3JYCA

Crystal structure of the eukaryotic strong inward-rectifier k+ channel kir2.2 at 3.1 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
330
structure length
321
Chain Sequence
NRFVKKNGQCNVEFTNMDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the eukaryotic strong inward-rectifier K+ channel Kir2.2 at 3.1 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 73
structure length 321
sequence length 330
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3jycA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3jycA01
2P7TC 4XDJA 4PDMA 3AT8A 3F7VC 4RUFA 2QTOA 2WLMA 3LNMB 5E1AC 2WLLA 3LDEA 1U4EA 1ORQC 4HYOA 2EINC 3E8BA 5CBHA 3T1CA 4J9YB 2EIKC 2EILC 5IY5C 1M56C 1U4FA 2YEVA 3LDDA 3ASOC 4PDRA 4MS2A 2R9RB 3IGAC 3R65A 3EFFK 4J9ZB 4QE7A 2DWDC 3AG3C 4R8CA 5J9PC 2H8PC 5B1AC 2ITCC 3VOUA 4R50A 2W0FC 3AG1C 3LDCA 3E89A 1QLEC 4HZ3A 2NLJC 4XDLA 1S5HC 4P9OA 3AUWB 4RAIA 2HJFC 2WLLB 2Q6AA 1ZWIC 5B3SC 2Q68A 3ATDA 1JVMA 2DWEC 2ITDC 1V55C 3K06A 1G4YB 4UUJC 1J95A 3RVYA 3ABLC 5KUKA 4F4LA 3GB7C 4PA7A 2OCCC 2AHYA 5EBMC 4MTGA 3SYCA 4GX5A 4BW5A 2A0LA 3RW0A 4PA3A 4WFEA 2WLHA 4X88A 1R3IC 2HVKC 3E8FA 3ATFA 3K0DA 4RO2A 4KFMA 4MVRA 1M57C 3ABMC 4TWKA 3RVZA 3TETA 3OUSA 4PA6A 3T2MA 1OCCC 3VSQA 2HVJC 3E86A 3SPHA 4G27B 2A79B 3ZJZA 4X89A 3BEHA 3AG4C 3LUTB 3UKMA 2DYRC 4X8AA 3STLC 4ZBMA 3K08A 4WFGA 5EBWC 5CBGA 1KKDA 1R3KC 3OR7C 5BZBA 3F7YC 3KG2A 1P7BA 5EC2C 2E4FA 4PDLA 4P2ZA 3TCUA 5EBLC 5CBFA 4RUEA 2HFEC 4P30A 1OCZC 4MW8A 4XDKA 4EKWA 3E8HA 2KB1A 3AG2C 2WLIA 3ABKC 3JYCA 4OXSA 3UM7A 3AGWA 3SYQA 3RBZA 3E8GA 3F5WC 4MSWC 2GIXA 2Y69C 4CBCA 3SJQC 3X2QC 2EIJC 4JTAB 3ATAA 2A9HA 1BL8A 3SPJA 3SYPA 4LBEC 3PJSK 4H37A 1V54C 5B1BC 1K4CC 4MTOA 2DYSC 3K6NA 3OR6C 4MTFA 2AHZA 1XL6A 2WLNA 3SPCA 3ASNC 4DXWA 2QKSA 2ATKC 2IH3C 2X6BA 3OGCC 4H33A 4PDVA 3ATBA 1R3LC 4MW3A 3SPIA 4PA9A 3IFXA 3SYAA 3OUFA 4QE9A 2IH1C 2X6CA 2BOBC 2HG5C 4G28B 3HPLC 4GX0A 1N9PA 2JK5C 3E83A 4I9WA 4GX2A 3K0GA 4MVMA 3T4ZA 3ZRSA 2ZD9A 4MVSA 5EK0A 3FB7C 4P9PA 4R6ZA 4R7CA 3T4DA 4LCUC 5KUMA 1OCOC 4WFFA 2WLJA 3FB6C 2Q69A 4LP8A 3WG7C 2WLKA 1R3JC 4JTDB 4MVUA 4GX1A 2WLIB 3AT9A 3K04A 3ATEA 3K03A 4MVOA 3STZC 4WFHA 4QNHB 4PA4A 4MVZA 1OCRC 3SPGA 2EIMC 1XL4A 1K4DC 2BOCC 2X6AA 1LNQA 3SYOA 2K1EA 3FB5C 5EC1C 2Q67A 4MVQA 3FB8C 4JTCB 2ZXWC
chains in the Genus database with same CATH superfamily
3AWGA 5AQ0A 2Y22A 1CMOA 2XHBA 4G8EA 1T4KB 1TQVA 4QOKA 5IKCA 4KVCL 5I1LA 5CZVH 3VE0B 5KMGA 3D09A 1KLFB 3JZ7A 5IWAB 1N6VA 2KZ1B 1D5MB 3APQA 5J57B 5JHDA 1DVSA 4K71B 4EVNA 2EVHA 1HXMA 1T1XA 4LCCA 4PSPA 5FM8A 3S4SA 2OK0H 3LSOB 5J9PC 1WFOA 3DV4B 2XTJB 1WWAX 1AQHA 4PG9B 4W6WB 3DIVA 3MRJB 2FE0A 3BAJA 3E80A 3B56A 5JOFA 3QNFA 3TBTA 4YHLL 4UUJA 2DWEB 4B9PA 4AIZA 2V17L 2VRAA 5EO1B 2C9AA 1JP5A 3DUSB 4OLZL 5CM1A 4G7YL 1OAYH 1RZGB 2ZOKA 1R3IH 4X7TA 4L2YA 2IGFH 4YAQA 3CFCH 4QPJA 1WAAE 5B3JF 3LQAH 5EIBC 3VD5A 4DPBX 2R56H 3OR6A 4BGDA 3QFJA 4GUQA 2R0ZL 3BEHA 1CF1A 4I0XA 3FB6A 2PP8A 3QE5A 2PI5A 3EW3B 4MJ6B 1HL4A 5D2NB 3WIIH 2R9AA 1T1YA 5C0JB 1UATA 3FO9B 4WUKH 3BIKA 3WLBA 3ASOB 3G5ZB 5FYJU 1SN0A 5HHQA 4P2ZA 1CYGA 3DHMA 3Q9QA 3GSVB 3IJHB 5GONA 4FI8A 4UAOC 1B4JH 2XXGA 5D1QA 3TEXA 1D5ZB 1C1EL 1QD0A 1JFQH 1SEQH 2EYRA 1TU2B 3B2UD 1T2QH 3TO4C 1DUYB 1QSVA 4XXDA 4PCYA 5DWPA 2ATAA 3IDXL 5B1AB 5I16A 1ZHBB 1FPOA 2HA1A 5TQ2L 1RIUH 3P0VH 1H0DA 4K0KO 3SIKA 2E3CA 4ICWA 1U95A 3RZCA 2CALA 3K9AA 3B4NA 4MZ2A 3SE4C 3X17A 2Z1KA 5F7EL 3B7YA 5SWZE 1XR8A 5H35A 1MCJA 4ZUTA 4Q6IB 4PJIE 1WCBA 4GQZA 4KJWC 4XPAH 4L4VE 4NRYB 4YHML 2OR8A 4R6ZA 3RU8L 4R7CA 3O6LL 1AD0A 1C12B 3VXUD 1KJ2A 3QUML 3L9RA 4LF3A 3IK2A 3I9AA 4Y5VB 4KMTH 2XUMA 5IWLA 3MACL 1CICB 5D71H 5AUMB 4U1NA 3W81A 5DZVA 2WOYA 4Z0BH 3MNMA 3S5YA 2IJKA 5DMKB 3M99B 2FEJA 2VABB 4L8DB 2WKOF 4JFDA 3H0TB 3QQ4A 4PJFB 5K9JH 2OSLA 4QTFA 1AJQA 1QTYT 4IRSA 1LWJA 2OJEA 2AJ3A 4H26A 2YAFA 4TQHA 5BJTB 2OMNA 1SJEA 2M1KA 2XVKA 3MO1A 1R3KB 2UU9O 1CR9H 3WI9A 4EZMA 4BFOA 5H94A 1F6AA 2UUDH 5L6YH 1TQCC 1AQDA 3A6BL 5HBBA 1PDKA 2V33A 3UPCA 2OXHA 1R3JB 1JA8A 1V05A 3UX9B 2PYFB 1R0AH 1KB5B 4UVAA 3VG9C 4XWOC 2P42B 4JS7A 3KGSA 2F19L 2Z35A 2ZD0A 4P06A 5D7LE 2PMZA 4ODTH 4GYCB 2KI6A 4M5SA 3TLRA 4DW1A 3UBGA 1OVZA 1JWUB 1LDSA 5IVZA 2DW4A 1WBZB 3T2LA 3MLSL 2FYYA 1JSYA 3TEZA 6PAZA 3MRCB 1RAMA 4DYLA 2QSQA 2H6PB 1F0LA 5HHVH 1EFXA 1G7MA 3I02B 3PWPE 2BIHA 3U6RA 4IMKC 5CCKL 4JR9H 1D9KA 4K55A 2AEQH 4YPGA 3K0DA 1S7VA 3RGVA 5AW3B 3WE6B 1M5IA 2XKUA 2YC0A 4FPPA 1B06A 2CGYA 4MDJB 5GRWA 1GGUA 3L3IA 5ESAA 1NLBH 4QOKD 3U7WH 8CGTA 4DAGH 2Y0IA 1PVHA 4X0KB 3DXAD 4CSPA 4GRLB 1S78C 3IJ9A 4LP4A 3LEVL 5LBSA 1P7QB 2YFOA 3CCLV 1DUZB 2X89D 3CC5B 3RB5A 2GYSA 4U1JB 1KYUA 4JG1H 1ZGLP 3PXHA 2Y6SC 1CDBA 4FG6C 2C1PA 3MBXL 4XDKA 4J3OG 1XI1A 1T4WA 3U30C 3RJDA 4ANUA 2XCMC 5AYTA 4CMMB 1J5IA 3EFDL 3RBZA 2HTKC 2VZTA 5A1AA 2YFNA 4YC2C 4J3VA 3HZVB 5J11B 5D9SA 2CGRH 2JI1A 3KBPA 1HYSD 1JZIA 2NW3B 3D9AL 4TLSA 1RUPL 4WK2B 1USQA 4MJID 1NBQA 4PRPD 4O51B 1ZKAA 4JKWA 12E8L 4N28A 3SOBH 1PKQB 2VDML 4HWZB 2P24A 4F7MA 3O11B 3FOMB 3NTCH 2QELA 3T6VA 1Z9OA 4LAJH 1P84F 4OIAA 1NFDF 1TEGA 2B39A 4HJ0C 3C6LA 2R8SH 5K39A 3CU1A 4NI3A 2G4EA 4HALA 5A16A 1VMGA 2ZD9A 1DR9A 1J8HB 2LVEA 3VI3F 3FQTB 2L8AA 3EVKA 5LBVA 5E2TL 5JXAL 1BQUA 4FQ1H 2H32H 2HFEB 5EU5B 2NZ9C 4YZWA 3SY0B 1EFRG 1VA9A 3LHPL 1ED3A 2FL5B 2N56A 3QDJB 4FFZH 4OLVL 4WAFA 3MNVB 4Y5XC 3ATEA 4J3OF 2VDLB 2GV9A 2ZCKH 3GMMA 5GGTA 1AMXA 3VWKC 4FYQA 3LDBC 4GKZB 1NKDA 5JVDA 4LLDB 4PBXA 1FLTX 4LCIH 1BQHG 4GRMB 4ZIBA 2JFCA 1B0RA 4AX3A 5KVGH 3N1MC 1U8KA 1AQ8A 1A7RL 5CEZL 4OLYH 3ZE1F 4ACPA 4J42A 4RX4A 2WWOA 1YEHL 4U1NB 5JNYB 4J3SA 3OQ3B 1P5UC 1MWOA 3WFCL 4YDLB 1U4EA 2NZ9D 4JPVH 5DZLA 3HNVH 3TCLB 4BR6A 4H20L 2IDCA 1SY6L 3P3PA 2PTVA 3FZUC 4JL2A 4MD4B 4YE0A 4F7TB 3GTNA 4M5YL 2FO8A 1XF2A 1M9SA 1OE3A 1OGTA 5E0FA 3GJEB 3GSXB 4JZNB 1K4CA 3OZ9H 3QQ9D 2ITCC 3E9TA 4P9ML 2ZQMA 1YG9A 3BHBB 3SBPA 5L2KD 5KSBA 3BSGA 1TNMA 3QR2A 3GQFA 4JFHD 2YMTA 2GTZA 1CDIA 5CFAA 2XWJA 2EZPA 2ED6A 4CA4A 4LOUC 1MI5E 2X9XA 3D18B 2IFFL 4R4FH 3BPCA 3QI9B 1B0GA 3GO1L 3S3WA 2Z93B 1BMGA 3IJHA 1IMHC 4W9KC 3VFTB 1S9KC 1AI4A 3BW9B 3KPSB 3N1QC 4PY8J 2UWEB 5ANHA 5FHAH 5AB2A 2UUBO 1KZQA 1OAUH 5HFMA 2NY4D 2J73A 2W60A 1AS8A 5I1GL 4X4ME 1I82A 1N2RB 1XTLA 5KX5B 2BNUA 1S5IL 1MREH 5KYXA 5FKPB 1E6OH 3TNNB 3N9GH 1MI5B 4NZ8A 2PR9A 4P57A 1KY6A 3OKNB 3GI9L 3SO3B 3IVKB 3O3DB 4GEJA 6FABL 5J2UB 4NQXB 4UCRA 1VFBB 1AFVL 2VCOA 2EIJC 4JRFA 3SQOH 3TGUH 4MJ5A 3PJSK 3ZZSA 1J10A 5T3XD 1FJ1A 4LGSB 2Z31B 3M7MX 2WAQA 1GKOA 2OI9C 2E86A 1N3NA 5EIQA 3MRIB 4W9ZA 4P48A 2QDWA 3OC5A 3NJVA 1CFSB 1MVFA 3MD0A 4LF5B 1ORSB 3ESPA 3HRZA 4NTXA 2H1PL 2Q7NA 2QWOB 4OI8A 3T0BA 2DQ3A 1SQGA 1KXVA 3UQ8A 1DBMH 3MJ9A 4L3CB 1JYNA 4PRHB 3V4VH 4JCWA 2GBAA 3HKZA 1MHHB 4TKWA 4JLRB 2Q7EA 2CPUA 5E8PB 4HKXB 4B3MB 2R9IA 3MCLL 4PJXE 4ADGA 1J0ZA 1EO5A 2Q2LA 2EVIA 3LN9A 5FFLA 4MNQD 4YHZL 1NCBH 3RTLA 2EDXA 4WGKA 5DUPH 2BOCC 4Y16A 4XR8C 1YEGL 2Z9TA 3W39B 5IR1A 1WNSA 1YLBB 5D6DC 4M6ML 2RR3A 2WBJC 4I89A 3NZ8A 1DTOA 1QBLH 4R7DA 3AT8A 4M7LT 4RUFA 5EU4B 2R0KL 4HOXA 1YAZA 1SERA 1DQVA 5E79Z 5JCOC 1ZA6B 1TMQA 4WWKB 1QPPA 4IKKA 4Z8FL 1S8DB 3DVNA 3P2DA 1D5NA 2Q7YA 1I94B 4IJ3C 4WI8A 1N3NB 3GMOB 2OMXA 1R3HA 5GXBB 1KLUB 2OTWA 2XWTA 1G4RA 1P4LA 4HD5A 1CGUA 2JCCB 1R9FA 3DURB 1OSPL 1A4JA 1LD9A 1H3PL 4G70B 4S1SL 4UT7L 3MJ9L 4KKBD 3BRDA 4HWEL 4JHAL 4GG8A 4HUWA 5B3SC 4OCWL 1ZY9A 4A38A 5IB3A 1MI5A 4GMTH 4KX9A 3LKSB 4PH8A 1JD7A 4Z77B 1GN2A 4EB6B 3UAFA 2XNAB 2BNRD 3OAWA 4GBXD 2YUAA 3FOLB 1JV2B 3ZKNC 3DWTA 3B3BA 3CFUA 5JTWA 5EDSA 2XQYK 5EN2A 1WB7A 1RSYA 1BAFH 3DURA 2FJSA 3KPMA 4JDEA 5EZYB 2I5YL 2XPYA 2CLZA 2VB5A 4JZJB 2YLHA 1DHKA 2C9VA 4AV4A 1G0XA 4EUPH 4X50A 1TZGL 1AXSB 3V9CA 4GAYA 3HOGA 3LRGA 3NJMA 4NKOA 3VG9B 1DLHA 4BK8A 2DM7A 2YGQA 1M6OB 3VQ2C 1G6RL 2MFNA 4DK3A 4WW2A 2WPGA 3WNOA 1HEJC 1Y6XA 1EZUA 2NR5A 2XWJB 3KL5A 4R7DB 3EG9A 2NY5L 5AENA 3ZRWA 4FZEL 1GC1L 4J3OC 4IIQB 3ML8A 4HIQA 4DR5O 4KBPA 1A14H 3M1OA 3IU3B 4WFGD 1QNZL 2FLMA 2F7OA 5ITFB 2RH0A 5B3SB 4X6BB 2OMUB 3RZWA 5DSCA 1LP9B 4GP8B 1A6PA 3WE1A 1KBGL 4L2LA 5DJ2A 4KJQD 2ZONA 4P3CH 4APQA 3HR5B 4OJCA 4B7KA 3KPNA 2O6FA 3U9UB 4LO9A 5L8JB 4ZUUA 1Z2KA 1V54B 2ZXBA 1NBMG 2G2NA 3OHXB 4JLRA 1FIGL 5KBLA 3L1FA 2RCVA 3BKYH 3C60C 1KPRA 3J8F7 4B41A 3RGVD 1YZZA 5BS0A 4MS6A 4AL8L 1H3UA 2HUHA 4R7NB 4RFOH 4KXRA 1Q38A 3S37H 2NQCA 4JREC 1Q82W 2BJMH 2ZR2A 1ZEAL 2YGNA 3SPVB 1FDLL 1NEPA 2WP3O 4LIQL 2BLFA 2IPUG 3T71A 5ID0A 4U1HB 1NAML 2BP8B 4UXNA 1CK0H 5IMMA 5JA9A 1YNTF 1IFGA 5DHYA 1DQDH 1FYTE 2JQZA 4X2UA 4LRIC 4P9HC 1F4XL 5D4IA 2DBJA 3G5XB 3MNVA 4PJDB 2VQUA 5FW7A 1Q5OA 2UXDO 1IAIH 3MRFA 4Z7QE 3CTTA 5HDQH 1T89A 2DMHA 3ZIYA 5E9NA 1SZNA 3L4TA 1JNHB 3QUZB 3MGTA 1TITA 2QVMA 3FT4A 4DO6A 3FFCB 5I6OA 3RG1C 2E56A 1MHPL 2KQXA 3ASOC 3PGDB 2QHRH 4OLEA 3B3IA 4R7VA 2YARA 4X1KB 4BK4A 2W60B 4GKJO 4MQ7B 3KPPB 2J25A 4YHIB 4ZFFA 3UG4A 1MCEA 4Y4KA 2GUYA 3LKSA 1HE8A 4BFEA 4RQEA 4ZSOB 5G5DA 4N2HA 4NO2B 4PBVC 5M94B 3U7YL 3KDMB 2YRPA 1OHHG 4JHWL 2CTWA 2LU3A 4GX5A 4G6MH 4KZEL 2GTQA 4GO8A 4OT1H 4BIUA 3PUUA 5C86A 3MGAA 2ZX5A 1C5BH 4RMBA 3V0WL 1HIMH 3CP1A 4JGJA 3V6BR 1CDGA 4I4TA 1BIIB 3ZX6A 1R24A 4JE4B 5HHOA 4YDLC 3FRPG 5I1GH 1K4CB 5EO9B 1A6WL 3L7FA 2IWFA 4G11A 2JKLA 2FD6H 1YPZF 5D7IB 2WVVA 4G9FD 4MJJA 4GQRA 4LMQI 4WNJA 4XPFH 1VDGA 5J6HB 2J6EA 4CC1A 4HQQH 1EFXB 3QAQA 5BMFH 5A2LH 2WLIA 4PJ5B 3B7TA 4PGDA 3ULAB 5KANI 3ZMNA 4KGLA 1YVLA 4ZOBA 3TH4T 4D7PA 5IBTH 2WYHA 1KGWA 3LPPA 4KO9A 3A4DA 3M8AA 2FX8L 1S7XB 2Z8RA 4HIPA 3W7SA 3MX0A 4OM1H 2X6UA 3IXTB 3HLAA 3VBBA 2Q3XA 2XN9B 1YJDL 5DJCA 4L3CA 5E6ID 2HFEA 5BXFA 2BWQA 2D0FA 1T20B 5D7KE 2R56L 1T1ZA 3MA7B 1HSBA 4PWJA 3CB2A 2R0ZH 4Z7IA 2AJZB 3FSZA 3QPQC 1PFOA 5I74B 5CP7B 4P2QB 1WA8B 4O2EA 1NGYA 1T89C 5CJQH 1DVUA 2WNKA 2VOTA 3FFCA 5D96C 5BOJA 2J88H 3L2LA 4M43H 1TGOA 2KUTA 1JYVA 4DWHA 5D5QA 4PJFA 5DK2A 4QJFB 3RPIB 5F6IC 1A6TA 1XSJA 3IGAB 1I8AA 5CN2A 4EOWH 3OLGA 5TD4A 1XV8A 1VFAB 2KC0A 1E28B 1B88A 2IGLA 4QO1B 4FABH 5JYLA 4G1EA 5EC1C 3HUJE 5EEWA 3K5OA 4DR6O 5I1IL 4U3JB 4B97A 3MRDA 4WDIA 4OGQC 5IOKA 1JUFA 2PYEE 4OX9B 4OGAC 4TNGA 4PIRF 5DHYB 3SD5A 3VDBA 2YSSA 4GW5A 5DYOA 4H8UA 1UH3A 3VUAA 5ID0B 2V1DA 5MI0C 3RYIA 1F51A 2NN4A 1IFHL 2XG4B 4GAJH 4N0UE 4QRTA 1AGCB 5DO2D 4TNVF 3HI5L 5F7YC 5J6GB 3RE0A 1WB8A 1FZOA 2DYPB 4Y16C 3T6WA 2HJKB 4R3SA 4Z7WB 5ELIA 4LC1A 2QM4A 2D7TL 3ULVE 3R1GH 3ETDA 1HXYB 4ERSH 5I18H 3WUWB 1YMHB 1KFAH 3QI9A 1VKXB 2LGWA 1UZ6F 1S7SA 1TTGA 5HDBB 3RPKA 3F5WA 4JM2F 5LKNA 2E7CA 1WS8A 2PCYA 2WXRA 3APDA 3RIFK 4P23A 1NCHA 4JG9A 1D9KB 2VR5A 3ISWA 1XMQO 1Z9SB 5EO0A 1KTBA 4YBLC 3TZVD 1H5BC 2UXFA 2ZF9A 3DX7A 5JO5B 3FUEA 1DVQA 4RGNB 4ZAKC 5F6IB 4XCCL 3VU1A 1MFBH 3CAFA 3QRBA 4JZNA 2HMID 3QXDB 3IEAA 4AGMA 3SY6A 1Q6IA 4YXKH 1ZWIB 4C59B 4PA6A 1DLHB 1PQZA 3OE7G 3AG3B 1N0NA 2KYIA 1E5UI 2A83B 3CHRA 3F7RA 1NU1H 2UZPA 3W82A 2HJLA 1CYWA 2BM3A 4YHNB 1ROPA 5JCOA 4W9CC 1A4KA 3QW9A 4ZQKA 4HYTB 5E1QA 4Z95H 1AI5A 2CUGA 5GGSA 1MLCB 2FSEB 2OSYA 3B9KD 3OWEA 1M1XA 2J7LA 3DTDA 4PRAA 5F2VO 1VEPA 3I6GA 1NDGA 2CIIB 1HCYA 3QJFA 4X6FA 3SOTA 3FOLA 3IAQA 2ZAIA 1MCWM 3AG7A 2YIBD 2V3DA 3BLKA 3MRJA 4EDWH 3Q06A 3QC6X 1U8NA 2WKLA 5DMKA 1L9RA 3T0EE 4CS2A 3TPUA 3OLIA 1W80A 4E9QA 4OKVB 1T1ZB 4MB4A 3IMVA 4UU9B 2ICWB 5LBQA 1NAKH 1TR7A 2XV6B 2A6JB 3NIDB 4PJCA 4TV3A 2DQ0A 5F70A 4Y5VA 4H1LB 1F3DJ 3HS8A 1A6VL 2UV3A 3K6OA 2HJLB 1C12A 4RA0C 1TJIH 2NMSA 2EJ7A 1KLUA 3BESR 4YHLH 5EBMB 1S7XA 1PQZB 1T4KA 3U7WL 1FFOA 5KAQG 3Q8CA 1XR8B 4LCUC 4TUJB 5D2LE 1XGUB 2C7UB 1OAYL 2EJ1A 2FLRT 1T7YA 3GLZA 4JO1H 2WLIB 3QG7L 1XIWB 2FSDA 5AD0A 3UTOA 5EU4A 2FTAA 3ZO0A 4U7NA 1XSIA 4FLUA 1OCWL 3F12A 1FV1B 3HHRB 2A2QT 5FM4A 3QO5A 2ADIB 5JQIB 1CICD 3QVNA 3U9PL 3O2DA 4HV8A 1TZAA 1GZPA 4BRVA 4X98A 3L3KA 1F18A 2XG5B 2ZYHA 1ZTXH 3FU9A 4AMXA 2A9NH 5CNHA 4OSUL 4I1NB 4AIEA 3KPRB 2AXFA 3LKPA 1LO4H 3TJHD 3BDBA 1UM4L 4J7KA 1L8DA 2B16A 3AB0C 3G7TA 3JVFC 3VXSB 4R26H 4BE6A 5BRPA 1CZ8L 5J3HC 4GW5B 5DYOB 3KDMA 1N8OE 1P4BL 3WXVH 3GS4A 3DXRB 5JXAH 3MRDB 1OP9A 1KACB 2GW5A 5CLZA 4AVIA 5IBLD 2PETA 4CS4A 5CZKA 4AVHA 4FFZL 5E6SB 3W11C 2NNRA 2Q6AA 1EDHA 1UJ3A 3GNML 5EF2A 3DMMC 3ZY7A 3ET9F 2YZ1A 2WSDA 1WH0A 5DRWA 1VQ7V 3RWEB 4FS0A 1G1XB 3EZJB 3FUIA 4KK6C 3QUXB 4MKMA 1MWAL 5SX5H 3IJEB 3AREC 5D4QA 4F15C 5EEZA 3IE9A 2QKIB 2XN9E 1LEKB 1M7UA 1JJOA 1VACA 4H8PA 3WS3B 2GY5A 3VSVA 4HEPG 3O6MH 3JV6A 3ESOA 3Q1SH 1I1FB 2FO1A 4W6YB 4HC1L 2F7IA 3GMLB 2PW2A 5E8NB 5HHXL 4TSCH 5AVQB 4PJBE 1HI6B 2R4SL 2WWKO 1X5AA 2LAGB 2NZIA 2RGSA 1FIEA 1NMCB 2E74B 3F6LA 2NY2C 4F33B 4PD4J 3FSWA 4MRCA 3QQ4B 1FVCB 4CUCA 4PMEA 3VGFA 2A3TA 4PW4A 5AW4B 4BWAA 3L13A 3SQRA 2EUWA 2P8MB 4NO3B 2ZR3A 1PGRB 2BIOA 2C34A 3WJMB 5TE6H 2F8VA 4OJAA 3B7RL 2NT1A 1ORQB 1OLLA 3VI3A 4GQPH 5D72L 2NR6D 4IEFA 2XWBB 1FVEB 2DZEA 2AXGA 1XHZA 3FQWA 3HZMB 5I17A 4WWKC 1RUML 4H33A 2WANA 2Q1EA 2WYIA 4WFAV 4MAYA 4QRSB 1W91A 4RMRA 1G7HB 1I7UA 3LNDA 4F15B 1H2LA 3JWOH 5EUKA 5D7JD 1JPFB 4LVHB 1IAKB 1SQXH 1DZ0A 3SBRA 1HHGB 1JZ2A 4P9PA 4LCUB 5LL6Y 5HHVL 4BSWA 2DS4A 3F3HA 4LFCB 1AGBB 2GY7B 4HCGA 4KVPA 3SZKC 4IYHA 2C3GA 3ZIAG 1VGEH 1PNKA 3ARUA 5LP6A 2F95B 1A7PH 3IAPA 2XWBA 2Q8AL 4J23A 4ODVH 4QD2E 4WFHE 4IS6A 1MFEL 3K0WA 4DV6B 1GMIA 2WXGA 3ARDD 4N2CA 4MX7A 1HOCB 1QLFA 2WGNB 4K5LA 4FFVC 4NKOB 4ZBJA 5C8YB 5J3HD 1FVCA 3CLEH 3D05A 3D69A 1FKAO 2B5IB 1YMMA 4LGRB 1I85A 4DAGL 4EBQH 4M7LL 4LLDA 4LESA 3NACL 5SWZB 1KJ2H 2VN3A 2NNXA 3MRGA 1S9WB 4L3EB 4UINH 2R70A 2ZIDA 1ORQC 3LQMA 1LK3L 3M45A 5E8NA 5EBWA 2C5DC 3WIFB 3OXSB 5E8EB 5AVYB 4ILDA 5I9QC 4K71C 2VDOB 4FK5C 2UX6A 3BVUA 3BC9A 3RFZA 5I0ZA 1XDCA 1C5CL 4R90H 4PRHE 4DK1A 2DQIL 1CQKA 3WFHB 4D0BA 4L5FL 1LUWA 1BGXH 3DDFA 2Q8VA 4LU5H 3JQOB 5ETUB 5LG6A 2VDMH 3FUNA 5E4IA 3W1ZA 4TQIA 3ZUNC 4XPBL 3LNEA 4ZO7A 5GTIZ 4U1SA 4GG6A 1OCRB 1IQDA 2RTTA 4DGYH 2WWMC 5IMMB 4OH2A 2O5YL 2VIRB 1RZ8B 2VDLL 1BFOA 3AAZB 2IF7A 4DKAA 1KGYE 1N12A 1P4IH 4WWKA 4NT6A 3AY2A 5JHDB 5FPRA 4WFFD 3C09C 3VXSA 2YAHA 4JKLA 3DMMD 4UIKH 4ZW7A 2MSPA 1BE3H 1VGKB 4NZDA 5AL8A 3RGVC 3HHMA 5HJBA 3TXQA 1QUNB 4WRLA 5A9GA 1GS6X 5I9QB 4EFBA 1UD3A 1QFWH 2P49B 5DJXB 2DQCL 3A0HZ 2ZX8A 3CDCA 3GZPA 4JYAO 5AVSB 3PU7A 5IEHA 2K6ZA 4FTDA 2D03H 2ZOUA 3FU8A 1KYDA 2FJGA 1SFDA 5CMAB 1P7KA 2Y06H 1FCCA 1NCWH 2X4SA 3QQ3A 3RHWK 4WUUA 4DO4A 2EUVA 1U8HB 5DJZA 4FN0A 1P53A 3RY6A 3V9EA 4KDTA 2VDOL 5GRUL 3VWJB 5JHDE 4PJHF 3VYPA 1IQWL 3QHFH 4U4IA 5I5IA 4AKPA 5FX3A 2NY1C 3H4FA 4Q56A 3GUTA 3UZQA 2ARWA 2BP0B 2E6QA 2X2UA 4TRPH 4TUJA 1GVIA 2K3TA 4OUOA 3IJYB 4P9MH 1D5RA 2WCGA 4PJCF 4Y2NA 1JQ0A 1WEJH 3U6XS 2DQTL 4P5KB 2Z35B 4ZTEA 4KO6A 1G1KA 4YLBA 1SOSA 3HG0A 3MUGA 1JNLH 2NYKA 1W8OA 2X1WL 4R97C 1GM8A 4H1LA 3WV0A 4KKZA 3BKJL 1GPOL 4XNQA 1U3HB 2KMWA 5L8KB 5KHHA 1PDKB 3NSFA 5IFHL 3EYSH 4LBAA 1N0XH 1BF8A 2HHHB 4PJEE 4PRID 1AANA 4RBPK 5A3ID 5BZDB 4GS7B 3L6FA 3U4AA 5TH2B 2R23B 3MQIA 1CB4A 4H26B 1OAUL 5IROD 3STBA 4DP7X 4LQFL 4YXLH 1JXKA 3AEIA 5C6WH 3K6DA 1JPSH 3WMQA 1IKFH 1NKRA 4F8PA 5E70A 1RPUA 3CCHA 3KGUA 4FYRA 4M9OA 3DOSB 5KS9E 1CL7I 3IT8D 3NABL 5LQBL 1H3XA 2K45A 4U3FH 3IFLL 2OTWB 2XWTB 4XMPH 4R5VA 1OM3H 2ZYRA 4N2NA 1NC4A 3GMOA 1MIEL 3KPSA 5FO7B 4Q89A 2ZYIA 3WTYA 2Z93A 5DD3L 3VXUB 3SE4A 1B0GB 4MX7B 4IJ3B 5ESQA 5CBEB 1PZAA 4DF9A 3IWVA 4PG2A 1ZK9A 3LNHA 4NO5A 4TF4A 4WUUB 1T7XA 1XEDA 2Y4UA 3ZL4L 2IADA 4XI5C 1PSKH 3ASWA 4Z7UB 2YBGA 3K91A 4NM8H 4ANVA 3DX1A 1E7VA 4A5UB 4PRPE 4OQTL 4OF7A 4H8HA 1J95A 5IROA 1KMGA 5KUKA 2ZOOA 2VE6A 3WMSA 3OFNG 3NIFF 3IGFA 3QFDA 3WN5B 1OANA 2CIKB 4NZTH 4FA7B 4ZMYA 5DVPA 4ES9A 4TOIA 2NSQA 2AXGB 1US6A 1XSKA 2XQ0A 3FQWB 5E2VH 2XPGA 3BPOB 5C3TA 5I17B 3VI3B 3H2WA 4YEEA 3MV9E 1JTPA 3WJMA 2FBOJ 1OAXH 2E5LO 2PO6C 3VRJB 4FZ0A 1F02I 5CBGA 1HNXO 3QQ9C 4N0CC 1MJJB 4QT5A 3AWFA 1JG9A 3L3OA 5HHMD 5PCYA 4LEEA 2YD0A 1IC0A 1ZGLA 3GJFK 4GKZA 5IBUG 2GJ6B 3P0YH 4AGQA 4FFYH 3HNSH 3WFBL 2CRMA 1RFDH 4PGBA 4HZLB 1BZDA 1JL8A 4L8JA 4QKTA 5SWSD 4JY6B 4PCSA 4XNUL 4G9DA 4NQDA 5IVOA 4C7UA 2Z34A 4L29A 4YSSA 4HJIA 2FWSA 4FG4A 2DL2A 3MJ6A 2OL3L 3QTCA 1D6EA 2OL3A 4OJFL 3VJ6A 1B3QA 3C3TA 1QVOB 4NXNB 1G43A 3B37A 2E76B 5LHGA 2W9DL 3N5AA 2LABA 4LCCC 3U36B 1JGLL 1OSPH 2Z1PA 5I6NA 1HIML 2CJTA 2P43B 5CP7A 5LAPA 4H5SA 1YO4A 2R2EA 3QDMB 1AP2B 3I6KA 2XN9D 2OYMA 5E6IB 2IG2H 1QBBA 1QEWA 4DNLA 3IU4L 1PZCA 4P23D 4XMKH 4U2YA 1R19A 4JAVA 4GIOA 4HUXB 1NL0H 5ISZB 1T5XA 4IW4C 1PY4A 4NVPA 3MCKA 3F84A 4I8DA 4X20A 4QHNB 3C5SB 4NQSA 3BAAA 1IGML 3MC0A 1N0LB 2EDJA 2NUTA 1IBLB 1LQSR 4PJ5A 2IWKA 3FQUA 4G5ZL 3RYFB 3SJAC 2J6EL 3P30H 1HSAA 1PPJH 4KV5F 2Y7QB 3BA9A 3VRLF 2OYQA 5I24A 4DRXB 1QI5A 1XIWD 1GOHA 3JAWB 4D7BA 1CI5A 4PBDA 5DJ8A 2JKNA 2XOTA 4E9LA 3OKEA 4G1MA 1G9MC 3FSVA 2FLBT 2OK0L 1ZTMA 5GGVL 2VC2H 1FV1A 2ZQKA 3HN8A 4NQCA 4MMXC 1R24B 3FZUD 2XZZA 3LN4B 2DJ4A 5G4MA 2YSUB 4OI7A 5EU6D 1MAMH 3EOYG 4MA8L 4RBPH 1N32O 4OGZA 4LSSH 4TMPA 4Z1PA 5CZXC 1QLRB 2OA9A 3T09A 3BAKA 3N0PB 4L4JA 5L9DL 3MCKB 2G3MA 3QYNA 4WLCA 2F8OA 1IFRA 1HTYA 3CZNA 1RIHL 5KSVB 3J07A 1E8WA 4Q9CA 1FXHA 1NQTA 3K1DA 4RFOL 5AVRB 2YPVA 5I1IH 2OXHB 4YDNA 3SE9L 5E6IA 1BIHA 1ZEAH 4XH2A 2IOOA 4RWHA 3H1KH 4A04A 2GTAA 1KU9A 1G7PA 1OZUA 3DYMA 3PGDA 4N0FA 3APNA 1Y4MA 1WAZA 4HMDA 2AJVL 5F3BB 4CN6A 1BF5A 4DR6B 1KCSH 4OI9A 4WV1C 1H6FA 2CGNA 1KUQA 1U42A 4P59L 1YUHB 4ONOA 1X4TA 3T3PB 3GFUA 2EXYC 4TNEA 2IALB 5DD6A 3T3ME 4JDVA 1B4JL 4LEXH 1DZBA 3CE2A 4XZUB 3E8GA 3F5WC 3T1YB 1M1KW 4OTXL 1E4WL 5LN4A 4XMTA 3OB0K 1N8ZB 4YIOA 2O6PA 3FO2A 2QGDA 5I5MA 2GJZB 3SDXB 4ZMXA 3THOA 4JVWA 2V3EA 1HNWB 2J21A 3WY2A 3GEFA 3IFOA 4GRLA 1BQLL 4F57H 4NZUL 1QNMA 4F9LC 4QE9A 32C2A 4YDKL 5FYKH 4ZS7H 1A3RH 1J7VR 4AW7A 3JWDC 3RTQA 2XG5A 4GBXC 3IXAA 1J87A 2V2TB 4O2CB 4ELME 3PWVB 4Y1AE 3ZKXC 2QKCA 5JR1L 3OGIB 1FWXA 2IGFL 1EM1A 3DRQA 2L4OA 3GM0A 2V8MA 2NZ1A 4HGKC 1FO0B 4LDCA 4EEQA 1CXEA 5C9JB 4ZMQA 4UILL 2EE0A 5EUOF 3RWCA 1KJVA 2F0CA 4X6BA 3C8KA 2GBVA 1HHJB 1KXQA 4X9QA 1F7YA 3G5ZA 5AOZA 4HIXL 3UCRA 4AT6A 3WB2A 2HP8A 2XG4A 3QJSB 4QRTB 3FFOA 1FFOB 4JG0L 4OR1A 2F66C 1H9DA 3B2DC 3FTWA 3QFJB 2BY3A 5IYBO 4RDQG 5C0AA 4U3JA 1FPTH 3APOA 2O93L 1B6QA 1QU7A 4FKKA 4PREB 4F80A 5DRXA 1HH9B 3R8QA 4JVPA 3SGJC 5F7DA 1G9NC 1I7RB 4P2OB 1E4HA 5IESH 4BSJA 4HAFA 4OVUA 5C07E 3SGDI 3MRRB 1XAUA 3MRPB 3F7KA 3KYKH 4FQXC 3GTVA 2HJDA 2DIBA 4I4WB 3QG7H 3BKML 4Z7AA 1TEFA 1WA8A 1U2HA 4NKQB 2YXFA 3BPZA 2FSEA 1JPGA 1TENA 3NCBB 2LLNA 3ZT7A 5BRZA 3KWVA 4XMZA 3U0TB 3GM8A 3QIWA 4Y4KC 4CSZA 2VKXA 5GRZA 5DJCB 2EEXA 2UXDB 2JKXA 4DO2A 5KW9L 1PAZA 4YHYC 1K3EA 2JJTA 2A9NL 2BWDA 3GXUB 5DUBA 4N87A 1RJZB 4M29A 2Q7YB 4NR1A 3VXNB 4Y4FD 4Z9KB 1XBLA 1MAJA 1R3LB 3ETGA 2EXWC 2E8ZA 1BXXA 2HX8A 4CC5A 2DWXA 3WNKA 3IBEA 1Z2GA 4HFWB 5IB4B 5SV3A 1AY1H 4KMLB 3QXWA 3EFDH 3CZEA 5DMJB 4J7JA 2OYLA 2BERA 3NCEB 1UOLA 4CJ0A 5D4JA 3JTTB 2OTPA 4F8QA 2APWA 4PV8A 3U48A 3MLTB 4H13C 1GCFA 1WTGT 2Z7YA 3F00A 3IPFA 3U83A 4JGMA 1PLGL 4X80L 3ZDYB 4OF3A 1AGCA 3H6JA 5C0JA 1IIIA 4LKCA 1NEZB 3FB5B 1C1EH 2ODHA 2ZKMX 2YIDA 3HKEB 4OPAA 2VKWA 4F92B 4PJ7B 2K78A 3L1GA 1G84A 2QV2A 1NICA 5IM7A 4AL8C 4WDIB 4ZI8A 1A6ZB 2ESVA 3BN9C 1CFBA 3C5ZB 4XCCH 4ZO8A 4NZRL 5HHXH 1BZ7A 2XHNA 5K9QI 3CX5J 2UUCB 1IQDB 3E3QC 2L7JA 3W37A 3NXSA 3CFKB 2ZXDA 1WWWX 3QS2A 3GUFA 5D8JL 1DF5A 3ZE0F 4OZHE 3LIZA 5HYJB 1OCRC 3NDYE 4F37F 3TZVA 4QY8A 4ZODA 1A1MB 2YQGA 2KT6A 4Q0XH 3JWDL 3U36A 2N01B 4E9SA 3FCTB 4LL1A 3FT4B 1KB5L 2WWKT 1W72L 2AVGA 4LHUB 3WKML 4JI8B 4TQEH 1FFTB 1F4AA 1PIGA 4U1MA 4HA1A 4JPVL 4D2NA 2ZX7A 5B39G 1UYWL 4H13B 1N5AB 3AQZA 4FDWA 4H20H 4O9HH 4ZJ9A 2D9CA 5EWIH 1VZGA 3JV5A 2BVEA 3VM5A 1OGAD 4NENA 4WHYH 5KMGB 1NWPA 5HYQB 2G3NA 1CT8B 4BQ8A 1TJGH 1WFJA 2XBTA 4GQQA 3ZHDA 1CR9L 1YMMB 1FNAA 1JMZA 2BSEA 5EOCJ 1MJJA 5JH7B 5C8YA 3GIZL 3RVTC 1FAIH 1SOQA 4ODBD 4Y19B 2CO1A 2NLJC 4ODVL 2YZ8A 1HEZB 3GXIA 2MJWA 3HE6D 2OJZH 1DFBL 4WHCA 3II2A 1A6VH 4KXZH 4QDGA 4C54A 4CGTA 2OYKA 4AI7A 5JORA 1QABA 5F9JB 3MJ8B 4Y9FA 5H6QA 4FCHA 2Q20A 1WFMA 3OWRA 1WRFA 3VCLA 1ZXKA 3MV9D 4I1RA 3CZUB 4QR7A 3V7AE 1RJYA 4RAVA 3WTTA 3T1WA 2YMXH 3L7FB 1S4IA 3HAEH 3VI3E 4AENA 4X6EA 4TWKA 4X62B 1LP9A 2X7RB 1I8LC 1Q9OB 1A1OB 2EC8A 3FONB 2BS9A 4PJ7F 3I9IA 3WIHH 4QRSA 4W9JC 4DQOH 1D2DA 3G9VA 1BVLB 5DEGA 3WY3A 1RZFL 4XMXA 3FT0A 1FYTB 5E8OB 3DXAE 4Y5XB 3WFZA 4DUYO 4X20B 5JIPA 1ECZA 4AXWA 2BIPA 43C9B 1CDCA 3ZE1E 1Y67A 4GAYB 1BQHB 4HG4J 1UB6B 4YO0A 2QHLA 1IVTA 1F4WL 5T5NF 4QRPD 2PCFA 4RISH 4EI0A 2F53D 5E1GA 3P77B 5C0IB 4XAKD 2EJRA 3T2PA 4HOZA 5EZYA 2HUEA 5CINL 3QSKB 5KVMC 1OTSD 4WHTB 1F3JB 4BQ6A 3O3BA 1OV9A 3MU3A 1J0YA 3OKMB 1RZJC 3HN3A 4J2QA 3MNZA 5LDUA 2OFQA 4EPSA 1U8IA 2HT3C 3PFUA 1A3QA 2A9DA 3D08A 5DHVB 1ETB1 1YEEL 2VWJA 4K7FB 1E9PB 2VM4A 4KHTL 2Z65C 1E5CA 3II1A 4WFHA 1PBYA 1EMTH 3AM8A 3LH9A 3PXJA 3QIBD 3RYCB 2OLDA 4LVNB 2XWZA 2DOSA 4CMMA 3VXME 4ZMZA 3KHQA 3WDHA 4LLQB 2AEQL 2GIYA 4Z3HA 4P5MA 2EDDA 5C07D 1UWGL 1UKTA 3OSKA 2NR6A 3RWHB 1U8HA 2ZCKL 3K9SA 1KPRB 5FDWA 3F85A 4M3JA 1QCEA 2AV1A 1EZJA 1AACA 4I7ZC 5J06A 3OMAB 5HTSA 3SDCB 2YS8A 3STLA 1Q9LB 2AI0H 4PJAE 4EAEA 3UIZA 3L73H 1CD1A 1VQ8V 5IQNA 4GXFA 4FTVB 1EEZB 3HN5A 4PP2A 3WNNA 2D4DA 5C0RH 3CCRV 5HGGS 3WN6A 1YN6A 2H0JA 3EOBB 4WU5B 5EFIB 2XIDA 4HPYH 2H8PC 5TK2A 1LQBC 2OPCA 2F6AA 1XF4A 3VD4A 2VDKB 4UV7H 3S2AA 5LNGA 3M1BA 3O2WL 1MZYA 1SY6H 2RD0A 1I1YB 2C4XA 4OZ4A 3SDDA 3L7EB 1VIBA 5CBEA 3JWOL 4PJBA 4EUPG 4FD0A 4YHPA 2XLLA 1R6KA 4F4LA 4KKRA 1EGJH 1LJMA 2X28A 1KTRL 2A6KA 2ITCA 3ULUH 1JZFA 1RQ5A 2FQEA 1NC4B 2Z3FA 1L0LH 1F2XK 4HIJA 4OCXH 4Y1AD 5FGSA 3UJIL 1ZOXA 1QQDB 1OF0A 3IFLH 1BJMA 4P2QE 3ARSA 1VFMA 3RVVC 2CGOA 4P2OC 4IKJA 2E4TA 1QSEE 1UZ6E 2NY3B 4TQFA 3RUGE 1YY9C 4DOHB 2WQSA 4AZ8B 1ET5A 2CXGA 4C56A 2QZ5A 2E75B 1OGAA 3BVNA 3VGGA 2YPVL 3S8GB 1ZJAA 3SE3A 2LE9A 3CSFA 1VEWA 1OWRM 4UM9B 4UQ2A 3I3BA 4HOWA 3FN9A 3I75A 4C83B 2R1XB 2ENQA 2X4RB 2NY5H 2VZUA 1E5ZA 2ENJA 2BOCB 2OULB 3EOAA 2OSLB 5F9OL 1PZDA 4Q9QH 2RMKB 3ZRXA 1A14L 1BVZA 1BJ1H 3TTSA 1QNZH 4O4LA 1ZA3B 5CB4A 4AEEA 1QPXA 1UD2A 2CDYA 3MRGB 3SCMA 5B1BC 3AY4A 4DV4O 1BXAA 2R0LH 3LNFA 4ZOEA 4UQ9A 1L9OA 4RGOH 4FQCH 4N4YB 3ZTJH 3FQYA 4KTGA 4S1SH 5DJDA 3TWCL 1E1RG 1S8DA 1R3LC 1BGXL 1GGCL 3I6SA 1C08A 1J9QA 1HOCA 1I9RL 1RZJH 5BMVB 1KLGB 2EO1A 2FNWA 4XX5A 2FL4A 2MWCA 3OD3A 4JW3A 5KOMC 1YPZE 1OAXL 1VEOA 1OPGH 4OZIB 3FB7C 2ZXEB 3GSQA 4NB7A 1ZHKB 2X42A 3ZE2E 1OCOC 2XBDA 5EEVA 3VI4F 3FAVB 2JXMB 4U3SA 5C0BB 5JQGA 3BVDB 5CSGA 2AQSA 4XHQA 3RY6C 3UC0L 1TJHH 3Q6GL 1U2CA 4KPHH 3CQFA 4GRWB 5I16B 3RIAF 1A0QL 4JFHE 2GI0A 3V0JA 4TTGA 1ZTXE 3VQYA 2ZPKH 3RFZC 5E8DL 4NFDA 4XP4H 1TZGH 5E8PA 1VQPV 4MAUL 3ETTA 1GGTA 3K2UH 5AL0A 5DVLA 5JOEA 1O5PA 2F61A 5DUJA 3TJPA 5E08L 4GUNA 2HJKA 4R3SB 3UACA 3TCTA 3MCLH 3OEHG 3RVTD 4M9PA 3E35A 3RFRA 3KCPB 2P8MA 4NO3A 1MFCL 2E5LB 2WSSG 4GZRB 1MCLA 2P7TB 4FGMA 4G42A 4H2AA 4P0DA 5DD1L 5FGCE 7PAZA 3K5LA 3L4UA 1EZLA 4FQ2L 1LVEA 3U1PA 3QRLA 3GJFA 2Y1VA 3H55A 4POZD 3IGAC 1GIGH 2HKHH 2VXUH 1JGDA 4OFYD 4OM0H 3LRKA 2K4AA 4XN1A 4YLCA 4PBWD 5M7QA 2GK0A 3RVUC 2C1OA 1HC1A 1FGVL 4MDIA 4Z18A 3RB7A 3IPEA 3TH2T 2GSIB 3JALA 3ZHTA 2YD1A 1NBYB 1MFUA 1DLFL 1AZNA 4AJ0A 1AC6A 2XVBA 1G1OA 1SHXA 4FLZA 4MNQA 4BWUA 3UTSE 3CSYB 1DDHB 3E2HC 3N50A 5GS3A 5D7SL 4JI7B 2BJML 2A0LA 3LXBA 4BKLA 1ZUQA 4XAKE 5J1SC 3FOMA 2LTQC 1DQJA 4ATWA 1ZANL 4XNZC 4E9WA 1CIUA 4PHXA 2WAMA 2XTSA 1I3UA 1WFUA 1M57C 5C0DB 2WSPA 3EJZC 4U0QB 3FW6A 3RAJH 3T2MA 4HKJA 1OM9A 3EXAA 3C08L 2DMGA 2WXFA 4FG0A 1ZT4A 1KLFA 1OSYA 3H6AA 3K80A 5GIRA 3MX0B 5D5ME 4PRDB 3VXTB 2WYZA 2VL5A 3W0WD 4FFVD 1BAFL 1TZIA 1B4TA 2FEDD 3EGXB 2AW9A 1CCZA 2B77A 1SVZA 1K5NB 1AGBA 5H37H 4L1DA 3G71V 3CFBB 4I3SH 5D6CA 2EIJB 4FFBA 4QNPF 1D2OA 5DQDL 7FABL 3OR6C 4B3SO 5EUKB 4N22A 1ZCRA 3VQXA 4EI5D 5AW1B 3ALPA 3RVWC 3OGCC 3FB7A 2H47C 4MD4A 2CBQA 4O4IB 43CAB 4XVJH 3AFLA 3IFXA 4PJ7E 4UV4L 1DJWA 2X2JA 3WY4A 4M6NL 5H37G 4F3FA 1ORQA 5KVEE 4GSXA 5BZWA 2AJVH 1ANUA 3P4NA 5I1EL 1CP9A 2EYTB 3MZTA 4G6ML 2COQA 4ADJA 3NEXA 3B2UC 4KZEH 5J12B 4HD9A 4PLJD 1VCBC 2XZCL 1ACCA 4MLSA 1KSRA 3LOWA 2DKMA 4UTAL 4NZTL 3CC7V 3CGTA 3F8UB 3MJ9H 5E1HB 2V2WB 4P2RB 4QJ5B 2CKNA 4O2BA 3K5MA 4OCWH 1M9WA 5IJBC 3KLQA 4U6HB 3O0RL 3PHAA 1L5GA 4GQ9L 4X66O 1R1BA 5IF0A 5C0AE 3CRRA 3LMJL 3ZDZB 2Q67A 2ID5A 5ISZD 5JJNB 2W6JG 1JZ3A 4PV1C 1MZFA 4HBCH 5GPRA 3DO7B 1I9JH 3TV8A 4UT6A 1INEL 4PJ5E 3WXWH 5IREA 4Y4HC 1E9QB 4GAFB 4DK0A 5BR8B 2ZCHH 2OL3B 4MQXC 2IPUK 3GKWH 4MAYD 5DQJA 2GITA 3PQYD 2YEVA 1D5XB 2B4CC 4M00A 5ITZA 4JX0A 5CN1A 1MLCA 5GRJL 3PXLA 1KBBA 4UTAA 3QZWB 1N36B 4XX1E 1UJ3B 3KLHD 4ZQKB 3ZHUA 2R15A 4IGGA 2VDRH 3HZVA 1YJDH 2R0WH 2WPDG 1SQ2N 1FFNB 3MA9H 2Q87A 3V5HB 1IAOA 1KWGA 1MSDA 4XDLA 1JK8B 2WHVA 2QVKA 1QO3B 1PCSA 5GGUA 1MEXL 1LWRA 3RKDD 1ZWIA 5IFAL 2QHRL 3VB8A 1BQ5A 3GB7C 2JTDA 4TL4A 2H0FA 4RGMB 1CD0A 3FX7A 4MLIA 4NXNO 3GSUB 2LV4A 4XC1H 3M07A 4GINA 1ODUA 4FXKC 2YBRA 3FRPA 3L5HA 5JDSA 3MTRA 2KQMA 3BRFA 1JX9A 5F9DC 4DEPB 1SZXA 4RWUA 1A6AB 1UWFA 2P8PB 4NQDE 1KXQE 2XTJC 1HJBC 2NTSP 4JO3H 3NRPA 1UD8A 3LKNB 4OD2A 1H6UA 3BMVA 3ECQA 5FCUL 2V5YA 1UM6L 3PQYA 1JHTB 2O72A 3VXRD 1JZ7A 5T1DH 4QRQB 3U6RB 1D7CA 1N5YH 4GAGH 1RURL 4DR5B 2CR6A 1JAEA 1SHWA 1MG1A 5LUMA 3NCJH 3LZFL 4GAAA 1A4CA 5D2NE 4NPJA 3WLBB 1E2WA 5LWYH 1DVYA 1T1YB 1TETL 5I1CH 4XNXH 4IOIA 3SKNB 1I1AA 2PR4L 3W9DB 5B66Z 3RX8A 3CCJV 4Z7WE 1OHQA 1VENA 1X6NA 1EO8H 4ZK8A 3W9EA 3WFEH 2YK1L 2QWNB 3OR6B 1SA0B 1Q3EA 1YSOA 2BIIA 4WHDA 4LOEA 2BS71 4NEHB 4NBZB 2F1AA 3US0A 1D7DA 3NZHL 4OZGB 2Q7GA 4G83A 1U96A 2H3XC 4A7TA 1ROWA 5I15L 2KL6A 3Q43A 1Q1JL 1UH2A 4NGHL 1RIUL 3P0VL 1BGYH 2HPTA 1I8KB 1H8NA 3Q9PA 4UANA 4M4PA 3ZDXB 3ZBHA 2BMKA 4V2CB 3CSGA 3NA4A 2YDEA 1NUFA 1ZMYA 1H15A 1I1RA 3QCTH 4IU3A 1IBKB 5GRXG 2QM7A 4ZFGL 2F43G 4GKKB 4DVRH 3MRLA 3RI5K 1LO0L 3HVNA 1KELH 1E27B 3EIFA 1U3HA 3CLFH 3LY6A 5C0CE 5HGBB 1SOKA 3FU6A 4AVKA 4CSSA 1OL0A 2A9MH 3QHZL 4JI3O 3CXHJ 4DV2B 4X89A 1X9UA 2A83A 2FX7H 2ZWZA 3F58H 3QR0A 4KRMB 5T3XL 3RX9A 4F8OA 5CZXD 3TVMC 4FA6A 3ZN1A 4YDVB 1XB6A 5DQ9A 5C6TL 4Y4HD 3IJYA 4OJDH 4E9XA 1NOLA 3KBHE 1YY8A 5L2JB 4Y5YB 2EH8L 2FAUA 1VFUA 2HT2C 3TN0D 1ESOA 3MXWL 1I8LA 3ARRA 3IDNB 3LB6D 1KF9B 3T8XB 1WD8A 5L6YL 5HI4D 4HT1L 5EIVA 1IGTB 4OLUL 4PY7A 4YSTA 3MDJA 3DTXA 4QPKA 5AEAA 3W39A 5IR1B 1SBSL 2WZAA 1WUZA 1YQVL 1S9YA 2L6LA 1NGQH 4BRJA 2NY0B 3D50A 4BA0A 1A32A 5IBTL 4BELD 4JFSA 5J6GA 1ZT7B 5F72S 1R33A 4X8JB 4Y9GA 4H0LB 5HXMA 4N2OA 1GRJA 4YSPA 1IC4H 4LSUL 1J1OL 5D2LF 1TO4A 1ZPUA 1R73A 3OUSA 3D3VB 1JJ2U 1OCWH 1SVCP 5MENE 1OLZA 4B95C 1CFSA 1NCUA 1ORSA 1RZ8A 1NGWA 3QDJD 5DA0B 4PVNA 1FD9A 3I74A 2ZE8A 2Q0AA 1VF5B 1NA8A 2Z5UA 5FECA 2NY6D 4J8RB 4Y5YA 2H6OA 5E2JA 3KLHC 1EAPA 2LFRA 5C09A 5IB1A 4X4KA 2Z31C 2VLJA 4FQIL 5AOMA 5D5MA 1U6AH 3AJ7A 4G80B 1F11B 2EDLA 2PF4E 3GZQA 5C3IA 1JGUL 2ROYA 2HKAA 4XNZB 1IBZA 2FEEL 2N0MA 3H9SB 4OFVA 2B2XH 3DV6A 3UADA 2IEPA 1IDSA 1I7TA 3S5LA 2AKRB 4S1QL 4JRXA 4PAZA 1MHCA 1T20A 4PJIB 2BFVL 1JXJA 2DLIA 4GLXA 1HXMB 4LCCB 1DJHA 4HJ1A 5E8EA 3SDXF 5CLXA 4PB0H 1EGJA 4PP1D 1L7IH 3WIIL 3DUHA 4QLWA 5BV7B 4Q2ZA 1PP9H 2HKOA 5DF0A 5J9PB 3EYFA 3HC3L 3FT3A 4GX2A 4PWEA 2CKBB 4V33A 3CXHF 4QRAA 2HRPH 2VQTA 3FN0L 4AM0Q 4BAYA 4K8XA 1FYTD 3A6CH 4NC1C 4QHLA 5EV7A 5TQ0H 4PLJC 1RSOA 2PYEB 3DMMB 4YXHH 1RK1B 2Q4PA 4F1ZA 2OMZB 4DESA 2V2XA 5K69A 4YHKH 4N8CL 1WAAF 2YI9A 2ADFH 3KPSE 1W16A 1NBVH 5CD5C 2BIMA 4EQ3A 1UA6L 1IC7H 2B9ZA 4JHZA 5A2AA 3E0GA 1N68A 4YXKL 1OP4A 4K5MA 2H94A 4WEMB 4DTGH 1A2YA 1OEZW 4S2SA 4XOAA 5SWQB 4UNVA 4KU1A 3T1CA 2FJHA 3CCEV 3SN6N 2LP7A 1JZHA 2QMJA 4JPKL 4OAWA 3LD8B 2ZINA 3NPSB 4N9GB 5K9KA 2WXPA 4CRPA 2PPEA 1A9VA 5JNYA 5D71L 1HKFA 1AZZC 4R96A 4W4KA 1JF5A 2BRQA 2J8UF 2JGDA 1ZTXL 2C3XA 3HNVL 5G4NA 4AQ8A 1UA3A 1J8SA 1JYXA 1XQ8A 3JD3A 5DHDA 4GRMA 5F89B 3L70H 3B83A 4X80H 1OZ0A 4P9OA 2WLLB 1T0MA 4FXGB 5FHBL 2C4FU 2ICES 4PW3A 3EDJA 1HXKA 2L7UA 3LS4L 1WGOA 4F93B 1PG7W 3F62A 4KK9C 4CDGC 5IHLB 3IMBA 2ZIOA 4WFEA 3A6BH 5IZ7A 4NBXB 1KCVH 1YYLL 2LW7A 3QIUD 4OZGE 2P22C 2H3NB 4D6TH 2WC7A 4M3KB 1PG7L 4HJTA 1X5KA 1XCTB 1T2QL 4GP5B 1T03H 3D52A 3HBGA 1EJOL 3CVHH 4GG8B 3W56A 5IGXH 2HLAA 2VMFA 2ZYSA 3C87A 2R69A 4LSRL 4OCLC 4ZHQA 1AD9A 1AGFB 5JIKA 1MRFH 4LPUA 1SYSA 1JWMB 3N2GA 2HRGA 2OMVA 3MLWH 3GRGA 4EIUA 1HOEA 3GK8L 4U3XA 1QBZA 2GTSA 4C56E 1S7QA 2H9GB 3EF7A 4L1TA 5ILTH 5DS1A 2C1PB 3FYIB 4UOQA 3BPOC 1A7NH 2XQBH 1R6TA 4MXWH 3JTBA 4AQAB 1GW0A 5GHWH 3OZKA 1ZTEA 3MV7B 3BP5B 4FXGA 3MV8B 4IU2B 3P3YA 4J3UA 3HPLB 3IMRA 1FC1A 2V2WA 4P2RA 2QQNL 2ZSVB 4UQDA 3WEMA 4HAMA 1NLBL 4A6YH 1RM1B 4QUOA 4XC3H 5I26A 1FGNH 2Q76B 1KZYA 3MREA 4YJZL 5LVEA 2NOYA 2A1WH 5LDSA 1S7RB 4FEIA 3RWIA 2ZE7A 4R26L 3KGTA 3UZVA 2ZXGA 3PYCA 3TCXA 3N1PC 4ALAH 1R5VA 4FA8A 3KAAA 1DVFD 1XNQB 3US9A 4MVUA 2G2PA 3VU2A 1MI5D 4PRHA 2H41A 4XCYB 2IAMC 3WBDA 1R0AL 4K8ZA 1DFXA 1XTMA 1ZVYA 5C6PB 2I32A 2J2ZA 2EH7L 2KZWA 4IYIA 1KENL 5IMLA 1UFUA 4X66B 2Q7HA 1FVDB 3DK0A 4UDUA 1Q94B 1R34A 4PPTA 1BLIA 5GGSY 2V9RA 3RL2B 3VXMD 1N34O 3NVQA 3LXCA 4KP4A 1H2SB 4ZW8A 4G71B 1LE9B 4UYPA 4FLVA 2OXGB 4I18C 3IDGA 1P84J 2W88A 5KTEL 2YD6A 1JV2A 3EJSA 2OR9H 1J5DA 5DJYB 2X9ZA 3BMWA 1HEHC 4FNPA 5CJBA 2R0KH 4Z7VF 3X13A 4BEIA 2X4PA 2WXIA 4IDJH 4BH8A 5HYSA 3V0GA 1TQCB 5C08E 5CGTA 5HI3C 4DP1X 4QE7A 1LP9E 2B1OA 4JN2A 2YOAA 3W5MA 3BXNA 3VQMA 1LNUA 2CR3A 2CH7A 3A2FA 5FCSH 3GI8L 4UZGA 5KSUB 1TTCA 3C6SB 1FG9C 4HXAL 5AUMA 3VXRE 5JMRA 4JI0O 2JCCE 4X6DB 4K7PX 5IOPA 4MCZB 3BKJH 4OIIL 5KZCB 2V5TA 4PJCE 3T2NH 4Y5YC 1UXSB 3V4PH 2NNUA 3X1BA 3Q1EA 2ZWLT 4WJ5A 5I6LA 2NXZD 1OAKL 1TCRB 3JALB 1JDAA 1S7WB 3X3GH 3VXMA 2AHIA 1YEEH 3U46A 4MMXB 4DZBA 2MHAB 3UYPB 3BVXA 1L7TH 2LGNA 4WKZB 2H26B 5IVXE 3DC5A 3FQXB 2HYMA 3MV7D 2DW5A 2WO4A 4Y0GA 12E8H 2G60H 2Q0ZX 4TQPA 1KKDA 3O81A 3P4MB 4AM0B 3Q2NA 4GBXA 4S0SD 1ECYA 3PL6B 4X6CA 1MF2L 2VZ3A 1TU2A 3DK2A 3TK1A 1SLUA 4HJGB 3VX0A 3PP4L 4PJGE 4BQCA 3EOTL 2DQUL 4HGMA 3CN3A 3GO1H 3ALXA 3HTLX 3FTSA 1Y0LB 3SKJL 2HT4D 3B43A 3JWNC 5JJJB 3KPSD 5I74C 1NC4D 3QPXL 2R29H 3LRMA 3FO9A 3RL1A 4J5VA 2DY2A 7PCYA 3FH7A 3QZNA 1JD9A 4J10A 2YSSB 2DEXX 2RJZA 1NFIB 3HKFA 4LKXA 5EBLA 2Z31A 3AQDA 3QP3A 2BOBA 4PRNA 4U4BA 1TVKB 4U7KA 5ECJE 2HT2D 1JZGA 3L54A 5FS5A 2W6IG 1AO7B 5J1AA 3ARGD 2MHAA 4JO8A 3T4YA 2GBUA 4ETQB 4F2ME 1YJWV 3O3DA 2Q6WB 3IVKA 4Q8BA 3HE6C 5FK9A 1ETJA 3INOA 1G8MA 4QHUB 5ESVA 1IAII 4RRPG 3AG1B 2VJ8A 4HKBB 4X42A 1UD4A 3WJJA 4YDVA 5DQ9B 1ZD6A 5JOFB 1LGVA 3HCVB 5CEXA 3CN0A 2D4FA 4NKIL 2CH7B 3UROR 5IG7A 5HJGA 4HMCA 2YGVA 5ICZA 2WJ5A 2FWUA 2K0RA 1IRAY 4MB5A 1J05B 2BHZA 5K93A 1AJ7L 5T1LB 2NY3C 1DBBL 3GS0A 2V7NB 3CRAA 3VXRA 1T5KA 3DIFB 3EDKA 2X1OA 3INUL 1G6UA 3MODL 4IRZH 3S88L 5GGVH 5LGUA 2P80D 3S2CA 3HZKA 4HK0A 3IJ8A 5EZJA 3BPCB 3B9KC 5E2WH 5GZOC 3PV6B 1NS1A 1SJMA 2NQDA 1MAML 2EVJA 3BRCA 4AGOA 1KBPA 1IGFL 3FFCE 3ETEA 1OM3L 2CHDA 3RL2A 2IXQA 4NKMB 2HLFC 4DEUA 1OQXA 2VQEO 2BTOA 4I3RL 1IJ9A 1UEMA 1ZWIC 3RX7A 5LGJB 3NP4A 1E50A 3IDJA 5GSRA 3LKQB 4RSYA 5F8QC 3RBGA 3QISA 1ZLWH 2UZIH 1WZMA 3V0EA 4GQ9H 1GAFL 3L3HB 3RJOA 4NCC1 4M5ZL 4KKQA 5JPNA 1IQWH 2X40A 3QHFL 2CDEA 2WLHA 1KY7A 3GI9H 4MZRA 1HDMB 2J8HA 5IJDC 1IL1A 4YR6B 2N04A 2CO2A 4DH2A 5H4ZA 4MAZA 2DIEA 3NRQA 2IJHA 3TBYA 5MEOA 2WA3A 1BZ8A 3EOBA 2F58L 4XCFL 1AGEA 1NJ9A 2ODMA 3AQYA 5AAMC 4U1GC 1M05A 1O9HA 4Y4HA 1H8OA 4HLZH 1JWUA 1MW1A 2PWHA 3EHBD 4CN1A 5IJ0A 1CD1B 4PY7B 4W81A 5JVDB 1YYML 4UOJA 3ROOA 1MDTA 3BGAA 1CLZL 1FN4B 3H9SD 4NO2A 4GSRA 3TCUA 5EPMA 2AMUA 4XBFA 4B3RB 4G7SB 4RMQA 4WFGE 4K3JH 1ID5I 1GHFL 3BUBA 5D7IE 5DI8B 2VZ1A 3BVOA 1BAWA 4ZMAT 5PAZA 4JTAB 1NGZA 5D1ZI 5IFAH 4RNRB 1B9ZA 2EKSB 1FNGA 2OSXA 3ZRFC 5BO1H 3AGVA 5BY1A 4GW4B 3V7MA 1ZLUK 3SPCA 3U6XA 1BQLH 4P4KC 1XOUA 4XN4A 3RWJB 1FGVH 1JNHA 1OTSC 4PWHA 4E41E 1WISA 1HW7A 2DF3A 4I2XA 3A0BZ 1QRNA 4G28B 2NW3A 4ZOLB 3GSRB 2GQHA 1CICA 2WXOA 4GIPD 2QV4A 5DMGC 2DLFH 4KKLC 1KKCA 1HS6A 1Q9WB 4KJYA 4PI0A 4HH9B 5I8KL 3DHPA 4JI5B 1HWHB 4OVVA 3TASA 3VA6A 1CLYL 1MJUL 1ZANH 5JWPA 1FNGB 3HFMH 4A37A 2ORBH 1XNRB 4N2LA 1BJ1J 4OQTH 5HYJD 2Y6SD 3I3DA 2ICCA 1RHHB 3BWAB 4XP1L 4JKPL 1U9KA 4JFUA 4EQ2A 3D2TA 3FB5C 1Q0XH 2WINB 4IRZA 4DR3B 1YEWA 3L17A 1UC6A 1NIBA 1QSED 4OGYH 1PEWA 2QTOA 2DV6A 4LHUD 5BRZE 3VFWA 4QRRE 3FQRB 1DUYA 1BHBA 2BVOA 4K07A 4XXDB 3BEWA 3HI1A 2P26A 3H54A 3RGVB 4MA1C 1PZ5B 1JN6A 2PLTA 3GDCA 4PJ8C 4UM8A 4OCSH 4HDIB 4KXBA 4N26A 2AQTA 4G9FA 4D0DA 1TLKA 3VACA 4V1DB 2CXKA 1S7UB 2AGJL 2R1YB 1NAMH 2GKIA 2VDNH 3TBYB 5MEOB 3QUXC 3LNNA 2F9BT 5IT2L 2DWDC 4JZ2A 3LPOA 5MERA 3K5RA 2JIXA 3MOQA 4JFVA 3PQYB 4M4RB 2AJUH 4D7SA 2YRZA 4MJ6A 4ZFQA 1G6RB 5AKVA 2OX5B 1UVQA 4KJQC 1OXYA 2VC2B 2ZNIA 3CVHA 1UEYA 1RPKA 3Q44A 4GKSB 2P8PA 1AXSA 5D7LB 4HVBA 3CLFL 4H0HB 4B9ZA 3OGCB 1GN4A 2PYEA 1S9XB 1YF2A 3REVB 3CC2V 3JSNA 4NKMA 5K1VA 5B7FA 4WBNA 1K5NA 3L3DA 5HDOA 5DJ6B 3T0WA 2BSBA 1U8MA 4Y4KD 4RZCB 4ZTPH 2Y23A 3FO1A 4W93A 1LLAA 3RNQB 4DEPC 5BV7C 3N55A 3TOPA 2ZJSL 1J5OL 3SPHA 1A8JH 3KXFB 4E0RA 1JHLL 2AJ3B 2L7EA 3Q2WA 1ZAGA 3TBTB 2CMRH 3HUJF 4PJDE 2A4CA 1AXTL 3I56V 2WNWA 4Z7VB 2XUWA 1AJNA 2YOCA 3PGCB 2Y1YA 1N7MH 3SD2A 3KL3A 3BKCL 4ELMA 3JYBA 4ZOLA 2XPZA 3ZQWA 2F53E 1RZIA 3B2EE 2YKKA 1T1XB 4NB5A 1YEJH 1MW0A 2R9HD 3MRHB 4G2AA 2EUZA 1MKFA 4ZX3A 3VO0A 1P1ZA 1MFVA 2EDEA 1UXWA 1KJ2B 4WCEV 4Z95L 3MUHL 4PJ0Z 3BPNB 5I1LB 7TAAA 3V0FA 1T7ZA 3V0WH 5L3GA 5HYIA 5TJWK 3QEUA 3UG5A 5I19H 5IWLC 2EUXA 2QJ1A 3CBRA 4OFDA 2DKUA 5C0GB 3CFKA 3JWNG 3PDDA 1M2OA 5FECB 1KP2A 3K6SB 3SPIA 2IJ0C 1J1OH 1F41A 3KWTA 4CVXB 3D36C 1DBKH 1NGWB 3CZLA 4BK5A 2HG5C 3FU7A 1AB3A 1FN4A 3EGSB 4O2BB 3UABA 1M71A 3DO3A 4M8QA 1Q81W 4G7RB 4HQQL 5SWSE 4LP5A 1H19A 2VAAB 3LKOB 3MFGB 3HKCB 4NYLA 4P4KA 5D1QB 1HZKA 1SHMA 4BM7A 1SVBA 3O65A 3R0MA 4IRJB 5JXEA 2GHWB 1XBRA 2IU3A 5KLVH 2FQGA 2JF1A 3H2PA 5DZ9A 2PI4A 1J48A 1KYOF 3SJVE 3CS5A 5HHQB 5CJ5A 5HHOE 1IM3A 4ABUA 4MYPA 2J1XA 5I73C 1MSPA 2UXGA 3ARPA 2PYED 4K94C 2F74A 5AW8B 3X1FA 1A4AA 1TVHA 2O26U 1UZ8B 2VRQA 2IWEA 3NESA 1D5IL 1NCIA 4YBHA 1CFNB 1E0OB 1V7MH 2DQHH 4UVCA 1MNUL 2VXQH 4FFBB 4B3SB 3CFBA 3FMGH 3N43B 4P46D 2EDTA 2YHGA 3G6DL 4K9EL 2IXQB 4N2FA 1U8LA 1RXLA 1R3LA 2DWDA 2DMBA 5DMGD 2H45A 3X14A 3EGXA 4J2XA 1DJSA 4JG0H 4OSUH 1AS7A 1Z3GL 2IDUA 1N64H 2V9TA 4FVMA 3U46B 5EZJB 4E42A 1AG0A 1CUOA 5B1NA 1EQWA 3CZGA 3EBIA 4KKCC 1ZT4B 4WENB 1KPUA 2QL1A 4G8GB 4UT6H 3CCUV 2FBRA 5FKPA 2G5RA 1T21B 2DQGH 1G4YB 3CVDA 1W0WB 1SDAB 4K23L 3CD4A 5KX5A 4YHKL 2BY1A 4HNAB 1I85C 4PA7A 3GSOA 4LCWB 4TSBH 5C7XH 1L0PA 1XCXA 5DXWA 4EEEA 4TUKL 3Q2CA 4LVOC 1GOFA 1IC7L 4ABQA 4G6JL 3VE0A 3ZTNL 1BX2B 4F57L 2WUBH 2CDFA 3TP4A 3B8MA 4LNUA 3GBLA 4MNQB 2A77H 4P2OA 5LYJA 3PP3H 3Q3GA 4KKBC 4Z7QF 1LO0H 1XMEB 4K5PA 3QWOA 3DETD 5BZXA 3ZHNA 5J89A 5E6YA 3BQUD 2AC0A 3L3DB 1G7QB 3K5SA 5JIDA 1B04A 2F1BA 2BX5A 2OXGA 4PLKC 1P7BA 3CJHB 2W65B 2XFGB 3H3PH 3O6ML 4PTTB 4BH7B 2AITA 3GJFB 2KZKA 4TNWK 4KHPO 4LKXB 1IARB 5EBLB 3CVHB 2CDGA 2ATKB 3BWZA 2R4RL 4UCOA 2IPTH 1IXBA 5EYPA 1HE7A 3AU1A 3MUY1 2ATPB 3AM8C 3X2QC 1N19A 1QASA 2PXYA 3M46A 2DQMA 2A7BA 2G2RA 3J81N 3A21A 4LSPL 4MNGB 3WJJC 3D39A 4XCYA 3DVGB 2V17H 5DM6V 5KG9B 5E95B 3H2QA 4XOCA 4G6KH 1NCGA 2AJSL 4CGUB 4DHLA 4K5NA 2HN7B 5JHDD 3L3JA 3WKYA 1JS4A 4MHHI 4RFEB 5A7EA 1Q8MA 2F5AH 1DFBH 2X09A 4L9LC 4O02H 4I5BB 2PTMA 1UWXK 1QATA 2Q8BL 4XCEA 3AWEA 4GBXB 5IGXL 3D3QA 3QDGD 4FTVA 2YPKB 5B3JE 4A7UA 2IBZX 4L18A 3KYOB 3SDCA 3MV7A 4IU2A 3ARYA 2BRRL 5IFJA 3GF8A 3FCSB 4PA4A 3MV9A 1AR1D 4JKMA 3AACA 3V5KB 4F6EA 1IB5A 1YEKL 3KR3L 4X9IA 5D96B 3VXMB 5E2UH 3VFMA 1G9NH 1YNKL 5LHHA 5BW7C 3L9DA 4MWFB 4XVSH 1RZFH 4NSKB 2JB5L 1QFOA 5KVEL 3GS7A 4BINA 3WD5L 2NNCA 4YIQA 1PL3A 2L04A 1CO1A 4JY4A 1GS7A 1UXMA 2XA3A 3S34H 4JI1O 4Q9RL 4GXVH 5D8JH 3GSRA 4C56D 3IDYB 4OU3A 3SCMD 3IB4A 3LYRA 4S1DD 5ITZB 2R69L 2VDQB 1G1YA 3IRCA 2CNYA 4K7FA 4MTMA 4XNYL 1GA2A 2EILC 2H8PA 2YPLA 2ARJB 2EYSB 5DUMH 4ZPVB 1B3JA 3QWRA 1PS3A 5KYUB 4AE0A 3CVCA 1AHWC 4M93C 4U1KB 1WFIA 4PJ9A 3STZA 4M6OH 1KEGL 4LBEB 5F96L 2F8IA 3AQXA 1UYWH 4YSRA 4W6XB 3O2WH 4YHMH 1XEQA 4TL5A 1CBJA 3HBZA 4PRHD 3F01A 4TQ8A 2K9PA 4KMTL 3H7LA 4F6RB 3SDCD 2WBJD 4UDTB 2Q86B 3ZKSD 3IAGC 1FXKB 3KYOA 2VLRE 4YZFE 3CFEA 3ROOB 4GKNB 4PJ8B 1X5JA 4QHMB 2JWYA 4DN3L 4ZDHA 2BE3A 2X4QB 4HEME 1U91A 5I8EB 1IO4C 4XCEB 3EHBB 4H88L 4K9EC 3RVZA 3G5VB 4W70A 4E9VA 1W0KG 3ZZLA 3A0RA 2QZQA 1UB5A 4LLAA 2NSXA 4XWGH 5FYJH 2HN7A 3N91A 3G08B 3D0VA 3OX8A 1CFTB 4DW2H 1A2YB 1AE6L 4JN1L 1K2DB 4S2SB 4KY2A 5GS2H 5C08B 2J72A 4QHPA 1KWKA 5DJ8B 1ZGLM 1S7RA 2CBTA 1Q9OA 2ADJA 2VDQL 4HMEA 5EBLC 4LF4O 1WBZA 5F9OH 1NFKA 5I76A 4WW1B 4PP2B 4AQ1C 2P1YA 4ZDHB 3VFGL 2XZAH 5T5FA 4ZTOL 3SYQA 3ZS8C 1DJZA 3FQUB 3H1IH 1CC3A 3EYQC 3MV8A 1Q43A 1L0YA 4NXMO 4DKEL 5K9OB 3U0WH 4S1DC 1NANI 3IJSA 4FQCL 5HHPA 3C09B 3TNMB 3C5SA 5EZIH 4ZT1A 4M62H 4P49A 1TO5A 3NJIA 1RK7A 2JE8A 3K72B 1E90A 1HINL 3PWPA 3ME0A 2EO7A 3NJLA 3Q3GB 3S3CB 1OALA 1VQLV 2EEAA 4OQTA 4PS8A 5CLWA 1MRCL 5GRUH 3UBXG 3H3BC 3ZDXF 3EHBC 3N2GB 3QORC 2EDMA 1HH6A 1RERA 1EGJL 1ONQA 5EOQH 3VD9A 3F7VA 4FJCC 2BNQA 5J5EA 4XXWC 1QNIA 3S0PA 3TFKD 4AYDC 1UWEH 4K3EH 1BVKA 3PWLA 1C5DA 3HG5A 3MMEA 1QVOA 4KKCD 2HFGL 2HWZH 3SGKC 3SKOA 1YVWA 1CQYA 5BRZD 4ENED 5C0FA 1UOKA 3P3UA 4J12A 3O3BB 4NWTL 1H9VA 1U2YA 4HWBH 4ZAKA 1F11A 4YMPA 5K9QG 2EDHA 2JEXA 5FGCB 1G5GA 4FLRA 2HG5B 2Y1AA 5IFJB 1PL4A 2HLFD 3QG6B 4HS8H 4RGND 1KP3A 5AVTB 2WLLA 1T0MB 4HYOA 4OLWL 1OF2A 2VM9A 4MXQC 1BVOA 3L3OB 4B9GA 5GW7A 1WZ1H 2X89A 1BV8A 3N0AA 2YKLL 1AR1B 2JKWA 2PW1A 4FG6D 4KO7A 4MT8A 5ID1B 4HWUA 4FFYA 2XFXA 4HW6A 1SDYA 3IETA 3RUGA 5FR3A 1V9PA 1TYJA 3VD1A 2R2HB 5DVNA 2EEBA 4RZKA 1CFVL 1KIUB 2NW2B 1PV0A 3R4RA 5TDNB 5JOPD 4JQIA 5E9AA 5DEGB 4YK4C 5DYFA 2H6UA 4LLVB 2UYLB 2HXAA 3NIGE 4RAIA 1UPGA 4F8LA 5LGNA 1ZT1B 2UXVA 3ATDA 3QFDB 3WN5A 4EBQL 1AQMA 4PJ6A 1EX0A 5EA0H 4IMLB 5H37A 1W8EA 1YPZB 3R8BB 2GB2A 4LFBO 3OMNB 2JK5B 2PWFA 1BBDH 4DR4O 1T7WA 4Z7UA 2W81C 5IYZB 3Q6GH 1XMWA 5FL7G 4F1SA 2ZKWA 3FK3A 5EIIA 1DBBH 1OSEA 4WSKA 3IF1B 3Q13A 3QG6A 3LPFA 4AW4A 2DTMH 3BQVA 1TQUA 3VI4B 1UURA 4DQAA 4NN7B 1K92A 2IH8A 3T0EB 5LYJB 2ZM6O 3CX5K 3UO3A 4FLTA 3AXLB 4G7VL 1XF3B 1O7DE 2DN7A 1RD6A 1AR5A 3QIWC 3FB8B 4URTB 4GY4A 6CGTA 1CI3M 4X6DA 3CPLB 1B4RA 2HFEC 3W7WA 1BBJB 1OCZC 3J7HA 3ZMUA 3WN5C 2JRIA 1UFGA 1K8IA 4UCTA 1J1PH 1R1CA 2VYRE 3DV4A 2C9SA 4NAJA 5CWSA 5CA0B 5B7MA 3J2PA 4JN2B 2UXCO 3BD3A 3MRLB 2ZCZA 3F7YB 3HNSL 3WFBH 1I08A 5KYYA 4AUUA 1S5JA 4ODSL 5TH2A 1D5MA 2C9QA 4NCC2 3UPRB 3M6DA 5C9KA 2AXJA 4JF3A 3ZR6A 4MA1B 4L8BA 2X0VA 1WT5A 2WAHA 1RZ7L 1FFRA 4JFYA 4DUVA 1OGAB 3BVNB 2FIRT 4OF6A 2PYJA 1U8CB 1IM9A 2HVBA 2OCFD 3SDLA 3PWUA 3WEXA 4UCSA 3OUFA 4RAUB 5EU6B 4OJFH 3JAMN 4RZCA 3IJSB 1I7RA 4B50A 4IHJA 4FFWD 2X1PA 1HT6A 5D7SH 4KZDL 3T4DA 1MCRA 1QYGH 4DUZB 4JGUA 4K8RH 2OMYA 4ORGA 4WY7L 4HCIA 1FZMA 3HE6B 5D7LA 2TAAA 5C0AB 3ZDZE 3FKUS 2CK0L 1JFFB 5DLLA 3SZ6A 5KSBF 2W0FB 2JJTC 4HWBA 1CFNA 4OB5L 2XTJE 4NAMA 3A4AA 4X7SL 4DETA 5CN3A 1ZIAA 2Q73A 4NUPA 2AXTZ 4X4XA 2E76C 2DQIH 4IQHA 4Z7WF 4B5ZA 4K3DH 4MXVF 4L5FH 1L0NH 3AABA 3M1BB 3MDSA 1BVNT 4HBCL 5A2FA 5HSFA 3BAIA 1TIUA 3T3PE 4AH2B 1GZQB 1FLRH 4I77H 3GGWB 1MY5A 4KPHL 5K1JA 1OAQL 2L0DA 3T8MA 3FN3A 4GSDH 1ZSDA 2X4TA 3MBWB 4J39A 2CO6A 3OTOB 1HWWA 2VDLH 3ZL1A 3LRHA 2FVNA 4O2CA 3EYVB 1KGJA 3MLUH 2G3ZA 4RA3A 2ZXWB 2Q86A 3EFFB 1CGSH 3PHQA 4CVXA 3RGBA 4I55A 4XNMA 3BZFB 1Z9MA 3H56A 3SBWC 5D7LD 3VXNA 3ZOAA 1AHMA 2EEFA 2FBJH 1CLYH 2VLKB 5I8OL 4TSAL 4JANA 1RZKC 1M7XA 3HFML 4FQXD 3W7XA 5KHJA 2ZUUA 1R5WA 4AHCA 1MUJB 3CPLA 3QUMB 2N1KA 1JK8A 1SJXA 2K8QA 4YHZH 3BHPA 4JV5O 3VFNA 4RGOL 3ECBB 4UTAH 4Q74A 3E7JA 4DCQA 3WCYA 1AHWA 2FYUH 1CDUA 4M56A 4WJG3 1SQPH 2OI9B 1J0KA 1JPGB 4P4KD 1U8IB 4Y19E 1ITCA 4WI0A 4JY4B 4NIYE 2XWEA 3ERXA 5CKGA 4R84A 1E9QA 4KRPD 1MUJA 3O3UN 4AEFA 4AUJA 3AITA 4GAGL 5KANG 5F3BA 3GSNH 2WIMA 3BUTA 4WEBH 4N2KA 1MN4A 2CKBH 4GRLC 4RLDA 5DJ6A 1TETH 1G6VK 3IKKA 1J18A 1CBVH 3BZFA 1UWYA 1OP3K 2RQ8A 1ZLVK 3BCFA 3AB0B 4NNPL 4DFIA 3UGEA 2ZUTA 1XMOB 3PHQB 4GRWH 4LEBA 4MJ2A 4TNFA 4TVPL 1BXVA 4YZFF 1JPEA 5F44A 3TM6A 4IBVA 2GSGB 2CHXA 5C0AD 2JVUA 5EU7E 5B1BB 2ZUVA 3ARWA 1WPXA 3RY4A 4P07A 2Q7AA 2JV6A 1TFPA 4NO0A 1F4YH 4NUJB 3H9HA 4IGBC 4WFFE 1MEXH 3WOVA 1ND0B 4I3RH 3NN8B 3MRMA 3O41B 3VMOA 4LLMB 2R2BA 2I5YH 3QZWG 3AREB 3FU3A 3BAWA 5TF1L 3ZYIA 4ONGL 3FB7B 4BKSC 3OKEB 4G1MB 1GAFH 3I6LD 2C3HA 4LL4A 4F7PB 3CD6V 2KLRA 2CDGB 4WWNA 3MBEA 3SE8H 5E24E 35C8H 1OP5K 5JORB 2BXZA 1EBPA 2HLEB 3B2XA 2ETWA 1WDAA 3UZEC 1Z5HA 1UFIA 3WSQH 2Y36L 4L4VA 3HMXH 4HP5A 4LPWA 1QZ1A 4RAUA 5EU6A 3U9WA 3V9FA 4Z3JA 1IM9B 2WQVA 5JPMC 1AROP 4IYKA 3VXTA 3GMRA 2UVFA 4NQVB 2IQ9H 2PO6A 2X70A 1A64A 1PKXA 4HUXA 3TO4B 3X3FL 2MTAA 4YUEH 5JW5A 4PJHE 4J6RL 5FAAA 4K5OA 4KTDL 3BP4B 4XN8A 4L37B 4OLUH 5JW3L 1PZBA 4UTBA 5FNVB 1ILUA 4OV6F 3VOUA 1IGMH 4LHUA 5EN3A 4Q4EA 2HFTA 1D6VH 3HE7A 4TOYH 2JKRM 1UM5L 9CGTA 2CTRA 2EKSA 2I69A 3ECWA 3T1FA 4PWGA 1X9LA 5BNXD 5HYJA 2Y07H 4WEUD 4G9DB 2BCCH 3KWWA 2CTQA 4N8UA 5FM5M 3BY6A 3D3VE 5L88L 3MOAL 1OT2A 1BXUA 4WTZA 3PJSA 3P0GB 4WNQB 5EOCL 2QVIA 3QNYA 5KS9F 1RPRA 1ES0A 2CG9X 3GJFH 3P40A 1NEZA 4FXKA 3T4AC 4LF5O 1GM9A 3CDZA 1FYJA 5HYJE 5D2LA 5MHSD 4AJWA 4HGWA 1ZT1A 1QKZH 5BZWB 4IJTA 4OJEH 1U0QA 2NUPA 3A5VA 3FULA 5TFSH 5EEUA 3IJ7A 3HRZC 3PS6A 4TQDA 3RDTB 4IK7A 1KYAA 4PVBA 2XZQL 2F5BL 5GSVB 2PUQT 2AEPL 3L2MA 1W0JG 3VRLE 4HJJL 3MRNB 2J1YA 1JJUA 1IJNA 5AVUB 1QLEH 2W0FA 4IKIA 3SYPA 4K23H 2NYZA 2BFVH 1K4CC 3QPKA