3JYIA

Structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELGEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical evidence that a TEM-1 beta-lactamase N170G active site mutant acts via substrate-assisted catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 95
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3jyiA00
4KZ7A 3VP2A 4R0QA 3BFGA 5KMWA 3HLCA 3MZEA 1G68A 4YINA 5HARA 1YLTA 3UY6A 2BG1A 4EBPA 3BEBA 1GHMA 2C5WB 2C6WB 2XF3A 5HAQA 1MPLA 3ZG7B 1FCMA 4UAAA 4X55A 5F1FA 1ESIA 4Z9QA 3WWXA 3PAEA 5F83A 1WYCA 5GLCA 4OH0A 4S2NC 3IXGA 4KZ8A 4IEDA 2E8IA 3IF6A 2VGKA 2ZM8A 5DTSA 3LEZA 1QMFA 5I94A 1KVLA 4S2LA 2XEPA 4KG5A 5A91A 3VSLA 5EVIA 3O86A 3IF5A 2A49A 2ZQCA 1FOFA 4MBKA 3IHAA 4EUZA 3S22A 1BLHA 3GSGA 4WMCD 2WZZA 3UO9A 5BOHA 1K25A 2ZQ9A 3BFEA 3V39A 3ZFZA 3S4XA 4BD1A 2IWBA 1S6RA 4IVKA 1MWTA 4ZAMA 4KZ5A 5AQBA 3IT9A 1Z6FA 3ZG5A 4LENA 4HBTA 4KQOA 2HDSA 3PBQA 2WGWB 4PM8A 1SDNA 5A92A 3PBNA 3C4OA 4DE1A 4E6WA 1IKGA 2Y2JA 4PPRA 3G2YA 1CEFA 4GKUA 1LI0A 3GMWA 2WK0A 3UDXA 2Y2MA 1IYOA 1JWVA 3SOIA 1PWGA 5F1GA 2WZXA 5CXWA 2EX6A 1L0EA 4S2OA 3IWIA 2GDNA 3DWZA 3HUNA 3NBLA 4RYEA 5DVAA 3MXRA 3IWOA 3TG9A 3N4IA 1K54A 3SH8A 3N6IA 1IEMA 2CC1A 1GA9A 1PZPA 3NDEA 4WYYA 1LL5A 1GHIA 1BSGA 1JTDA 3N8RA 4GD6A 1M40A 5CECA 3GVBA 1MXOA 3M2KA 3C7VA 3UNWA 5JYOA 5AQ7A 4O7DA 3W4PA 4ID4A 1K4FA 5EE8A 1IYPA 2I72A 1BT5A 3A3IA 3WS1A 1IYQA 1YLZA 1ES3A 3Q7VA 1SDEA 3MXSA 2WKHA 4S2NA 3DTMA 4WZ4A 1IELA 1XX2A 2V20A 1JWZA 1LL9A 5GLBA 4B4XA 3GQZA 3RXWA 1HTZA 4OLGA 3NDGA 3MBZA 5GLDA 1NYMA 2X01A 3BLSA 3EQUA 4LV0A 1JTGA 4ZJ3A 2WKEA 4QJGA 4Y0UA 4R4SA 4P0MA 4BL3A 4JBFA 1ONHA 1PIOA 2Z2LB 3Q82A 3GTCA 3HBRA 4KZAA 4E3KA 3PAGA 3S1YA 1CI8A 1ESUA 4MEZA 3N8LA 1YMXA 3AGEA 4KZ4A 4IBXA 5FASA 3ZNTA 5M19A 4JXSA 4R1GA 4F94A 1K54C 4L0LA 5CRFA 2ZMAA 2J9OA 4OONA 1FR1A 3RXXA 2H5SA 4WM9A 5FI7A 2H10A 3WS4A 1U60A 3MKFA 4E3NA 2RCXA 1LHYA 3TOIA 1K57C 1MY8A 2Y2HA 1KDWA 3OCNA 5CHUA 3UPPA 4Y0TA 1W7FA 4WZ5A 4ZDXA 2H0TA 3FV7A 1K6RA 5J8XA 5E2EA 1FCNA 3C4PA 3FKWA 3ZNYA 1EROA 5L2FA 3VP1A 4GZBA 1E3UD 4NETA 3SS5A 3LY3A 4X6TA 1SHVA 1BUEA 1IYSA 2J9PA 4N9KA 3IXBA 5CEDA 1XGJA 4RVAA 3ZVTA 3HREA 4EWFA 2Y2QA 1SCWA 4WZ5C 4E3MA 5EOOA 4EBNA 4HBUA 5EPHA 2ZC4B 1KGGA 1NZUA 2ZC6B 2ZQDA 4OKPA 2ZM0A 3ZCZA 1KDSA 3ZG8B 4BL2A 5HW3A 3CMZA 3N8SA 4N1HA 1K56D 1L0FA 1O7EA 3HLFA 1MWUA 1DJAA 1PWCA 5GLAA 5TR7A 3HUOA 4PM5A 3M6BA 5FQ9A 2WUQA 4QHCA 1ERQA 1RGZA 5EUAA 5FI6A 5FQIA 1EWZA 4OVDA 4OPZA 2QMIA 1LI9A 5E2FA 1E25A 4M3KA 4MBFA 5TFQA 5FI2A 3G2ZA 4OLDA 4C75A 4OPYA 1BLPA 1YLYA 2OV5A 3BRMA 4RA7A 2EX2A 2Y59A 2EX9A 3IQAA 3BFFA 2Y2PA 5AQ9A 4KZ3A 5HL1A 2ZQ8A 1VM1A 4PM7A 4WELA 1W5DA 2XR0A 1XPBA 1FSYA 4DF6A 1BULA 1GA0A 5CHJA 3FZCA 2IWDA 1K4EA 1L0DA 3PTEA 2XK1A 1E4DA 1K56A 3IH8A 5CGWA 5E2GA 5AQAA 4K0XA 4OQ0A 4OPQA 4BJPA 4U0XA 4DXCA 1LLBA 3VSKA 2ZD8A 5CHMA 3VFHA 4RX3A 4DE2A 3FYZA 3IF6B 1DY6A 1PYYA 2H0YA 4FD8A 4S2PA 2JE5A 1PW8A 2A3UA 2HDRA 4ZBEA 3V5MA 3OPHA 4Y0OA 1WE4A 2EFUA 1YQSA 1BLCA 1CI9A 5KSHA 3IF6C 3ITBA 1XXMA 4JPMA 2EX8A 2EXAA 1ES2A 3HLEA 1CK3A 3VP4A 1YLPA 4XUZA 3O3VA 5KZHA 5HX9A 4K91A 4GB7A 1N9BA 1ZG6A 2ZM2A 1I5QA 1FQGA 3NIAA 2RL3A 4JXWA 5A93A 1I2WA 1YMSA 4E3JA 4N92A 1SKFA 4ZJ2A 3VOYA 3BECA 3VFFA 1K38A 2Y2IA 3G35A 3NI9A 3SS3A 3W4OA 2Y2GA 3O87A 3SS4A 3BLMA 4HESA 3OPLA 1TDGA 1DJBA 4JKTA 2X02A 5EOEA 4FSFA 3NCKA 1PI5A 4QY5A 3LY4A 4KG6A 3ZHHA 2HP9A 4C3QA 4LCLA 5EECA 4X68A 2XFTA 4LCMA 2PBYA 4X53A 1NXYA 2ZQ7A 1BZAA 3N7WA 1FSWA 2Y2NA 3E2LA 4PM9A 3UE3A 1RP5A 4GN2A 4WBGA 4S2JA 3OPPA 4GNUA 1KVMA 3FWLA 3CJMA 1ES5A 3PBSA 2JCHA 1K57A 3W8KA 4BD0A 5FA7A 3BFDA 1EI5A 3HUMA 1W8YA 4B4ZA 1HZOA 2OLVA 2ZC5B 5DTKA 1Y54A 3WS5A 4FH2A 2ZC3B 4JF6A 4OPRA 2FFYA 5FDHA 5A90A 5TGFA 5CERA 4FCFA 3A3FA 4Y7PA 1Q2QA 1QMEA 5DF8A 5EVLA 4DRTA 3UE1A 2PU2A 1RCJA 4BLMA 1HD8A 2JC7A 2Y4AA 2Y91A 4OP8A 3UPOA 3WS2A 4UA6A 2P9VA 4DKIA 4S2MA 4KQQA 2V1ZA 2XDMA 4E3LA 1W79A 1YLJA 1PWDA 1NY0A 1XGIA 2P9VB 2QPNA 3C5AA 5CGSA 5CEBA 4GOGA 5D3OA 1WYBA 5EVID 5F82A 3DW0A 3A3JA 5E2HA 5HAPA 3G32A 5GL9A 5IHVA 4ZTKA 2WGVA 3VP0A 4QY6A 4RX2A 4R23A 4FH4A 1K55A 5HAIA 4IBRA 2ZJ9A 5FQQA 1GCEA 1H5XA 3GRJA 3HL9A 4WEKA 2XD5A 3VMAA 1CEGA 3OC2A 2HP5A 2V2FF 3FKVA 4JLFA 4KZ9A 1NZOA 4XXRA 1PW1A 4BQMA 3V3SA 3GV9A 5E43A 3OPRA 4DXBA 1ZC2A 3D4FA 1MKIA 5FQKA 4XUXA 4X69A 3BYDA 4N9LA 4MNRA 3RJUA 4YFMA 1K55C 1NJ4A 2IWCA 3GR2A 4A5RA 1I2SA 2XLNA 3UDFA 1PZOA 1TDLA 3UN7A 4UA7A 2Y2LA 1N4OA 1W8QA 4GDNA 3P09A 1FCOA 1ONGA 4UA9A 2WKIA 1ES4A 3WRTA 1JWPA 3QHYA 4OQIA 1AXBA 3ZG0A 4QD4A 3HLBA 3UE0A 1C3BA 2ZLYA 3IXDA 3HLDA 2WGWA 4OOMA 4NK3A 4PMAA 4ZJ1A 3HLWA 3IH9A 4IVIA 3V3RA 2WAEA 4BENA 2WAFA 3B3XA 5KSCA 2EFXA 4E3IA 3EQVA 2Y2KA 4UHUA 3W4QA 2DNSA 4R4RA 1L0GA 4B88A 5FSRA 4CJNA 3A3EA 5FAPA 5U47A 2JBFA 3ZG9B 2P74A 2ZC7A 1ZKJA 2DRWA 3ZVWA 2B5RA 3QNCA 3WRZA 4LV3A 3Q1FA 1GHPA 2J8YA 1ZG4A 1YM1A 3Q7ZA 4WEJA 5JYPA 1DJCA 2Z2MB 4KG2A 4OQGA 3BM6A 1K6SA 3SH9A 1KGEA 1BLSA 1MBLA 1L2SA 5GHZA 3I7JA 1KE4A 4PM6A 3Q7VB 4JXVA 1OMEA 3NY4A 1O07A 5FAQA 1XA7A 1IKIA 2X71A 5FATA 2G2UA 4P85A 5M18A 3LCEA 1RGYA 5FAOA 3MZDA 4CPKA 3PBTA 3OZHA 3ITAA 2PU4A 3IXHA 1S0WA 4H8RA 1G6AA 3AGFA 4U0TA 5CTNA 2G2WA 1XA1A 5DF7A 5G18A 3DWKA 2XQZA 3E2KA 3UDIA 1H8YA 5GHXA 4HEFA 3C7UA 2WYXA 3G31A 3Q81A 4WMCA 3PBOA 3AGDA 4DE3A 3G34A 1JVJA 5M1AA 4OOYA 2Y55A 4GD8A 3QNBA 3VOZA 1XP4A 2XFSA 3BFCA 4S2KA 4DDYA 1Q2PA 1PI4A 1MWSA 2OSUA 3M6HA 4QU3A 5DF9A 3ISGA 4OOLA 1E3UA 5CGXA 4E6XA 4U3TA 4MLLA 4R3BA 2XD1A 2VGJA 2QZ6A 1M6KA 3NC8A 4P6BA 4P87A 3VP3A 3O88A 4EQIA 4KQRA 3ZGAB 2DCFA 3A3DA 3WS0A 1ERMA 1MWRA 4KENB 1NYYA 3MKEA 3P98A 4LV2A 4S2IA 3OCLA 3JYIA 4JF5A 1TEMA 4EBLA 2Q9MA 1YT4A 3HVFA 1FR6A 2HDQA 2J7VA 4C6YA 2HPBA 5CTMA 3HLGA 2HDUA 4GDBA 1NRFA 5DTTA 4DE0A 4Q8IA 1XKZA 2BLSA 4MBHA 1VQQA 4R3JA 2WADA 3Q07A 4JXGA 2EXBA 3CZDA 1H8ZA 4EV4A 3IWQA 2UWXA 1TVFA 3MZFA 1BTLA 3TSGA 1KE0A 2Y2OA 4LV1A 3CG5A 5EVIB 3UPNA 4E3OA 2XH9A 4K0WA 2HP6A 5HFOA 3SH7A 1ALQA 4QB8A 1KE3A 4KZ6A 4OQHA 2FFFB 2OLUA 1J9MA 3G30A 5GHYA 2R9XA 2XGNA 3ZDJA 4D2OA 2ZQAA 4DDSA 3LO7A 3PBRA 2Q9NA 5EVIC 5FQJA 3M2JA 2WGIA 3G4PA 4JF4A 4KZBA 4N1XA 4X56A 5FQMA 4OP5A 3MFDA 3IHBA 1HVBA 2R9WA 1KGFA 1YLWA 3V50A
chains in the Genus database with same CATH superfamily
4KZ7A 3T1XA 3VP2A 1LSWA 3HLCA 1G68A 4YINA 3UY6A 3E4QA 1GHMA 3ZG7B 4X55A 1ESIA 2B95A 1WYCA 4KZ8A 4I3AA 3IF6A 2VV8A 1KVLA 2XEPA 4KG5A 2PRFA 3IF5A 3NHQA 2A49A 4RQ9A 2EWVA 3S22A 1BLHA 3UO9A 2ZQ9A 3BFEA 1ODVA 1S6RA 2JKTI 1MWTA 4ZAMA 2P08A 4HBTA 3PBQA 5A92A 1T1AA 1SZVA 1DP6A 3PBNA 3A0VA 1T1BA 4GW9A 4PPRA 2I9VA 3G2YA 2A24B 1LI0A 2WK0A 3IX8A 5F1GA 3TW8A 4NXBA 3IWIA 5AJGA 1EW0A 3MXRA 4IJGA 3LICA 1IEMA 1PZPA 1LL5A 1BSGA 1M40A 3A0SA 1K4FA 2I72A 3A3IA 2Y8HA 4EXOA 2WKHA 1IELA 4HJ6A 1HTZA 4OLGA 3NDGA 2X01A 1SKOB 1JTGA 2OWHA 4P0MA 2Z2LB 3Q82A 4E3KA 1ESUA 3P7NA 4O0PA 5FASA 3ZNTA 4F94A 4L0LA 5CRFA 4H6JA 3T1SA 3UMEA 2H10A 4Y13A 2RCXA 1D1JA 2D01A 1MY8A 5CHUA 2W0NA 1OTBA 1V9YA 3FV7A 3ZQ5A 5E2EA 1EROA 4LRZE 1SHVA 2W3DA 1BUEA 1IYSA 3JVUA 5CEDA 3FPWA 4EWFA 1SCWA 4E3MA 5EPHA 2ZC4B 2ZQDA 3PHYA 3ZG8B 4BL2A 3CMZA 1K56D 4ESPA 3HLFA 1MWUA 1DJAA 2P04A 3HUOA 5FQ9A 4QHCA 1ERQA 3IX4A 5FI6A 1EWZA 4OVDA 1LI9A 1E25A 4MBFA 4MDZA 1LSVA 5HWTA 2OV5A 3BRMA 3UB6A 2PHYA 2EX9A 4Z1WA 5HL1A 3S7NA 2Y79A 2M7UA 1W5DA 2IWDA 3PTEA 2MJ6A 1UWNX 3F1OA 1F5MA 1LLBA 3VSKA 4DJ3A 4X1LA 3NULA 3IF6B 1DY6A 2H0YA 3E98A 1PW8A 4ZBEA 4F3LB 3V5MA 4Q0IA 4JGQA 2EFUA 1BLCA 1CI9A 3IF6C 3ITBA 1ES2A 3BQ8A 1ZG6A 3KSHA 2RL3A 4JXWA 1I2WA 1SKFA 3BECA 4I39A 2KLIA 1K38A 2B18A 3SW1A 1OPXA 2QJ5A 4QY5A 4KG6A 3VE3A 5HDDA 1NXYA 2ZQ7A 1FSWA 3E2LA 2PYPA 3CHWP 4GNUA 3FWLA 1ES5A 2JCHA 1K57A 3BFDA 3SZTA 5IU1A 3QP5A 5DTKA 2FFYA 5A90A 1F9IA 5HWVA 5CERA 4FCFA 4Y7PA 4IUHA 1Q2QA 1QMEA 5DF8A 3S7OA 4BLMA 3LGOA 4WLAA 4OP8A 3WS2A 2P9VA 1BYWA 4S2MA 2XDMA 4BBVA 3C5AA 5CGSA 4GOGA 2HF6A 2XRNA 2ZL1A 4R23A 3RFBA 5HAIA 4IBRA 2ZJ9A 4WEKA 4H6JB 3FKVA 4KZ9A 3DTKA 1OTEA 3OPRA 4DXBA 4FUWA 1MKIA 3T4QA 4MNRA 4YFMA 2ZMFA 4IUKA 1NJ4A 1PZOA 4HOIA 1TDLA 4UA7A 3K2NA 2Y2LA 1K0KA 1XJ2A 3HJKA 4PAUA 3WRTA 3KYQA 3QHYA 4QD4A 3HLBA 2QKPA 4NK3A 3QP4A 3CWFA 3V3RA 5KSCA 2ZL1B 2K31A 4E3IA 5EV0A 4R4RA 5LBRA 4CJNA 2E8JA 3EGDC 4LV3A 3Q1FA 5DKKA 2J8YA 2QJ7A 3CITA 1YM1A 3Q7ZA 5JYPA 5FEGA 2J3TD 4OQGA 4HP4A 1MBLA 1KE4A 3Q7VB 3NY4A 1IKIA 2X71A 2ZOHA 5FAOA 4CPKA 3MZDA 2XSSA 3PBTA 3ITAA 1STZA 3DWKA 2W3GA 3E2KA 1H8YA 4HEFA 4MN6A 3Q81A 2VV7A 3KSFA 2CMNA 3PBOA 4GS9B 1F2KA 5M1AA 4L9FA 3BFCA 2YKFA 1PI4A 1MWSA 2OSUA 3M6HA 3MQQA 3ISGA 5CGXA 4MLLA 2XD1A 3OLOA 4EQIA 4KQRA 3A3DA 4KENB 3MKEA 3P98A 4DN0A 2FZ0A 4EBLA 3HVFA 2HDQA 4C6YA 3NOUC 4Q8IA 1XKZA 4EQ1A 2BLSA 4R3JA 2EXBA 1TS8A 4BMWA 2UWXA 3TSGA 3MQ0A 1YSQA 1NLYA 2OLUA 4UEYA 3LO7A 5EVIC 1D7EA 2EWWA 4X56A 2HJ9C 2VGLS 1HVBA 3MSHA 3R7WA 1A0KA 4HQAA 4R0QA 3BFGA 5KMWA 5HARA 1YLTA 3CLOA 2DMWA 2JHEA 1FCMA 2QHKA 4UAAA 2VEAA 1OTDA 4WL9A 4IEDA 2E8IA 3GECA 3LEZA 5I94A 3O86A 2INWA 2M1CA 3MFXA 4HIAA 4XT2A 5J7EA 4EUZA 3R7WB 4WMCD 5BOHA 3ZFZA 3S4XA 2IWBA 2J3WA 5AQBA 4LENA 4KQOA 2WGWB 1SDNA 1OTIA 3UMDA 2Y2JA 3DTEA 3EGXC 3GMWA 1MZUA 4FOFA 2Y2MA 5EM0A 2P7JA 2V0UA 2WZXA 2EX6A 2GDNA 3T4JA 3DWZA 3HUNA 3LUQA 4RYEA 5DVAA 2V8FA 2O9AA 2CC1A 3NDEA 3RH8B 5HZHA 1GHIA 4GD6A 4G3WA 3C7VA 5JYOA 2HJEA 5AQ7A 4O7DA 4ID4A 4EEUA 5EE8A 4LGWA 3Q7VA 1SDEA 3LIFA 1YAXA 3B47A 2V1BA 1G5UA 3BLSA 3EQUA 2PD8A 4ZJ3A 2PAVP 2WKEA 3DAVA 4P6ZS 3GTCA 4L9EA 5DKLA 4JGPA 4NEED 4MEZA 3N8LA 1YMXA 3A0RA 4JXSA 1K54C 2ZMAA 1TS6A 3BWLA 5C5KA 3T4LA 1N9OA 3MKFA 4ETXA 4E3NA 3T4SA 1DRMA 5HWWA 4Y0TA 3UPPA 2H0TA 1S1ZA 2V1AA 4HI4A 4RVAA 3ZVTA 4MMNA 3BW6A 3IS2A 4WZ5C 5EOOA 1NZUA 3UB9A 3NOTC 5TR7A 5GLAA 1CQAA 4GHIB 4M3KA 5FI2A 3D3OA 4C75A 4OPYA 4RA7A 4L9GA 2EX2A 2ZBBA 4ARZB 2YKHA 4KZ3A 2PD7A 3F1NB 2JKRI 2ZQ8A 3FPVA 1VM1A 2XR0A 1E4DA 2O99A 5G4ZA 2XK1A 4KUKA 4UQIS 1TS7A 4BJPA 4DXCA 5CHMA 3L7HA 2V0WA 4CLCC 2VGLM 2A3UA 3OPHA 1WE4A 4JPMA 1CK3A 5FL3A 3CPTB 1Y4OA 5HX9A 4WN5A 4GB7A 1N9BA 2ZM2A 3LIAA 4E3JA 2Y2IA 3TE8A 3NI9A 3ICYA 2Y2GA 3BY9A 3ULFA 3MS6A 3OPLA 5EOEA 2X02A 4FSFA 4EESA 4MCWA 3ZHHA 2HP9A 4LCLA 5EECA 5TJJA 3E4OA 4HNBA 3N7WA 2Y2NA 4HY8A 4PM9A 2UV0E 4S2JA 3OPPA 3BQAA 3DBAA 4I5SA 3R4KA 4HP9A 2JKTM 2ZC5B 2OLVA 2W3EA 2VA0A 4JF6A 2B02A 4JGRA 5FDHA 3UE1A 1VB6A 1RCJA 3F1OB 3H82A 4DKIA 2W1TB 2L0WA 3C2WA 4E3LA 1NY0A 5CEBA 5FEFA 1WYBA 4D60A 3CAXA 3DW0A 3IX3A 5HAPA 3PYPA 4BBTA 1K55A 3U2AA 1CEGA 4Q0HA 4XXRA 1PW1A 4I3IA 3H7WA 5HPFA 4N9LA 2IWCA 3GR2A 1I2SA 3UDFA 1N4OA 1FCOA 1ONGA 3E4PA 1JWPA 1AXBA 3UE0A 3IXDA 3HLDA 3HCYA 1TF1A 4IVIA 2WAEA 3B3XA 3EQVA 4P6ZM 2Y2KA 4UHUA 2DNSA 1P0ZA 5FSRA 3H9WA 5U47A 3ZG9B 2P74A 2ZC7A 5L09A 2B5RA 2VV6A 3QNCA 3WRZA 4WEJA 2Z2MB 4KG2A 2WKRA 1KGEA 1L2SA 3I7JA 4HJ4A 4PM6A 1VEUB 5FATA 4R70A 4P85A 4NXEA 3LIDA 5DF7A 1S0WA 2ZOIA 5CTNA 1G6AA 1LSXA 3AGFA 2G2WA 5G18A 1MKMA 1GSVA 3C38A 3PR6A 3C7UA 2WYXA 3G31A 3K3DA 4WMCA 3AGDA 4DE3A 3VOZA 3QNBA 1XP4A 2XFSA 4DDYA 3CUEC 1AWIA 2W1RA 4E6XA 4OOLA 1E3UA 4U3TA 2HZ5A 3T50A 5L8MA 3GDIA 2VGJA 2QZ6A 3NC8A 4O01A 1G6OA 3LI8A 2O9BA 1ERMA 3IS2B 3JYIA 2Q9MA 1FR6A 5DTTA 4DE0A 3MXQA 1ZTUA 4CLCE 3KSGA 4XT2B 4EV4A 3IWQA 3MZFA 1BTLA 1KE0A 4E3OA 3UPNA 5HFOA 1ALQA 4QB8A 3UB8A 4D2OA 1L3LA 3M2JA 2WGIA 4KZBA 5FQMA 4OP5A 3MFDA 3IHBA 3EOIA 3C8CA 1PFLA 3UE6A 2W1TA 2BG1A 1HLUP 2XF3A 5TBMA 5HAQA 1MPLA 2VX8A 1NRJA 5F1FA 5F83A 5GLCA 5DJTA 4S2NC 3IXGA 3F1PA 5DTSA 3TJZC 3VSLA 4LRYC 3S7PA 2VKSA 3MR0A 4II7A 1FOFA 2O0YA 5KIZA 3CI6A 2WZZA 4ZRRA 4KZ5A 3IT9A 1IFQA 2HDSA 2M7VA 1XJ4A 3D9YA 4DE1A 1IKGA 1FILA 5J3WA 1CEFA 4GKUA 1XJ3A 1IYOA 1JWVA 3SOIA 1PWGA 5CXWA 1L0EA 4S2OA 3LFVA 5F69A 4Y5FA 5EVEA 3TG9A 2OOLA 3U4LP 1GA9A 3EEHA 4LFUA 1JTDA 3N8RA 3UB7A 4IHQA 5CECA 3GVBA 3M2KA 3W4PA 1OTAA 5DFXA 4HH3A 1ES3A 2A24A 4K08A 1N9NA 3DTMA 5GLBA 1XX2A 1LL9A 1KOUA 4ME4A 5HPIA 5GLDA 4ARZA 4QJGA 4BL3A 4JBFA 4KZAA 3S1YA 1CI8A 3AGEA 4KZ4A 5M19A 1GSWA 4R1GA 2J9OA 2OAP1 4OONA 3E0YA 3RXXA 2GX5A 2H5SA 4WM9A 3WS4A 4PKYG 3KYEA 3OOVA 3TOIA 2HV1A 4JGOA 3CUEA 2Y2HA 1KDWA 5HDSA 3OCNA 1W7FA 3TRCA 1IOUA 5TBMB 4ZDXA 5AVFA 5L2FA 3VP1A 4GZBA 1W63M 1E3UD 4NETA 5A8BA 2J3TC 4R38A 2J9PA 1XGJA 2ACGA 3HREA 2Y2QA 4B93A 4OKPA 3ZCZA 2ZC6B 1XFQA 4N1HA 1L0FA 1O7EA 2PR6A 1PWCA 4PM5A 3BY8A 1RGZA 4YWZA 3ZYTA 4OLDA 1YLYA 1VETB 3IQAA 3BFFA 3T4KA 4EETB 3FG8A 1D06A 4PM7A 4WELA 2PT7A 1XPBA 1FSYA 1GA0A 3FZCA 1L0DA 5E2GA 3QP2A 1CF0A 3FC7A 4OQ0A 2L4RA 4E04A 4MN5A 4RX3A 3FYZA 4ETZA 1PYYA 3QP6A 4FD8A 3JPUA 4Y0OA 1YQSA 4WF0A 5KSHA 1XXMA 2EX8A 2EXAA 4NKPA 5HD3A 1ACFA 3VP4A 2EA9A 5KZHA 2A2LA 3NIAA 1YMSA 2R78A 4ZJ2A 3VOYA 4Q0JA 3G35A 4I38A 4HHDA 3OBFA 3SS4A 4HESA 3QP8A 4JKTA 1DJBA 2OAQ1 3LY4A 5HL6A 1W63Q 5K5BA 4X68A 2XFTA 2PBYA 3F1NA 4FTXA 1BZAA 4AFIA 4R3AA 3UE3A 2JKGA 4F3LA 1YKDA 3CJMA 4CQHA 1UWPX 4BD0A 5F68A 1HZOA 3WS5A 1S4RA 5TGFA 2PU2A 2Y91A 2K2NA 2AVXA 4GS9A 1W79A 1YLJA 3P01A 2D02A 5D3OA 3A3JA 3IBRA 2BTFP 1VEUA 4ZTKA 2WGVA 4RX2A 3L9KA 1OJGA 1GCEA 1H5XA 2W27A 2XD5A 2V2FF 1NWZA 4BQMA 3V3SA 2IA2A 1ZC2A 3T1QB 4G3KA 3D4FA 5FQKA 4XUXA 4X69A 3BYDA 3IBJA 3RJUA 1CJFA 1G28A 1MC0A 2XLNA 3UN7A 3NJAA 2L1MA 3O5YA 1W8QA 3P09A 4GHIA 4UA9A 1GSXA 2J80A 4OQIA 1C3BA 4CLCA 2O9CA 4BBUA 3W4QA 1L0GA 3A3EA 5FAPA 2JBFA 3ZVWA 3B33A 1GHPA 3T4TA 1DJCA 1K6SA 2GJ3A 3LIBA 1BLSA 4JXVA 1O07A 3LR4A 2NUTC 2G2UA 4QWOA 5M18A 3LCEA 5FDSA 2PU4A 4H8RA 3IXHA 1S4SA 4B88A 2V8CA 2XQZA 3UDIA 2XA7S 2W3HA 1XJ6A 1JVJA 2GNXA 3RTYA 4OOYA 1Q2PA 5J4EA 1UGUA 4R3BA 3C30A 1M6KA 4G3VA 4P87A 5I5LA 5F5YA 3MJQA 3WS0A 1MWRA 1NYYA 2HPBA 4Y17A 4GDBA 2HDUA 5CTMA 3JVVA 4GJ4A 4JXGA 3PXPA 3MMHA 1TVFA 1Y28A 1PRQA 2Y2OA 4LV1A 2OWJA 5EVIB 2XH9A 2HP6A 1KE3A 4NXFA 3G30A 2R9XA 2ZQAA 3PBRA 4CLCB 2BASA 4JF4A 5EFWA 4N1XA 1T19A 4EEPA 1XFNA 2R9WA 1KGFA 2JN7A 1YLWA 3V50A 2XA7M 3KSIA 3MZEA 4EBPA 3BEBA 2C5WB 2C6WB 3LR5A 2PBDP 4Z9QA 3WWXA 3PAEA 4OH0A 1P9WA 2VGKA 2ZM8A 3HJIA 1QMFA 4S2LA 5A91A 5EVIA 1LT0A 2ZQCA 4MBKA 3IHAA 1H8MA 1S1YA 3GSGA 1K25A 1P9RA 3V39A 4BD1A 2GZAA 4IVKA 3LI9A 2K7SA 4O8GA 2JKFA 1Z6FA 3ZG5A 1S67L 4PM8A 4UQIM 1X0OA 3C4OA 4E6WA 3VOLA 4Y2FA 3W2ZA 3UDXA 2HGVA 4LLOB 3NBLA 3D72A 3IWOA 3N4IA 1K54A 3SH8A 3N6IA 1OJ5A 5AVEA 4WYYA 1P97A 3H7WB 1MXOA 3UNWA 1IYPA 1J3WA 1BT5A 4Y15A 3WS1A 1IYQA 1YLZA 3MXSA 4WZ4A 4S2NA 1JWZA 2V20A 4B4XA 3DTIA 3GQZA 3RXWA 1YPRA 3MBZA 1NYMA 2Z6DA 4LV0A 4Y0UA 4R4SA 1ONHA 1PIOA 3HBRA 3PAGA 2H28A 4IBXA 1FR1A 5FI7A 1U60A 2VZWA 5L07A 4EU0A 1LHYA 1K57C 4WUJA 5HSQA 1DP9A 4CLCD 4WZ5A 2KDKA 1K6RA 5J8XA 1FCNA 3C4PA 3FKWA 3ZNYA 2KOIA 3SS5A 3LY3A 4NG2A 4X6TA 1PNEA 4N9KA 3IXBA 5IS1A 4EBNA 4HBUA 1KGGA 2ZM0A 1KDSA 5HW3A 3N8SA 3NOPC 3G6OA 1F98A 3VV4A 1TD5A 1LL8A 2Q0OA 3M6BA 2WUQA 5EUAA 5FQIA 4OPZA 2QMIA 5E2FA 5TFQA 3G2ZA 1BLPA 3CPTA 1S66L 3KYZA 2Y59A 3LR3A 2WKPA 2Y2PA 4PHTA 5AQ9A 4M4XA 3S7QA 4DF6A 1BULA 5CHJA 1FIKA 1K4EA 1K56A 3IH8A 5CGWA 2JKRM 4K0XA 5AQAA 4OPQA 4B9OA 4U0XA 2NUPC 4DMZA 2ZD8A 3VFHA 4DE2A 4HJ3A 2KX6A 4S2PA 2JE5A 2HDRA 4QPRA 2ZMVA 2LB5A 3HLEA 3VE4A 4YOFA 1ZHHB 1YLPA 4XUZA 3O3VA 4K91A 2LB9A 1I5QA 1FQGA 5A93A 4N92A 3VFFA 1DP8A 3EWKA 3SS3A 3W4OA 1H3QA 3MF0A 3O87A 2FH5A 3BLMA 1TDGA 3NCKA 1PI5A 3LEQA 4C3QA 4LCMA 4X53A 3UB5P 5DJUA 4BWIA 5CX7A 1RP5A 3MQOA 4GN2A 4WBGA 1KVMA 3PBSA 3W8KA 5FA7A 1EI5A 3HUMA 1W8YA 4B4ZA 1Y54A 4FH2A 2ZC3B 4OPRA 3A3FA 4LRXC 4EUVA 5EVLA 4DRTA 4GLQA 1HD8A 2JC7A 2Y4AA 4KQDA 1V9ZA 3QP1A 3UPOA 1OT6A 4UA6A 2Z6CA 4KQQA 2V1ZA 2V9AA 1PWDA 5IT5A 1XGIA 2P9VB 2QPNA 3LIEA 5EVID 5F82A 3KO6A 5E2HA 3G32A 5GL9A 5IHVA 5DFYA 1T1CA 3VP0A 4QY6A 3LR0A 4FH4A 1JNUA 3EEAA 5FQQA 3HL9A 3GRJA 3VMAA 3OC2A 2HP5A 4JLFA 5HDCA 1NZOA 3GV9A 4YNRA 5E43A 4PKYA 2QWSA 4KUOA 1SKOA 4MN7A 1K55C 4A5RA 1VETA 4X1MA 4I3JA 3T1RA 4Y3IA 4GDNA 2WKIA 1ES4A 2VLGA 2ZLYA 2PDRA 2WGWA 4OOMA 4PMAA 4X25A 1WA9A 4ZJ1A 1VHMA 3HLWA 1OT9A 3IH9A 4BENA 4LPZA 1T18A 2WAFA 2EFXA 1ZKJA 2DRWA 1ZG4A 2VJWA 3BM6A 5L10A 3SH9A 3T4OA 2PYRA 5GHZA 2XROA 5HD5A 1OMEA 2W3FA 5FAQA 1H0MA 1XA7A 3T12B 1RGYA 3OZHA 4U0TA 3V67A 1XA1A 5GHXA 2VK3A 3KX0X 1NLZA 3G34A 2Y55A 2QYBA 4GD8A 3H82B 4S2KA 4QU3A 3LYXA 5DF9A 5G4YA 2PR5A 4DJ2A 4P6BA 3VP3A 3O88A 1TS0A 3ZGAB 2DCFA 4S2IA 4LV2A 3OCLA 4JF5A 4R6LA 1TEMA 1YT4A 2J7VA 3HLGA 1NRFA 2G7UA 4MBHA 1Z09A 1VQQA 2WADA 4HH2A 3Q07A 5EM1A 3CZDA 4EW7A 1H8ZA 3BJNA 3K3CA 3CG5A 4K0WA 3SH7A 5MC7A 2WKQA 4KZ6A 5F6AA 1N9LA 4OQHA 2FFFB 3ZDJA 1J9MA 5GHYA 2XGNA 4GCZA 4DDSA 3F1PB 3NECA 4EERA 2Q9NA 5FQJA 4NXGA 3G4PA 3B42A 1YSPA 3ZG0A
chains in the Genus database with same CATH topology
4KZ7A 3VP2A 4R0QA 3BFGA 5KMWA 3HLCA 3MZEA 1G68A 4YINA 5HARA 1YLTA 3UY6A 2BG1A 4EBPA 3BEBA 1GHMA 2C5WB 2C6WB 2XF3A 5HAQA 1MPLA 3ZG7B 1FCMA 4UAAA 4X55A 5F1FA 1ESIA 4Z9QA 3WWXA 3PAEA 5F83A 1WYCA 5GLCA 4OH0A 4S2NC 3IXGA 4KZ8A 4IEDA 2E8IA 3IF6A 2VGKA 2ZM8A 5DTSA 3LEZA 1QMFA 5I94A 1KVLA 4S2LA 2XEPA 4KG5A 5A91A 3VSLA 5EVIA 3O86A 3IF5A 2A49A 2ZQCA 1FOFA 4MBKA 3IHAA 4EUZA 3S22A 1BLHA 3GSGA 4WMCD 2WZZA 3UO9A 5BOHA 1K25A 2ZQ9A 3BFEA 3V39A 3ZFZA 3S4XA 4BD1A 2IWBA 1S6RA 4IVKA 1MWTA 4ZAMA 4KZ5A 5AQBA 3IT9A 1Z6FA 3ZG5A 4LENA 4HBTA 4KQOA 2HDSA 3PBQA 2WGWB 4PM8A 1SDNA 5A92A 3PBNA 3C4OA 4DE1A 4E6WA 1IKGA 2Y2JA 4PPRA 3G2YA 1CEFA 4GKUA 1LI0A 3GMWA 2WK0A 3UDXA 2Y2MA 1IYOA 1JWVA 3SOIA 1PWGA 5F1GA 2WZXA 5CXWA 2EX6A 1L0EA 4S2OA 3IWIA 2GDNA 3DWZA 3HUNA 3NBLA 4RYEA 5DVAA 3MXRA 3IWOA 3TG9A 3N4IA 1K54A 3SH8A 3N6IA 1IEMA 2CC1A 1GA9A 1PZPA 3NDEA 4WYYA 1LL5A 1GHIA 1BSGA 1JTDA 3N8RA 4GD6A 1M40A 5CECA 3GVBA 1MXOA 3M2KA 3C7VA 3UNWA 5JYOA 5AQ7A 4O7DA 3W4PA 4ID4A 1K4FA 5EE8A 1IYPA 2I72A 1BT5A 3A3IA 3WS1A 1IYQA 1YLZA 1ES3A 3Q7VA 1SDEA 3MXSA 2WKHA 4S2NA 3DTMA 4WZ4A 1IELA 1XX2A 2V20A 1JWZA 1LL9A 5GLBA 4B4XA 3GQZA 3RXWA 1HTZA 4OLGA 3NDGA 3MBZA 5GLDA 1NYMA 2X01A 3BLSA 3EQUA 4LV0A 1JTGA 4ZJ3A 2WKEA 4QJGA 4Y0UA 4R4SA 4P0MA 4BL3A 4JBFA 1ONHA 1PIOA 2Z2LB 3Q82A 3GTCA 3HBRA 4KZAA 4E3KA 3PAGA 3S1YA 1CI8A 1ESUA 4MEZA 3N8LA 1YMXA 3AGEA 4KZ4A 4IBXA 5FASA 3ZNTA 5M19A 4JXSA 4R1GA 4F94A 1K54C 4L0LA 5CRFA 2ZMAA 2J9OA 4OONA 1FR1A 3RXXA 2H5SA 4WM9A 5FI7A 2H10A 3WS4A 1U60A 3MKFA 4E3NA 2RCXA 1LHYA 3TOIA 1K57C 1MY8A 2Y2HA 1KDWA 3OCNA 5CHUA 3UPPA 4Y0TA 1W7FA 4WZ5A 4ZDXA 2H0TA 3FV7A 1K6RA 5J8XA 5E2EA 1FCNA 3C4PA 3FKWA 3ZNYA 1EROA 5L2FA 3VP1A 4GZBA 1E3UD 4NETA 3SS5A 3LY3A 4X6TA 1SHVA 1BUEA 1IYSA 2J9PA 4N9KA 3IXBA 5CEDA 1XGJA 4RVAA 3ZVTA 3HREA 4EWFA 2Y2QA 1SCWA 4WZ5C 4E3MA 5EOOA 4EBNA 4HBUA 5EPHA 2ZC4B 1KGGA 1NZUA 2ZC6B 2ZQDA 4OKPA 2ZM0A 3ZCZA 1KDSA 3ZG8B 4BL2A 5HW3A 3CMZA 3N8SA 4N1HA 1K56D 1L0FA 1O7EA 3HLFA 1MWUA 1DJAA 1PWCA 5GLAA 5TR7A 3HUOA 4PM5A 3M6BA 5FQ9A 2WUQA 4QHCA 1ERQA 1RGZA 5EUAA 5FI6A 5FQIA 1EWZA 4OVDA 4OPZA 2QMIA 1LI9A 5E2FA 1E25A 4M3KA 4MBFA 5TFQA 5FI2A 3G2ZA 4OLDA 4C75A 4OPYA 1BLPA 1YLYA 2OV5A 3BRMA 4RA7A 2EX2A 2Y59A 2EX9A 3IQAA 3BFFA 2Y2PA 5AQ9A 4KZ3A 5HL1A 2ZQ8A 1VM1A 4PM7A 4WELA 1W5DA 2XR0A 1XPBA 1FSYA 4DF6A 1BULA 1GA0A 5CHJA 3FZCA 2IWDA 1K4EA 1L0DA 3PTEA 2XK1A 1E4DA 1K56A 3IH8A 5CGWA 5E2GA 5AQAA 4K0XA 4OQ0A 4OPQA 4BJPA 4U0XA 4DXCA 1LLBA 3VSKA 2ZD8A 5CHMA 3VFHA 4RX3A 4DE2A 3FYZA 3IF6B 1DY6A 1PYYA 2H0YA 4FD8A 4S2PA 2JE5A 1PW8A 2A3UA 2HDRA 4ZBEA 3V5MA 3OPHA 4Y0OA 1WE4A 2EFUA 1YQSA 1BLCA 1CI9A 5KSHA 3IF6C 3ITBA 1XXMA 4JPMA 2EX8A 2EXAA 1ES2A 3HLEA 1CK3A 3VP4A 1YLPA 4XUZA 3O3VA 5KZHA 5HX9A 4K91A 4GB7A 1N9BA 1ZG6A 2ZM2A 1I5QA 1FQGA 3NIAA 2RL3A 4JXWA 5A93A 1I2WA 1YMSA 4E3JA 4N92A 1SKFA 4ZJ2A 3VOYA 3BECA 3VFFA 1K38A 2Y2IA 3G35A 3NI9A 3SS3A 3W4OA 2Y2GA 3O87A 3SS4A 3BLMA 4HESA 3OPLA 1TDGA 1DJBA 4JKTA 2X02A 5EOEA 4FSFA 3NCKA 1PI5A 4QY5A 3LY4A 4KG6A 3ZHHA 2HP9A 4C3QA 4LCLA 5EECA 4X68A 2XFTA 4LCMA 2PBYA 4X53A 1NXYA 2ZQ7A 1BZAA 3N7WA 1FSWA 2Y2NA 3E2LA 4PM9A 3UE3A 1RP5A 4GN2A 4WBGA 4S2JA 3OPPA 4GNUA 1KVMA 3FWLA 3CJMA 1ES5A 3PBSA 2JCHA 1K57A 3W8KA 4BD0A 5FA7A 3BFDA 1EI5A 3HUMA 1W8YA 4B4ZA 1HZOA 2OLVA 2ZC5B 5DTKA 1Y54A 3WS5A 4FH2A 2ZC3B 4JF6A 4OPRA 2FFYA 5FDHA 5A90A 5TGFA 5CERA 4FCFA 3A3FA 4Y7PA 1Q2QA 1QMEA 5DF8A 5EVLA 4DRTA 3UE1A 2PU2A 1RCJA 4BLMA 1HD8A 2JC7A 2Y4AA 2Y91A 4OP8A 3UPOA 3WS2A 4UA6A 2P9VA 4DKIA 4S2MA 4KQQA 2V1ZA 2XDMA 4E3LA 1W79A 1YLJA 1PWDA 1NY0A 1XGIA 2P9VB 2QPNA 3C5AA 5CGSA 5CEBA 4GOGA 5D3OA 1WYBA 5EVID 5F82A 3DW0A 3A3JA 5E2HA 5HAPA 3G32A 5GL9A 5IHVA 4ZTKA 2WGVA 3VP0A 4QY6A 4RX2A 4R23A 4FH4A 1K55A 5HAIA 4IBRA 2ZJ9A 5FQQA 1GCEA 1H5XA 3GRJA 3HL9A 4WEKA 2XD5A 3VMAA 1CEGA 3OC2A 2HP5A 2V2FF 3FKVA 4JLFA 4KZ9A 1NZOA 4XXRA 1PW1A 4BQMA 3V3SA 3GV9A 5E43A 3OPRA 4DXBA 1ZC2A 3D4FA 1MKIA 5FQKA 4XUXA 4X69A 3BYDA 4N9LA 4MNRA 3RJUA 4YFMA 1K55C 1NJ4A 2IWCA 3GR2A 4A5RA 1I2SA 2XLNA 3UDFA 1PZOA 1TDLA 3UN7A 4UA7A 2Y2LA 1N4OA 1W8QA 4GDNA 3P09A 1FCOA 1ONGA 4UA9A 2WKIA 1ES4A 3WRTA 1JWPA 3QHYA 4OQIA 1AXBA 3ZG0A 4QD4A 3HLBA 3UE0A 1C3BA 2ZLYA 3IXDA 3HLDA 2WGWA 4OOMA 4NK3A 4PMAA 4ZJ1A 3HLWA 3IH9A 4IVIA 3V3RA 2WAEA 4BENA 2WAFA 3B3XA 5KSCA 2EFXA 4E3IA 3EQVA 2Y2KA 4UHUA 3W4QA 2DNSA 4R4RA 1L0GA 4B88A 5FSRA 4CJNA 3A3EA 5FAPA 5U47A 2JBFA 3ZG9B 2P74A 2ZC7A 1ZKJA 2DRWA 3ZVWA 2B5RA 3QNCA 3WRZA 4LV3A 3Q1FA 1GHPA 2J8YA 1ZG4A 1YM1A 3Q7ZA 4WEJA 5JYPA 1DJCA 2Z2MB 4KG2A 4OQGA 3BM6A 1K6SA 3SH9A 1KGEA 1BLSA 1MBLA 1L2SA 5GHZA 3I7JA 1KE4A 4PM6A 3Q7VB 4JXVA 1OMEA 3NY4A 1O07A 5FAQA 1XA7A 1IKIA 2X71A 5FATA 2G2UA 4P85A 5M18A 3LCEA 1RGYA 5FAOA 3MZDA 4CPKA 3PBTA 3OZHA 3ITAA 2PU4A 3IXHA 1S0WA 4H8RA 1G6AA 3AGFA 4U0TA 5CTNA 2G2WA 1XA1A 5DF7A 5G18A 3DWKA 2XQZA 3E2KA 3UDIA 1H8YA 5GHXA 4HEFA 3C7UA 2WYXA 3G31A 3Q81A 4WMCA 3PBOA 3AGDA 4DE3A 3G34A 1JVJA 5M1AA 4OOYA 2Y55A 4GD8A 3QNBA 3VOZA 1XP4A 2XFSA 3BFCA 4S2KA 4DDYA 1Q2PA 1PI4A 1MWSA 2OSUA 3M6HA 4QU3A 5DF9A 3ISGA 4OOLA 1E3UA 5CGXA 4E6XA 4U3TA 4MLLA 4R3BA 2XD1A 2VGJA 2QZ6A 1M6KA 3NC8A 4P6BA 4P87A 3VP3A 3O88A 4EQIA 4KQRA 3ZGAB 2DCFA 3A3DA 3WS0A 1ERMA 1MWRA 4KENB 1NYYA 3MKEA 3P98A 4LV2A 4S2IA 3OCLA 3JYIA 4JF5A 1TEMA 4EBLA 2Q9MA 1YT4A 3HVFA 1FR6A 2HDQA 2J7VA 4C6YA 2HPBA 5CTMA 3HLGA 2HDUA 4GDBA 1NRFA 5DTTA 4DE0A 4Q8IA 1XKZA 2BLSA 4MBHA 1VQQA 4R3JA 2WADA 3Q07A 4JXGA 2EXBA 3CZDA 1H8ZA 4EV4A 3IWQA 2UWXA 1TVFA 3MZFA 1BTLA 3TSGA 1KE0A 2Y2OA 4LV1A 3CG5A 5EVIB 3UPNA 4E3OA 2XH9A 4K0WA 2HP6A 5HFOA 3SH7A 1ALQA 4QB8A 1KE3A 4KZ6A 4OQHA 2FFFB 2OLUA 1J9MA 3G30A 5GHYA 2R9XA 2XGNA 3ZDJA 4D2OA 2ZQAA 4DDSA 3LO7A 3PBRA 2Q9NA 5EVIC 5FQJA 3M2JA 2WGIA 3G4PA 4JF4A 4KZBA 4N1XA 4X56A 5FQMA 4OP5A 3MFDA 3IHBA 1HVBA 2R9WA 1KGFA 1YLWA 3V50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ7 A;  3VP2 A;  4R0Q A;  3BFG A;  5KMW A;  3HLC A;  3MZE A;  1G68 A;  4YIN A;  5HAR A;  1YLT A;  3UY6 A;  2BG1 A;  4EBP A;  3BEB A;  1GHM A;  2C5W B;  2C6W B;  2XF3 A;  5HAQ A;  1MPL A;  3ZG7 B;  1FCM A;  4UAA A;  4X55 A;  5F1F A;  1ESI A;  4Z9Q A;  3WWX A;  3PAE A;  5F83 A;  1WYC A;  5GLC A;  4OH0 A;  4S2N C;  3IXG A;  4KZ8 A;  4IED A;  2E8I A;  3IF6 A;  2VGK A;  2ZM8 A;  5DTS A;  3LEZ A;  1QMF A;  5I94 A;  1KVL A;  4S2L A;  2XEP A;  4KG5 A;  5A91 A;  3VSL A;  5EVI A;  3O86 A;  3IF5 A;  2A49 A;  2ZQC A;  1FOF A;  4MBK A;  3IHA A;  4EUZ A;  3S22 A;  1BLH A;  3GSG A;  4WMC D;  2WZZ A;  3UO9 A;  5BOH A;  1K25 A;  2ZQ9 A;  3BFE A;  3V39 A;  3ZFZ A;  3S4X A;  4BD1 A;  2IWB A;  1S6R A;  4IVK A;  1MWT A;  4ZAM A;  4KZ5 A;  5AQB A;  3IT9 A;  1Z6F A;  3ZG5 A;  4LEN A;  4HBT A;  4KQO A;  2HDS A;  3PBQ A;  2WGW B;  4PM8 A;  1SDN A;  5A92 A;  3PBN A;  3C4O A;  4DE1 A;  4E6W A;  1IKG A;  2Y2J A;  4PPR A;  3G2Y A;  1CEF A;  4GKU A;  1LI0 A;  3GMW A;  2WK0 A;  3UDX A;  2Y2M A;  1IYO A;  1JWV A;  3SOI A;  1PWG A;  5F1G A;  2WZX A;  5CXW A;  2EX6 A;  1L0E A;  4S2O A;  3IWI A;  2GDN A;  3DWZ A;  3HUN A;  3NBL A;  4RYE A;  5DVA A;  3MXR A;  3IWO A;  3TG9 A;  3N4I A;  1K54 A;  3SH8 A;  3N6I A;  1IEM A;  2CC1 A;  1GA9 A;  1PZP A;  3NDE A;  4WYY A;  1LL5 A;  1GHI A;  1BSG A;  1JTD A;  3N8R A;  4GD6 A;  1M40 A;  5CEC A;  3GVB A;  1MXO A;  3M2K A;  3C7V A;  3UNW A;  5JYO A;  5AQ7 A;  4O7D A;  3W4P A;  4ID4 A;  1K4F A;  5EE8 A;  1IYP A;  2I72 A;  1BT5 A;  3A3I A;  3WS1 A;  1IYQ A;  1YLZ A;  1ES3 A;  3Q7V A;  1SDE A;  3MXS A;  2WKH A;  4S2N A;  3DTM A;  4WZ4 A;  1IEL A;  1XX2 A;  2V20 A;  1JWZ A;  1LL9 A;  5GLB A;  4B4X A;  3GQZ A;  3RXW A;  1HTZ A;  4OLG A;  3NDG A;  3MBZ A;  5GLD A;  1NYM A;  2X01 A;  3BLS A;  3EQU A;  4LV0 A;  1JTG A;  4ZJ3 A;  2WKE A;  4QJG A;  4Y0U A;  4R4S A;  4P0M A;  4BL3 A;  4JBF A;  1ONH A;  1PIO A;  2Z2L B;  3Q82 A;  3GTC A;  3HBR A;  4KZA A;  4E3K A;  3PAG A;  3S1Y A;  1CI8 A;  1ESU A;  4MEZ A;  3N8L A;  1YMX A;  3AGE A;  4KZ4 A;  4IBX A;  5FAS A;  3ZNT A;  5M19 A;  4JXS A;  4R1G A;  4F94 A;  1K54 C;  4L0L A;  5CRF A;  2ZMA A;  2J9O A;  4OON A;  1FR1 A;  3RXX A;  2H5S A;  4WM9 A;  5FI7 A;  2H10 A;  3WS4 A;  1U60 A;  3MKF A;  4E3N A;  2RCX A;  1LHY A;  3TOI A;  1K57 C;  1MY8 A;  2Y2H A;  1KDW A;  3OCN A;  5CHU A;  3UPP A;  4Y0T A;  1W7F A;  4WZ5 A;  4ZDX A;  2H0T A;  3FV7 A;  1K6R A;  5J8X A;  5E2E A;  1FCN A;  3C4P A;  3FKW A;  3ZNY A;  1ERO A;  5L2F A;  3VP1 A;  4GZB A;  1E3U D;  4NET A;  3SS5 A;  3LY3 A;  4X6T A;  1SHV A;  1BUE A;  1IYS A;  2J9P A;  4N9K A;  3IXB A;  5CED A;  1XGJ A;  4RVA A;  3ZVT A;  3HRE A;  4EWF A;  2Y2Q A;  1SCW A;  4WZ5 C;  4E3M A;  5EOO A;  4EBN A;  4HBU A;  5EPH A;  2ZC4 B;  1KGG A;  1NZU A;  2ZC6 B;  2ZQD A;  4OKP A;  2ZM0 A;  3ZCZ A;  1KDS A;  3ZG8 B;  4BL2 A;  5HW3 A;  3CMZ A;  3N8S A;  4N1H A;  1K56 D;  1L0F A;  1O7E A;  3HLF A;  1MWU A;  1DJA A;  1PWC A;  5GLA A;  5TR7 A;  3HUO A;  4PM5 A;  3M6B A;  5FQ9 A;  2WUQ A;  4QHC A;  1ERQ A;  1RGZ A;  5EUA A;  5FI6 A;  5FQI A;  1EWZ A;  4OVD A;  4OPZ A;  2QMI A;  1LI9 A;  5E2F A;  1E25 A;  4M3K A;  4MBF A;  5TFQ A;  5FI2 A;  3G2Z A;  4OLD A;  4C75 A;  4OPY A;  1BLP A;  1YLY A;  2OV5 A;  3BRM A;  4RA7 A;  2EX2 A;  2Y59 A;  2EX9 A;  3IQA A;  3BFF A;  2Y2P A;  5AQ9 A;  4KZ3 A;  5HL1 A;  2ZQ8 A;  1VM1 A;  4PM7 A;  4WEL A;  1W5D A;  2XR0 A;  1XPB A;  1FSY A;  4DF6 A;  1BUL A;  1GA0 A;  5CHJ A;  3FZC A;  2IWD A;  1K4E A;  1L0D A;  3PTE A;  2XK1 A;  1E4D A;  1K56 A;  3IH8 A;  5CGW A;  5E2G A;  5AQA A;  4K0X A;  4OQ0 A;  4OPQ A;  4BJP A;  4U0X A;  4DXC A;  1LLB A;  3VSK A;  2ZD8 A;  5CHM A;  3VFH A;  4RX3 A;  4DE2 A;  3FYZ A;  3IF6 B;  1DY6 A;  1PYY A;  2H0Y A;  4FD8 A;  4S2P A;  2JE5 A;  1PW8 A;  2A3U A;  2HDR A;  4ZBE A;  3V5M A;  3OPH A;  4Y0O A;  1WE4 A;  2EFU A;  1YQS A;  1BLC A;  1CI9 A;  5KSH A;  3IF6 C;  3ITB A;  1XXM A;  4JPM A;  2EX8 A;  2EXA A;  1ES2 A;  3HLE A;  1CK3 A;  3VP4 A;  1YLP A;  4XUZ A;  3O3V A;  5KZH A;  5HX9 A;  4K91 A;  4GB7 A;  1N9B A;  1ZG6 A;  2ZM2 A;  1I5Q A;  1FQG A;  3NIA A;  2RL3 A;  4JXW A;  5A93 A;  1I2W A;  1YMS A;  4E3J A;  4N92 A;  1SKF A;  4ZJ2 A;  3VOY A;  3BEC A;  3VFF A;  1K38 A;  2Y2I A;  3G35 A;  3NI9 A;  3SS3 A;  3W4O A;  2Y2G A;  3O87 A;  3SS4 A;  3BLM A;  4HES A;  3OPL A;  1TDG A;  1DJB A;  4JKT A;  2X02 A;  5EOE A;  4FSF A;  3NCK A;  1PI5 A;  4QY5 A;  3LY4 A;  4KG6 A;  3ZHH A;  2HP9 A;  4C3Q A;  4LCL A;  5EEC A;  4X68 A;  2XFT A;  4LCM A;  2PBY A;  4X53 A;  1NXY A;  2ZQ7 A;  1BZA A;  3N7W A;  1FSW A;  2Y2N A;  3E2L A;  4PM9 A;  3UE3 A;  1RP5 A;  4GN2 A;  4WBG A;  4S2J A;  3OPP A;  4GNU A;  1KVM A;  3FWL A;  3CJM A;  1ES5 A;  3PBS A;  2JCH A;  1K57 A;  3W8K A;  4BD0 A;  5FA7 A;  3BFD A;  1EI5 A;  3HUM A;  1W8Y A;  4B4Z A;  1HZO A;  2OLV A;  2ZC5 B;  5DTK A;  1Y54 A;  3WS5 A;  4FH2 A;  2ZC3 B;  4JF6 A;  4OPR A;  2FFY A;  5FDH A;  5A90 A;  5TGF A;  5CER A;  4FCF A;  3A3F A;  4Y7P A;  1Q2Q A;  1QME A;  5DF8 A;  5EVL A;  4DRT A;  3UE1 A;  2PU2 A;  1RCJ A;  4BLM A;  1HD8 A;  2JC7 A;  2Y4A A;  2Y91 A;  4OP8 A;  3UPO A;  3WS2 A;  4UA6 A;  2P9V A;  4DKI A;  4S2M A;  4KQQ A;  2V1Z A;  2XDM A;  4E3L A;  1W79 A;  1YLJ A;  1PWD A;  1NY0 A;  1XGI A;  2P9V B;  2QPN A;  3C5A A;  5CGS A;  5CEB A;  4GOG A;  5D3O A;  1WYB A;  5EVI D;  5F82 A;  3DW0 A;  3A3J A;  5E2H A;  5HAP A;  3G32 A;  5GL9 A;  5IHV A;  4ZTK A;  2WGV A;  3VP0 A;  4QY6 A;  4RX2 A;  4R23 A;  4FH4 A;  1K55 A;  5HAI A;  4IBR A;  2ZJ9 A;  5FQQ A;  1GCE A;  1H5X A;  3GRJ A;  3HL9 A;  4WEK A;  2XD5 A;  3VMA A;  1CEG A;  3OC2 A;  2HP5 A;  2V2F F;  3FKV A;  4JLF A;  4KZ9 A;  1NZO A;  4XXR A;  1PW1 A;  4BQM A;  3V3S A;  3GV9 A;  5E43 A;  3OPR A;  4DXB A;  1ZC2 A;  3D4F A;  1MKI A;  5FQK A;  4XUX A;  4X69 A;  3BYD A;  4N9L A;  4MNR A;  3RJU A;  4YFM A;  1K55 C;  1NJ4 A;  2IWC A;  3GR2 A;  4A5R A;  1I2S A;  2XLN A;  3UDF A;  1PZO A;  1TDL A;  3UN7 A;  4UA7 A;  2Y2L A;  1N4O A;  1W8Q A;  4GDN A;  3P09 A;  1FCO A;  1ONG A;  4UA9 A;  2WKI A;  1ES4 A;  3WRT A;  1JWP A;  3QHY A;  4OQI A;  1AXB A;  3ZG0 A;  4QD4 A;  3HLB A;  3UE0 A;  1C3B A;  2ZLY A;  3IXD A;  3HLD A;  2WGW A;  4OOM A;  4NK3 A;  4PMA A;  4ZJ1 A;  3HLW A;  3IH9 A;  4IVI A;  3V3R A;  2WAE A;  4BEN A;  2WAF A;  3B3X A;  5KSC A;  2EFX A;  4E3I A;  3EQV A;  2Y2K A;  4UHU A;  3W4Q A;  2DNS A;  4R4R A;  1L0G A;  4B88 A;  5FSR A;  4CJN A;  3A3E A;  5FAP A;  5U47 A;  2JBF A;  3ZG9 B;  2P74 A;  2ZC7 A;  1ZKJ A;  2DRW A;  3ZVW A;  2B5R A;  3QNC A;  3WRZ A;  4LV3 A;  3Q1F A;  1GHP A;  2J8Y A;  1ZG4 A;  1YM1 A;  3Q7Z A;  4WEJ A;  5JYP A;  1DJC A;  2Z2M B;  4KG2 A;  4OQG A;  3BM6 A;  1K6S A;  3SH9 A;  1KGE A;  1BLS A;  1MBL A;  1L2S A;  5GHZ A;  3I7J A;  1KE4 A;  4PM6 A;  3Q7V B;  4JXV A;  1OME A;  3NY4 A;  1O07 A;  5FAQ A;  1XA7 A;  1IKI A;  2X71 A;  5FAT A;  2G2U A;  4P85 A;  5M18 A;  3LCE A;  1RGY A;  5FAO A;  3MZD A;  4CPK A;  3PBT A;  3OZH A;  3ITA A;  2PU4 A;  3IXH A;  1S0W A;  4H8R A;  1G6A A;  3AGF A;  4U0T A;  5CTN A;  2G2W A;  1XA1 A;  5DF7 A;  5G18 A;  3DWK A;  2XQZ A;  3E2K A;  3UDI A;  1H8Y A;  5GHX A;  4HEF A;  3C7U A;  2WYX A;  3G31 A;  3Q81 A;  4WMC A;  3PBO A;  3AGD A;  4DE3 A;  3G34 A;  1JVJ A;  5M1A A;  4OOY A;  2Y55 A;  4GD8 A;  3QNB A;  3VOZ A;  1XP4 A;  2XFS A;  3BFC A;  4S2K A;  4DDY A;  1Q2P A;  1PI4 A;  1MWS A;  2OSU A;  3M6H A;  4QU3 A;  5DF9 A;  3ISG A;  4OOL A;  1E3U A;  5CGX A;  4E6X A;  4U3T A;  4MLL A;  4R3B A;  2XD1 A;  2VGJ A;  2QZ6 A;  1M6K A;  3NC8 A;  4P6B A;  4P87 A;  3VP3 A;  3O88 A;  4EQI A;  4KQR A;  3ZGA B;  2DCF A;  3A3D A;  3WS0 A;  1ERM A;  1MWR A;  4KEN B;  1NYY A;  3MKE A;  3P98 A;  4LV2 A;  4S2I A;  3OCL A;  3JYI A;  4JF5 A;  1TEM A;  4EBL A;  2Q9M A;  1YT4 A;  3HVF A;  1FR6 A;  2HDQ A;  2J7V A;  4C6Y A;  2HPB A;  5CTM A;  3HLG A;  2HDU A;  4GDB A;  1NRF A;  5DTT A;  4DE0 A;  4Q8I A;  1XKZ A;  2BLS A;  4MBH A;  1VQQ A;  4R3J A;  2WAD A;  3Q07 A;  4JXG A;  2EXB A;  3CZD A;  1H8Z A;  4EV4 A;  3IWQ A;  2UWX A;  1TVF A;  3MZF A;  1BTL A;  3TSG A;  1KE0 A;  2Y2O A;  4LV1 A;  3CG5 A;  5EVI B;  3UPN A;  4E3O A;  2XH9 A;  4K0W A;  2HP6 A;  5HFO A;  3SH7 A;  1ALQ A;  4QB8 A;  1KE3 A;  4KZ6 A;  4OQH A;  2FFF B;  2OLU A;  1J9M A;  3G30 A;  5GHY A;  2R9X A;  2XGN A;  3ZDJ A;  4D2O A;  2ZQA A;  4DDS A;  3LO7 A;  3PBR A;  2Q9N A;  5EVI C;  5FQJ A;  3M2J A;  2WGI A;  3G4P A;  4JF4 A;  4KZB A;  4N1X A;  4X56 A;  5FQM A;  4OP5 A;  3MFD A;  3IHB A;  1HVB A;  2R9W A;  1KGF A;  1YLW A;  3V50 A; 
#chains in the Genus database with same CATH topology
 4KZ7 A;  3T1X A;  3VP2 A;  1LSW A;  3HLC A;  1G68 A;  4YIN A;  3UY6 A;  3E4Q A;  1GHM A;  3ZG7 B;  4X55 A;  1ESI A;  2B95 A;  1WYC A;  4KZ8 A;  4I3A A;  3IF6 A;  2VV8 A;  1KVL A;  2XEP A;  4KG5 A;  2PRF A;  3IF5 A;  3NHQ A;  2A49 A;  4RQ9 A;  2EWV A;  3S22 A;  1BLH A;  3UO9 A;  2ZQ9 A;  3BFE A;  1ODV A;  1S6R A;  2JKT I;  1MWT A;  4ZAM A;  2P08 A;  4HBT A;  3PBQ A;  5A92 A;  1T1A A;  1SZV A;  1DP6 A;  3PBN A;  3A0V A;  1T1B A;  4GW9 A;  4PPR A;  2I9V A;  3G2Y A;  2A24 B;  1LI0 A;  2WK0 A;  3IX8 A;  5F1G A;  3TW8 A;  4NXB A;  3IWI A;  5AJG A;  1EW0 A;  3MXR A;  4IJG A;  3LIC A;  1IEM A;  1PZP A;  1LL5 A;  1BSG A;  1M40 A;  3A0S A;  1K4F A;  2I72 A;  3A3I A;  2Y8H A;  4EXO A;  2WKH A;  1IEL A;  4HJ6 A;  1HTZ A;  4OLG A;  3NDG A;  2X01 A;  1SKO B;  1JTG A;  2OWH A;  4P0M A;  2Z2L B;  3Q82 A;  4E3K A;  1ESU A;  3P7N A;  4O0P A;  5FAS A;  3ZNT A;  4F94 A;  4L0L A;  5CRF A;  4H6J A;  3T1S A;  3UME A;  2H10 A;  4Y13 A;  2RCX A;  1D1J A;  2D01 A;  1MY8 A;  5CHU A;  2W0N A;  1OTB A;  1V9Y A;  3FV7 A;  3ZQ5 A;  5E2E A;  1ERO A;  4LRZ E;  1SHV A;  2W3D A;  1BUE A;  1IYS A;  3JVU A;  5CED A;  3FPW A;  4EWF A;  1SCW A;  4E3M A;  5EPH A;  2ZC4 B;  2ZQD A;  3PHY A;  3ZG8 B;  4BL2 A;  3CMZ A;  1K56 D;  4ESP A;  3HLF A;  1MWU A;  1DJA A;  2P04 A;  3HUO A;  5FQ9 A;  4QHC A;  1ERQ A;  3IX4 A;  5FI6 A;  1EWZ A;  4OVD A;  1LI9 A;  1E25 A;  4MBF A;  4MDZ A;  1LSV A;  5HWT A;  2OV5 A;  3BRM A;  3UB6 A;  2PHY A;  2EX9 A;  4Z1W A;  5HL1 A;  3S7N A;  2Y79 A;  2M7U A;  1W5D A;  2IWD A;  3PTE A;  2MJ6 A;  1UWN X;  3F1O A;  1F5M A;  1LLB A;  3VSK A;  4DJ3 A;  4X1L A;  3NUL A;  3IF6 B;  1DY6 A;  2H0Y A;  3E98 A;  1PW8 A;  4ZBE A;  4F3L B;  3V5M A;  4Q0I A;  4JGQ A;  2EFU A;  1BLC A;  1CI9 A;  3IF6 C;  3ITB A;  1ES2 A;  3BQ8 A;  1ZG6 A;  3KSH A;  2RL3 A;  4JXW A;  1I2W A;  1SKF A;  3BEC A;  4I39 A;  2KLI A;  1K38 A;  2B18 A;  3SW1 A;  1OPX A;  2QJ5 A;  4QY5 A;  4KG6 A;  3VE3 A;  5HDD A;  1NXY A;  2ZQ7 A;  1FSW A;  3E2L A;  2PYP A;  3CHW P;  4GNU A;  3FWL A;  1ES5 A;  2JCH A;  1K57 A;  3BFD A;  3SZT A;  5IU1 A;  3QP5 A;  5DTK A;  2FFY A;  5A90 A;  1F9I A;  5HWV A;  5CER A;  4FCF A;  4Y7P A;  4IUH A;  1Q2Q A;  1QME A;  5DF8 A;  3S7O A;  4BLM A;  3LGO A;  4WLA A;  4OP8 A;  3WS2 A;  2P9V A;  1BYW A;  4S2M A;  2XDM A;  4BBV A;  3C5A A;  5CGS A;  4GOG A;  2HF6 A;  2XRN A;  2ZL1 A;  4R23 A;  3RFB A;  5HAI A;  4IBR A;  2ZJ9 A;  4WEK A;  4H6J B;  3FKV A;  4KZ9 A;  3DTK A;  1OTE A;  3OPR A;  4DXB A;  4FUW A;  1MKI A;  3T4Q A;  4MNR A;  4YFM A;  2ZMF A;  4IUK A;  1NJ4 A;  1PZO A;  4HOI A;  1TDL A;  4UA7 A;  3K2N A;  2Y2L A;  1K0K A;  1XJ2 A;  3HJK A;  4PAU A;  3WRT A;  3KYQ A;  3QHY A;  4QD4 A;  3HLB A;  2QKP A;  4NK3 A;  3QP4 A;  3CWF A;  3V3R A;  5KSC A;  2ZL1 B;  2K31 A;  4E3I A;  5EV0 A;  4R4R A;  5LBR A;  4CJN A;  2E8J A;  3EGD C;  4LV3 A;  3Q1F A;  5DKK A;  2J8Y A;  2QJ7 A;  3CIT A;  1YM1 A;  3Q7Z A;  5JYP A;  5FEG A;  2J3T D;  4OQG A;  4HP4 A;  1MBL A;  1KE4 A;  3Q7V B;  3NY4 A;  1IKI A;  2X71 A;  2ZOH A;  5FAO A;  4CPK A;  3MZD A;  2XSS A;  3PBT A;  3ITA A;  1STZ A;  3DWK A;  2W3G A;  3E2K A;  1H8Y A;  4HEF A;  4MN6 A;  3Q81 A;  2VV7 A;  3KSF A;  2CMN A;  3PBO A;  4GS9 B;  1F2K A;  5M1A A;  4L9F A;  3BFC A;  2YKF A;  1PI4 A;  1MWS A;  2OSU A;  3M6H A;  3MQQ A;  3ISG A;  5CGX A;  4MLL A;  2XD1 A;  3OLO A;  4EQI A;  4KQR A;  3A3D A;  4KEN B;  3MKE A;  3P98 A;  4DN0 A;  2FZ0 A;  4EBL A;  3HVF A;  2HDQ A;  4C6Y A;  3NOU C;  4Q8I A;  1XKZ A;  4EQ1 A;  2BLS A;  4R3J A;  2EXB A;  1TS8 A;  4BMW A;  2UWX A;  3TSG A;  3MQ0 A;  1YSQ A;  1NLY A;  2OLU A;  4UEY A;  3LO7 A;  5EVI C;  1D7E A;  2EWW A;  4X56 A;  2HJ9 C;  2VGL S;  1HVB A;  3MSH A;  3R7W A;  1A0K A;  4HQA A;  4R0Q A;  3BFG A;  5KMW A;  5HAR A;  1YLT A;  3CLO A;  2DMW A;  2JHE A;  1FCM A;  2QHK A;  4UAA A;  2VEA A;  1OTD A;  4WL9 A;  4IED A;  2E8I A;  3GEC A;  3LEZ A;  5I94 A;  3O86 A;  2INW A;  2M1C A;  3MFX A;  4HIA A;  4XT2 A;  5J7E A;  4EUZ A;  3R7W B;  4WMC D;  5BOH A;  3ZFZ A;  3S4X A;  2IWB A;  2J3W A;  5AQB A;  4LEN A;  4KQO A;  2WGW B;  1SDN A;  1OTI A;  3UMD A;  2Y2J A;  3DTE A;  3EGX C;  3GMW A;  1MZU A;  4FOF A;  2Y2M A;  5EM0 A;  2P7J A;  2V0U A;  2WZX A;  2EX6 A;  2GDN A;  3T4J A;  3DWZ A;  3HUN A;  3LUQ A;  4RYE A;  5DVA A;  2V8F A;  2O9A A;  2CC1 A;  3NDE A;  3RH8 B;  5HZH A;  1GHI A;  4GD6 A;  4G3W A;  3C7V A;  5JYO A;  2HJE A;  5AQ7 A;  4O7D A;  4ID4 A;  4EEU A;  5EE8 A;  4LGW A;  3Q7V A;  1SDE A;  3LIF A;  1YAX A;  3B47 A;  2V1B A;  1G5U A;  3BLS A;  3EQU A;  2PD8 A;  4ZJ3 A;  2PAV P;  2WKE A;  3DAV A;  4P6Z S;  3GTC A;  4L9E A;  5DKL A;  4JGP A;  4NEE D;  4MEZ A;  3N8L A;  1YMX A;  3A0R A;  4JXS A;  1K54 C;  2ZMA A;  1TS6 A;  3BWL A;  5C5K A;  3T4L A;  1N9O A;  3MKF A;  4ETX A;  4E3N A;  3T4S A;  1DRM A;  5HWW A;  4Y0T A;  3UPP A;  2H0T A;  1S1Z A;  2V1A A;  4HI4 A;  4RVA A;  3ZVT A;  4MMN A;  3BW6 A;  3IS2 A;  4WZ5 C;  5EOO A;  1NZU A;  3UB9 A;  3NOT C;  5TR7 A;  5GLA A;  1CQA A;  4GHI B;  4M3K A;  5FI2 A;  3D3O A;  4C75 A;  4OPY A;  4RA7 A;  4L9G A;  2EX2 A;  2ZBB A;  4ARZ B;  2YKH A;  4KZ3 A;  2PD7 A;  3F1N B;  2JKR I;  2ZQ8 A;  3FPV A;  1VM1 A;  2XR0 A;  1E4D A;  2O99 A;  5G4Z A;  2XK1 A;  4KUK A;  4UQI S;  1TS7 A;  4BJP A;  4DXC A;  5CHM A;  3L7H A;  2V0W A;  4CLC C;  2VGL M;  2A3U A;  3OPH A;  1WE4 A;  4JPM A;  1CK3 A;  5FL3 A;  3CPT B;  1Y4O A;  5HX9 A;  4WN5 A;  4GB7 A;  1N9B A;  2ZM2 A;  3LIA A;  4E3J A;  2Y2I A;  3TE8 A;  3NI9 A;  3ICY A;  2Y2G A;  3BY9 A;  3ULF A;  3MS6 A;  3OPL A;  5EOE A;  2X02 A;  4FSF A;  4EES A;  4MCW A;  3ZHH A;  2HP9 A;  4LCL A;  5EEC A;  5TJJ A;  3E4O A;  4HNB A;  3N7W A;  2Y2N A;  4HY8 A;  4PM9 A;  2UV0 E;  4S2J A;  3OPP A;  3BQA A;  3DBA A;  4I5S A;  3R4K A;  4HP9 A;  2JKT M;  2ZC5 B;  2OLV A;  2W3E A;  2VA0 A;  4JF6 A;  2B02 A;  4JGR A;  5FDH A;  3UE1 A;  1VB6 A;  1RCJ A;  3F1O B;  3H82 A;  4DKI A;  2W1T B;  2L0W A;  3C2W A;  4E3L A;  1NY0 A;  5CEB A;  5FEF A;  1WYB A;  4D60 A;  3CAX A;  3DW0 A;  3IX3 A;  5HAP A;  3PYP A;  4BBT A;  1K55 A;  3U2A A;  1CEG A;  4Q0H A;  4XXR A;  1PW1 A;  4I3I A;  3H7W A;  5HPF A;  4N9L A;  2IWC A;  3GR2 A;  1I2S A;  3UDF A;  1N4O A;  1FCO A;  1ONG A;  3E4P A;  1JWP A;  1AXB A;  3UE0 A;  3IXD A;  3HLD A;  3HCY A;  1TF1 A;  4IVI A;  2WAE A;  3B3X A;  3EQV A;  4P6Z M;  2Y2K A;  4UHU A;  2DNS A;  1P0Z A;  5FSR A;  3H9W A;  5U47 A;  3ZG9 B;  2P74 A;  2ZC7 A;  5L09 A;  2B5R A;  2VV6 A;  3QNC A;  3WRZ A;  4WEJ A;  2Z2M B;  4KG2 A;  2WKR A;  1KGE A;  1L2S A;  3I7J A;  4HJ4 A;  4PM6 A;  1VEU B;  5FAT A;  4R70 A;  4P85 A;  4NXE A;  3LID A;  5DF7 A;  1S0W A;  2ZOI A;  5CTN A;  1G6A A;  1LSX A;  3AGF A;  2G2W A;  5G18 A;  1MKM A;  1GSV A;  3C38 A;  3PR6 A;  3C7U A;  2WYX A;  3G31 A;  3K3D A;  4WMC A;  3AGD A;  4DE3 A;  3VOZ A;  3QNB A;  1XP4 A;  2XFS A;  4DDY A;  3CUE C;  1AWI A;  2W1R A;  4E6X A;  4OOL A;  1E3U A;  4U3T A;  2HZ5 A;  3T50 A;  5L8M A;  3GDI A;  2VGJ A;  2QZ6 A;  3NC8 A;  4O01 A;  1G6O A;  3LI8 A;  2O9B A;  1ERM A;  3IS2 B;  3JYI A;  2Q9M A;  1FR6 A;  5DTT A;  4DE0 A;  3MXQ A;  1ZTU A;  4CLC E;  3KSG A;  4XT2 B;  4EV4 A;  3IWQ A;  3MZF A;  1BTL A;  1KE0 A;  4E3O A;  3UPN A;  5HFO A;  1ALQ A;  4QB8 A;  3UB8 A;  4D2O A;  1L3L A;  3M2J A;  2WGI A;  4KZB A;  5FQM A;  4OP5 A;  3MFD A;  3IHB A;  3EOI A;  3C8C A;  1PFL A;  3UE6 A;  2W1T A;  2BG1 A;  1HLU P;  2XF3 A;  5TBM A;  5HAQ A;  1MPL A;  2VX8 A;  1NRJ A;  5F1F A;  5F83 A;  5GLC A;  5DJT A;  4S2N C;  3IXG A;  3F1P A;  5DTS A;  3TJZ C;  3VSL A;  4LRY C;  3S7P A;  2VKS A;  3MR0 A;  4II7 A;  1FOF A;  2O0Y A;  5KIZ A;  3CI6 A;  2WZZ A;  4ZRR A;  4KZ5 A;  3IT9 A;  1IFQ A;  2HDS A;  2M7V A;  1XJ4 A;  3D9Y A;  4DE1 A;  1IKG A;  1FIL A;  5J3W A;  1CEF A;  4GKU A;  1XJ3 A;  1IYO A;  1JWV A;  3SOI A;  1PWG A;  5CXW A;  1L0E A;  4S2O A;  3LFV A;  5F69 A;  4Y5F A;  5EVE A;  3TG9 A;  2OOL A;  3U4L P;  1GA9 A;  3EEH A;  4LFU A;  1JTD A;  3N8R A;  3UB7 A;  4IHQ A;  5CEC A;  3GVB A;  3M2K A;  3W4P A;  1OTA A;  5DFX A;  4HH3 A;  1ES3 A;  2A24 A;  4K08 A;  1N9N A;  3DTM A;  5GLB A;  1XX2 A;  1LL9 A;  1KOU A;  4ME4 A;  5HPI A;  5GLD A;  4ARZ A;  4QJG A;  4BL3 A;  4JBF A;  4KZA A;  3S1Y A;  1CI8 A;  3AGE A;  4KZ4 A;  5M19 A;  1GSW A;  4R1G A;  2J9O A;  2OAP 1;  4OON A;  3E0Y A;  3RXX A;  2GX5 A;  2H5S A;  4WM9 A;  3WS4 A;  4PKY G;  3KYE A;  3OOV A;  3TOI A;  2HV1 A;  4JGO A;  3CUE A;  2Y2H A;  1KDW A;  5HDS A;  3OCN A;  1W7F A;  3TRC A;  1IOU A;  5TBM B;  4ZDX A;  5AVF A;  5L2F A;  3VP1 A;  4GZB A;  1W63 M;  1E3U D;  4NET A;  5A8B A;  2J3T C;  4R38 A;  2J9P A;  1XGJ A;  2ACG A;  3HRE A;  2Y2Q A;  4B93 A;  4OKP A;  3ZCZ A;  2ZC6 B;  1XFQ A;  4N1H A;  1L0F A;  1O7E A;  2PR6 A;  1PWC A;  4PM5 A;  3BY8 A;  1RGZ A;  4YWZ A;  3ZYT A;  4OLD A;  1YLY A;  1VET B;  3IQA A;  3BFF A;  3T4K A;  4EET B;  3FG8 A;  1D06 A;  4PM7 A;  4WEL A;  2PT7 A;  1XPB A;  1FSY A;  1GA0 A;  3FZC A;  1L0D A;  5E2G A;  3QP2 A;  1CF0 A;  3FC7 A;  4OQ0 A;  2L4R A;  4E04 A;  4MN5 A;  4RX3 A;  3FYZ A;  4ETZ A;  1PYY A;  3QP6 A;  4FD8 A;  3JPU A;  4Y0O A;  1YQS A;  4WF0 A;  5KSH A;  1XXM A;  2EX8 A;  2EXA A;  4NKP A;  5HD3 A;  1ACF A;  3VP4 A;  2EA9 A;  5KZH A;  2A2L A;  3NIA A;  1YMS A;  2R78 A;  4ZJ2 A;  3VOY A;  4Q0J A;  3G35 A;  4I38 A;  4HHD A;  3OBF A;  3SS4 A;  4HES A;  3QP8 A;  4JKT A;  1DJB A;  2OAQ 1;  3LY4 A;  5HL6 A;  1W63 Q;  5K5B A;  4X68 A;  2XFT A;  2PBY A;  3F1N A;  4FTX A;  1BZA A;  4AFI A;  4R3A A;  3UE3 A;  2JKG A;  4F3L A;  1YKD A;  3CJM A;  4CQH A;  1UWP X;  4BD0 A;  5F68 A;  1HZO A;  3WS5 A;  1S4R A;  5TGF A;  2PU2 A;  2Y91 A;  2K2N A;  2AVX A;  4GS9 A;  1W79 A;  1YLJ A;  3P01 A;  2D02 A;  5D3O A;  3A3J A;  3IBR A;  2BTF P;  1VEU A;  4ZTK A;  2WGV A;  4RX2 A;  3L9K A;  1OJG A;  1GCE A;  1H5X A;  2W27 A;  2XD5 A;  2V2F F;  1NWZ A;  4BQM A;  3V3S A;  2IA2 A;  1ZC2 A;  3T1Q B;  4G3K A;  3D4F A;  5FQK A;  4XUX A;  4X69 A;  3BYD A;  3IBJ A;  3RJU A;  1CJF A;  1G28 A;  1MC0 A;  2XLN A;  3UN7 A;  3NJA A;  2L1M A;  3O5Y A;  1W8Q A;  3P09 A;  4GHI A;  4UA9 A;  1GSX A;  2J80 A;  4OQI A;  1C3B A;  4CLC A;  2O9C A;  4BBU A;  3W4Q A;  1L0G A;  3A3E A;  5FAP A;  2JBF A;  3ZVW A;  3B33 A;  1GHP A;  3T4T A;  1DJC A;  1K6S A;  2GJ3 A;  3LIB A;  1BLS A;  4JXV A;  1O07 A;  3LR4 A;  2NUT C;  2G2U A;  4QWO A;  5M18 A;  3LCE A;  5FDS A;  2PU4 A;  4H8R A;  3IXH A;  1S4S A;  4B88 A;  2V8C A;  2XQZ A;  3UDI A;  2XA7 S;  2W3H A;  1XJ6 A;  1JVJ A;  2GNX A;  3RTY A;  4OOY A;  1Q2P A;  5J4E A;  1UGU A;  4R3B A;  3C30 A;  1M6K A;  4G3V A;  4P87 A;  5I5L A;  5F5Y A;  3MJQ A;  3WS0 A;  1MWR A;  1NYY A;  2HPB A;  4Y17 A;  4GDB A;  2HDU A;  5CTM A;  3JVV A;  4GJ4 A;  4JXG A;  3PXP A;  3MMH A;  1TVF A;  1Y28 A;  1PRQ A;  2Y2O A;  4LV1 A;  2OWJ A;  5EVI B;  2XH9 A;  2HP6 A;  1KE3 A;  4NXF A;  3G30 A;  2R9X A;  2ZQA A;  3PBR A;  4CLC B;  2BAS A;  4JF4 A;  5EFW A;  4N1X A;  1T19 A;  4EEP A;  1XFN A;  2R9W A;  1KGF A;  2JN7 A;  1YLW A;  3V50 A;  2XA7 M;  3KSI A;  3MZE A;  4EBP A;  3BEB A;  2C5W B;  2C6W B;  3LR5 A;  2PBD P;  4Z9Q A;  3WWX A;  3PAE A;  4OH0 A;  1P9W A;  2VGK A;  2ZM8 A;  3HJI A;  1QMF A;  4S2L A;  5A91 A;  5EVI A;  1LT0 A;  2ZQC A;  4MBK A;  3IHA A;  1H8M A;  1S1Y A;  3GSG A;  1K25 A;  1P9R A;  3V39 A;  4BD1 A;  2GZA A;  4IVK A;  3LI9 A;  2K7S A;  4O8G A;  2JKF A;  1Z6F A;  3ZG5 A;  1S67 L;  4PM8 A;  4UQI M;  1X0O A;  3C4O A;  4E6W A;  3VOL A;  4Y2F A;  3W2Z A;  3UDX A;  2HGV A;  4LLO B;  3NBL A;  3D72 A;  3IWO A;  3N4I A;  1K54 A;  3SH8 A;  3N6I A;  1OJ5 A;  5AVE A;  4WYY A;  1P97 A;  3H7W B;  1MXO A;  3UNW A;  1IYP A;  1J3W A;  1BT5 A;  4Y15 A;  3WS1 A;  1IYQ A;  1YLZ A;  3MXS A;  4WZ4 A;  4S2N A;  1JWZ A;  2V20 A;  4B4X A;  3DTI A;  3GQZ A;  3RXW A;  1YPR A;  3MBZ A;  1NYM A;  2Z6D A;  4LV0 A;  4Y0U A;  4R4S A;  1ONH A;  1PIO A;  3HBR A;  3PAG A;  2H28 A;  4IBX A;  1FR1 A;  5FI7 A;  1U60 A;  2VZW A;  5L07 A;  4EU0 A;  1LHY A;  1K57 C;  4WUJ A;  5HSQ A;  1DP9 A;  4CLC D;  4WZ5 A;  2KDK A;  1K6R A;  5J8X A;  1FCN A;  3C4P A;  3FKW A;  3ZNY A;  2KOI A;  3SS5 A;  3LY3 A;  4NG2 A;  4X6T A;  1PNE A;  4N9K A;  3IXB A;  5IS1 A;  4EBN A;  4HBU A;  1KGG A;  2ZM0 A;  1KDS A;  5HW3 A;  3N8S A;  3NOP C;  3G6O A;  1F98 A;  3VV4 A;  1TD5 A;  1LL8 A;  2Q0O A;  3M6B A;  2WUQ A;  5EUA A;  5FQI A;  4OPZ A;  2QMI A;  5E2F A;  5TFQ A;  3G2Z A;  1BLP A;  3CPT A;  1S66 L;  3KYZ A;  2Y59 A;  3LR3 A;  2WKP A;  2Y2P A;  4PHT A;  5AQ9 A;  4M4X A;  3S7Q A;  4DF6 A;  1BUL A;  5CHJ A;  1FIK A;  1K4E A;  1K56 A;  3IH8 A;  5CGW A;  2JKR M;  4K0X A;  5AQA A;  4OPQ A;  4B9O A;  4U0X A;  2NUP C;  4DMZ A;  2ZD8 A;  3VFH A;  4DE2 A;  4HJ3 A;  2KX6 A;  4S2P A;  2JE5 A;  2HDR A;  4QPR A;  2ZMV A;  2LB5 A;  3HLE A;  3VE4 A;  4YOF A;  1ZHH B;  1YLP A;  4XUZ A;  3O3V A;  4K91 A;  2LB9 A;  1I5Q A;  1FQG A;  5A93 A;  4N92 A;  3VFF A;  1DP8 A;  3EWK A;  3SS3 A;  3W4O A;  1H3Q A;  3MF0 A;  3O87 A;  2FH5 A;  3BLM A;  1TDG A;  3NCK A;  1PI5 A;  3LEQ A;  4C3Q A;  4LCM A;  4X53 A;  3UB5 P;  5DJU A;  4BWI A;  5CX7 A;  1RP5 A;  3MQO A;  4GN2 A;  4WBG A;  1KVM A;  3PBS A;  3W8K A;  5FA7 A;  1EI5 A;  3HUM A;  1W8Y A;  4B4Z A;  1Y54 A;  4FH2 A;  2ZC3 B;  4OPR A;  3A3F A;  4LRX C;  4EUV A;  5EVL A;  4DRT A;  4GLQ A;  1HD8 A;  2JC7 A;  2Y4A A;  4KQD A;  1V9Z A;  3QP1 A;  3UPO A;  1OT6 A;  4UA6 A;  2Z6C A;  4KQQ A;  2V1Z A;  2V9A A;  1PWD A;  5IT5 A;  1XGI A;  2P9V B;  2QPN A;  3LIE A;  5EVI D;  5F82 A;  3KO6 A;  5E2H A;  3G32 A;  5GL9 A;  5IHV A;  5DFY A;  1T1C A;  3VP0 A;  4QY6 A;  3LR0 A;  4FH4 A;  1JNU A;  3EEA A;  5FQQ A;  3HL9 A;  3GRJ A;  3VMA A;  3OC2 A;  2HP5 A;  4JLF A;  5HDC A;  1NZO A;  3GV9 A;  4YNR A;  5E43 A;  4PKY A;  2QWS A;  4KUO A;  1SKO A;  4MN7 A;  1K55 C;  4A5R A;  1VET A;  4X1M A;  4I3J A;  3T1R A;  4Y3I A;  4GDN A;  2WKI A;  1ES4 A;  2VLG A;  2ZLY A;  2PDR A;  2WGW A;  4OOM A;  4PMA A;  4X25 A;  1WA9 A;  4ZJ1 A;  1VHM A;  3HLW A;  1OT9 A;  3IH9 A;  4BEN A;  4LPZ A;  1T18 A;  2WAF A;  2EFX A;  1ZKJ A;  2DRW A;  1ZG4 A;  2VJW A;  3BM6 A;  5L10 A;  3SH9 A;  3T4O A;  2PYR A;  5GHZ A;  2XRO A;  5HD5 A;  1OME A;  2W3F A;  5FAQ A;  1H0M A;  1XA7 A;  3T12 B;  1RGY A;  3OZH A;  4U0T A;  3V67 A;  1XA1 A;  5GHX A;  2VK3 A;  3KX0 X;  1NLZ A;  3G34 A;  2Y55 A;  2QYB A;  4GD8 A;  3H82 B;  4S2K A;  4QU3 A;  3LYX A;  5DF9 A;  5G4Y A;  2PR5 A;  4DJ2 A;  4P6B A;  3VP3 A;  3O88 A;  1TS0 A;  3ZGA B;  2DCF A;  4S2I A;  4LV2 A;  3OCL A;  4JF5 A;  4R6L A;  1TEM A;  1YT4 A;  2J7V A;  3HLG A;  1NRF A;  2G7U A;  4MBH A;  1Z09 A;  1VQQ A;  2WAD A;  4HH2 A;  3Q07 A;  5EM1 A;  3CZD A;  4EW7 A;  1H8Z A;  3BJN A;  3K3C A;  3CG5 A;  4K0W A;  3SH7 A;  5MC7 A;  2WKQ A;  4KZ6 A;  5F6A A;  1N9L A;  4OQH A;  2FFF B;  3ZDJ A;  1J9M A;  5GHY A;  2XGN A;  4GCZ A;  4DDS A;  3F1P B;  3NEC A;  4EER A;  2Q9N A;  5FQJ A;  4NXG A;  3G4P A;  3B42 A;  1YSP A;  3ZG0 A; 
#chains in the Genus database with same CATH homology
 4KZ7 A;  3VP2 A;  4R0Q A;  3BFG A;  5KMW A;  3HLC A;  3MZE A;  1G68 A;  4YIN A;  5HAR A;  1YLT A;  3UY6 A;  2BG1 A;  4EBP A;  3BEB A;  1GHM A;  2C5W B;  2C6W B;  2XF3 A;  5HAQ A;  1MPL A;  3ZG7 B;  1FCM A;  4UAA A;  4X55 A;  5F1F A;  1ESI A;  4Z9Q A;  3WWX A;  3PAE A;  5F83 A;  1WYC A;  5GLC A;  4OH0 A;  4S2N C;  3IXG A;  4KZ8 A;  4IED A;  2E8I A;  3IF6 A;  2VGK A;  2ZM8 A;  5DTS A;  3LEZ A;  1QMF A;  5I94 A;  1KVL A;  4S2L A;  2XEP A;  4KG5 A;  5A91 A;  3VSL A;  5EVI A;  3O86 A;  3IF5 A;  2A49 A;  2ZQC A;  1FOF A;  4MBK A;  3IHA A;  4EUZ A;  3S22 A;  1BLH A;  3GSG A;  4WMC D;  2WZZ A;  3UO9 A;  5BOH A;  1K25 A;  2ZQ9 A;  3BFE A;  3V39 A;  3ZFZ A;  3S4X A;  4BD1 A;  2IWB A;  1S6R A;  4IVK A;  1MWT A;  4ZAM A;  4KZ5 A;  5AQB A;  3IT9 A;  1Z6F A;  3ZG5 A;  4LEN A;  4HBT A;  4KQO A;  2HDS A;  3PBQ A;  2WGW B;  4PM8 A;  1SDN A;  5A92 A;  3PBN A;  3C4O A;  4DE1 A;  4E6W A;  1IKG A;  2Y2J A;  4PPR A;  3G2Y A;  1CEF A;  4GKU A;  1LI0 A;  3GMW A;  2WK0 A;  3UDX A;  2Y2M A;  1IYO A;  1JWV A;  3SOI A;  1PWG A;  5F1G A;  2WZX A;  5CXW A;  2EX6 A;  1L0E A;  4S2O A;  3IWI A;  2GDN A;  3DWZ A;  3HUN A;  3NBL A;  4RYE A;  5DVA A;  3MXR A;  3IWO A;  3TG9 A;  3N4I A;  1K54 A;  3SH8 A;  3N6I A;  1IEM A;  2CC1 A;  1GA9 A;  1PZP A;  3NDE A;  4WYY A;  1LL5 A;  1GHI A;  1BSG A;  1JTD A;  3N8R A;  4GD6 A;  1M40 A;  5CEC A;  3GVB A;  1MXO A;  3M2K A;  3C7V A;  3UNW A;  5JYO A;  5AQ7 A;  4O7D A;  3W4P A;  4ID4 A;  1K4F A;  5EE8 A;  1IYP A;  2I72 A;  1BT5 A;  3A3I A;  3WS1 A;  1IYQ A;  1YLZ A;  1ES3 A;  3Q7V A;  1SDE A;  3MXS A;  2WKH A;  4S2N A;  3DTM A;  4WZ4 A;  1IEL A;  1XX2 A;  2V20 A;  1JWZ A;  1LL9 A;  5GLB A;  4B4X A;  3GQZ A;  3RXW A;  1HTZ A;  4OLG A;  3NDG A;  3MBZ A;  5GLD A;  1NYM A;  2X01 A;  3BLS A;  3EQU A;  4LV0 A;  1JTG A;  4ZJ3 A;  2WKE A;  4QJG A;  4Y0U A;  4R4S A;  4P0M A;  4BL3 A;  4JBF A;  1ONH A;  1PIO A;  2Z2L B;  3Q82 A;  3GTC A;  3HBR A;  4KZA A;  4E3K A;  3PAG A;  3S1Y A;  1CI8 A;  1ESU A;  4MEZ A;  3N8L A;  1YMX A;  3AGE A;  4KZ4 A;  4IBX A;  5FAS A;  3ZNT A;  5M19 A;  4JXS A;  4R1G A;  4F94 A;  1K54 C;  4L0L A;  5CRF A;  2ZMA A;  2J9O A;  4OON A;  1FR1 A;  3RXX A;  2H5S A;  4WM9 A;  5FI7 A;  2H10 A;  3WS4 A;  1U60 A;  3MKF A;  4E3N A;  2RCX A;  1LHY A;  3TOI A;  1K57 C;  1MY8 A;  2Y2H A;  1KDW A;  3OCN A;  5CHU A;  3UPP A;  4Y0T A;  1W7F A;  4WZ5 A;  4ZDX A;  2H0T A;  3FV7 A;  1K6R A;  5J8X A;  5E2E A;  1FCN A;  3C4P A;  3FKW A;  3ZNY A;  1ERO A;  5L2F A;  3VP1 A;  4GZB A;  1E3U D;  4NET A;  3SS5 A;  3LY3 A;  4X6T A;  1SHV A;  1BUE A;  1IYS A;  2J9P A;  4N9K A;  3IXB A;  5CED A;  1XGJ A;  4RVA A;  3ZVT A;  3HRE A;  4EWF A;  2Y2Q A;  1SCW A;  4WZ5 C;  4E3M A;  5EOO A;  4EBN A;  4HBU A;  5EPH A;  2ZC4 B;  1KGG A;  1NZU A;  2ZC6 B;  2ZQD A;  4OKP A;  2ZM0 A;  3ZCZ A;  1KDS A;  3ZG8 B;  4BL2 A;  5HW3 A;  3CMZ A;  3N8S A;  4N1H A;  1K56 D;  1L0F A;  1O7E A;  3HLF A;  1MWU A;  1DJA A;  1PWC A;  5GLA A;  5TR7 A;  3HUO A;  4PM5 A;  3M6B A;  5FQ9 A;  2WUQ A;  4QHC A;  1ERQ A;  1RGZ A;  5EUA A;  5FI6 A;  5FQI A;  1EWZ A;  4OVD A;  4OPZ A;  2QMI A;  1LI9 A;  5E2F A;  1E25 A;  4M3K A;  4MBF A;  5TFQ A;  5FI2 A;  3G2Z A;  4OLD A;  4C75 A;  4OPY A;  1BLP A;  1YLY A;  2OV5 A;  3BRM A;  4RA7 A;  2EX2 A;  2Y59 A;  2EX9 A;  3IQA A;  3BFF A;  2Y2P A;  5AQ9 A;  4KZ3 A;  5HL1 A;  2ZQ8 A;  1VM1 A;  4PM7 A;  4WEL A;  1W5D A;  2XR0 A;  1XPB A;  1FSY A;  4DF6 A;  1BUL A;  1GA0 A;  5CHJ A;  3FZC A;  2IWD A;  1K4E A;  1L0D A;  3PTE A;  2XK1 A;  1E4D A;  1K56 A;  3IH8 A;  5CGW A;  5E2G A;  5AQA A;  4K0X A;  4OQ0 A;  4OPQ A;  4BJP A;  4U0X A;  4DXC A;  1LLB A;  3VSK A;  2ZD8 A;  5CHM A;  3VFH A;  4RX3 A;  4DE2 A;  3FYZ A;  3IF6 B;  1DY6 A;  1PYY A;  2H0Y A;  4FD8 A;  4S2P A;  2JE5 A;  1PW8 A;  2A3U A;  2HDR A;  4ZBE A;  3V5M A;  3OPH A;  4Y0O A;  1WE4 A;  2EFU A;  1YQS A;  1BLC A;  1CI9 A;  5KSH A;  3IF6 C;  3ITB A;  1XXM A;  4JPM A;  2EX8 A;  2EXA A;  1ES2 A;  3HLE A;  1CK3 A;  3VP4 A;  1YLP A;  4XUZ A;  3O3V A;  5KZH A;  5HX9 A;  4K91 A;  4GB7 A;  1N9B A;  1ZG6 A;  2ZM2 A;  1I5Q A;  1FQG A;  3NIA A;  2RL3 A;  4JXW A;  5A93 A;  1I2W A;  1YMS A;  4E3J A;  4N92 A;  1SKF A;  4ZJ2 A;  3VOY A;  3BEC A;  3VFF A;  1K38 A;  2Y2I A;  3G35 A;  3NI9 A;  3SS3 A;  3W4O A;  2Y2G A;  3O87 A;  3SS4 A;  3BLM A;  4HES A;  3OPL A;  1TDG A;  1DJB A;  4JKT A;  2X02 A;  5EOE A;  4FSF A;  3NCK A;  1PI5 A;  4QY5 A;  3LY4 A;  4KG6 A;  3ZHH A;  2HP9 A;  4C3Q A;  4LCL A;  5EEC A;  4X68 A;  2XFT A;  4LCM A;  2PBY A;  4X53 A;  1NXY A;  2ZQ7 A;  1BZA A;  3N7W A;  1FSW A;  2Y2N A;  3E2L A;  4PM9 A;  3UE3 A;  1RP5 A;  4GN2 A;  4WBG A;  4S2J A;  3OPP A;  4GNU A;  1KVM A;  3FWL A;  3CJM A;  1ES5 A;  3PBS A;  2JCH A;  1K57 A;  3W8K A;  4BD0 A;  5FA7 A;  3BFD A;  1EI5 A;  3HUM A;  1W8Y A;  4B4Z A;  1HZO A;  2OLV A;  2ZC5 B;  5DTK A;  1Y54 A;  3WS5 A;  4FH2 A;  2ZC3 B;  4JF6 A;  4OPR A;  2FFY A;  5FDH A;  5A90 A;  5TGF A;  5CER A;  4FCF A;  3A3F A;  4Y7P A;  1Q2Q A;  1QME A;  5DF8 A;  5EVL A;  4DRT A;  3UE1 A;  2PU2 A;  1RCJ A;  4BLM A;  1HD8 A;  2JC7 A;  2Y4A A;  2Y91 A;  4OP8 A;  3UPO A;  3WS2 A;  4UA6 A;  2P9V A;  4DKI A;  4S2M A;  4KQQ A;  2V1Z A;  2XDM A;  4E3L A;  1W79 A;  1YLJ A;  1PWD A;  1NY0 A;  1XGI A;  2P9V B;  2QPN A;  3C5A A;  5CGS A;  5CEB A;  4GOG A;  5D3O A;  1WYB A;  5EVI D;  5F82 A;  3DW0 A;  3A3J A;  5E2H A;  5HAP A;  3G32 A;  5GL9 A;  5IHV A;  4ZTK A;  2WGV A;  3VP0 A;  4QY6 A;  4RX2 A;  4R23 A;  4FH4 A;  1K55 A;  5HAI A;  4IBR A;  2ZJ9 A;  5FQQ A;  1GCE A;  1H5X A;  3GRJ A;  3HL9 A;  4WEK A;  2XD5 A;  3VMA A;  1CEG A;  3OC2 A;  2HP5 A;  2V2F F;  3FKV A;  4JLF A;  4KZ9 A;  1NZO A;  4XXR A;  1PW1 A;  4BQM A;  3V3S A;  3GV9 A;  5E43 A;  3OPR A;  4DXB A;  1ZC2 A;  3D4F A;  1MKI A;  5FQK A;  4XUX A;  4X69 A;  3BYD A;  4N9L A;  4MNR A;  3RJU A;  4YFM A;  1K55 C;  1NJ4 A;  2IWC A;  3GR2 A;  4A5R A;  1I2S A;  2XLN A;  3UDF A;  1PZO A;  1TDL A;  3UN7 A;  4UA7 A;  2Y2L A;  1N4O A;  1W8Q A;  4GDN A;  3P09 A;  1FCO A;  1ONG A;  4UA9 A;  2WKI A;  1ES4 A;  3WRT A;  1JWP A;  3QHY A;  4OQI A;  1AXB A;  3ZG0 A;  4QD4 A;  3HLB A;  3UE0 A;  1C3B A;  2ZLY A;  3IXD A;  3HLD A;  2WGW A;  4OOM A;  4NK3 A;  4PMA A;  4ZJ1 A;  3HLW A;  3IH9 A;  4IVI A;  3V3R A;  2WAE A;  4BEN A;  2WAF A;  3B3X A;  5KSC A;  2EFX A;  4E3I A;  3EQV A;  2Y2K A;  4UHU A;  3W4Q A;  2DNS A;  4R4R A;  1L0G A;  4B88 A;  5FSR A;  4CJN A;  3A3E A;  5FAP A;  5U47 A;  2JBF A;  3ZG9 B;  2P74 A;  2ZC7 A;  1ZKJ A;  2DRW A;  3ZVW A;  2B5R A;  3QNC A;  3WRZ A;  4LV3 A;  3Q1F A;  1GHP A;  2J8Y A;  1ZG4 A;  1YM1 A;  3Q7Z A;  4WEJ A;  5JYP A;  1DJC A;  2Z2M B;  4KG2 A;  4OQG A;  3BM6 A;  1K6S A;  3SH9 A;  1KGE A;  1BLS A;  1MBL A;  1L2S A;  5GHZ A;  3I7J A;  1KE4 A;  4PM6 A;  3Q7V B;  4JXV A;  1OME A;  3NY4 A;  1O07 A;  5FAQ A;  1XA7 A;  1IKI A;  2X71 A;  5FAT A;  2G2U A;  4P85 A;  5M18 A;  3LCE A;  1RGY A;  5FAO A;  3MZD A;  4CPK A;  3PBT A;  3OZH A;  3ITA A;  2PU4 A;  3IXH A;  1S0W A;  4H8R A;  1G6A A;  3AGF A;  4U0T A;  5CTN A;  2G2W A;  1XA1 A;  5DF7 A;  5G18 A;  3DWK A;  2XQZ A;  3E2K A;  3UDI A;  1H8Y A;  5GHX A;  4HEF A;  3C7U A;  2WYX A;  3G31 A;  3Q81 A;  4WMC A;  3PBO A;  3AGD A;  4DE3 A;  3G34 A;  1JVJ A;  5M1A A;  4OOY A;  2Y55 A;  4GD8 A;  3QNB A;  3VOZ A;  1XP4 A;  2XFS A;  3BFC A;  4S2K A;  4DDY A;  1Q2P A;  1PI4 A;  1MWS A;  2OSU A;  3M6H A;  4QU3 A;  5DF9 A;  3ISG A;  4OOL A;  1E3U A;  5CGX A;  4E6X A;  4U3T A;  4MLL A;  4R3B A;  2XD1 A;  2VGJ A;  2QZ6 A;  1M6K A;  3NC8 A;  4P6B A;  4P87 A;  3VP3 A;  3O88 A;  4EQI A;  4KQR A;  3ZGA B;  2DCF A;  3A3D A;  3WS0 A;  1ERM A;  1MWR A;  4KEN B;  1NYY A;  3MKE A;  3P98 A;  4LV2 A;  4S2I A;  3OCL A;  3JYI A;  4JF5 A;  1TEM A;  4EBL A;  2Q9M A;  1YT4 A;  3HVF A;  1FR6 A;  2HDQ A;  2J7V A;  4C6Y A;  2HPB A;  5CTM A;  3HLG A;  2HDU A;  4GDB A;  1NRF A;  5DTT A;  4DE0 A;  4Q8I A;  1XKZ A;  2BLS A;  4MBH A;  1VQQ A;  4R3J A;  2WAD A;  3Q07 A;  4JXG A;  2EXB A;  3CZD A;  1H8Z A;  4EV4 A;  3IWQ A;  2UWX A;  1TVF A;  3MZF A;  1BTL A;  3TSG A;  1KE0 A;  2Y2O A;  4LV1 A;  3CG5 A;  5EVI B;  3UPN A;  4E3O A;  2XH9 A;  4K0W A;  2HP6 A;  5HFO A;  3SH7 A;  1ALQ A;  4QB8 A;  1KE3 A;  4KZ6 A;  4OQH A;  2FFF B;  2OLU A;  1J9M A;  3G30 A;  5GHY A;  2R9X A;  2XGN A;  3ZDJ A;  4D2O A;  2ZQA A;  4DDS A;  3LO7 A;  3PBR A;  2Q9N A;  5EVI C;  5FQJ A;  3M2J A;  2WGI A;  3G4P A;  4JF4 A;  4KZB A;  4N1X A;  4X56 A;  5FQM A;  4OP5 A;  3MFD A;  3IHB A;  1HVB A;  2R9W A;  1KGF A;  1YLW A;  3V50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...