 3F58L 5IW6B 2I9LB 2BY3A 5FF6B 1CYGA 1QQDB 1KC5H 4LFAO 3PJSB 2QADB 3VXUE 1HCZA 4P59L 43CAA 1TCMA 2HZHA 2IGFL 4GAJL 1UQSA 2GSMB 4DGUA 3VVWA 1EFRG 4GUNA 3WB0A 4PY7A 2OR9L 3WS6C 2JS3A 5LVEA 1UTDA 5EU5B 2IH1C 1QOKA 1KGWA 4G6KL 4RGNB 2GEEA 5E6ZA 4TQFA 4DVBB 5B3NA 3NVQA 2IWKA 4XVJL 3ASWA 4WI4A 4P4RA 1C5BH 3BH8A 1ZAUA 1YEKH 2Y06L 3PWPE 1HHJA 3DMMD 3GHEH 4Q2ZB 4ODXB 4XTRD 4IRJC 4X6BA 1VEOA 1UPGA 4NYLA 4P07A 1X5IA 4M7LH 5IBLD 3BGFB 2ETNA 4FQIL 4Q9RL 3Q1EA 3VWJA 2ZKYA 2M2DA 3VFUA 4LF3A 5D93C 3UX9B 5SWQA 1NC4B 2VC2B 1LEKA 3AMKA 2F6AA 3GBML 3OKKA 1PQZB 3ZKND 1V7ML 2OL3H 4EE2A 2TSBA 3NESA 1F5WA 2LT9A 4L3EE 4ANXA 4B95C 5ITZA 4U1LB 2F0CA 3L2NA 5CN3A 2WLLA 5ES4B 3S36X 1CZ8L 5DJAB 5E94A 3VFGL 1B4JL 4B9JA 3G6BA 4EIZC 2E76C 4B9KC 4FS0A 4RVBA 1IQDB 1TJGH 4K71B 3TCUA 1U92B 4RSYA 3OAAG 5GZNC 1VCAA 3MUUA 1KKCA 3BHBB 1Y1DA 2PWEA 2VM9A 2VN3A 1QSVA 3SYCA 2JTDA 5CEZL 3FUDA 1SJVA 2YGOA 3CXDH 2HB0A 2VR5A 2CAKA 1S9VA 1PX4A 2CTQA 4CGUB 3HG2A 4BFFA 4YZFE 3QK0A 5H4ZA 4C56D 1JZHA 4L05A 3OAYK 4EN2A 5CGMA 4D9RD 1TU2A 3PWLB 1KXVA 3K81A 2R1XA 5EBMA 1I82A 1SF3A 4I48A 1L3WA 3ABZA 5IJBC 2KT6A 3UERA 4I50B 2YWYA 1TGOA 1HH6B 5F7DB 3NZSA 3AB0C 2C3XA 1BVKB 3VWKD 4NWUH 4MVMA 1WZ1H 3TA3C 5I1IH 3S98A 4FLYA 3O4LB 5IROA 4G42A 2UZPA 3GHPA 1J1PH 4NO3B 3HE6A 4NXNO 1KFAH 4ZW5A 1R24A 4H5SA 2E0PA 4PRIE 3RTQB 4U1SA 1VP7A 3CXFA 5C07B 4Z76A 2OP4H 4PJGE 3VRJB 1JVMA 1NKRA 5K93A 4JO2H 3GD1C 3AWGA 1IO4C 4N0RA 2A7WA 1JYVA 2RJZA 1F2QA 2N04A 3UZQA 4UQ3B 4EUPB 3CSXA 1RZJL 1PDKB 1FH2A 3MACL 1SERA 4G6FD 5CCJA 1CD0A 3F01A 1OSEA 2BIQA 2JELH 4ODWA 3IAQA 4XXWC 4P3DB 5EMYA 5C0AA 2J1KA 4UM9D 3UBXG 1GH6A 4ZAKA 1BFVL 1IFRA 2DS4A 4PJ9A 5B4MD 5T1DH 5KJ4A 2EADA 3WXWH 2WXPA 3ECBA 4F57L 1EZSA 2P52A 4X4XB 1HEZB 4X9QA 2J8OA 2DI7A 1RZGA 3RA7H 1MLCA 4R7NB 2LGWA 4Q4IA 4JNXA 3GGWA 5IFHL 4EFBA 4IIJA 4ADJA 3JSSA 2FUQA 2Q2EB 3QDGA 3SDYH 1E9PA 1XB3A 1ZLDA 1KWKA 5FYLE 5KSVA 1S9XB 1K8IA 3QJZA 4Y5YA 4DP5X 1IT9L 4B60A 3ZE0B 2E7BA 2OLDA 2X12A 2ITCB 2NXYC 2DJMA 2WK2A 3TOPA 2OK0L 2CBOA 4M3HA 2HVKA 2AXFA 1MFEH 1PLAA 4ZG1A 2B3IA 3VXPB 1J1OL 1OAYH 5L7XL 5E6ID 5I76B 2V7QG 5E5UB 3CLFH 1KP2A 4I3RL 4K3AA 3E38A 1R3KC 1NR7A 1KDIA 4HPYH 1F4HA 2UXDB 1Y1UA 2YS4A 1AYRA 2PO6B 3KXFD 4QRSB 4YC2C 4PG2A 3SE9H 2Z4QB 3CYOA 1T1YA 4IYKA 1I08A 1R73A 2EYSA 3Q2VA 1KT2B 3L9BA 5E2VH 3QDMB 5CCHE 1P6FA 3WGUB 2ATKA 4DR2O 4ZFZB 4YHNA 1IQWL 1N26A 2BNQD 3EO0B 2NX5E 3KCPB 3EF7A 3TVMA 1TUBA 1SMAA 1U8CA 2EJRA 1N9PA 2WXGA 3AM8C 3HI5H 3WN5A 2R9HD 5CJQH 3QNEA 4WEUD 2TRHA 4A5UB 2VLKE 1S3JA 3HNSL 4KQ0A 2BSED 3FHAA 4MJ5B 4U6HA 1MH5A 3RL2A 3WOVA 4LPYA 2L7QA 1FCGA 5FPOA 3QJHB 3U7WL 1FL6A 4FG4A 5F8QC 2IAMB 1RHFA 1S7RB 3WNLA 5HGHB 3ZK0A 3MNVA 2EH7L 1OCRB 1I4FA 4OM1L 1ZGLM 2QR4A 5GS1C 4XVSL 1JDDA 1WZLA 3J7HA 3PDDA 3ETBF 5DWUL 4ZFOB 3DHPA 5F6HJ 3KLHC 4BFNA 2ODIA 3GZPA 5JHLL 5BRZD 4FQCH 4MMXC 5F89B 1XGTA 5FYKL 3ARFB 1NCAH 3CSYA 3FN3A 4KMTH 1SNRA 5KMGA 3EFOB 2NR5A 3P0VH 4WHYG 5FW6A 2K3TA 4NWTL 3PN1A 1E6JL 4GIAA 4F15C 1MJUH 5CZRA 4CA4A 5KYYA 3IMBA 1IBBA 3KCWA 1MHHB 3DPBB 3V55A 1LGVA 3BQVA 3VI4E 3RYCB 2Z3FA 4ZOAA 2YXMA 5DRNA 1IBMB 2F68X 5J1AA 2LFEA 1NM4A 3ARGD 4QJ5B 1GPOL 1UT2A 3RVXC 1FNSL 1RK1B 3MOAH 5JQIB 3HUJA 1OF2B 5DRWB 4LHJB 2YSSA 5SX5H 2FO8A 3MRMA 1G1XB 1PSKL 2G2RA 2YIBA 3HOGA 1A8JH 3MCLH 4Z7UB 3D0VB 3X1GA 5JW4R 4OQTA 3BRCA 4FYQA 1IC5H 1N0XL 3V7AG 1BMFG 5I1JH 1L9TA 2ZD0A 3EF4A 5I1HL 4OPAA 4IBTA 3ARBA 5I0ZA 4I5BA 4XZUA 2QJDA 4S0HA 1HNYA 3QDJA 4NUJA 2GTWA 3CHOA 4PWKA 1RJCA 3ZTNL 5D7SL 3DHJA 2DQUL 4G5AA 4M03A 5EOCL 1GMIA 1WLEA 3IGAC 2NR6C 4QTIH 3UTSA 4N2OA 2O93L 2CLZA 3H7LA 4TNFA 3SEPA 3VXRD 3RIFF 1BE3H 1TTGA 5IYCO 5SWZB 2LW7A 3LPFA 3UCRA 3V0VA 2YPVH 1MFCL 3AXLA 4KXAA 5ABAA 5HHPA 5KEZA 1N19A 3GMQA 2OMZA 5LHHA 4MBRA 1XH1A 4L1SA 4X4MA 5IB5A 3DDGA 5J11C 5KBKA 4QPKA 3DECA 3IU4H 2J1WA 3D85B 4DV4O 1WGVA 3KEHA 4LFBO 4IRSB 4JRWA 4LARL 4P5TB 4X2UA 5HYSB 1MOEA 4L8DB 4MQ7B 3NGBC 3QZMA 3EO9L 5F7MC 3WKPA 1OOAA 3HZVA 4L8JA 2B1AH 2CKBL 3QDAA 2TAAA 3S35H 1EGJA 3CFEB 2IJ0C 3ZYJA 4KRNA 4PDMA 1JZJA 4Y4HB 1UOLA 1TQTA 1NUGA 3EJYC 2Q0AA 3V4PH 5AAWC 1Y7VA 5GRWA 1KJ2B 2NXZB 4TQDA 4HK0B 5EBLB 3H9ZA 3ULSB 2NDGA 4PJHE 3MV9A 1BFOB 3SPCA 4QXGL 1AGFA 3UJJH 2C9VA 3BKCL 3POCA 2EIMB 4KUZL 1ZAGA 2J8UF 3BLBA 1M42A 4CC4C 3PWPB 5DEFA 2R15A 3ZE1B 3KPLA 3R19A 2DBLL 2MCAA 4NQEE 3CFBB 2BIHA 1KG0A 1GXEA 1AOHA 4PJ7E 1HNFA 2XBZA 3WL9B 1FFTB 2WSSG 2LAAA 4MKMA 4F1ZA 5K9KA 3B1UA 4N28A 1C1EH 2WIMA 4HOZA 1CU4H 3M07A 1LWHA 1RUKL 4LESA 1KPUA 1GIGH 1I8AA 4X0NA 3UG4A 1RZ8B 5DVLA 1ZHNA 4L5FH 1NGYB 5HPMB 4L3EB 3I02B 5DJ8B 4GS7C 3CX5F 1UXMA 3LZFH 1HHHB 2C1PB 4HMEA 1OGPA 2YZ8A 4G1EA 1YECH 1DEEA 1I1AD 3UH8A 4BDVA 2ORBH 5JJNB 2CGZA 4YVUA 4M8RA 4YDIH 1TTUA 1FRGH 2K0RA 4XP5H 1AQMA 3O4LD 4JFSA 4ZO7A 5DHYB 1KYOF 3F7YB 4J3XA 1GGIH 1NFDE 2CGNA 5FCSH 5I8CB 5C8YA 5M95B 2R0LL 1JQ0A 3LMJL 4HUNB 3L81A 4UM8A 2OMNA 2NYZA 1OW0C 2UZIL 1XIWB 2FK9A 2BK8A 4H8WH 5K9QI 2XYBA 5CSBA 1CFVL 6FABH 1E28A 1CN4A 1R5VB 3CSGA 1KCKA 1KV3A 1M3IA 1NAML 3QYCA 3WXVL 4P5MB 1OCWH 1OD9A 1NJ9B 4X9HA 4RAVB 2XY1A 4OF3A 1MQKH 3LQMA 4WNSA 2Z1PA 2ZKHH 3N1PC 5DJXA 3UYPB 2HHHB 1VQ8V 1Q0YH 3K8MA 3R7RA 4A2EA 1XSKA 2B08A 4MD0B 3ZO0A 4WFED 1Y74B 1XR9B 3H2QA 3CZLA 2IH3B 3KBHE 2BIPA 2ZKXA 4BRVA 5IQOA 2GYSA 4BWTA 3K71B 4M29A 4M93B 5KS9F 3PV6B 4JI2B 3STLC 3OLIA 1DQML 1HKFA 4E0RA 3P11L 1BIHA 1U97A 2I07B 5JW4N 4FA8A 4KX8A 4PJGB 5EC1B 5T33H 5BS0B 1RERA 4UUJC 3I50H 2E5LB 3NSFA 4N5EC 1DVFA 4UIKL 1GHFH 3LKSA 5GGRB 5I8EB 4HU2A 5CMUA 4J3SA 2IDSA 3HZMB 1QEWA 3H3BC 3KJ6H 3QCVL 4UTAH 2XYCA 2F95B 4WI3A 3HKCB 4ZTPH 4B3MB 3FTGA 1M7UA 3RWHB 5A7BA 3FUFA 4AMKH 3HFML 3NZ8B 6PAZA 2MEJB 5KSUA 1KEGL 1KTLB 4FG0A 3QO1A 3C2AH 3MTRA 3RT3C 4DR5B 4KKAC 2WWOA 4N8CL 3OKEB 3IJHA 1VFOA 5K39A 3VGHA 1AANA 2YI8A 1JV5A 3WD5L 2QWNB 1GRWA 3QIWD 4YAQA 2QGNA 2VO5A 1CGUA 5CR1A 4AQAA 1QBLH 3O3AA 5IJ0B 4DW1A 4G6MH 2XKNB 4UT9H 2YD0A 4EI6A 4XNXH 3EYUL 4CVUA 3IE4A 3V0IA 4UBDC 3L7EB 4PP1D 1W0WA 2FWOA 2VERA 3CFUA 2Q8AL 3GSUA 4I3SH 2HRHA 2IAMD 4JFHD 5E1QA 1KTDB 1O7SA 2CH8A 2Q87A 4PVBA 1E50A 1XOUA 3I55V 4ESKA 2DQEH 3ZHNA 4FTDA 4XX1E 3H4FA 1NT2B 2FJUB 5E6IA 1KTBA 3LB6C 3OAUH 4PD4K 5LAXB 2RMKB 3FT2A 1TO4A 5AZEL 2CRZA 2W0XA 4WI6A 3F84A 4FERA 4U05A 3KW8A 1A7OL 2WC7A 5CMAA 2APXA 2DTMH 5D72L 1BGXL 1CDCA 1A4BA 4K15A 4BGDA 5DSCA 4URKA 4HG4J 2BMKA 3GM0A 5DI8B 2BNQA 2VLKB 5ESQA 4CN1A 5ISZB 1QZNA 2WLKA 3S34L 3ZGIA 4KO7A 4NBZB 2NY4D 1JE6A 2F19H 3HAEH 4K23L 4XAWL 2DIEA 4Y2LA 3UZEA 3ZDXE 2D7NA 2J21A 4UT6H 3CIQA 1T1ZA 3FS9A 5F3BA 4Z7VA 3JD4A 1N4CA 4LEOA 4XOEA 1N32B 3WNJA 3OMIB 3IJ4A 2R83A 2OSWA 3X1NA 1V05A 3QG6A 3ZE2E 3S96A 5JXEA 2RH0A 4P8QA 3NN8B 3CWGA 4XN1A 2A74A 5CCKH 4OZIE 1FYTE 4QJFB 1URZA 2XWTB 2E74C 5H94B 1AD0A 4TNWK 1ZJAA 5CEYB 5IVZB 4ODHH 3QAZC 3L3JA 5CINL 3ZIAG 4JRYB 4LQFL 2GSGB 4M9PA 4FGMA 1GS7A 3HLAB 1J0YA 5T3ZE 3IDIA 3B34A 3RGVB 4X8JA 3OM3B 1MWAB 1M9WA 3MRDB 4JQIA 5SWZD 3DIFA 1UC6A 3HI6H 5FWRA 3BFWA 5CA0B 1QSZA 5E6YA 3UPAA 3PABA 3JZ7A 4ENED 3QZBA 1HWYA 3GK8L 3KYMA 5IEHA 5JW3L 3RFZA 4R8CA 1FVDA 2QQQA 2R29L 3MV7A 4FFWC 1SKVA 1YEFL 2AJ3A 4XCCH 3BAWA 2Q8BH 3CCRV 1X5ZA 1ZTXL 5LYJB 5KVEL 3ABTA 3H4HA 2R2BA 1DCLA 3QI9A 4P9ML 4Y16B 2K7QA 4GAAA 3RWCB 5F9AC 4YX2L 1AGDA 4GBXB 1T2QH 2DWXA 3LZLA 2GK2A 2I9LA 4AXWB 5FF6A 5IW6A 4JTCB 1QQDA 4Y4HD 5TDNA 2WWWA 3PJSA 1PLGH 3L5XH 1U4FA 4LF7O 3B5GA 1YJ9V 5JLZB 4APXB 1XCTB 3NIGF 1KPRB 3CFIC 2LW1A 1J0IA 1CVSC 1U8PB 2HFGL 4KI5F 2YEVB 5E24E 2O4EA 4Z1PA 1QPKA 1RP8A 1E3XA 1KJ3H 4BFIB 5EU5A 5ICXB 1R3HB 4WWKB 1X9LA 1K3EA 1CPYA 4JG1L 1SHSA 1WLHA 1IBKO 4PJAE 5C7ZA 4DVBA 3Q9PA 4S2SB 2B39A 2K3HA 2B20A 5LHIA 3FF7A 3O0RL 4Q2ZA 2NUPB 3VI3E 1Z2GA 2ZUQC 4ODXA 3K0WA 1RL1A 2UY6B 2VRZA 3GSRB 3PJLA 4DQOL 4NZ8A 1U3HD 4HUUB 3QNFA 4N5UA 5IVNA 2BY0A 2Z7YA 3S5YA 2FATH 4XP6H 5FGCE 1OTSC 4NKGB 3BEWB 4DR4B 1NC4A 1UH2A 2MFNA 3ZSSA 3ZYZA 3RKDD 1PQZA 1A7QL 1BJ1J 2D73A 5DD6B 1EVTC 1SQ2N 4PJHB 4AW7A 5BVPH 3TTYA 5JDSB 4PYHA 4QYOB 3CFJB 5E95B 5FECB 2Y0PA 1KB3A 1ZLWH 5DJAA 1PPJH 3OZLA 2W81C 4LGSB 3VFRB 3GSQB 1O9GA 4OJDH 4ETYA 1XIWD 1A7RH 3A0BZ 4NQEB 1CICC 4C55A 1LM8V 4PJ7B 3FHQA 3CWBH 5CZVH 1S2EA 3M1BA 1B0RB 1IQDA 1SHXA 2RB8A 1U92A 3B09A 1M71B 4YHYC 3W9DB 3BHBA 1FZMB 4YGVB 3TXAA 3BSZH 4EI5B 4Z3TA 1LWRA 4LF8O 4J42A 3IBOA 1RZQA 5HPOA 1G9MH 3QZLA 3SGKC 4UB8Z 3APNA 1I7RB 4G6JH 1YEJH 3PWLA 5HDQL 3CBJB 3FUNA 4L9LC 2AABL 5C0ND 1T04B 4OKDA 4TUYB 4I50A 3QQ9D 1HH6A 5F7DA 1NFDB 5K9JL 5IMOB 1BVKA 4C47A 1RVFH 4HKBB 5BS0D 2ADQB 2YEQA 3O4LA 1G7IB 3VG9C 4JG5A 4TSAH 1H0DB 4HW6A 4NO3A 5AG2A 1ZY9A 3HHMA 2J20A 4JHVA 2EDJA 3RTQA 5C07A 3T04D 4WSGA 2C4XA 3QQDB 4DP0X 4HYOA 5J2TB 2H0PA 5E56A 2B5IC 3ME0B 3ASNB 1QEXA 1ES0B 4ANVA 3AAZB 4UQ3A 4EUPA 1CE1H 1PDKA 1VF5B 3EDKA 4G7VL 5CJ8A 2XV3A 1LYQA 5E8NB 4P3DA 2UXGA 3C5ZB 3DLQR 4HC1A 2FCBA 5LMUB 3LH2H 5DMIH 3ZZSA 4ZFGL 3VA2C 1U8OB 1KXQE 2RBLA 3GSOB 1SY6L 4J3TA 3K57A 4X4XA 3P40A 1HEZA 4OLUL 2FECI 1SLVA 1B6DA 2Y7LA 4KJPD 5AW4B 4YK4B 4QY8B 4R7NA 1U8NB 2K9PA 3QWRD 3MV8E 1NGWB 4OGXH 5DD3H 3FPXA 3K08A 3VNZA 1QHTA 3QHZH 3JTTB 4XDKA 4U2ZA 1ZRUA 2QWOB 4MS8D 1MPAH 4ZSOE 1XXDC 2EIKC 1AHWC 1S9XA 4FZEL 1I9JH 1VZIA 1ZXQA 4ILDA 4WV1C 3W38A 2XZAL 2P28B 3BKML 3VW3H 2ZICA 3GTVA 2ITCA 2DN7A 4NT6B 3OEEG 2X6BA 5EF1A 3E3QC 2ENYA 4KK8C 3QUZC 2K1MA 4J9YB 4FTVD 4GEIA 5DO2D 3VXPA 1Z5LB 1V55C 1MSDA 1Z6JT 1OGAD 2N56A 5I76A 4BSVB 5EORL 4Y7OC 2FD6H 3MOQA 2I5YL 3B7RL 2PO6A 1GMGA 1QR8A 2ICCA 3K72B 4QRSA 4ANWA 3REVB 2Z4QA 2XKSA 3N9GL 2Z31C 4TYUA 1KT2A 2VDOH 2OULB 3QDMA 1JPFB 1J9CT 2V5MA 2XIIA 4IMKC 4DR3B 4ZFZA 3R1GL 5KAFZ 3EO0A 1EEUA 3UZVB 3J81N 4KNQA 4HJTA 3JXAA 3KCPA 3DTUB 1R0AL 1Q94B 3THML 1LTXA 4MMYB 5B3JF 4IJ3B 2EH8H 2ZE7A 5E4IA 4Q56A 1W16A 4WK4B 5CGYD 4IIZA 4MJ5A 4E9SA 4NM4H 4ZT1A 4N2GA 3QJHA 5BVJB 1HTYA 4WI2A 2IAMA 5F7AA 1JXGA 1S7RA 1TT6A 3L4VA 5HGHA 3UPCA 4RBPK 4IBZA 1AE6H 3ZUCA 3A0HZ 2XTJC 2XAJA 3PV7A 3WNNA 3O4OB 4DUVA 2NNUA 3L9YA 5HP5A 4ZFOA 2IBBA 1N5YL 2JKSA 3PXHA 1PNDA 3WFEL 4JRYD 4AC4A 5CILL 3T2MA 5D71L 1MRFH 2H2SD 3S3JA 3IB4A 5F89A 2EZPA 3ARFA 4O9HH 3EFOA 5HGAA 2X1XR 3G7TA 4ZPTB 1D5AA 2GC7C 4YHHB 4KNUA 5JA8B 1MHHA 3DPBA 1YNLH 4MXQD 4AWJC 4JZJC 4JS7A 4YFEA 4W9LC 1K5WA 1YEHL 3MGAA 3RYCA 4L4VE 1GGTA 1HX0A 3IJEB 3PL6C 1KOAA 1E79G 1JXJA 3IRPX 3P2TA 5I18H 1LK3L 2Y07H 3ZE2B 1MY5A 5FS5A 2HEPA 3SQBB 1RK1A 5TE7L 4AKOA 1OF2A 1FYTB 4JI8B 5DRWA 1ETA1 2R4RH 4U3XA 3UTPD 1CBVL 1YI2V 5EDXA 4AMWA 5I75C 4G43B 1U8IB 4Z7UA 3D0VA 3QJFB 4QKTA 4MW8A 1QYGL 5TFSH 4YXHH 1QFOA 4GRWH 5CBFA 1ZT4B 3D12B 3VUAA 1ZT1B 1ZTXE 3B4NA 5TDOB 1BF8A 5KVEE 1BG9A 4NN7B 4WJKB 4NQVB 2ZPKH 2XC8A 4J3OH 4N8VG 1SJHB 3K5MA 3O6LH 2P4KA 2DQGL 1U3ZA 4XVTH 5JMOC 1OHHG 3RGBA 1F56A 1M2VB 5AW7B 1EZVH 4GX5A 2YBRB 3ILQD 3BUDA 5SWZA 1OD7A 1BHAA 1II4E 3ZJZA 5KHJA 5E9AA 1KCRH 3PU7A 4KX9A 4X20B 1FDLH 1MLBB 3WO4C 3BRGC 1SRDA 3NJLA 4FCHA 4GQPH 2OAAA 3LXCA 4WY7H 3H9SE 3D85A 2JB6B 2L04A 4IRSA 4P5TA 3GB7B 5HYSA 1OTUC 2BSKB 4L8DA 4MQ7A 3D3IA 4Y4FD 3TTSA 2B4CH 3SIKA 2OMTB 3T1HB 3CH8A 3GXIA 4MXWH 3CFEA 4J10A 4XBEL 4L8SC 5LXTB 4JI5B 1M1KW 2OWOA 4Y4HA 1HOCB 1IKFL 1OAQH 1ZUQA 2CKBB 1W0KG 3BKYH 2NY5H 3BPOB 2RD0A 2XA8L 1A47A 4IHOB 1VEPA 1KJ2A 4HK0A 5EBLA 3ULSA 1HYSC 2XTLA 1KBKA 3B2XA 5AWNH 1BFOA 1RJZB 3V79C 3AS1A 4OFKA 2B8OT 3TJHC 5C9KA 3GRGA 3PWPA 4QHNB 5LMNO 3U9UB 1XGYL 3CVHL 1UJWB 3VI3B 2CDGA 2JB5H 4AIEA 1UVQB 4XOCA