3JYIA

Structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELGEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Structural and biochemical evidence that a TEM-1 beta-lactamase N170G active site mutant acts via substrate-assisted catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3jyiA00
1YLYA 1PZPA 2ZM0A 3M2JA 2Y2OA 5F1GA 4MNRA 5E2EA 3ZG8B 2Y2HA 3O86A 3ZG5A 1O7EA 5CHUA 3TSGA 3RXXA 3LY4A 4K0WA 5HW3A 2UWXA 2I72A 2JBFA 3IWOA 4RYEA 5TR7A 3FWLA 3VFHA 2H10A 3P98A 3W4QA 2EXAA 2WAEA 3WS1A 3IT9A 3LO7A 3O3VA 4LENA 1NYYA 2XR0A 2G2WA 2EX2A 2ZC6B 3NCKA 4GZBA 2ZQ7A 3HLEA 3UDXA 1L2SA 2J7VA 3BEBA 2H5SA 1PWCA 3MZFA 4E6XA 1FQGA 1I5QA 1QMEA 1LL5A 2DCFA 3O87A 3IF6B 3Q7ZA 4DE2A 2ZQ9A 1ESIA 4GD6A 2Y59A 4KZ5A 4OLGA 1BTLA 4UA6A 3G30A 4D2OA 3OCLA 3A3IA 4OONA 4GKUA 4GOGA 1PWDA 5E2FA 1MKIA 5FI6A 4OOLA 5CGSA 3IXHA 1JWPA 3SOIA 3ITBA 5JYOA 1K55A 1LHYA 1PI4A 1TVFA 3MZEA 1WYBA 1HZOA 5DTSA 1BSGA 3W4OA 2A49A 1CI8A 2QZ6A 2HDSA 3A3EA 3PBOA 1KDSA 1LL9A 3CZDA 4OOMA 4OKPA 5GLCA 3WS4A 1YQSA 4N9KA 3PTEA 5JYPA 3BRMA 1CEFA 3ZNTA 4ZAMA 2RCXA 1EI5A 3C4OA 1NJ4A 4BD1A 4K91A 2P9VB 4DDYA 4E3OA 2Z2MB 5HFOA 4Q8IA 4KG6A 3MKFA 4QY5A 5KZHA 1SDEA 1K55C 2Y2LA 4S2NC 4O7DA 3VP0A 3ZGAB 4PM9A 3OPPA 3ITAA 3NY4A 2XD1A 3Q7VA 1CK3A 3OZHA 1EROA 4X68A 3VP2A 4RVAA 3OC2A 4MBHA 1E25A 5CGWA 4WM9A 1EWZA 1MWSA 5A93A 2XFTA 4B4XA 3C5AA 4QB8A 2IWCA 1IKIA 1XP4A 4LV0A 4DDSA 2R9WA 3ZG7B 3UPNA 4ZBEA 3HLFA 5FQKA 3HLCA 3IXBA 1MWRA 5KMWA 2WKHA 2BG1A 5EVID 3SH8A 5M18A 3M6BA 3HL9A 4E6WA 3PAEA 4FH2A 5IHVA 1XXMA 3V3RA 2B5RA 1K56D 4E3IA 1KVLA 3VP3A 2ZQ8A 4WZ5A 3ZVTA 2WK0A 4B4ZA 1K54A 3RJUA 3E2KA 3GRJA 3IHBA 1VM1A 4HBTA 3N6IA 2WYXA 1BLSA 3VOZA 2XDMA 3GR2A 5GLDA 3G34A 3BM6A 2WKEA 3Q81A 3V50A 3C7UA 4JKTA 3WRTA 1FCOA 3DTMA 3N8RA 1MPLA 4GB7A 4X6TA 4U0XA 1C3BA 5F82A 3SS4A 2OLVA 5EVIC 1K57A 4R0QA 1W8YA 2OLUA 3GSGA 3Q1FA 5A91A 3S1YA 1KE0A 3ZCZA 4LV1A 5D3OA 4WZ5C 2WGVA 3SS3A 2WAFA 1W8QA 1K54C 5FQIA 4BL3A 4E3MA 5HAQA 1ERQA 1U60A 2E8IA 4S2IA 4X56A 4R1GA 3NIAA 1YLWA 4R4SA 1LI0A 1WYCA 2ZLYA 4QHCA 5DF8A 1L0FA 1JWVA 3AGDA 1G6AA 1HTZA 2FFFB 4EUZA 4WEJA 5AQ9A 1MBLA 3UN7A 2X02A 4R3JA 2V2FF 1NY0A 3MXRA 1CI9A 5FSRA 5M19A 4WMCA 3A3JA 4JF4A 1NZOA 1XPBA 3SS5A 2XD5A 4RX2A 5EOOA 4Y0TA 4N1XA 4GNUA 1JWZA 3ZFZA 4C6YA 2CC1A 1HVBA 4A5RA 5A92A 2V20A 1XGJA 3DW0A 5CGXA 4PMAA 4N92A 2X01A 3PBSA 2ZM2A 5F83A 3ZVWA 1M6KA 3AGFA 1BUEA 4S2MA 3HLGA 3OCNA 2Y91A 1RP5A 5GHYA 3PBQA 1MWUA 1PW8A 1Q2QA 2WGWB 2XEPA 3BFGA 1FR1A 2QPNA 3HLWA 3ZG0A 2WUQA 4BENA 5DVAA 2ZC7A 3NI9A 5FI7A 2FFYA 2QMIA 1I2SA 5A90A 4PPRA 1XA1A 2OSUA 1I2WA 2IWDA 3ZG9B 4S2PA 3GV9A 3ZNYA 2JE5A 3HVFA 3NDGA 4KENB 2EFXA 3GTCA 1KE4A 3UO9A 5F1FA 1K4EA 4OQIA 1RCJA 3UPPA 3UNWA 2Y55A 4P0MA 4R23A 1LI9A 3OPRA 2H0YA 4S2LA 4QU3A 5FI2A 1TDGA 1XGIA 4HBUA 3A3FA 4X55A 2ZQAA 5CTNA 3VP1A 4HESA 3BFEA 3BFDA 1ES2A 2Q9NA 3UPOA 1YMSA 5AQBA 5HAPA 1IYPA 4Y7PA 1PZOA 4RA7A 5CEDA 2ZMAA 3VOYA 2VGKA 2HDRA 4P6BA 4U0TA 5BOHA 1MWTA 4FSFA 4MLLA 5FA7A 2VGJA 4X53A 1ESUA 4UHUA 1IYOA 3QNBA 5TFQA 3GQZA 4M3KA 1O07A 4R4RA 4F94A 1K6SA 5CHJA 1ZG6A 5DF7A 3MZDA 1GA0A 1NZUA 2EFUA 3IHAA 4EQIA 3I7JA 3HLBA 5FQJA 3IQAA 3FYZA 4OOYA 2H0TA 3HUOA 5KSCA 2DRWA 5EPHA 3ZDJA 3BECA 4KZAA 1QMFA 2Y2MA 3VMAA 3IF6A 1ES4A 1JTDA 2Y2QA 2HDUA 1ES3A 5HAIA 1KGFA 1KVMA 1YLZA 4S2KA 1BLCA 3G4PA 5CERA 4MBFA 1JTGA 5G18A 4KG2A 2WKIA 3Q07A 5DTTA 4DF6A 2XH9A 2WZZA 4E3KA 3MXSA 4OVDA 3RXWA 4BLMA 2JCHA 1KGEA 4GDBA 1YM1A 4PM5A 1PIOA 4JXSA 1JVJA 3O88A 1SKFA 3IF5A 3P09A 1Y54A 2Y2JA 2GDNA 2ZQCA 4BQMA 4KZBA 4XUXA 1S0WA 4FH4A 4JPMA 3N8LA 4ZJ2A 1IYQA 3BLMA 3WS2A 3G2ZA 5M1AA 3QNCA 4N9LA 1H8YA 1XX2A 3IF6C 1IYSA 2Y2GA 4IEDA 4KQQA 4KQRA 5AQ7A 1DJBA 1L0GA 3UDFA 1YLTA 2Y2IA 4PM8A 3OPHA 4OQGA 4XUZA 5E2HA 2IWBA 1E3UA 4FCFA 4ID4A 1GA9A 1XA7A 5GHZA 2P9VA 5FAQA 3E2LA 1BZAA 4OPQA 4DKIA 4IVIA 3IH8A 4NETA 4OQ0A 2WADA 3FKWA 4BJPA 4UAAA 2V1ZA 3G2YA 5GL9A 2C6WB 1GHPA 1WE4A 4P85A 4KQOA 4Y0UA 3N8SA 4MBKA 4DRTA 1MY8A 5CHMA 1FCMA 1KDWA 2PU4A 3Q82A 4ZDXA 4WZ4A 4WMCD 1K57C 4E3JA 2Q9MA 4JXWA 2EX8A 3A3DA 1K6RA 1PYYA 3SH9A 1H8ZA 4B88A 5U47A 2HDQA 3TG9A 3IXGA 2Y2PA 5FATA 3UE3A 1K38A 2XF3A 1YLPA 2J9OA 1CEGA 2RL3A 4PM7A 3HLDA 3W8KA 4DE3A 2G2UA 1E4DA 2BLSA 1TDLA 1HD8A 3W4PA 4ZTKA 4DE0A 3HUMA 2DNSA 3UDIA 3BLSA 1ZC2A 3NBLA 5CXWA 5CTMA 4WEKA 2ZM8A 4X69A 3Q7VB 3MKEA 4OQHA 3LEZA 1KGGA 5GLBA 3G31A 1VQQA 4P87A 3PBRA 4OP8A 3BYDA 3UE1A 2XQZA 4MEZA 4DE1A 4EBLA 5E2GA 2ZD8A 3MBZA 1W7FA 3NC8A 4KZ3A 4UA9A 1SDNA 4IVKA 4OPYA 2OV5A 4E3LA 4OPRA 4CJNA 2R9XA 5DTKA 3IWQA 2XFSA 3LY3A 4FD8A 3WRZA 3S4XA 4K0XA 1DJCA 3V3SA 5EVIB 1BLPA 1ZKJA 4UA7A 4C75A 2PU2A 2Z2LB 1PWGA 3CG5A 4YFMA 3QHYA 4LV2A 3BFCA 1XKZA 4E3NA 1M40A 1LLBA 4IBXA 5FAOA 4EBPA 3VP4A 1NYMA 2WZXA 4OP5A 4RX3A 4WBGA 3GMWA 1S6RA 1YLJA 4R3BA 3VSLA 4JXGA 3IH9A 1FCNA 3MFDA 3S22A 5I94A 4JBFA 4S2NA 2JC7A 1IKGA 1ALQA 1TEMA 3PBTA 4S2JA 3C7VA 3N4IA 1J9MA 1W5DA 2HPBA 3G35A 1OMEA 3AGEA 1BLHA 1FOFA 1SHVA 1H5XA 3D4FA 3HREA 4PM6A 4KZ8A 1FR6A 4GD8A 3VFFA 4CPKA 2HP5A 1NXYA 3BFFA 1GHIA 5HARA 5CRFA 5TGFA 1ONHA 2EXBA 5EOEA 3IWIA 2EX6A 3EQUA 2HP6A 4ZJ3A 3FV7A 4JF5A 5FAPA 4H8RA 3M2KA 5FQMA 1MXOA 1YMXA 1DJAA 1Z6FA 4NK3A 3TOIA 1RGYA 2Y2NA 5HL1A 4QY6A 1IELA 3B3XA 2WGWA 3LCEA 1L0DA 3G32A 2X71A 5EUAA 1YT4A 2P74A 3HUNA 4LCLA 5GHXA 3WS0A 3V39A 4OH0A 3UY6A 2EX9A 5L2FA 1RGZA 4KZ7A 5FASA 3M6HA 4DXBA 1N9BA 5EECA 4EWFA 4LV3A 4XXRA 3JYIA 1DY6A 4IBRA 1K4FA 4LCMA 5FQ9A 2ZC5B 4KZ6A 4BD0A 3NDEA 1Q2PA 4L0LA 2J9PA 5EVIA 3FZCA 1GCEA 1SCWA 3IXDA 2XLNA 5DF9A 3DWZA 5J8XA 1FSYA 5GLAA 1FSWA 1ES5A 2PBYA 1IEMA 1BT5A 3N7WA 1E3UD 3CJMA 1K56A 4WELA 3EQVA 3DWKA 1N4OA 4GN2A 2ZQDA 2C5WB 2WGIA 4OPZA 4Y0OA 4S2OA 3ZHHA 4Z9QA 3WS5A 4KG5A 4KZ4A 2HP9A 4JF6A 1ZG4A 3PAGA 4ZJ1A 1G68A 1K25A 4U3TA 4WYYA 5FQQA 4EBNA 1ERMA 5CECA 3VSKA 4OLDA 1GHMA 3WWXA 5E43A 4QJGA 2Y4AA 3OPLA 1BULA 1PI5A 5KSHA 4DXCA 2J8YA 5HX9A 3SH7A 5CEBA 3UE0A 5AQAA 4QD4A 1AXBA 4C3QA 1L0EA 2ZC4B 4N1HA 3FKVA 3GVBA 4BL2A 2ZJ9A 3ISGA 2Y2KA 5EVLA 2A3UA 2XGNA 1ONGA 4EV4A 3HBRA 4KZ9A 4GDNA 5FDHA 2XK1A 3PBNA 3V5MA 4YINA 4JXVA 1NRFA 4JLFA 1PW1A 1KE3A 3CMZA 5EE8A 1W79A 4HEFA 3C4PA 2ZC3B
chains in the Genus database with same CATH superfamily
4CLCB 1YLYA 2Y2HA 3ZG5A 3O5YA 1O7EA 5CHUA 3LY4A 4K0WA 4L9GA 5HW3A 2JBFA 3IWOA 5TR7A 1VETB 2WAEA 3WS1A 3IT9A 1NYYA 2XR0A 2ZQ7A 4Q0JA 3MZFA 1FQGA 2W0NA 3D9YA 5FL3A 3CWFA 5DFXA 2VV6A 4GD6A 4KZ5A 4UA6A 3G30A 1H0MA 2VK3A 5E2FA 2O9AA 3ITBA 3CPTA 1UWPX 3C2WA 1T1AA 1BSGA 2W1TB 3W4OA 2A49A 1KDSA 3CZDA 4N9KA 3QP2A 3VE4A 3BRMA 3ZNTA 4ARZA 4BD1A 3PXPA 2Z2MB 3MKFA 4QY5A 1K55C 1GSVA 2JN7A 2Y2LA 4PM9A 2XD1A 3Q7VA 5HPFA 1T18A 1L3LA 3VP2A 3OC2A 4WM9A 1EWZA 2XFTA 4B4XA 3C5AA 4QB8A 4Q0IA 4DDSA 3UPNA 4ZBEA 3HLFA 5KMWA 4BBVA 2L0WA 2VA0A 3HL9A 4E6WA 1XXMA 2W3FA 3NOUC 4X25A 1K56D 3CUEC 4E3IA 1KVLA 1S67L 5HDSA 3KYQA 4R38A 4B4ZA 2PBDP 3RJUA 2OWHA 2PT7A 1D06A 5HDCA 3VOZA 3G34A 2WKEA 3Q81A 3WRTA 4X6TA 1MPLA 4GB7A 5F82A 4MCWA 1FIKA 3S7OA 4R0QA 1W8YA 3GSGA 3Q1FA 5A91A 3S1YA 3LICA 4O0PA 4LV1A 4WZ5C 2WGVA 3F1OB 4QWOA 4BL3A 5HAQA 1U60A 4X56A 4R4SA 2ZLYA 2ZMVA 1JWVA 1G6AA 4EUVA 2XROA 2K31A 1MBLA 3UN7A 2V2FF 4HOIA 1CI9A 5HPIA 2PD8A 4WMCA 4Q0HA 4RX2A 4Y0TA 4Y17A 4UQIS 3L9KA 4GNUA 3E0YA 4C6YA 2CC1A 3QP8A 1VEUA 5CGXA 2X01A 5J7EA 5AVFA 2ZM2A 3CLOA 1BUEA 4MMNA 5K5BA 2Y91A 1MWUA 2Q0OA 3BFGA 2VJWA 5DVAA 2ZC7A 2M1CA 5FI7A 1HLUP 3QP6A 3T4QA 1I2WA 3ZG9B 3GV9A 4KENB 1T1BA 1RCJA 4GW9A 3UNWA 5G4ZA 1AWIA 4R23A 5HD3A 4QU3A 4GHIB 2UV0E 4HBUA 3A3FA 3FPWA 2Q9NA 3T4LA 4Y7PA 1PZOA 4WF0A 3TJZC 3BY9A 3T1SA 3VOYA 2O0YA 1MWTA 4FSFA 3KSGA 5TFQA 3GQZA 4Y3IA 4F94A 1K6SA 2ZL1B 5CX7A 3HLBA 4GJ4A 2H0TA 5EPHA 3MMHA 4EU0A 3NJAA 1BLCA 5G18A 2WZZA 2V0UA 4E3KA 5L10A 1DP8A 1YM1A 1XJ2A 3P09A 1Y54A 2ZQCA 2V0WA 3C30A 1S0WA 4JPMA 1H8YA 1XX2A 1DJBA 3PHYA 3OPHA 4KUKA 4FCFA 4ID4A 1BZAA 4HQAA 1G6OA 1UWNX 4BJPA 4UAAA 4AFIA 4KQOA 2V9AA 1MY8A 2V8FA 1KDWA 3Q82A 1S4SA 4E3JA 2EX8A 3IXGA 1IFQA 2Y2PA 1K38A 3W8KA 4ARZB 1E4DA 1TS8A 3EEAA 3W4PA 3KO6A 4HJ3A 3T1XA 4KQDA 4WEKA 2ZM8A 3Q7VB 3LEZA 1DP6A 4P87A 3BYDA 4IUKA 5E2GA 4B9OA 3MXQA 4KZ3A 3MS6A 4UA9A 4IVKA 4OPYA 4E3LA 3LGOA 4CJNA 2R9XA 2XFSA 3LY3A 3G6OA 3WRZA 3S4XA 3QP5A 4HJ6A 2P08A 1LSVA 3BFCA 4ETZA 4EBPA 5TBMA 3VP4A 1NYMA 4RX3A 3VSLA 1YLJA 4R3BA 5I94A 4JBFA 1IKGA 3T1RA 2HPBA 4I3IA 3EGDC 1BLHA 1FOFA 4PM6A 4KZ8A 2EXBA 5EOEA 1PNEA 2HP6A 3FV7A 1MKMA 5FQMA 3HCYA 5HL1A 4LPZA 5DJTA 1IELA 1CJFA 3B3XA 3NOPC 4FTXA 3LCEA 3G32A 3WS0A 2X71A 4LCLA 1P9WA 4LV3A 1F5MA 5FQ9A 1S1ZA 1VEUB 4EQ1A 3T1QB 1F9IA 1FSYA 3N7WA 1E3UD 1K56A 4WELA 3EQVA 5HDDA 3LIBA 4GN2A 2ZQDA 2C5WB 5HL6A 2OOLA 4Y0OA 4S2OA 3WS5A 1G68A 1XJ6A 4G3WA 4OLDA 2A24A 2Y4AA 1G28A 1PI5A 2J3WA 2J8YA 5EM0A 4GS9B 3JPUA 2FH5A 4QD4A 3QP1A 4C3QA 3ISGA 2XGNA 4EV4A 3HBRA 3NULA 3T4JA 4GDNA 3K2NA 2XK1A 3DBAA 2K7SA 4JLFA 3CMZA 4HEFA 2ZC3B 2Y2OA 1YAXA 3ZG8B 5FEFA 4BBTA 4RYEA 1ZHHB 2JKGA 1OJGA 1H8MA 3UDXA 2J7VA 3OLOA 1I5QA 2VGLS 3T50A 2Y59A 1BTLA 2QHKA 3OOVA 4LLOB 3OCLA 2XA7S 4OONA 5FI6A 4ZRRA 1STZA 5CGSA 2GNXA 4HP4A 4F3LB 2HJEA 2XSSA 3MR0A 3BQ8A 3JVUA 1F98A 3PBOA 1LL9A 1T1CA 3H82B 3C38A 1YQSA 2FZ0A 3IS2A 3B47A 2QJ7A 2RCXA 3ZYTA 3R4KA 3C4OA 1NJ4A 5MC7A 4DDYA 4E3OA 4Q8IA 3MJQA 4S2NC 3OPPA 5DKLA 3NY4A 1EROA 1P97A 4MBHA 4PKYA 5F5YA 2IWCA 1IKIA 3VV4A 2R9WA 1P9RA 4Y13A 3SH8A 1XJ3A 1OPXA 3PAEA 4EETB 3LUQA 4JGOA 3VP3A 3ZQ5A 2JKFA 1K54A 2WYXA 1BLSA 3CITA 3GR2A 2NUTC 3BM6A 1WA9A 3V50A 3N8RA 3SS4A 3TW8A 1KE0A 3TRCA 3A0RA 5D3OA 2WAFA 5FQIA 1ERQA 2E8IA 4S2IA 1XJ4A 3NIAA 1YLWA 4UEYA 4QHCA 4MN6A 4WEJA 1YKDA 3NOTC 1NY0A 1LSXA 4WUJA 2O99A 4HJ4A 3A3JA 2Z6CA 4O01A 1XPBA 3SS5A 4IUHA 1TS7A 3ZFZA 3IBJA 3U4LP 4RQ9A 3DW0A 1W63M 4PMAA 2ZBBA 5F83A 1M6KA 3OCNA 1RP5A 1XFNA 3KSHA 1FR1A 4BENA 4ME4A 2FFYA 5A90A 4PPRA 4S2PA 3ZNYA 1DRMA 3F1PA 2YKHA 5F1FA 4OQIA 3UPPA 4PAUA 1NWZA 2Y55A 1LI9A 1XGIA 3K3CA 4X55A 4G3KA 3BFDA 1T19A 4CLCD 4RA7A 3F1NA 4U0TA 5BOHA 1LT0A 4M4XA 1ODVA 2VGJA 2A24B 4Y2FA 1IYOA 2PR6A 1OTDA 4M3KA 1J3WA 4HHDA 1GA0A 1NZUA 3IHAA 5EV0A 5FQJA 1A0KA 4OOYA 3HUOA 4CLCC 5KSCA 4KZAA 2XRNA 3VMAA 3IF6A 2HDUA 3LR5A 1KVMA 3LIEA 4DF6A 4MBFA 3MXSA 1KGEA 1Y4OA 4JXSA 4PM5A 3O88A 3IF5A 2Y2JA 4QPRA 4X1LA 4KZBA 3BLMA 4WLAA 3WS2A 3UDFA 3MQOA 1VHMA 4PM8A 5E2HA 1E3UA 5GHZA 2P9VA 2VLGA 5FAQA 1SKOB 4OQ0A 2WADA 2V1ZA 3G2YA 5GL9A 2C6WB 2VX8A 3N8SA 1K57C 2O9CA 2Q9MA 3SH9A 4B88A 3A0VA 2HDQA 3UB9A 1YLPA 2J9OA 2RL3A 4PM7A 3MF0A 4DE3A 3KSIA 1N9OA 4ZTKA 4DE0A 2B95A 3HUMA 3UE6A 1ZC2A 3D3OA 1D1JA 4X69A 3SW1A 1GSWA 3MKEA 3LEQA 2E8JA 4EXOA 1KGGA 2VEAA 3BY8A 4OP8A 3T4OA 4MEZA 1W7FA 4BMWA 3OBFA 2Z6DA 3UB6A 4OPRA 4I5SA 2WKQA 4NXFA 3IWQA 2NUPC 3LR3A 4Z1WA 5EVIB 2WKPA 4C75A 3T12B 1V9ZA 3CG5A 4NEED 4E3NA 1M40A 1LLBA 2P7JA 2WZXA 4OP5A 4WBGA 2H28A 2JKRI 1OT6A 4JXGA 3S22A 4S2NA 2JC7A 2M7VA 3N4IA 1J9MA 2PHYA 4XT2A 1SHVA 3HREA 4CPKA 3BFFA 5HARA 1GHIA 2PDRA 4HH3A 3KX0X 2QWSA 3KSFA 3IWIA 4ESPA 4BBUA 4IHQA 5FAPA 3H9WA 1MXOA 1YMXA 3C8CA 3ULFA 1DJAA 3QP4A 1NLZA 4QY6A 2WGWA 5FDSA 3T4SA 4EESA 5L8MA 3HUNA 3EWKA 2B18A 4KZ7A 4EW7A 1N9BA 5EECA 1K0KA 1V9YA 2W3EA 1DY6A 4IBRA 1K4FA 4LCMA 4KZ6A 3JVVA 4L0LA 4WL9A 1GCEA 1SCWA 2XLNA 5GLAA 3MQQA 1ES5A 1BT5A 3DWKA 2KDKA 2WGIA 3VE3A 2HP9A 1ZG4A 4JGRA 3LIAA 5LBRA 4U3TA 4WYYA 4EBNA 5A8BA 4QJGA 2VZWA 3F1PB 4B93A 3OPLA 1BULA 3CPTB 5KSHA 3LYXA 5CEBA 3UE0A 5AQAA 2OAQ1 1L0EA 2ZC4B 3DAVA 2QYBA 2Y2KA 5EVLA 4BWIA 5FDHA 2L4RA 3PBNA 3V5MA 3W2ZA 1KE3A 2INWA 3C4PA 4FUWA 1TD5A 4LFUA 1PZPA 1Z09A 2ZM0A 3F1NB 3M2JA 5F1GA 4MNRA 3B42A 3H7WA 3TSGA 4X1MA 2I72A 3DTEA 3FWLA 3VFHA 3W4QA 2EXAA 3UB8A 3O3VA 4FOFA 1TF1A 1FILA 1L2SA 3BEBA 2H5SA 1TS6A 1QMEA 2DCFA 3IF6B 3Q7ZA 2ZQ9A 4OLGA 1NLYA 2LB5A 3A3IA 4G3VA 1PWDA 1MKIA 3E4QA 1JWPA 1K55A 1PI4A 1TVFA 3MZEA 2VV8A 5DTSA 5DKKA 1LL8A 2QZ6A 4OOMA 3WS4A 4H6JA 3LIFA 3NECA 4DJ3A 1TS0A 1EI5A 2P9VB 4CLCA 5KZHA 5TJJA 4O7DA 1KOUA 3ITAA 2D01A 3CUEA 2EWVA 5CGWA 1VETA 5A93A 1XP4A 2MJ6A 3B33A 3HLCA 3IXBA 2BG1A 5M18A 3M6BA 4FH2A 2W3HA 3V3RA 4MN7A 4WZ5A 2W3GA 3GRJA 3IHBA 1BYWA 4I39A 4HBTA 5GLDA 2BTFP 2A2LA 3CI6A 3FG8A 2W1TA 3C7UA 1FCOA 2W1RA 3DTMA 3U2AA 1C3BA 3EOIA 1K57A 3R7WA 2QKPA 4CQHA 1ACFA 2J80A 4HH2A 3MFXA 4R1GA 5DF8A 5AVEA 3AGDA 2FFFB 4EUZA 1JNUA 5AQ9A 3TE8A 4R3JA 4KUOA 3MXRA 5FSRA 4XT2B 4L9FA 4I3AA 4LRZE 5IT5A 4JF4A 5EOOA 4N1XA 1JWZA 4A5RA 5A92A 2V20A 3DTKA 4N92A 3PBSA 3ZVWA 1N9LA 4S2MA 3RH8B 5GHYA 1PW8A 2WGWB 2XEPA 5F68A 2QPNA 3HLWA 3NI9A 3IBRA 2IWDA 2JE5A 3HVFA 4PKYG 4I3JA 3UO9A 1KE4A 4O8GA 4LRYC 4P0MA 3OPRA 4S2LA 1TDGA 3F1OA 3KYZA 3VP1A 4HESA 3BFEA 3DTIA 3UPOA 1IYPA 5CEDA 2ZMAA 4P6BA 4MLLA 5FA7A 3T4TA 1OT9A 4HI4A 1O07A 4R4RA 1S4RA 4WN5A 1ZG6A 4II7A 5DF7A 3MZDA 5KIZA 2EFUA 1H3QA 4EQIA 3IQAA 3FYZA 3D72A 3RTYA 3BECA 2Y2MA 3ICYA 2KLIA 1ES4A 1X0OA 5CERA 2IA2A 3H7WB 3Q07A 2XH9A 1OTBA 4OVDA 1PIOA 4R6LA 1SKFA 4EEUA 2GDNA 4BQMA 4FH4A 5J3WA 2J3TC 3N8LA 5I5LA 4DMZA 2V8CA 3QNCA 4UQIM 3P7NA 1IYSA 4KQQA 5AQ7A 1L0GA 4GHIA 1YLTA 2Y2IA 2IWBA 3V67A 1GA9A 3E2LA 3LIDA 1YPRA 5TBMB 1IOUA 4Y0UA 4GLQA 1FCMA 2PU4A 2ZL1A 5U47A 3TG9A 5FATA 4R70A 3UE3A 2XF3A 1CEGA 1CQAA 3P01A 2B02A 2OWJA 2D02A 4EEPA 2DNSA 2HF6A 3BLSA 3NBLA 5C5KA 5CXWA 5GLBA 3G31A 3UE1A 3PYPA 3PBRA 2PRFA 2XQZA 2ZD8A 3MBZA 3NC8A 1G5UA 2EA9A 1P0ZA 2VV7A 1SDNA 2OV5A 2GX5A 5DTKA 2WKRA 4FD8A 4IJGA 4K0XA 1DJCA 1ZKJA 4UA7A 1DP9A 1PWGA 3QHYA 5FAOA 3GMWA 3RFBA 3BWLA 1TEMA 1YSPA 1ALQA 3PBTA 3LR4A 3C7VA 3G35A 3AGEA 3D4FA 1H5XA 4HIAA 4P6ZS 2HP5A 5CRFA 3R7WB 2EX6A 3EQUA 4ZJ3A 2BASA 3M2KA 1Z6FA 4NK3A 1RGYA 4HY8A 3BW6A 1L0DA 2P74A 3UY6A 2EX9A 1RGZA 1MZUA 4DXBA 4JGQA 3T4KA 1VB6A 3E4PA 3UMDA 3NDEA 1Q2PA 1NRJA 3IXDA 1FSWA 2PBYA 1N4OA 1S1YA 4OPZA 2CMNA 3ZHHA 4KZ4A 4JF6A 4ZJ1A 1K25A 3UMEA 5HX9A 3SH7A 4I38A 5J4EA 4N1HA 3GVBA 2ZJ9A 3VOLA 3IS2B 4YINA 1NRFA 1PW1A 5EE8A 1GHMA 1W79A 2W27A 3FC7A 2PD7A 5E2EA 3O86A 2HJ9C 3RXXA 2UWXA 2H10A 3P98A 3LI8A 3LO7A 4LENA 1PRQA 4LRXC 2G2WA 2EX2A 2ZC6B 3NCKA 4GZBA 3HLEA 3NHQA 1PWCA 4E6XA 4GCZA 1LL5A 1XFQA 3O87A 4DE2A 2PR5A 1ESIA 4NKPA 4D2OA 5L07A 4NXBA 1N9NA 2I9VA 4GKUA 4GOGA 4YOFA 4OOLA 3IXHA 3SOIA 5JYOA 1LHYA 1WYBA 2ZOHA 1HZOA 3LR0A 4GS9A 1CI8A 2HDSA 3A3EA 2GJ3A 2JKTM 4OKPA 5GLCA 3PTEA 5JYPA 1CEFA 4ZAMA 4K91A 2YKFA 4K08A 5HFOA 3S7NA 3IX8A 4KG6A 1SDEA 3ZGAB 3HJIA 3VP0A 1CK3A 3IX3A 3OZHA 4X68A 2HV1A 3IX4A 4RVAA 1E25A 1YSQA 3LFVA 1MWSA 2JHEA 2G7UA 4DN0A 4LV0A 3ZG7B 5FQKA 1MWRA 2WKHA 5EVID 5IHVA 2B5RA 2VKSA 2ZQ8A 2PYRA 2WK0A 3E2KA 1VM1A 3E4OA 3EGXC 4F3LA 3N6IA 2XDMA 5HWWA 3BJNA 4JKTA 4U0XA 2OLVA 5EVIC 3H82A 2OLUA 1OTIA 3ZCZA 3SS3A 1W8QA 1K54C 2VGLM 4E3MA 1LI0A 1WYCA 2LB9A 2OAP1 1L0FA 1HTZA 2XA7M 2K2NA 2X02A 1OJ5A 5L09A 5M19A 5HWTA 2ACGA 1NZOA 1CF0A 2KOIA 2XD5A 3KYEA 5F6AA 1HVBA 1XGJA 2M7UA 3AGFA 3HLGA 2PYPA 3PBQA 1Q2QA 2R78A 2V1BA 4MDZA 1UGUA 5HWVA 2PAVP 3ZG0A 2WUQA 2QMIA 1I2SA 1XA1A 2OSUA 3NDGA 2EFXA 3GTCA 1K4EA 2Y8HA 3L7HA 2H0YA 5FI2A 3BQAA 3MQ0A 2ZQAA 5CTNA 1ES2A 1YMSA 5AQBA 5HAPA 3PR6A 1SZVA 3EEHA 2VGKA 2HDRA 4D60A 4LGWA 4X53A 1ESUA 5F69A 4UHUA 3QNBA 5IU1A 5CHJA 2DMWA 3I7JA 2DRWA 3ZDJA 1QMFA 4JGPA 2Y2QA 1JTDA 4YWZA 1ES3A 5HAIA 2Y79A 1KGFA 1YLZA 4S2KA 4EERA 3G4PA 1JTGA 4KG2A 2WKIA 5DTTA 5HD5A 1PFLA 3RXWA 4BLMA 2JCHA 4GDBA 1JVJA 4HNBA 4XUXA 4ZJ2A 1IYQA 1S66L 3G2ZA 5M1AA 2AVXA 4N9LA 3E98A 3IF6C 4IEDA 2Y2GA 4KQRA 1GSXA 4OQGA 4XUZA 5FEGA 1XA7A 4OPQA 4R3AA 3FPVA 5DJUA 4DKIA 4IVIA 3IH8A 4NETA 3FKWA 3A0SA 1D7EA 1GHPA 1WE4A 3K3DA 4P85A 4MBKA 4DRTA 5CHMA 4ZDXA 4WZ4A 4WMCD 1Y28A 4NXGA 4JXWA 3A3DA 5AJGA 1K6RA 1PYYA 1H8ZA 3HLDA 3MSHA 2G2UA 2BLSA 4Y15A 1TDLA 1HD8A 2W3DA 3UDIA 5EFWA 5CTMA 1OTAA 2HGVA 2ZOIA 4OQHA 4DE1A 1VQQA 4EBLA 3S7PA 1W63Q 2L1MA 4P6ZM 2JKTI 3CHWP 3V3SA 1BLPA 2PU2A 2Z2LB 4YFMA 5IS1A 4LV2A 1SKOA 1XKZA 5DFYA 4IBXA 3GDIA 1S6RA 3IH9A 1FCNA 3MFDA 4YNRA 4S2JA 1W5DA 1OMEA 1LSWA 4MN5A 4PHTA 1FR6A 4GD8A 5EVEA 1MC0A 1EW0A 3CAXA 3VFFA 5HSQA 1NXYA 5TGFA 1ONHA 1OTEA 2V1AA 1F2KA 4NXEA 4CLCE 4JF5A 4H8RA 2J3TD 3UB7A 2GZAA 3TOIA 2Y2NA 3LI9A 3HJKA 2JKRM 5EUAA 1YT4A 5GHXA 3V39A 4DJ2A 3UB5P 4OH0A 5HZHA 5L2FA 5FASA 2QJ5A 3M6HA 4EWFA 4XXRA 3JYIA 4E04A 4Y5FA 4BD0A 2ZC5B 2J9PA 5EVIA 3FZCA 5DF9A 3DWZA 5J8XA 5EM1A 2P04A 4HP9A 1IEMA 3CJMA 1ZTUA 3S7QA 4Z9QA 4KG5A 4L9EA 3PAGA 4ETXA 4NG2A 5FQQA 2KX6A 1ERMA 5G4YA 3SZTA 3VSKA 3WWXA 5CECA 5E43A 3GECA 4DXCA 1AXBA 2EWWA 3FKVA 4BL2A 2ZMFA 2A3UA 2O9BA 1ONGA 4H6JB 4KZ9A 4JXVA 3ZVTA 2HZ5A
chains in the Genus database with same CATH topology
1YLYA 1PZPA 2ZM0A 3M2JA 2Y2OA 5F1GA 4MNRA 5E2EA 3ZG8B 2Y2HA 3O86A 3ZG5A 1O7EA 5CHUA 3TSGA 3RXXA 3LY4A 4K0WA 5HW3A 2UWXA 2I72A 2JBFA 3IWOA 4RYEA 5TR7A 3FWLA 3VFHA 2H10A 3P98A 3W4QA 2EXAA 2WAEA 3WS1A 3IT9A 3LO7A 3O3VA 4LENA 1NYYA 2XR0A 2G2WA 2EX2A 2ZC6B 3NCKA 4GZBA 2ZQ7A 3HLEA 3UDXA 1L2SA 2J7VA 3BEBA 2H5SA 1PWCA 3MZFA 4E6XA 1FQGA 1I5QA 1QMEA 1LL5A 2DCFA 3O87A 3IF6B 3Q7ZA 4DE2A 2ZQ9A 1ESIA 4GD6A 2Y59A 4KZ5A 4OLGA 1BTLA 4UA6A 3G30A 4D2OA 3OCLA 3A3IA 4OONA 4GKUA 4GOGA 1PWDA 5E2FA 1MKIA 5FI6A 4OOLA 5CGSA 3IXHA 1JWPA 3SOIA 3ITBA 5JYOA 1K55A 1LHYA 1PI4A 1TVFA 3MZEA 1WYBA 1HZOA 5DTSA 1BSGA 3W4OA 2A49A 1CI8A 2QZ6A 2HDSA 3A3EA 3PBOA 1KDSA 1LL9A 3CZDA 4OOMA 4OKPA 5GLCA 3WS4A 1YQSA 4N9KA 3PTEA 5JYPA 3BRMA 1CEFA 3ZNTA 4ZAMA 2RCXA 1EI5A 3C4OA 1NJ4A 4BD1A 4K91A 2P9VB 4DDYA 4E3OA 2Z2MB 5HFOA 4Q8IA 4KG6A 3MKFA 4QY5A 5KZHA 1SDEA 1K55C 2Y2LA 4S2NC 4O7DA 3VP0A 3ZGAB 4PM9A 3OPPA 3ITAA 3NY4A 2XD1A 3Q7VA 1CK3A 3OZHA 1EROA 4X68A 3VP2A 4RVAA 3OC2A 4MBHA 1E25A 5CGWA 4WM9A 1EWZA 1MWSA 5A93A 2XFTA 4B4XA 3C5AA 4QB8A 2IWCA 1IKIA 1XP4A 4LV0A 4DDSA 2R9WA 3ZG7B 3UPNA 4ZBEA 3HLFA 5FQKA 3HLCA 3IXBA 1MWRA 5KMWA 2WKHA 2BG1A 5EVID 3SH8A 5M18A 3M6BA 3HL9A 4E6WA 3PAEA 4FH2A 5IHVA 1XXMA 3V3RA 2B5RA 1K56D 4E3IA 1KVLA 3VP3A 2ZQ8A 4WZ5A 3ZVTA 2WK0A 4B4ZA 1K54A 3RJUA 3E2KA 3GRJA 3IHBA 1VM1A 4HBTA 3N6IA 2WYXA 1BLSA 3VOZA 2XDMA 3GR2A 5GLDA 3G34A 3BM6A 2WKEA 3Q81A 3V50A 3C7UA 4JKTA 3WRTA 1FCOA 3DTMA 3N8RA 1MPLA 4GB7A 4X6TA 4U0XA 1C3BA 5F82A 3SS4A 2OLVA 5EVIC 1K57A 4R0QA 1W8YA 2OLUA 3GSGA 3Q1FA 5A91A 3S1YA 1KE0A 3ZCZA 4LV1A 5D3OA 4WZ5C 2WGVA 3SS3A 2WAFA 1W8QA 1K54C 5FQIA 4BL3A 4E3MA 5HAQA 1ERQA 1U60A 2E8IA 4S2IA 4X56A 4R1GA 3NIAA 1YLWA 4R4SA 1LI0A 1WYCA 2ZLYA 4QHCA 5DF8A 1L0FA 1JWVA 3AGDA 1G6AA 1HTZA 2FFFB 4EUZA 4WEJA 5AQ9A 1MBLA 3UN7A 2X02A 4R3JA 2V2FF 1NY0A 3MXRA 1CI9A 5FSRA 5M19A 4WMCA 3A3JA 4JF4A 1NZOA 1XPBA 3SS5A 2XD5A 4RX2A 5EOOA 4Y0TA 4N1XA 4GNUA 1JWZA 3ZFZA 4C6YA 2CC1A 1HVBA 4A5RA 5A92A 2V20A 1XGJA 3DW0A 5CGXA 4PMAA 4N92A 2X01A 3PBSA 2ZM2A 5F83A 3ZVWA 1M6KA 3AGFA 1BUEA 4S2MA 3HLGA 3OCNA 2Y91A 1RP5A 5GHYA 3PBQA 1MWUA 1PW8A 1Q2QA 2WGWB 2XEPA 3BFGA 1FR1A 2QPNA 3HLWA 3ZG0A 2WUQA 4BENA 5DVAA 2ZC7A 3NI9A 5FI7A 2FFYA 2QMIA 1I2SA 5A90A 4PPRA 1XA1A 2OSUA 1I2WA 2IWDA 3ZG9B 4S2PA 3GV9A 3ZNYA 2JE5A 3HVFA 3NDGA 4KENB 2EFXA 3GTCA 1KE4A 3UO9A 5F1FA 1K4EA 4OQIA 1RCJA 3UPPA 3UNWA 2Y55A 4P0MA 4R23A 1LI9A 3OPRA 2H0YA 4S2LA 4QU3A 5FI2A 1TDGA 1XGIA 4HBUA 3A3FA 4X55A 2ZQAA 5CTNA 3VP1A 4HESA 3BFEA 3BFDA 1ES2A 2Q9NA 3UPOA 1YMSA 5AQBA 5HAPA 1IYPA 4Y7PA 1PZOA 4RA7A 5CEDA 2ZMAA 3VOYA 2VGKA 2HDRA 4P6BA 4U0TA 5BOHA 1MWTA 4FSFA 4MLLA 5FA7A 2VGJA 4X53A 1ESUA 4UHUA 1IYOA 3QNBA 5TFQA 3GQZA 4M3KA 1O07A 4R4RA 4F94A 1K6SA 5CHJA 1ZG6A 5DF7A 3MZDA 1GA0A 1NZUA 2EFUA 3IHAA 4EQIA 3I7JA 3HLBA 5FQJA 3IQAA 3FYZA 4OOYA 2H0TA 3HUOA 5KSCA 2DRWA 5EPHA 3ZDJA 3BECA 4KZAA 1QMFA 2Y2MA 3VMAA 3IF6A 1ES4A 1JTDA 2Y2QA 2HDUA 1ES3A 5HAIA 1KGFA 1KVMA 1YLZA 4S2KA 1BLCA 3G4PA 5CERA 4MBFA 1JTGA 5G18A 4KG2A 2WKIA 3Q07A 5DTTA 4DF6A 2XH9A 2WZZA 4E3KA 3MXSA 4OVDA 3RXWA 4BLMA 2JCHA 1KGEA 4GDBA 1YM1A 4PM5A 1PIOA 4JXSA 1JVJA 3O88A 1SKFA 3IF5A 3P09A 1Y54A 2Y2JA 2GDNA 2ZQCA 4BQMA 4KZBA 4XUXA 1S0WA 4FH4A 4JPMA 3N8LA 4ZJ2A 1IYQA 3BLMA 3WS2A 3G2ZA 5M1AA 3QNCA 4N9LA 1H8YA 1XX2A 3IF6C 1IYSA 2Y2GA 4IEDA 4KQQA 4KQRA 5AQ7A 1DJBA 1L0GA 3UDFA 1YLTA 2Y2IA 4PM8A 3OPHA 4OQGA 4XUZA 5E2HA 2IWBA 1E3UA 4FCFA 4ID4A 1GA9A 1XA7A 5GHZA 2P9VA 5FAQA 3E2LA 1BZAA 4OPQA 4DKIA 4IVIA 3IH8A 4NETA 4OQ0A 2WADA 3FKWA 4BJPA 4UAAA 2V1ZA 3G2YA 5GL9A 2C6WB 1GHPA 1WE4A 4P85A 4KQOA 4Y0UA 3N8SA 4MBKA 4DRTA 1MY8A 5CHMA 1FCMA 1KDWA 2PU4A 3Q82A 4ZDXA 4WZ4A 4WMCD 1K57C 4E3JA 2Q9MA 4JXWA 2EX8A 3A3DA 1K6RA 1PYYA 3SH9A 1H8ZA 4B88A 5U47A 2HDQA 3TG9A 3IXGA 2Y2PA 5FATA 3UE3A 1K38A 2XF3A 1YLPA 2J9OA 1CEGA 2RL3A 4PM7A 3HLDA 3W8KA 4DE3A 2G2UA 1E4DA 2BLSA 1TDLA 1HD8A 3W4PA 4ZTKA 4DE0A 3HUMA 2DNSA 3UDIA 3BLSA 1ZC2A 3NBLA 5CXWA 5CTMA 4WEKA 2ZM8A 4X69A 3Q7VB 3MKEA 4OQHA 3LEZA 1KGGA 5GLBA 3G31A 1VQQA 4P87A 3PBRA 4OP8A 3BYDA 3UE1A 2XQZA 4MEZA 4DE1A 4EBLA 5E2GA 2ZD8A 3MBZA 1W7FA 3NC8A 4KZ3A 4UA9A 1SDNA 4IVKA 4OPYA 2OV5A 4E3LA 4OPRA 4CJNA 2R9XA 5DTKA 3IWQA 2XFSA 3LY3A 4FD8A 3WRZA 3S4XA 4K0XA 1DJCA 3V3SA 5EVIB 1BLPA 1ZKJA 4UA7A 4C75A 2PU2A 2Z2LB 1PWGA 3CG5A 4YFMA 3QHYA 4LV2A 3BFCA 1XKZA 4E3NA 1M40A 1LLBA 4IBXA 5FAOA 4EBPA 3VP4A 1NYMA 2WZXA 4OP5A 4RX3A 4WBGA 3GMWA 1S6RA 1YLJA 4R3BA 3VSLA 4JXGA 3IH9A 1FCNA 3MFDA 3S22A 5I94A 4JBFA 4S2NA 2JC7A 1IKGA 1ALQA 1TEMA 3PBTA 4S2JA 3C7VA 3N4IA 1J9MA 1W5DA 2HPBA 3G35A 1OMEA 3AGEA 1BLHA 1FOFA 1SHVA 1H5XA 3D4FA 3HREA 4PM6A 4KZ8A 1FR6A 4GD8A 3VFFA 4CPKA 2HP5A 1NXYA 3BFFA 1GHIA 5HARA 5CRFA 5TGFA 1ONHA 2EXBA 5EOEA 3IWIA 2EX6A 3EQUA 2HP6A 4ZJ3A 3FV7A 4JF5A 5FAPA 4H8RA 3M2KA 5FQMA 1MXOA 1YMXA 1DJAA 1Z6FA 4NK3A 3TOIA 1RGYA 2Y2NA 5HL1A 4QY6A 1IELA 3B3XA 2WGWA 3LCEA 1L0DA 3G32A 2X71A 5EUAA 1YT4A 2P74A 3HUNA 4LCLA 5GHXA 3WS0A 3V39A 4OH0A 3UY6A 2EX9A 5L2FA 1RGZA 4KZ7A 5FASA 3M6HA 4DXBA 1N9BA 5EECA 4EWFA 4LV3A 4XXRA 3JYIA 1DY6A 4IBRA 1K4FA 4LCMA 5FQ9A 2ZC5B 4KZ6A 4BD0A 3NDEA 1Q2PA 4L0LA 2J9PA 5EVIA 3FZCA 1GCEA 1SCWA 3IXDA 2XLNA 5DF9A 3DWZA 5J8XA 1FSYA 5GLAA 1FSWA 1ES5A 2PBYA 1IEMA 1BT5A 3N7WA 1E3UD 3CJMA 1K56A 4WELA 3EQVA 3DWKA 1N4OA 4GN2A 2ZQDA 2C5WB 2WGIA 4OPZA 4Y0OA 4S2OA 3ZHHA 4Z9QA 3WS5A 4KG5A 4KZ4A 2HP9A 4JF6A 1ZG4A 3PAGA 4ZJ1A 1G68A 1K25A 4U3TA 4WYYA 5FQQA 4EBNA 1ERMA 5CECA 3VSKA 4OLDA 1GHMA 3WWXA 5E43A 4QJGA 2Y4AA 3OPLA 1BULA 1PI5A 5KSHA 4DXCA 2J8YA 5HX9A 3SH7A 5CEBA 3UE0A 5AQAA 4QD4A 1AXBA 4C3QA 1L0EA 2ZC4B 4N1HA 3FKVA 3GVBA 4BL2A 2ZJ9A 3ISGA 2Y2KA 5EVLA 2A3UA 2XGNA 1ONGA 4EV4A 3HBRA 4KZ9A 4GDNA 5FDHA 2XK1A 3PBNA 3V5MA 4YINA 4JXVA 1NRFA 4JLFA 1PW1A 1KE3A 3CMZA 5EE8A 1W79A 4HEFA 3C4PA 2ZC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLY A;  1PZP A;  2ZM0 A;  3M2J A;  2Y2O A;  5F1G A;  4MNR A;  5E2E A;  3ZG8 B;  2Y2H A;  3O86 A;  3ZG5 A;  1O7E A;  5CHU A;  3TSG A;  3RXX A;  3LY4 A;  4K0W A;  5HW3 A;  2UWX A;  2I72 A;  2JBF A;  3IWO A;  4RYE A;  5TR7 A;  3FWL A;  3VFH A;  2H10 A;  3P98 A;  3W4Q A;  2EXA A;  2WAE A;  3WS1 A;  3IT9 A;  3LO7 A;  3O3V A;  4LEN A;  1NYY A;  2XR0 A;  2G2W A;  2EX2 A;  2ZC6 B;  3NCK A;  4GZB A;  2ZQ7 A;  3HLE A;  3UDX A;  1L2S A;  2J7V A;  3BEB A;  2H5S A;  1PWC A;  3MZF A;  4E6X A;  1FQG A;  1I5Q A;  1QME A;  1LL5 A;  2DCF A;  3O87 A;  3IF6 B;  3Q7Z A;  4DE2 A;  2ZQ9 A;  1ESI A;  4GD6 A;  2Y59 A;  4KZ5 A;  4OLG A;  1BTL A;  4UA6 A;  3G30 A;  4D2O A;  3OCL A;  3A3I A;  4OON A;  4GKU A;  4GOG A;  1PWD A;  5E2F A;  1MKI A;  5FI6 A;  4OOL A;  5CGS A;  3IXH A;  1JWP A;  3SOI A;  3ITB A;  5JYO A;  1K55 A;  1LHY A;  1PI4 A;  1TVF A;  3MZE A;  1WYB A;  1HZO A;  5DTS A;  1BSG A;  3W4O A;  2A49 A;  1CI8 A;  2QZ6 A;  2HDS A;  3A3E A;  3PBO A;  1KDS A;  1LL9 A;  3CZD A;  4OOM A;  4OKP A;  5GLC A;  3WS4 A;  1YQS A;  4N9K A;  3PTE A;  5JYP A;  3BRM A;  1CEF A;  3ZNT A;  4ZAM A;  2RCX A;  1EI5 A;  3C4O A;  1NJ4 A;  4BD1 A;  4K91 A;  2P9V B;  4DDY A;  4E3O A;  2Z2M B;  5HFO A;  4Q8I A;  4KG6 A;  3MKF A;  4QY5 A;  5KZH A;  1SDE A;  1K55 C;  2Y2L A;  4S2N C;  4O7D A;  3VP0 A;  3ZGA B;  4PM9 A;  3OPP A;  3ITA A;  3NY4 A;  2XD1 A;  3Q7V A;  1CK3 A;  3OZH A;  1ERO A;  4X68 A;  3VP2 A;  4RVA A;  3OC2 A;  4MBH A;  1E25 A;  5CGW A;  4WM9 A;  1EWZ A;  1MWS A;  5A93 A;  2XFT A;  4B4X A;  3C5A A;  4QB8 A;  2IWC A;  1IKI A;  1XP4 A;  4LV0 A;  4DDS A;  2R9W A;  3ZG7 B;  3UPN A;  4ZBE A;  3HLF A;  5FQK A;  3HLC A;  3IXB A;  1MWR A;  5KMW A;  2WKH A;  2BG1 A;  5EVI D;  3SH8 A;  5M18 A;  3M6B A;  3HL9 A;  4E6W A;  3PAE A;  4FH2 A;  5IHV A;  1XXM A;  3V3R A;  2B5R A;  1K56 D;  4E3I A;  1KVL A;  3VP3 A;  2ZQ8 A;  4WZ5 A;  3ZVT A;  2WK0 A;  4B4Z A;  1K54 A;  3RJU A;  3E2K A;  3GRJ A;  3IHB A;  1VM1 A;  4HBT A;  3N6I A;  2WYX A;  1BLS A;  3VOZ A;  2XDM A;  3GR2 A;  5GLD A;  3G34 A;  3BM6 A;  2WKE A;  3Q81 A;  3V50 A;  3C7U A;  4JKT A;  3WRT A;  1FCO A;  3DTM A;  3N8R A;  1MPL A;  4GB7 A;  4X6T A;  4U0X A;  1C3B A;  5F82 A;  3SS4 A;  2OLV A;  5EVI C;  1K57 A;  4R0Q A;  1W8Y A;  2OLU A;  3GSG A;  3Q1F A;  5A91 A;  3S1Y A;  1KE0 A;  3ZCZ A;  4LV1 A;  5D3O A;  4WZ5 C;  2WGV A;  3SS3 A;  2WAF A;  1W8Q A;  1K54 C;  5FQI A;  4BL3 A;  4E3M A;  5HAQ A;  1ERQ A;  1U60 A;  2E8I A;  4S2I A;  4X56 A;  4R1G A;  3NIA A;  1YLW A;  4R4S A;  1LI0 A;  1WYC A;  2ZLY A;  4QHC A;  5DF8 A;  1L0F A;  1JWV A;  3AGD A;  1G6A A;  1HTZ A;  2FFF B;  4EUZ A;  4WEJ A;  5AQ9 A;  1MBL A;  3UN7 A;  2X02 A;  4R3J A;  2V2F F;  1NY0 A;  3MXR A;  1CI9 A;  5FSR A;  5M19 A;  4WMC A;  3A3J A;  4JF4 A;  1NZO A;  1XPB A;  3SS5 A;  2XD5 A;  4RX2 A;  5EOO A;  4Y0T A;  4N1X A;  4GNU A;  1JWZ A;  3ZFZ A;  4C6Y A;  2CC1 A;  1HVB A;  4A5R A;  5A92 A;  2V20 A;  1XGJ A;  3DW0 A;  5CGX A;  4PMA A;  4N92 A;  2X01 A;  3PBS A;  2ZM2 A;  5F83 A;  3ZVW A;  1M6K A;  3AGF A;  1BUE A;  4S2M A;  3HLG A;  3OCN A;  2Y91 A;  1RP5 A;  5GHY A;  3PBQ A;  1MWU A;  1PW8 A;  1Q2Q A;  2WGW B;  2XEP A;  3BFG A;  1FR1 A;  2QPN A;  3HLW A;  3ZG0 A;  2WUQ A;  4BEN A;  5DVA A;  2ZC7 A;  3NI9 A;  5FI7 A;  2FFY A;  2QMI A;  1I2S A;  5A90 A;  4PPR A;  1XA1 A;  2OSU A;  1I2W A;  2IWD A;  3ZG9 B;  4S2P A;  3GV9 A;  3ZNY A;  2JE5 A;  3HVF A;  3NDG A;  4KEN B;  2EFX A;  3GTC A;  1KE4 A;  3UO9 A;  5F1F A;  1K4E A;  4OQI A;  1RCJ A;  3UPP A;  3UNW A;  2Y55 A;  4P0M A;  4R23 A;  1LI9 A;  3OPR A;  2H0Y A;  4S2L A;  4QU3 A;  5FI2 A;  1TDG A;  1XGI A;  4HBU A;  3A3F A;  4X55 A;  2ZQA A;  5CTN A;  3VP1 A;  4HES A;  3BFE A;  3BFD A;  1ES2 A;  2Q9N A;  3UPO A;  1YMS A;  5AQB A;  5HAP A;  1IYP A;  4Y7P A;  1PZO A;  4RA7 A;  5CED A;  2ZMA A;  3VOY A;  2VGK A;  2HDR A;  4P6B A;  4U0T A;  5BOH A;  1MWT A;  4FSF A;  4MLL A;  5FA7 A;  2VGJ A;  4X53 A;  1ESU A;  4UHU A;  1IYO A;  3QNB A;  5TFQ A;  3GQZ A;  4M3K A;  1O07 A;  4R4R A;  4F94 A;  1K6S A;  5CHJ A;  1ZG6 A;  5DF7 A;  3MZD A;  1GA0 A;  1NZU A;  2EFU A;  3IHA A;  4EQI A;  3I7J A;  3HLB A;  5FQJ A;  3IQA A;  3FYZ A;  4OOY A;  2H0T A;  3HUO A;  5KSC A;  2DRW A;  5EPH A;  3ZDJ A;  3BEC A;  4KZA A;  1QMF A;  2Y2M A;  3VMA A;  3IF6 A;  1ES4 A;  1JTD A;  2Y2Q A;  2HDU A;  1ES3 A;  5HAI A;  1KGF A;  1KVM A;  1YLZ A;  4S2K A;  1BLC A;  3G4P A;  5CER A;  4MBF A;  1JTG A;  5G18 A;  4KG2 A;  2WKI A;  3Q07 A;  5DTT A;  4DF6 A;  2XH9 A;  2WZZ A;  4E3K A;  3MXS A;  4OVD A;  3RXW A;  4BLM A;  2JCH A;  1KGE A;  4GDB A;  1YM1 A;  4PM5 A;  1PIO A;  4JXS A;  1JVJ A;  3O88 A;  1SKF A;  3IF5 A;  3P09 A;  1Y54 A;  2Y2J A;  2GDN A;  2ZQC A;  4BQM A;  4KZB A;  4XUX A;  1S0W A;  4FH4 A;  4JPM A;  3N8L A;  4ZJ2 A;  1IYQ A;  3BLM A;  3WS2 A;  3G2Z A;  5M1A A;  3QNC A;  4N9L A;  1H8Y A;  1XX2 A;  3IF6 C;  1IYS A;  2Y2G A;  4IED A;  4KQQ A;  4KQR A;  5AQ7 A;  1DJB A;  1L0G A;  3UDF A;  1YLT A;  2Y2I A;  4PM8 A;  3OPH A;  4OQG A;  4XUZ A;  5E2H A;  2IWB A;  1E3U A;  4FCF A;  4ID4 A;  1GA9 A;  1XA7 A;  5GHZ A;  2P9V A;  5FAQ A;  3E2L A;  1BZA A;  4OPQ A;  4DKI A;  4IVI A;  3IH8 A;  4NET A;  4OQ0 A;  2WAD A;  3FKW A;  4BJP A;  4UAA A;  2V1Z A;  3G2Y A;  5GL9 A;  2C6W B;  1GHP A;  1WE4 A;  4P85 A;  4KQO A;  4Y0U A;  3N8S A;  4MBK A;  4DRT A;  1MY8 A;  5CHM A;  1FCM A;  1KDW A;  2PU4 A;  3Q82 A;  4ZDX A;  4WZ4 A;  4WMC D;  1K57 C;  4E3J A;  2Q9M A;  4JXW A;  2EX8 A;  3A3D A;  1K6R A;  1PYY A;  3SH9 A;  1H8Z A;  4B88 A;  5U47 A;  2HDQ A;  3TG9 A;  3IXG A;  2Y2P A;  5FAT A;  3UE3 A;  1K38 A;  2XF3 A;  1YLP A;  2J9O A;  1CEG A;  2RL3 A;  4PM7 A;  3HLD A;  3W8K A;  4DE3 A;  2G2U A;  1E4D A;  2BLS A;  1TDL A;  1HD8 A;  3W4P A;  4ZTK A;  4DE0 A;  3HUM A;  2DNS A;  3UDI A;  3BLS A;  1ZC2 A;  3NBL A;  5CXW A;  5CTM A;  4WEK A;  2ZM8 A;  4X69 A;  3Q7V B;  3MKE A;  4OQH A;  3LEZ A;  1KGG A;  5GLB A;  3G31 A;  1VQQ A;  4P87 A;  3PBR A;  4OP8 A;  3BYD A;  3UE1 A;  2XQZ A;  4MEZ A;  4DE1 A;  4EBL A;  5E2G A;  2ZD8 A;  3MBZ A;  1W7F A;  3NC8 A;  4KZ3 A;  4UA9 A;  1SDN A;  4IVK A;  4OPY A;  2OV5 A;  4E3L A;  4OPR A;  4CJN A;  2R9X A;  5DTK A;  3IWQ A;  2XFS A;  3LY3 A;  4FD8 A;  3WRZ A;  3S4X A;  4K0X A;  1DJC A;  3V3S A;  5EVI B;  1BLP A;  1ZKJ A;  4UA7 A;  4C75 A;  2PU2 A;  2Z2L B;  1PWG A;  3CG5 A;  4YFM A;  3QHY A;  4LV2 A;  3BFC A;  1XKZ A;  4E3N A;  1M40 A;  1LLB A;  4IBX A;  5FAO A;  4EBP A;  3VP4 A;  1NYM A;  2WZX A;  4OP5 A;  4RX3 A;  4WBG A;  3GMW A;  1S6R A;  1YLJ A;  4R3B A;  3VSL A;  4JXG A;  3IH9 A;  1FCN A;  3MFD A;  3S22 A;  5I94 A;  4JBF A;  4S2N A;  2JC7 A;  1IKG A;  1ALQ A;  1TEM A;  3PBT A;  4S2J A;  3C7V A;  3N4I A;  1J9M A;  1W5D A;  2HPB A;  3G35 A;  1OME A;  3AGE A;  1BLH A;  1FOF A;  1SHV A;  1H5X A;  3D4F A;  3HRE A;  4PM6 A;  4KZ8 A;  1FR6 A;  4GD8 A;  3VFF A;  4CPK A;  2HP5 A;  1NXY A;  3BFF A;  1GHI A;  5HAR A;  5CRF A;  5TGF A;  1ONH A;  2EXB A;  5EOE A;  3IWI A;  2EX6 A;  3EQU A;  2HP6 A;  4ZJ3 A;  3FV7 A;  4JF5 A;  5FAP A;  4H8R A;  3M2K A;  5FQM A;  1MXO A;  1YMX A;  1DJA A;  1Z6F A;  4NK3 A;  3TOI A;  1RGY A;  2Y2N A;  5HL1 A;  4QY6 A;  1IEL A;  3B3X A;  2WGW A;  3LCE A;  1L0D A;  3G32 A;  2X71 A;  5EUA A;  1YT4 A;  2P74 A;  3HUN A;  4LCL A;  5GHX A;  3WS0 A;  3V39 A;  4OH0 A;  3UY6 A;  2EX9 A;  5L2F A;  1RGZ A;  4KZ7 A;  5FAS A;  3M6H A;  4DXB A;  1N9B A;  5EEC A;  4EWF A;  4LV3 A;  4XXR A;  3JYI A;  1DY6 A;  4IBR A;  1K4F A;  4LCM A;  5FQ9 A;  2ZC5 B;  4KZ6 A;  4BD0 A;  3NDE A;  1Q2P A;  4L0L A;  2J9P A;  5EVI A;  3FZC A;  1GCE A;  1SCW A;  3IXD A;  2XLN A;  5DF9 A;  3DWZ A;  5J8X A;  1FSY A;  5GLA A;  1FSW A;  1ES5 A;  2PBY A;  1IEM A;  1BT5 A;  3N7W A;  1E3U D;  3CJM A;  1K56 A;  4WEL A;  3EQV A;  3DWK A;  1N4O A;  4GN2 A;  2ZQD A;  2C5W B;  2WGI A;  4OPZ A;  4Y0O A;  4S2O A;  3ZHH A;  4Z9Q A;  3WS5 A;  4KG5 A;  4KZ4 A;  2HP9 A;  4JF6 A;  1ZG4 A;  3PAG A;  4ZJ1 A;  1G68 A;  1K25 A;  4U3T A;  4WYY A;  5FQQ A;  4EBN A;  1ERM A;  5CEC A;  3VSK A;  4OLD A;  1GHM A;  3WWX A;  5E43 A;  4QJG A;  2Y4A A;  3OPL A;  1BUL A;  1PI5 A;  5KSH A;  4DXC A;  2J8Y A;  5HX9 A;  3SH7 A;  5CEB A;  3UE0 A;  5AQA A;  4QD4 A;  1AXB A;  4C3Q A;  1L0E A;  2ZC4 B;  4N1H A;  3FKV A;  3GVB A;  4BL2 A;  2ZJ9 A;  3ISG A;  2Y2K A;  5EVL A;  2A3U A;  2XGN A;  1ONG A;  4EV4 A;  3HBR A;  4KZ9 A;  4GDN A;  5FDH A;  2XK1 A;  3PBN A;  3V5M A;  4YIN A;  4JXV A;  1NRF A;  4JLF A;  1PW1 A;  1KE3 A;  3CMZ A;  5EE8 A;  1W79 A;  4HEF A;  3C4P A;  2ZC3 B; 
#chains in the Genus database with same CATH topology
 4CLC B;  1YLY A;  2Y2H A;  3ZG5 A;  3O5Y A;  1O7E A;  5CHU A;  3LY4 A;  4K0W A;  4L9G A;  5HW3 A;  2JBF A;  3IWO A;  5TR7 A;  1VET B;  2WAE A;  3WS1 A;  3IT9 A;  1NYY A;  2XR0 A;  2ZQ7 A;  4Q0J A;  3MZF A;  1FQG A;  2W0N A;  3D9Y A;  5FL3 A;  3CWF A;  5DFX A;  2VV6 A;  4GD6 A;  4KZ5 A;  4UA6 A;  3G30 A;  1H0M A;  2VK3 A;  5E2F A;  2O9A A;  3ITB A;  3CPT A;  1UWP X;  3C2W A;  1T1A A;  1BSG A;  2W1T B;  3W4O A;  2A49 A;  1KDS A;  3CZD A;  4N9K A;  3QP2 A;  3VE4 A;  3BRM A;  3ZNT A;  4ARZ A;  4BD1 A;  3PXP A;  2Z2M B;  3MKF A;  4QY5 A;  1K55 C;  1GSV A;  2JN7 A;  2Y2L A;  4PM9 A;  2XD1 A;  3Q7V A;  5HPF A;  1T18 A;  1L3L A;  3VP2 A;  3OC2 A;  4WM9 A;  1EWZ A;  2XFT A;  4B4X A;  3C5A A;  4QB8 A;  4Q0I A;  4DDS A;  3UPN A;  4ZBE A;  3HLF A;  5KMW A;  4BBV A;  2L0W A;  2VA0 A;  3HL9 A;  4E6W A;  1XXM A;  2W3F A;  3NOU C;  4X25 A;  1K56 D;  3CUE C;  4E3I A;  1KVL A;  1S67 L;  5HDS A;  3KYQ A;  4R38 A;  4B4Z A;  2PBD P;  3RJU A;  2OWH A;  2PT7 A;  1D06 A;  5HDC A;  3VOZ A;  3G34 A;  2WKE A;  3Q81 A;  3WRT A;  4X6T A;  1MPL A;  4GB7 A;  5F82 A;  4MCW A;  1FIK A;  3S7O A;  4R0Q A;  1W8Y A;  3GSG A;  3Q1F A;  5A91 A;  3S1Y A;  3LIC A;  4O0P A;  4LV1 A;  4WZ5 C;  2WGV A;  3F1O B;  4QWO A;  4BL3 A;  5HAQ A;  1U60 A;  4X56 A;  4R4S A;  2ZLY A;  2ZMV A;  1JWV A;  1G6A A;  4EUV A;  2XRO A;  2K31 A;  1MBL A;  3UN7 A;  2V2F F;  4HOI A;  1CI9 A;  5HPI A;  2PD8 A;  4WMC A;  4Q0H A;  4RX2 A;  4Y0T A;  4Y17 A;  4UQI S;  3L9K A;  4GNU A;  3E0Y A;  4C6Y A;  2CC1 A;  3QP8 A;  1VEU A;  5CGX A;  2X01 A;  5J7E A;  5AVF A;  2ZM2 A;  3CLO A;  1BUE A;  4MMN A;  5K5B A;  2Y91 A;  1MWU A;  2Q0O A;  3BFG A;  2VJW A;  5DVA A;  2ZC7 A;  2M1C A;  5FI7 A;  1HLU P;  3QP6 A;  3T4Q A;  1I2W A;  3ZG9 B;  3GV9 A;  4KEN B;  1T1B A;  1RCJ A;  4GW9 A;  3UNW A;  5G4Z A;  1AWI A;  4R23 A;  5HD3 A;  4QU3 A;  4GHI B;  2UV0 E;  4HBU A;  3A3F A;  3FPW A;  2Q9N A;  3T4L A;  4Y7P A;  1PZO A;  4WF0 A;  3TJZ C;  3BY9 A;  3T1S A;  3VOY A;  2O0Y A;  1MWT A;  4FSF A;  3KSG A;  5TFQ A;  3GQZ A;  4Y3I A;  4F94 A;  1K6S A;  2ZL1 B;  5CX7 A;  3HLB A;  4GJ4 A;  2H0T A;  5EPH A;  3MMH A;  4EU0 A;  3NJA A;  1BLC A;  5G18 A;  2WZZ A;  2V0U A;  4E3K A;  5L10 A;  1DP8 A;  1YM1 A;  1XJ2 A;  3P09 A;  1Y54 A;  2ZQC A;  2V0W A;  3C30 A;  1S0W A;  4JPM A;  1H8Y A;  1XX2 A;  1DJB A;  3PHY A;  3OPH A;  4KUK A;  4FCF A;  4ID4 A;  1BZA A;  4HQA A;  1G6O A;  1UWN X;  4BJP A;  4UAA A;  4AFI A;  4KQO A;  2V9A A;  1MY8 A;  2V8F A;  1KDW A;  3Q82 A;  1S4S A;  4E3J A;  2EX8 A;  3IXG A;  1IFQ A;  2Y2P A;  1K38 A;  3W8K A;  4ARZ B;  1E4D A;  1TS8 A;  3EEA A;  3W4P A;  3KO6 A;  4HJ3 A;  3T1X A;  4KQD A;  4WEK A;  2ZM8 A;  3Q7V B;  3LEZ A;  1DP6 A;  4P87 A;  3BYD A;  4IUK A;  5E2G A;  4B9O A;  3MXQ A;  4KZ3 A;  3MS6 A;  4UA9 A;  4IVK A;  4OPY A;  4E3L A;  3LGO A;  4CJN A;  2R9X A;  2XFS A;  3LY3 A;  3G6O A;  3WRZ A;  3S4X A;  3QP5 A;  4HJ6 A;  2P08 A;  1LSV A;  3BFC A;  4ETZ A;  4EBP A;  5TBM A;  3VP4 A;  1NYM A;  4RX3 A;  3VSL A;  1YLJ A;  4R3B A;  5I94 A;  4JBF A;  1IKG A;  3T1R A;  2HPB A;  4I3I A;  3EGD C;  1BLH A;  1FOF A;  4PM6 A;  4KZ8 A;  2EXB A;  5EOE A;  1PNE A;  2HP6 A;  3FV7 A;  1MKM A;  5FQM A;  3HCY A;  5HL1 A;  4LPZ A;  5DJT A;  1IEL A;  1CJF A;  3B3X A;  3NOP C;  4FTX A;  3LCE A;  3G32 A;  3WS0 A;  2X71 A;  4LCL A;  1P9W A;  4LV3 A;  1F5M A;  5FQ9 A;  1S1Z A;  1VEU B;  4EQ1 A;  3T1Q B;  1F9I A;  1FSY A;  3N7W A;  1E3U D;  1K56 A;  4WEL A;  3EQV A;  5HDD A;  3LIB A;  4GN2 A;  2ZQD A;  2C5W B;  5HL6 A;  2OOL A;  4Y0O A;  4S2O A;  3WS5 A;  1G68 A;  1XJ6 A;  4G3W A;  4OLD A;  2A24 A;  2Y4A A;  1G28 A;  1PI5 A;  2J3W A;  2J8Y A;  5EM0 A;  4GS9 B;  3JPU A;  2FH5 A;  4QD4 A;  3QP1 A;  4C3Q A;  3ISG A;  2XGN A;  4EV4 A;  3HBR A;  3NUL A;  3T4J A;  4GDN A;  3K2N A;  2XK1 A;  3DBA A;  2K7S A;  4JLF A;  3CMZ A;  4HEF A;  2ZC3 B;  2Y2O A;  1YAX A;  3ZG8 B;  5FEF A;  4BBT A;  4RYE A;  1ZHH B;  2JKG A;  1OJG A;  1H8M A;  3UDX A;  2J7V A;  3OLO A;  1I5Q A;  2VGL S;  3T50 A;  2Y59 A;  1BTL A;  2QHK A;  3OOV A;  4LLO B;  3OCL A;  2XA7 S;  4OON A;  5FI6 A;  4ZRR A;  1STZ A;  5CGS A;  2GNX A;  4HP4 A;  4F3L B;  2HJE A;  2XSS A;  3MR0 A;  3BQ8 A;  3JVU A;  1F98 A;  3PBO A;  1LL9 A;  1T1C A;  3H82 B;  3C38 A;  1YQS A;  2FZ0 A;  3IS2 A;  3B47 A;  2QJ7 A;  2RCX A;  3ZYT A;  3R4K A;  3C4O A;  1NJ4 A;  5MC7 A;  4DDY A;  4E3O A;  4Q8I A;  3MJQ A;  4S2N C;  3OPP A;  5DKL A;  3NY4 A;  1ERO A;  1P97 A;  4MBH A;  4PKY A;  5F5Y A;  2IWC A;  1IKI A;  3VV4 A;  2R9W A;  1P9R A;  4Y13 A;  3SH8 A;  1XJ3 A;  1OPX A;  3PAE A;  4EET B;  3LUQ A;  4JGO A;  3VP3 A;  3ZQ5 A;  2JKF A;  1K54 A;  2WYX A;  1BLS A;  3CIT A;  3GR2 A;  2NUT C;  3BM6 A;  1WA9 A;  3V50 A;  3N8R A;  3SS4 A;  3TW8 A;  1KE0 A;  3TRC A;  3A0R A;  5D3O A;  2WAF A;  5FQI A;  1ERQ A;  2E8I A;  4S2I A;  1XJ4 A;  3NIA A;  1YLW A;  4UEY A;  4QHC A;  4MN6 A;  4WEJ A;  1YKD A;  3NOT C;  1NY0 A;  1LSX A;  4WUJ A;  2O99 A;  4HJ4 A;  3A3J A;  2Z6C A;  4O01 A;  1XPB A;  3SS5 A;  4IUH A;  1TS7 A;  3ZFZ A;  3IBJ A;  3U4L P;  4RQ9 A;  3DW0 A;  1W63 M;  4PMA A;  2ZBB A;  5F83 A;  1M6K A;  3OCN A;  1RP5 A;  1XFN A;  3KSH A;  1FR1 A;  4BEN A;  4ME4 A;  2FFY A;  5A90 A;  4PPR A;  4S2P A;  3ZNY A;  1DRM A;  3F1P A;  2YKH A;  5F1F A;  4OQI A;  3UPP A;  4PAU A;  1NWZ A;  2Y55 A;  1LI9 A;  1XGI A;  3K3C A;  4X55 A;  4G3K A;  3BFD A;  1T19 A;  4CLC D;  4RA7 A;  3F1N A;  4U0T A;  5BOH A;  1LT0 A;  4M4X A;  1ODV A;  2VGJ A;  2A24 B;  4Y2F A;  1IYO A;  2PR6 A;  1OTD A;  4M3K A;  1J3W A;  4HHD A;  1GA0 A;  1NZU A;  3IHA A;  5EV0 A;  5FQJ A;  1A0K A;  4OOY A;  3HUO A;  4CLC C;  5KSC A;  4KZA A;  2XRN A;  3VMA A;  3IF6 A;  2HDU A;  3LR5 A;  1KVM A;  3LIE A;  4DF6 A;  4MBF A;  3MXS A;  1KGE A;  1Y4O A;  4JXS A;  4PM5 A;  3O88 A;  3IF5 A;  2Y2J A;  4QPR A;  4X1L A;  4KZB A;  3BLM A;  4WLA A;  3WS2 A;  3UDF A;  3MQO A;  1VHM A;  4PM8 A;  5E2H A;  1E3U A;  5GHZ A;  2P9V A;  2VLG A;  5FAQ A;  1SKO B;  4OQ0 A;  2WAD A;  2V1Z A;  3G2Y A;  5GL9 A;  2C6W B;  2VX8 A;  3N8S A;  1K57 C;  2O9C A;  2Q9M A;  3SH9 A;  4B88 A;  3A0V A;  2HDQ A;  3UB9 A;  1YLP A;  2J9O A;  2RL3 A;  4PM7 A;  3MF0 A;  4DE3 A;  3KSI A;  1N9O A;  4ZTK A;  4DE0 A;  2B95 A;  3HUM A;  3UE6 A;  1ZC2 A;  3D3O A;  1D1J A;  4X69 A;  3SW1 A;  1GSW A;  3MKE A;  3LEQ A;  2E8J A;  4EXO A;  1KGG A;  2VEA A;  3BY8 A;  4OP8 A;  3T4O A;  4MEZ A;  1W7F A;  4BMW A;  3OBF A;  2Z6D A;  3UB6 A;  4OPR A;  4I5S A;  2WKQ A;  4NXF A;  3IWQ A;  2NUP C;  3LR3 A;  4Z1W A;  5EVI B;  2WKP A;  4C75 A;  3T12 B;  1V9Z A;  3CG5 A;  4NEE D;  4E3N A;  1M40 A;  1LLB A;  2P7J A;  2WZX A;  4OP5 A;  4WBG A;  2H28 A;  2JKR I;  1OT6 A;  4JXG A;  3S22 A;  4S2N A;  2JC7 A;  2M7V A;  3N4I A;  1J9M A;  2PHY A;  4XT2 A;  1SHV A;  3HRE A;  4CPK A;  3BFF A;  5HAR A;  1GHI A;  2PDR A;  4HH3 A;  3KX0 X;  2QWS A;  3KSF A;  3IWI A;  4ESP A;  4BBU A;  4IHQ A;  5FAP A;  3H9W A;  1MXO A;  1YMX A;  3C8C A;  3ULF A;  1DJA A;  3QP4 A;  1NLZ A;  4QY6 A;  2WGW A;  5FDS A;  3T4S A;  4EES A;  5L8M A;  3HUN A;  3EWK A;  2B18 A;  4KZ7 A;  4EW7 A;  1N9B A;  5EEC A;  1K0K A;  1V9Y A;  2W3E A;  1DY6 A;  4IBR A;  1K4F A;  4LCM A;  4KZ6 A;  3JVV A;  4L0L A;  4WL9 A;  1GCE A;  1SCW A;  2XLN A;  5GLA A;  3MQQ A;  1ES5 A;  1BT5 A;  3DWK A;  2KDK A;  2WGI A;  3VE3 A;  2HP9 A;  1ZG4 A;  4JGR A;  3LIA A;  5LBR A;  4U3T A;  4WYY A;  4EBN A;  5A8B A;  4QJG A;  2VZW A;  3F1P B;  4B93 A;  3OPL A;  1BUL A;  3CPT B;  5KSH A;  3LYX A;  5CEB A;  3UE0 A;  5AQA A;  2OAQ 1;  1L0E A;  2ZC4 B;  3DAV A;  2QYB A;  2Y2K A;  5EVL A;  4BWI A;  5FDH A;  2L4R A;  3PBN A;  3V5M A;  3W2Z A;  1KE3 A;  2INW A;  3C4P A;  4FUW A;  1TD5 A;  4LFU A;  1PZP A;  1Z09 A;  2ZM0 A;  3F1N B;  3M2J A;  5F1G A;  4MNR A;  3B42 A;  3H7W A;  3TSG A;  4X1M A;  2I72 A;  3DTE A;  3FWL A;  3VFH A;  3W4Q A;  2EXA A;  3UB8 A;  3O3V A;  4FOF A;  1TF1 A;  1FIL A;  1L2S A;  3BEB A;  2H5S A;  1TS6 A;  1QME A;  2DCF A;  3IF6 B;  3Q7Z A;  2ZQ9 A;  4OLG A;  1NLY A;  2LB5 A;  3A3I A;  4G3V A;  1PWD A;  1MKI A;  3E4Q A;  1JWP A;  1K55 A;  1PI4 A;  1TVF A;  3MZE A;  2VV8 A;  5DTS A;  5DKK A;  1LL8 A;  2QZ6 A;  4OOM A;  3WS4 A;  4H6J A;  3LIF A;  3NEC A;  4DJ3 A;  1TS0 A;  1EI5 A;  2P9V B;  4CLC A;  5KZH A;  5TJJ A;  4O7D A;  1KOU A;  3ITA A;  2D01 A;  3CUE A;  2EWV A;  5CGW A;  1VET A;  5A93 A;  1XP4 A;  2MJ6 A;  3B33 A;  3HLC A;  3IXB A;  2BG1 A;  5M18 A;  3M6B A;  4FH2 A;  2W3H A;  3V3R A;  4MN7 A;  4WZ5 A;  2W3G A;  3GRJ A;  3IHB A;  1BYW A;  4I39 A;  4HBT A;  5GLD A;  2BTF P;  2A2L A;  3CI6 A;  3FG8 A;  2W1T A;  3C7U A;  1FCO A;  2W1R A;  3DTM A;  3U2A A;  1C3B A;  3EOI A;  1K57 A;  3R7W A;  2QKP A;  4CQH A;  1ACF A;  2J80 A;  4HH2 A;  3MFX A;  4R1G A;  5DF8 A;  5AVE A;  3AGD A;  2FFF B;  4EUZ A;  1JNU A;  5AQ9 A;  3TE8 A;  4R3J A;  4KUO A;  3MXR A;  5FSR A;  4XT2 B;  4L9F A;  4I3A A;  4LRZ E;  5IT5 A;  4JF4 A;  5EOO A;  4N1X A;  1JWZ A;  4A5R A;  5A92 A;  2V20 A;  3DTK A;  4N92 A;  3PBS A;  3ZVW A;  1N9L A;  4S2M A;  3RH8 B;  5GHY A;  1PW8 A;  2WGW B;  2XEP A;  5F68 A;  2QPN A;  3HLW A;  3NI9 A;  3IBR A;  2IWD A;  2JE5 A;  3HVF A;  4PKY G;  4I3J A;  3UO9 A;  1KE4 A;  4O8G A;  4LRY C;  4P0M A;  3OPR A;  4S2L A;  1TDG A;  3F1O A;  3KYZ A;  3VP1 A;  4HES A;  3BFE A;  3DTI A;  3UPO A;  1IYP A;  5CED A;  2ZMA A;  4P6B A;  4MLL A;  5FA7 A;  3T4T A;  1OT9 A;  4HI4 A;  1O07 A;  4R4R A;  1S4R A;  4WN5 A;  1ZG6 A;  4II7 A;  5DF7 A;  3MZD A;  5KIZ A;  2EFU A;  1H3Q A;  4EQI A;  3IQA A;  3FYZ A;  3D72 A;  3RTY A;  3BEC A;  2Y2M A;  3ICY A;  2KLI A;  1ES4 A;  1X0O A;  5CER A;  2IA2 A;  3H7W B;  3Q07 A;  2XH9 A;  1OTB A;  4OVD A;  1PIO A;  4R6L A;  1SKF A;  4EEU A;  2GDN A;  4BQM A;  4FH4 A;  5J3W A;  2J3T C;  3N8L A;  5I5L A;  4DMZ A;  2V8C A;  3QNC A;  4UQI M;  3P7N A;  1IYS A;  4KQQ A;  5AQ7 A;  1L0G A;  4GHI A;  1YLT A;  2Y2I A;  2IWB A;  3V67 A;  1GA9 A;  3E2L A;  3LID A;  1YPR A;  5TBM B;  1IOU A;  4Y0U A;  4GLQ A;  1FCM A;  2PU4 A;  2ZL1 A;  5U47 A;  3TG9 A;  5FAT A;  4R70 A;  3UE3 A;  2XF3 A;  1CEG A;  1CQA A;  3P01 A;  2B02 A;  2OWJ A;  2D02 A;  4EEP A;  2DNS A;  2HF6 A;  3BLS A;  3NBL A;  5C5K A;  5CXW A;  5GLB A;  3G31 A;  3UE1 A;  3PYP A;  3PBR A;  2PRF A;  2XQZ A;  2ZD8 A;  3MBZ A;  3NC8 A;  1G5U A;  2EA9 A;  1P0Z A;  2VV7 A;  1SDN A;  2OV5 A;  2GX5 A;  5DTK A;  2WKR A;  4FD8 A;  4IJG A;  4K0X A;  1DJC A;  1ZKJ A;  4UA7 A;  1DP9 A;  1PWG A;  3QHY A;  5FAO A;  3GMW A;  3RFB A;  3BWL A;  1TEM A;  1YSP A;  1ALQ A;  3PBT A;  3LR4 A;  3C7V A;  3G35 A;  3AGE A;  3D4F A;  1H5X A;  4HIA A;  4P6Z S;  2HP5 A;  5CRF A;  3R7W B;  2EX6 A;  3EQU A;  4ZJ3 A;  2BAS A;  3M2K A;  1Z6F A;  4NK3 A;  1RGY A;  4HY8 A;  3BW6 A;  1L0D A;  2P74 A;  3UY6 A;  2EX9 A;  1RGZ A;  1MZU A;  4DXB A;  4JGQ A;  3T4K A;  1VB6 A;  3E4P A;  3UMD A;  3NDE A;  1Q2P A;  1NRJ A;  3IXD A;  1FSW A;  2PBY A;  1N4O A;  1S1Y A;  4OPZ A;  2CMN A;  3ZHH A;  4KZ4 A;  4JF6 A;  4ZJ1 A;  1K25 A;  3UME A;  5HX9 A;  3SH7 A;  4I38 A;  5J4E A;  4N1H A;  3GVB A;  2ZJ9 A;  3VOL A;  3IS2 B;  4YIN A;  1NRF A;  1PW1 A;  5EE8 A;  1GHM A;  1W79 A;  2W27 A;  3FC7 A;  2PD7 A;  5E2E A;  3O86 A;  2HJ9 C;  3RXX A;  2UWX A;  2H10 A;  3P98 A;  3LI8 A;  3LO7 A;  4LEN A;  1PRQ A;  4LRX C;  2G2W A;  2EX2 A;  2ZC6 B;  3NCK A;  4GZB A;  3HLE A;  3NHQ A;  1PWC A;  4E6X A;  4GCZ A;  1LL5 A;  1XFQ A;  3O87 A;  4DE2 A;  2PR5 A;  1ESI A;  4NKP A;  4D2O A;  5L07 A;  4NXB A;  1N9N A;  2I9V A;  4GKU A;  4GOG A;  4YOF A;  4OOL A;  3IXH A;  3SOI A;  5JYO A;  1LHY A;  1WYB A;  2ZOH A;  1HZO A;  3LR0 A;  4GS9 A;  1CI8 A;  2HDS A;  3A3E A;  2GJ3 A;  2JKT M;  4OKP A;  5GLC A;  3PTE A;  5JYP A;  1CEF A;  4ZAM A;  4K91 A;  2YKF A;  4K08 A;  5HFO A;  3S7N A;  3IX8 A;  4KG6 A;  1SDE A;  3ZGA B;  3HJI A;  3VP0 A;  1CK3 A;  3IX3 A;  3OZH A;  4X68 A;  2HV1 A;  3IX4 A;  4RVA A;  1E25 A;  1YSQ A;  3LFV A;  1MWS A;  2JHE A;  2G7U A;  4DN0 A;  4LV0 A;  3ZG7 B;  5FQK A;  1MWR A;  2WKH A;  5EVI D;  5IHV A;  2B5R A;  2VKS A;  2ZQ8 A;  2PYR A;  2WK0 A;  3E2K A;  1VM1 A;  3E4O A;  3EGX C;  4F3L A;  3N6I A;  2XDM A;  5HWW A;  3BJN A;  4JKT A;  4U0X A;  2OLV A;  5EVI C;  3H82 A;  2OLU A;  1OTI A;  3ZCZ A;  3SS3 A;  1W8Q A;  1K54 C;  2VGL M;  4E3M A;  1LI0 A;  1WYC A;  2LB9 A;  2OAP 1;  1L0F A;  1HTZ A;  2XA7 M;  2K2N A;  2X02 A;  1OJ5 A;  5L09 A;  5M19 A;  5HWT A;  2ACG A;  1NZO A;  1CF0 A;  2KOI A;  2XD5 A;  3KYE A;  5F6A A;  1HVB A;  1XGJ A;  2M7U A;  3AGF A;  3HLG A;  2PYP A;  3PBQ A;  1Q2Q A;  2R78 A;  2V1B A;  4MDZ A;  1UGU A;  5HWV A;  2PAV P;  3ZG0 A;  2WUQ A;  2QMI A;  1I2S A;  1XA1 A;  2OSU A;  3NDG A;  2EFX A;  3GTC A;  1K4E A;  2Y8H A;  3L7H A;  2H0Y A;  5FI2 A;  3BQA A;  3MQ0 A;  2ZQA A;  5CTN A;  1ES2 A;  1YMS A;  5AQB A;  5HAP A;  3PR6 A;  1SZV A;  3EEH A;  2VGK A;  2HDR A;  4D60 A;  4LGW A;  4X53 A;  1ESU A;  5F69 A;  4UHU A;  3QNB A;  5IU1 A;  5CHJ A;  2DMW A;  3I7J A;  2DRW A;  3ZDJ A;  1QMF A;  4JGP A;  2Y2Q A;  1JTD A;  4YWZ A;  1ES3 A;  5HAI A;  2Y79 A;  1KGF A;  1YLZ A;  4S2K A;  4EER A;  3G4P A;  1JTG A;  4KG2 A;  2WKI A;  5DTT A;  5HD5 A;  1PFL A;  3RXW A;  4BLM A;  2JCH A;  4GDB A;  1JVJ A;  4HNB A;  4XUX A;  4ZJ2 A;  1IYQ A;  1S66 L;  3G2Z A;  5M1A A;  2AVX A;  4N9L A;  3E98 A;  3IF6 C;  4IED A;  2Y2G A;  4KQR A;  1GSX A;  4OQG A;  4XUZ A;  5FEG A;  1XA7 A;  4OPQ A;  4R3A A;  3FPV A;  5DJU A;  4DKI A;  4IVI A;  3IH8 A;  4NET A;  3FKW A;  3A0S A;  1D7E A;  1GHP A;  1WE4 A;  3K3D A;  4P85 A;  4MBK A;  4DRT A;  5CHM A;  4ZDX A;  4WZ4 A;  4WMC D;  1Y28 A;  4NXG A;  4JXW A;  3A3D A;  5AJG A;  1K6R A;  1PYY A;  1H8Z A;  3HLD A;  3MSH A;  2G2U A;  2BLS A;  4Y15 A;  1TDL A;  1HD8 A;  2W3D A;  3UDI A;  5EFW A;  5CTM A;  1OTA A;  2HGV A;  2ZOI A;  4OQH A;  4DE1 A;  1VQQ A;  4EBL A;  3S7P A;  1W63 Q;  2L1M A;  4P6Z M;  2JKT I;  3CHW P;  3V3S A;  1BLP A;  2PU2 A;  2Z2L B;  4YFM A;  5IS1 A;  4LV2 A;  1SKO A;  1XKZ A;  5DFY A;  4IBX A;  3GDI A;  1S6R A;  3IH9 A;  1FCN A;  3MFD A;  4YNR A;  4S2J A;  1W5D A;  1OME A;  1LSW A;  4MN5 A;  4PHT A;  1FR6 A;  4GD8 A;  5EVE A;  1MC0 A;  1EW0 A;  3CAX A;  3VFF A;  5HSQ A;  1NXY A;  5TGF A;  1ONH A;  1OTE A;  2V1A A;  1F2K A;  4NXE A;  4CLC E;  4JF5 A;  4H8R A;  2J3T D;  3UB7 A;  2GZA A;  3TOI A;  2Y2N A;  3LI9 A;  3HJK A;  2JKR M;  5EUA A;  1YT4 A;  5GHX A;  3V39 A;  4DJ2 A;  3UB5 P;  4OH0 A;  5HZH A;  5L2F A;  5FAS A;  2QJ5 A;  3M6H A;  4EWF A;  4XXR A;  3JYI A;  4E04 A;  4Y5F A;  4BD0 A;  2ZC5 B;  2J9P A;  5EVI A;  3FZC A;  5DF9 A;  3DWZ A;  5J8X A;  5EM1 A;  2P04 A;  4HP9 A;  1IEM A;  3CJM A;  1ZTU A;  3S7Q A;  4Z9Q A;  4KG5 A;  4L9E A;  3PAG A;  4ETX A;  4NG2 A;  5FQQ A;  2KX6 A;  1ERM A;  5G4Y A;  3SZT A;  3VSK A;  3WWX A;  5CEC A;  5E43 A;  3GEC A;  4DXC A;  1AXB A;  2EWW A;  3FKV A;  4BL2 A;  2ZMF A;  2A3U A;  2O9B A;  1ONG A;  4H6J B;  4KZ9 A;  4JXV A;  3ZVT A;  2HZ5 A; 
#chains in the Genus database with same CATH homology
 1YLY A;  1PZP A;  2ZM0 A;  3M2J A;  2Y2O A;  5F1G A;  4MNR A;  5E2E A;  3ZG8 B;  2Y2H A;  3O86 A;  3ZG5 A;  1O7E A;  5CHU A;  3TSG A;  3RXX A;  3LY4 A;  4K0W A;  5HW3 A;  2UWX A;  2I72 A;  2JBF A;  3IWO A;  4RYE A;  5TR7 A;  3FWL A;  3VFH A;  2H10 A;  3P98 A;  3W4Q A;  2EXA A;  2WAE A;  3WS1 A;  3IT9 A;  3LO7 A;  3O3V A;  4LEN A;  1NYY A;  2XR0 A;  2G2W A;  2EX2 A;  2ZC6 B;  3NCK A;  4GZB A;  2ZQ7 A;  3HLE A;  3UDX A;  1L2S A;  2J7V A;  3BEB A;  2H5S A;  1PWC A;  3MZF A;  4E6X A;  1FQG A;  1I5Q A;  1QME A;  1LL5 A;  2DCF A;  3O87 A;  3IF6 B;  3Q7Z A;  4DE2 A;  2ZQ9 A;  1ESI A;  4GD6 A;  2Y59 A;  4KZ5 A;  4OLG A;  1BTL A;  4UA6 A;  3G30 A;  4D2O A;  3OCL A;  3A3I A;  4OON A;  4GKU A;  4GOG A;  1PWD A;  5E2F A;  1MKI A;  5FI6 A;  4OOL A;  5CGS A;  3IXH A;  1JWP A;  3SOI A;  3ITB A;  5JYO A;  1K55 A;  1LHY A;  1PI4 A;  1TVF A;  3MZE A;  1WYB A;  1HZO A;  5DTS A;  1BSG A;  3W4O A;  2A49 A;  1CI8 A;  2QZ6 A;  2HDS A;  3A3E A;  3PBO A;  1KDS A;  1LL9 A;  3CZD A;  4OOM A;  4OKP A;  5GLC A;  3WS4 A;  1YQS A;  4N9K A;  3PTE A;  5JYP A;  3BRM A;  1CEF A;  3ZNT A;  4ZAM A;  2RCX A;  1EI5 A;  3C4O A;  1NJ4 A;  4BD1 A;  4K91 A;  2P9V B;  4DDY A;  4E3O A;  2Z2M B;  5HFO A;  4Q8I A;  4KG6 A;  3MKF A;  4QY5 A;  5KZH A;  1SDE A;  1K55 C;  2Y2L A;  4S2N C;  4O7D A;  3VP0 A;  3ZGA B;  4PM9 A;  3OPP A;  3ITA A;  3NY4 A;  2XD1 A;  3Q7V A;  1CK3 A;  3OZH A;  1ERO A;  4X68 A;  3VP2 A;  4RVA A;  3OC2 A;  4MBH A;  1E25 A;  5CGW A;  4WM9 A;  1EWZ A;  1MWS A;  5A93 A;  2XFT A;  4B4X A;  3C5A A;  4QB8 A;  2IWC A;  1IKI A;  1XP4 A;  4LV0 A;  4DDS A;  2R9W A;  3ZG7 B;  3UPN A;  4ZBE A;  3HLF A;  5FQK A;  3HLC A;  3IXB A;  1MWR A;  5KMW A;  2WKH A;  2BG1 A;  5EVI D;  3SH8 A;  5M18 A;  3M6B A;  3HL9 A;  4E6W A;  3PAE A;  4FH2 A;  5IHV A;  1XXM A;  3V3R A;  2B5R A;  1K56 D;  4E3I A;  1KVL A;  3VP3 A;  2ZQ8 A;  4WZ5 A;  3ZVT A;  2WK0 A;  4B4Z A;  1K54 A;  3RJU A;  3E2K A;  3GRJ A;  3IHB A;  1VM1 A;  4HBT A;  3N6I A;  2WYX A;  1BLS A;  3VOZ A;  2XDM A;  3GR2 A;  5GLD A;  3G34 A;  3BM6 A;  2WKE A;  3Q81 A;  3V50 A;  3C7U A;  4JKT A;  3WRT A;  1FCO A;  3DTM A;  3N8R A;  1MPL A;  4GB7 A;  4X6T A;  4U0X A;  1C3B A;  5F82 A;  3SS4 A;  2OLV A;  5EVI C;  1K57 A;  4R0Q A;  1W8Y A;  2OLU A;  3GSG A;  3Q1F A;  5A91 A;  3S1Y A;  1KE0 A;  3ZCZ A;  4LV1 A;  5D3O A;  4WZ5 C;  2WGV A;  3SS3 A;  2WAF A;  1W8Q A;  1K54 C;  5FQI A;  4BL3 A;  4E3M A;  5HAQ A;  1ERQ A;  1U60 A;  2E8I A;  4S2I A;  4X56 A;  4R1G A;  3NIA A;  1YLW A;  4R4S A;  1LI0 A;  1WYC A;  2ZLY A;  4QHC A;  5DF8 A;  1L0F A;  1JWV A;  3AGD A;  1G6A A;  1HTZ A;  2FFF B;  4EUZ A;  4WEJ A;  5AQ9 A;  1MBL A;  3UN7 A;  2X02 A;  4R3J A;  2V2F F;  1NY0 A;  3MXR A;  1CI9 A;  5FSR A;  5M19 A;  4WMC A;  3A3J A;  4JF4 A;  1NZO A;  1XPB A;  3SS5 A;  2XD5 A;  4RX2 A;  5EOO A;  4Y0T A;  4N1X A;  4GNU A;  1JWZ A;  3ZFZ A;  4C6Y A;  2CC1 A;  1HVB A;  4A5R A;  5A92 A;  2V20 A;  1XGJ A;  3DW0 A;  5CGX A;  4PMA A;  4N92 A;  2X01 A;  3PBS A;  2ZM2 A;  5F83 A;  3ZVW A;  1M6K A;  3AGF A;  1BUE A;  4S2M A;  3HLG A;  3OCN A;  2Y91 A;  1RP5 A;  5GHY A;  3PBQ A;  1MWU A;  1PW8 A;  1Q2Q A;  2WGW B;  2XEP A;  3BFG A;  1FR1 A;  2QPN A;  3HLW A;  3ZG0 A;  2WUQ A;  4BEN A;  5DVA A;  2ZC7 A;  3NI9 A;  5FI7 A;  2FFY A;  2QMI A;  1I2S A;  5A90 A;  4PPR A;  1XA1 A;  2OSU A;  1I2W A;  2IWD A;  3ZG9 B;  4S2P A;  3GV9 A;  3ZNY A;  2JE5 A;  3HVF A;  3NDG A;  4KEN B;  2EFX A;  3GTC A;  1KE4 A;  3UO9 A;  5F1F A;  1K4E A;  4OQI A;  1RCJ A;  3UPP A;  3UNW A;  2Y55 A;  4P0M A;  4R23 A;  1LI9 A;  3OPR A;  2H0Y A;  4S2L A;  4QU3 A;  5FI2 A;  1TDG A;  1XGI A;  4HBU A;  3A3F A;  4X55 A;  2ZQA A;  5CTN A;  3VP1 A;  4HES A;  3BFE A;  3BFD A;  1ES2 A;  2Q9N A;  3UPO A;  1YMS A;  5AQB A;  5HAP A;  1IYP A;  4Y7P A;  1PZO A;  4RA7 A;  5CED A;  2ZMA A;  3VOY A;  2VGK A;  2HDR A;  4P6B A;  4U0T A;  5BOH A;  1MWT A;  4FSF A;  4MLL A;  5FA7 A;  2VGJ A;  4X53 A;  1ESU A;  4UHU A;  1IYO A;  3QNB A;  5TFQ A;  3GQZ A;  4M3K A;  1O07 A;  4R4R A;  4F94 A;  1K6S A;  5CHJ A;  1ZG6 A;  5DF7 A;  3MZD A;  1GA0 A;  1NZU A;  2EFU A;  3IHA A;  4EQI A;  3I7J A;  3HLB A;  5FQJ A;  3IQA A;  3FYZ A;  4OOY A;  2H0T A;  3HUO A;  5KSC A;  2DRW A;  5EPH A;  3ZDJ A;  3BEC A;  4KZA A;  1QMF A;  2Y2M A;  3VMA A;  3IF6 A;  1ES4 A;  1JTD A;  2Y2Q A;  2HDU A;  1ES3 A;  5HAI A;  1KGF A;  1KVM A;  1YLZ A;  4S2K A;  1BLC A;  3G4P A;  5CER A;  4MBF A;  1JTG A;  5G18 A;  4KG2 A;  2WKI A;  3Q07 A;  5DTT A;  4DF6 A;  2XH9 A;  2WZZ A;  4E3K A;  3MXS A;  4OVD A;  3RXW A;  4BLM A;  2JCH A;  1KGE A;  4GDB A;  1YM1 A;  4PM5 A;  1PIO A;  4JXS A;  1JVJ A;  3O88 A;  1SKF A;  3IF5 A;  3P09 A;  1Y54 A;  2Y2J A;  2GDN A;  2ZQC A;  4BQM A;  4KZB A;  4XUX A;  1S0W A;  4FH4 A;  4JPM A;  3N8L A;  4ZJ2 A;  1IYQ A;  3BLM A;  3WS2 A;  3G2Z A;  5M1A A;  3QNC A;  4N9L A;  1H8Y A;  1XX2 A;  3IF6 C;  1IYS A;  2Y2G A;  4IED A;  4KQQ A;  4KQR A;  5AQ7 A;  1DJB A;  1L0G A;  3UDF A;  1YLT A;  2Y2I A;  4PM8 A;  3OPH A;  4OQG A;  4XUZ A;  5E2H A;  2IWB A;  1E3U A;  4FCF A;  4ID4 A;  1GA9 A;  1XA7 A;  5GHZ A;  2P9V A;  5FAQ A;  3E2L A;  1BZA A;  4OPQ A;  4DKI A;  4IVI A;  3IH8 A;  4NET A;  4OQ0 A;  2WAD A;  3FKW A;  4BJP A;  4UAA A;  2V1Z A;  3G2Y A;  5GL9 A;  2C6W B;  1GHP A;  1WE4 A;  4P85 A;  4KQO A;  4Y0U A;  3N8S A;  4MBK A;  4DRT A;  1MY8 A;  5CHM A;  1FCM A;  1KDW A;  2PU4 A;  3Q82 A;  4ZDX A;  4WZ4 A;  4WMC D;  1K57 C;  4E3J A;  2Q9M A;  4JXW A;  2EX8 A;  3A3D A;  1K6R A;  1PYY A;  3SH9 A;  1H8Z A;  4B88 A;  5U47 A;  2HDQ A;  3TG9 A;  3IXG A;  2Y2P A;  5FAT A;  3UE3 A;  1K38 A;  2XF3 A;  1YLP A;  2J9O A;  1CEG A;  2RL3 A;  4PM7 A;  3HLD A;  3W8K A;  4DE3 A;  2G2U A;  1E4D A;  2BLS A;  1TDL A;  1HD8 A;  3W4P A;  4ZTK A;  4DE0 A;  3HUM A;  2DNS A;  3UDI A;  3BLS A;  1ZC2 A;  3NBL A;  5CXW A;  5CTM A;  4WEK A;  2ZM8 A;  4X69 A;  3Q7V B;  3MKE A;  4OQH A;  3LEZ A;  1KGG A;  5GLB A;  3G31 A;  1VQQ A;  4P87 A;  3PBR A;  4OP8 A;  3BYD A;  3UE1 A;  2XQZ A;  4MEZ A;  4DE1 A;  4EBL A;  5E2G A;  2ZD8 A;  3MBZ A;  1W7F A;  3NC8 A;  4KZ3 A;  4UA9 A;  1SDN A;  4IVK A;  4OPY A;  2OV5 A;  4E3L A;  4OPR A;  4CJN A;  2R9X A;  5DTK A;  3IWQ A;  2XFS A;  3LY3 A;  4FD8 A;  3WRZ A;  3S4X A;  4K0X A;  1DJC A;  3V3S A;  5EVI B;  1BLP A;  1ZKJ A;  4UA7 A;  4C75 A;  2PU2 A;  2Z2L B;  1PWG A;  3CG5 A;  4YFM A;  3QHY A;  4LV2 A;  3BFC A;  1XKZ A;  4E3N A;  1M40 A;  1LLB A;  4IBX A;  5FAO A;  4EBP A;  3VP4 A;  1NYM A;  2WZX A;  4OP5 A;  4RX3 A;  4WBG A;  3GMW A;  1S6R A;  1YLJ A;  4R3B A;  3VSL A;  4JXG A;  3IH9 A;  1FCN A;  3MFD A;  3S22 A;  5I94 A;  4JBF A;  4S2N A;  2JC7 A;  1IKG A;  1ALQ A;  1TEM A;  3PBT A;  4S2J A;  3C7V A;  3N4I A;  1J9M A;  1W5D A;  2HPB A;  3G35 A;  1OME A;  3AGE A;  1BLH A;  1FOF A;  1SHV A;  1H5X A;  3D4F A;  3HRE A;  4PM6 A;  4KZ8 A;  1FR6 A;  4GD8 A;  3VFF A;  4CPK A;  2HP5 A;  1NXY A;  3BFF A;  1GHI A;  5HAR A;  5CRF A;  5TGF A;  1ONH A;  2EXB A;  5EOE A;  3IWI A;  2EX6 A;  3EQU A;  2HP6 A;  4ZJ3 A;  3FV7 A;  4JF5 A;  5FAP A;  4H8R A;  3M2K A;  5FQM A;  1MXO A;  1YMX A;  1DJA A;  1Z6F A;  4NK3 A;  3TOI A;  1RGY A;  2Y2N A;  5HL1 A;  4QY6 A;  1IEL A;  3B3X A;  2WGW A;  3LCE A;  1L0D A;  3G32 A;  2X71 A;  5EUA A;  1YT4 A;  2P74 A;  3HUN A;  4LCL A;  5GHX A;  3WS0 A;  3V39 A;  4OH0 A;  3UY6 A;  2EX9 A;  5L2F A;  1RGZ A;  4KZ7 A;  5FAS A;  3M6H A;  4DXB A;  1N9B A;  5EEC A;  4EWF A;  4LV3 A;  4XXR A;  3JYI A;  1DY6 A;  4IBR A;  1K4F A;  4LCM A;  5FQ9 A;  2ZC5 B;  4KZ6 A;  4BD0 A;  3NDE A;  1Q2P A;  4L0L A;  2J9P A;  5EVI A;  3FZC A;  1GCE A;  1SCW A;  3IXD A;  2XLN A;  5DF9 A;  3DWZ A;  5J8X A;  1FSY A;  5GLA A;  1FSW A;  1ES5 A;  2PBY A;  1IEM A;  1BT5 A;  3N7W A;  1E3U D;  3CJM A;  1K56 A;  4WEL A;  3EQV A;  3DWK A;  1N4O A;  4GN2 A;  2ZQD A;  2C5W B;  2WGI A;  4OPZ A;  4Y0O A;  4S2O A;  3ZHH A;  4Z9Q A;  3WS5 A;  4KG5 A;  4KZ4 A;  2HP9 A;  4JF6 A;  1ZG4 A;  3PAG A;  4ZJ1 A;  1G68 A;  1K25 A;  4U3T A;  4WYY A;  5FQQ A;  4EBN A;  1ERM A;  5CEC A;  3VSK A;  4OLD A;  1GHM A;  3WWX A;  5E43 A;  4QJG A;  2Y4A A;  3OPL A;  1BUL A;  1PI5 A;  5KSH A;  4DXC A;  2J8Y A;  5HX9 A;  3SH7 A;  5CEB A;  3UE0 A;  5AQA A;  4QD4 A;  1AXB A;  4C3Q A;  1L0E A;  2ZC4 B;  4N1H A;  3FKV A;  3GVB A;  4BL2 A;  2ZJ9 A;  3ISG A;  2Y2K A;  5EVL A;  2A3U A;  2XGN A;  1ONG A;  4EV4 A;  3HBR A;  4KZ9 A;  4GDN A;  5FDH A;  2XK1 A;  3PBN A;  3V5M A;  4YIN A;  4JXV A;  1NRF A;  4JLF A;  1PW1 A;  1KE3 A;  3CMZ A;  5EE8 A;  1W79 A;  4HEF A;  3C4P A;  2ZC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...