3JYIA

Structural and biochemical evidence that a tem-1 {beta}-lactamase asn170gly active site mutant acts via substrate-assisted catalysis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELGEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical evidence that a TEM-1 beta-lactamase N170G active site mutant acts via substrate-assisted catalysis
pubmed doi rcsb
molecule keywords Beta-lactamase TEM
molecule tags Hydrolase
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3jyiA00
3GR2A 4OLGA 3TG9A 3RXWA 5CEBA 1XA1A 4JF5A 2I72A 4QB8A 3OPHA 2ZQ9A 5A92A 4OQ0A 2R9XA 1L0FA 4IBXA 2Y2NA 1W8YA 2Y2PA 3SOIA 5GHZA 3WS4A 1K55A 1Q2QA 4DE2A 1IKIA 3UDXA 1PYYA 4E3MA 1XXMA 1FCOA 2H0YA 5G18A 5M1AA 3FYZA 5D3OA 4JF6A 3M6HA 3ISGA 1TDLA 2Y4AA 3HLGA 3PBQA 4MLLA 2XF3A 3FKWA 3NDEA 5CTMA 2E8IA 5EVID 3M2KA 3P98A 3IHAA 3HL9A 3UPPA 1KGEA 4S2MA 3ZG7B 1XA7A 1YM1A 4KZ7A 3DWKA 1W5DA 4QJGA 1CEGA 1ES2A 3N4IA 4BQMA 5HARA 1PWCA 5JYPA 3PBTA 2VGJA 4GKUA 3UE3A 1KDSA 4GN2A 4QY6A 1CEFA 4CJNA 4KQQA 3Q81A 4X55A 1JVJA 1KDWA 1KGFA 1L0GA 4OPQA 1ONGA 2WZZA 2ZD8A 3MBZA 3Q1FA 4IVIA 5GLCA 3VOZA 5KSCA 1XGJA 1GCEA 2EFUA 3HUOA 3ZVTA 4UHUA 5F83A 4GB7A 5CXWA 5DTSA 3VSLA 2XD5A 3O86A 5F82A 1ALQA 3IT9A 3RJUA 4A5RA 1E3UA 5EOEA 4JLFA 1YLYA 1YMSA 3IHBA 4UA6A 4HESA 3ZG5A 4JKTA 4B88A 5A90A 3NDGA 4N92A 1SDEA 2Q9MA 4N9KA 4M3KA 4BD1A 1IELA 1G68A 1KVMA 3ZFZA 3CMZA 1SKFA 3DW0A 4EBNA 1VM1A 3E2KA 1E25A 3AGFA 3SH8A 4LV0A 1K56D 4JPMA 3HUNA 2Z2MB 4R4RA 5FQKA 3QHYA 2XFTA 1K6SA 1WYCA 3ITBA 4GNUA 1JTGA 2QZ6A 1KE0A 3GVBA 4R3BA 3OC2A 1XX2A 5FI7A 5HL1A 2ZC4B 5EPHA 2EXAA 3N7WA 3N8SA 4WEJA 1Y54A 2Y2OA 4OOLA 4L0LA 4FH4A 1RGYA 1RGZA 3ZNYA 3GSGA 3UDIA 4B4ZA 1FR1A 3DWZA 5FDHA 1K4EA 1K38A 3BFFA 4MBKA 3G32A 2X71A 1K25A 1NJ4A 3GMWA 3HUMA 5GLBA 1GA0A 1PI5A 4K91A 2OSUA 2ZC7A 4C6YA 5JYOA 1ONHA 1W7FA 1SCWA 2A49A 1BLCA 1MWRA 4ZDXA 1LL9A 2ZC5B 2ZLYA 4LV3A 3NI9A 1QMEA 3HVFA 4YFMA 5DF8A 1L0DA 2HDQA 4KG5A 1KGGA 2XD1A 4R23A 2QPNA 2QMIA 1SHVA 4IEDA 1RCJA 3BFDA 5CHMA 1GHMA 1U60A 4PPRA 5FQ9A 3BECA 1I5QA 3VP3A 4OLDA 4P6BA 3Q7VA 4E3NA 3PTEA 1ESIA 3C7VA 3FV7A 4JXSA 3ZCZA 2ZQ7A 2HDSA 3VFFA 1FCNA 1MWUA 4FH2A 4KG2A 3TSGA 1GHIA 4WM9A 1K54C 2Q9NA 4DRTA 4BJPA 3UPOA 3EQVA 5E2GA 5GLDA 1LI0A 2VGKA 3MKEA 4IBRA 4QY5A 1E4DA 5DF7A 3G30A 4ZTKA 2WGWB 3HLCA 4X56A 5GLAA 4EUZA 4JBFA 4OQIA 3HLBA 4BL3A 1L2SA 1MWSA 3ZHHA 4KZ3A 1IKGA 1ES5A 2C5WB 3BFEA 2BLSA 3HLDA 4Y0UA 3IF5A 4JF4A 5CGSA 3ZG0A 1TVFA 5HAQA 4XUZA 4BLMA 1E3UD 1PW8A 1K54A 4FSFA 1YLPA 1HD8A 4B4XA 4DDSA 5HAIA 4DE1A 5F1FA 3LY3A 4E3IA 2XK1A 5EOOA 2WKIA 1OMEA 3Q7VB 4KZ4A 3V5MA 1YLZA 4LV1A 1ZG6A 5U47A 4P85A 3WRZA 2WGVA 3NBLA 4PMAA 3HLFA 5EUAA 5CTNA 4ZJ1A 5KSHA 3GTCA 4EWFA 4KENB 1PW1A 2Y91A 4R1GA 1MPLA 3CG5A 1K57A 4O7DA 2JBFA 3IWIA 4H8RA 4Y0OA 1LL5A 4PM6A 5AQBA 3VFHA 3GRJA 2HP5A 1NY0A 5TGFA 3BLMA 3O87A 1BTLA 4OOMA 3WRTA 1Q2PA 2B5RA 2JC7A 3S22A 2X01A 3FWLA 2RCXA 4OOYA 2EX9A 2PU2A 2JCHA 3B3XA 2WADA 2OV5A 4ZBEA 3V50A 2J9OA 2H10A 2Y2HA 4PM7A 3HBRA 3LEZA 1MKIA 3HLEA 4KZ9A 3LCEA 1K4FA 4DXBA 4ZJ3A 3IH9A 4HEFA 4GDBA 2V2FF 1N4OA 2J9PA 3BFGA 5EE8A 1IYPA 2HDRA 2R9WA 5DTTA 4UAAA 4S2PA 3ITAA 2WKEA 1ESUA 1Z6FA 1JWPA 2WAFA 4LV2A 4WZ4A 1W79A 3MZDA 1HZOA 4UA9A 1NZOA 5CHUA 1BSGA 4Z9QA 3BFCA 4OVDA 1FOFA 4F94A 2J7VA 4KG6A 4CPKA 2IWCA 5FSRA 3OCNA 3OZHA 5CERA 3PBRA 3MZEA 3QNCA 3QNBA 1I2SA 3S1YA 4EBPA 2OLVA 3V3RA 1NRFA 4MBHA 3Q07A 4PM9A 3LY4A 3JYIA 3OPRA 3W4QA 3CZDA 2ZQ8A 4D2OA 5I94A 3MZFA 3WS2A 3DTMA 5CHJA 3UDFA 2ZJ9A 2Y2MA 4C3QA 4R3JA 1IEMA 5L2FA 3WS0A 3RXXA 2Y2JA 5GHXA 5EECA 1I2WA 2XDMA 4MNRA 4NETA 4E6XA 1PWDA 2XH9A 3BYDA 5E43A 3NC8A 1YMXA 5DVAA 3UPNA 3ZDJA 1YLJA 1YT4A 1HTZA 2Y2KA 3G34A 2Y2LA 4OP8A 3WS1A 2HDUA 2WGWA 2XFSA 2Z2LB 3AGEA 3IWOA 3G2ZA 4S2IA 2ZQDA 5FI2A 4EV4A 4E6WA 4X6TA 1J9MA 1DJBA 2WGIA 1O7EA 3OPLA 4GD8A 1IYOA 1K6RA 4S2KA 3P09A 5HFOA 1BUEA 3M6BA 4OONA 4PM5A 4BENA 1FSWA 1NZUA 1XPBA 3A3DA 2C6WB 3N8RA 1S0WA 4KZ8A 1MY8A 3IH8A 4FCFA 3SH7A 1BLPA 2XLNA 3UO9A 1ZKJA 5GL9A 1H8YA 2OLUA 1JTDA 1L0EA 4GD6A 2FFYA 1EWZA 3IQAA 4WEKA 4WBGA 3O3VA 5CRFA 4P0MA 3S4XA 1MWTA 2G2WA 3NY4A 4QHCA 2Y55A 4KZAA 2FFFB 2XGNA 5F1GA 3WWXA 2PBYA 2GDNA 4JXWA 2WUQA 5E2HA 1PIOA 2PU4A 4RA7A 1PZOA 1EI5A 1LLBA 2RL3A 2H0TA 3C4PA 3IWQA 3MXRA 4DE3A 1W8QA 1GA9A 2Y2GA 1LI9A 3AGDA 4E3OA 1HVBA 2EXBA 5A93A 4WMCA 5CGXA 5AQAA 4KZ6A 5FQJA 2ZM2A 3UE1A 5KZHA 1CI9A 3C5AA 4DDYA 1FQGA 4BL2A 5AQ7A 5AQ9A 5J8XA 1KVLA 3NCKA 1K55C 1ES3A 5BOHA 2WYXA 3UY6A 3BEBA 4HBTA 1H5XA 3V3SA 2EX6A 3Q82A 2P74A 1QMFA 2Y59A 3IXBA 1S6RA 1BULA 3PBNA 3OCLA 3A3EA 3M2JA 4GZBA 3D4FA 2EX8A 3UNWA 2ZM8A 4LENA 3BRMA 5E2EA 5GHYA 4C75A 4OP5A 3HREA 4KZ5A 4Q8IA 1ZC2A 3W4OA 5HW3A 2WKHA 1IYSA 4FD8A 4OKPA 5FI6A 5FQQA 1RP5A 1DJAA 4DKIA 2WAEA 4YINA 5DF9A 1PI4A 3GV9A 3A3FA 1XP4A 4OQGA 2HP9A 1C3BA 4LCLA 4S2NC 3A3JA 5FATA 3VP0A 4R0QA 4QU3A 4GOGA 2ZQCA 1M6KA 3N8LA 4RX2A 2X02A 1FCMA 4EBLA 1DJCA 1H8ZA 1M40A 4PM8A 4DE0A 2BG1A 5E2FA 2Y2IA 5FA7A 5CECA 1G6AA 1PZPA 2Y2QA 2ZC3B 5HX9A 3IF6C 4OPZA 5M19A 3BM6A 1PWGA 3WS5A 4OPYA 2EFXA 1NYMA 5FAQA 3W4PA 4S2NA 3C7UA 2G2UA 3LO7A 3ZG8B 3G35A 1BLHA 3TOIA 2V20A 3HLWA 2V1ZA 3SS4A 3PAEA 2IWDA 5EVIC 2EX2A 4KQRA 3IXHA 3VP4A 4N9LA 3MKFA 3SH9A 4MBFA 3A3IA 4P87A 4X53A 3VOYA 1ERQA 1BLSA 5FASA 3IF6A 2HPBA 1IYQA 1KE3A 3IXGA 3ZVWA 4OH0A 1VQQA 5TR7A 1CK3A 3SS3A 4E3LA 4WMCD 3UN7A 3Q7ZA 1XGIA 4IVKA 1LHYA 4S2OA 4Y0TA 3VSKA 3O88A 3E2LA 2DNSA 2P9VA 3BLSA 4KQOA 2WK0A 4U3TA 5EVIA 5EVLA 3V39A 4U0XA 4K0WA 3SS5A 4E3KA 4GDNA 3G2YA 1WYBA 4XUXA 3FKVA 3UE0A 5CEDA 1WE4A 5FAOA 3OPPA 5FQIA 5TFQA 5A91A 4ID4A 3NIAA 4JXGA 3PBOA 2JE5A 4X68A 2XQZA 4HBUA 5DTKA 5KMWA 4N1XA 4OPRA 3MXSA 4DF6A 3FZCA 1MBLA 4QD4A 4ZJ2A 4KZBA 1EROA 2A3UA 3IF6B 1N9BA 1TEMA 4RVAA 1GHPA 5IHVA 1BT5A 1BZAA 1FR6A 4WELA 1SDNA 5HAPA 2XR0A 2CC1A 4RX3A 3W8KA 3GQZA 3MFDA 4UA7A 4MEZA 4X69A 1FSYA 1KE4A 3G31A 3ZG9B 1ES4A 3G4PA 2P9VB 4WZ5C 4S2LA 5EVIB 3VP1A 2HP6A 2ZMAA 3C4OA 3IXDA 1YQSA 3PAGA 1DY6A 4NK3A 3ZGAB 4K0XA 1JWZA 2IWBA 1K56A 4DXCA 4Y7PA 3VMAA 1CI8A 2UWXA 2WZXA 1YLWA 1NYYA 4BD0A 5CGWA 4N1HA 3CJMA 3EQUA 1YLTA 5FAPA 1MXOA 4RYEA 3VP2A 4EQIA 1NXYA 2ZQAA 2J8YA 2ZM0A 3PBSA 1TDGA 4WZ5A 4R4SA 3I7JA 4U0TA 1O07A 1XKZA 2DCFA 4OQHA 4XXRA 4S2JA 1JWVA 2XEPA 2ZC6B 1K57C 4JXVA 4LCMA 4E3JA 2H5SA 3N6IA 4ZAMA 2DRWA 5M18A 3ZNTA 1ERMA 4WYYA 1ZG4A 5FQMA 1AXBA
chains in the Genus database with same CATH superfamily
2O9AA 3TG9A 3B47A 5A92A 4X1LA 5GHZA 1Q2QA 4XT2A 1PYYA 4E3MA 2H0YA 5G18A 5M1AA 2P08A 1TS8A 2Y4AA 4NEED 3HLGA 4MLLA 4HY8A 3NDEA 2V1BA 3M2KA 1PFLA 3IHAA 3HL9A 3VE3A 1KGEA 2V8FA 1A0KA 1YM1A 2UV0E 3DWKA 1W5DA 2QJ7A 3NOTC 5HARA 2VGJA 1KDSA 4CJNA 1L0GA 5J7EA 1ONGA 5FDSA 5KSCA 1XGJA 1GCEA 3E0YA 4WN5A 4WL9A 2PRFA 4NG2A 5CXWA 3VSLA 2XD5A 3G6OA 1EW0A 3O86A 3IT9A 1E3UA 5EOEA 4Q0HA 3IHBA 4UA6A 1S4RA 3EEAA 1PNEA 2Q9MA 4N9KA 1IELA 4CLCD 3CMZA 3T50A 3E2KA 4H6JB 3AGFA 3HUNA 4R4RA 5FEFA 5FQKA 4GNUA 3GVBA 4MN5A 1XX2A 2OOLA 2EXAA 3N7WA 3N8SA 4WEJA 1Y54A 2Y2OA 2VV7A 4HJ6A 5TBMA 2Z6CA 2W1RA 3BFFA 2X71A 2OSUA 4UQIM 1W7FA 4GHIA 1OTAA 1KGGA 2QMIA 4IEDA 1GHMA 4PPRA 5FQ9A 3BECA 5DKLA 3T1RA 4OLDA 2J3WA 3T4KA 4JXSA 2WKPA 4FH2A 4KG2A 3TSGA 3F1NA 2Q9NA 2PDRA 5DFYA 1MKMA 2VGKA 1N9LA 2JKRI 4EUZA 5EM0A 3HLBA 1S67L 4I39A 3V67A 3H82B 2Y79A 4XUZA 4BLMA 1E3UD 1PW8A 1GSWA 4B4XA 4IJGA 3RFBA 1VETA 4DE1A 3P7NA 4E3IA 5EOOA 1OMEA 4LV1A 5CTNA 3GTCA 4WLAA 4KENB 2E8JA 1MPLA 3CG5A 2JBFA 3IWIA 5AQBA 5L07A 1W63Q 2HP5A 3BLMA 1F5MA 2L1MA 5LBRA 2B5RA 3C2WA 2RCXA 4R38A 3TE8A 2EX9A 3B3XA 2WADA 2OV5A 5HPFA 2Y2HA 3PHYA 3HBRA 3LEZA 4KZ9A 3LCEA 4ZJ3A 3IH9A 2V2FF 1N4OA 2J9PA 1T1AA 3MZDA 1OJGA 2WKQA 5CHUA 3F1OA 5CERA 3PBRA 3QNBA 2EWWA 4EBPA 4MBHA 3Q07A 3OPRA 3W4QA 3CZDA 2ZQ8A 3WS2A 4ARZA 4R3JA 2ZOIA 2Y2JA 3RXXA 3T1XA 1I2WA 4MNRA 3T1QB 1P97A 4EW7A 3BYDA 2M1CA 3NC8A 3ZDJA 1YLJA 1YT4A 1HTZA 3D72A 5C5KA 1P0ZA 2XFSA 1FIKA 1DJBA 1O7EA 4G3KA 1FSWA 3IH8A 4FCFA 1ZKJA 1JTDA 2FFYA 3CHWP 4WEKA 2XRNA 4YWZA 3S4XA 3NY4A 2G2WA 1G5UA 1LT0A 2PHYA 3HCYA 2RL3A 3IWQA 2H0TA 3R4KA 4DE3A 5FL3A 1OTEA 2O99A 2W3FA 3AGDA 3BWLA 3T4TA 4F3LB 5HZHA 3JPUA 3UE1A 2VLGA 5KZHA 5L8MA 5AQ7A 3NCKA 5MC7A 1K55C 1ES3A 4LFUA 2JKRM 2EX6A 3Q82A 3U4LP 2Y59A 3CPTB 2L0WA 3PBNA 1TS6A 3ICYA 3A3EA 3M2JA 4CLCB 2EX8A 2QKPA 4KZ5A 5FI6A 4YINA 5DF9A 4Z1WA 1C3BA 4R0QA 3UMDA 4GOGA 3C30A 3R7WA 1H8ZA 2V9AA 4PM8A 2OWHA 3C8CA 3IF6C 1D06A 4QPRA 3WS5A 4OPYA 2EFXA 3C7UA 4XT2B 3G35A 3SS4A 3PAEA 3IXHA 4P6ZS 4X53A 5FASA 1IYQA 3IXGA 1YKDA 3UN7A 3Q7ZA 4IVKA 2P9VA 3C38A 5EVIA 4GDNA 3QP2A 4XUXA 1S4SA 4JXGA 3PBOA 4HBUA 4KQDA 4CLCC 4MN7A 4Q0JA 4ZJ2A 4BBUA 5IHVA 1BT5A 1SDNA 3KSHA 1OPXA 4UA7A 4MEZA 1FSYA 1P9RA 1J3WA 2HP6A 3C4OA 3F1PB 3IX8A 1DY6A 3ZGAB 5AJGA 1OT6A 1K56A 5TBMB 2WZXA 5CGWA 4N1HA 4HH3A 1S1ZA 2A24B 5FAPA 4EQIA 3A0RA 2ZM0A 4R4SA 1SZVA 1O07A 4GHIB 4S2JA 3CWFA 4LCMA 4E3JA 2PAVP 2CMNA 3GR2A 3LEQA 4JF5A 2ZQ9A 2R9XA 1K55A 1IKIA 5D3OA 4JF6A 3M6HA 3ISGA 1TS7A 3FKWA 5CTMA 5EVID 3KSIA 4S2MA 5HWWA 3A0SA 3LR3A 3N4IA 4BQMA 1XFNA 5JYPA 1PWCA 3PBTA 1XJ3A 3UE3A 1CEFA 2PR6A 3JVVA 1VETB 3Q81A 2PD7A 1JVJA 1KDWA 3MBZA 2JHEA 5F83A 3T1SA 5A8BA 3K3CA 5DTSA 5F82A 3PR6A 3RJUA 4A5RA 2KLIA 1YMSA 4FTXA 3EEHA 4B88A 5A90A 4BD1A 4BBVA 1G68A 3ZFZA 1E25A 5HDCA 4LV0A 1K56D 3QHYA 3EGXC 3ITBA 2O9CA 1JTGA 1YAXA 2VK3A 5EPHA 2O0YA 4OOLA 4L0LA 5HSQA 4FH4A 1RGYA 4B4ZA 3MQ0A 1FR1A 5FDHA 4DN0A 1K4EA 1K38A 3G32A 3HUMA 4I38A 5GLBA 4JGPA 1GSVA 5HD3A 4C6YA 4ETXA 3F1OB 1ONHA 1SCWA 5J3WA 1ACFA 4LV3A 3NI9A 1N9OA 3FG8A 4KG5A 2QPNA 3UMEA 1UWPX 5DJTA 4ARZB 3QP5A 2GJ3A 3CLOA 3VP3A 3LI9A 4E3NA 3PTEA 2V0WA 1FCNA 4GCZA 2B02A 3KYQA 3D3OA 3UPOA 2FZ0A 5E2GA 5GLDA 4EU0A 1LI0A 5DF7A 4QY5A 4LRZE 4ZTKA 3LUQA 1L2SA 3ZHHA 1IKGA 3HLDA 1X0OA 4Y0UA 1TD5A 4KUKA 3UB7A 5HAQA 1T18A 2V0UA 5HAIA 3O5YA 5F1FA 2K2NA 3Q7VB 3V5MA 3WRZA 4P85A 4L9FA 5EM1A 3FPWA 1PW1A 2Y91A 3T4LA 4EWFA 1XJ2A 5F5YA 4H8RA 1DRMA 5TGFA 1BTLA 3LICA 4WF0A 4OOMA 3WRTA 1Q2PA 2A2LA 3DTIA 2JC7A 1D7EA 2PU2A 1LSXA 2L4RA 4ZBEA 1ZTUA 1MKIA 1K4FA 4EEUA 4HEFA 4GDBA 3BFGA 5EE8A 2HDRA 5DTTA 1VB6A 3FPVA 1Z6FA 2WAFA 4LV2A 2OAQ1 5IU1A 1FOFA 4NXFA 4KG6A 1F2KA 4CPKA 2IWCA 2QWSA 3OCNA 3OZHA 3S1YA 4DMZA 3MZEA 1XJ6A 1JNUA 3LY4A 4D2OA 3MXQA 5I94A 3UDFA 2Y2MA 1IEMA 1XJ4A 1VHMA 2B95A 5GHXA 2VGLS 1T19A 4E6XA 3QP8A 2XH9A 2O9BA 4HHDA 5DVAA 1NLZA 3R7WB 2Y2LA 3WS1A 5EV0A 2HDUA 3AGEA 3P01A 2ZQDA 5FI2A 4EV4A 1J9MA 3S7QA 3DTKA 4GD8A 1IYOA 4EXOA 3P09A 1BUEA 5HDDA 1H0MA 3K2NA 1S0WA 4HP9A 4KZ8A 1BLPA 5GL9A 1H8YA 4UEYA 4GD6A 3IQAA 4Y5FA 3CITA 4P0MA 2Y55A 4KZAA 2XGNA 2PBYA 2WUQA 3MXRA 5K5BA 2W0NA 3UB9A 2P04A 4YNRA 1YSPA 1HLUP 2ZM2A 1OTIA 1CI9A 4B9OA 3C5AA 1FQGA 3LR4A 5BOHA 3E98A 3CAXA 2PR5A 3HJIA 1VEUB 4BMWA 3T4SA 2PD8A 3K3DA 4GZBA 3KSGA 1CQAA 5E2EA 3S7PA 3ZQ5A 5FQQA 1IYSA 4FD8A 3H7WA 1SKOA 3GV9A 1KOUA 3A3FA 1XP4A 4OQGA 2FH5A 4LCLA 4M4XA 2JKTI 1M6KA 2Q0OA 2X02A 1FCMA 2W1TB 1M40A 4DE0A 4HNBA 2ZC3B 2Y2QA 4P6ZM 4ESPA 1Z09A 1OTBA 5M19A 1PWGA 3ULFA 2PBDP 5FAQA 3LIDA 2Z6DA 3TOIA 5IT5A 2IWDA 5EVIC 4K08A 2EX2A 2G7UA 3VP4A 4N9LA 3MKFA 3IX4A 3ZVWA 4OH0A 5TR7A 1LHYA 4S2OA 4Y0TA 3E2LA 2DNSA 3BLSA 2HF6A 3KO6A 4U0XA 4K0WA 4II7A 1BYWA 3UE0A 5CEDA 5FAOA 5FQIA 3OPPA 5TFQA 4ID4A 3NIAA 4FUWA 2JE5A 4X68A 2XQZA 5DTKA 5F6AA 5KMWA 3MXSA 4KZBA 3IF6B 4RVAA 4HH2A 4IUKA 1BZAA 4WELA 3W8KA 2CC1A 3W2ZA 1Y28A 4X69A 3G4PA 3KX0X 4S2LA 3VP1A 3IXDA 1YQSA 3PAGA 4NK3A 4UQIS 1JWZA 1F9IA 2B18A 2UWXA 2ZOHA 4BD0A 4G3WA 1S66L 3CJMA 3EQUA 1YLTA 3A0VA 3LGOA 4HIAA 1L3LA 4RYEA 3VP2A 2ZQAA 4U0TA 1ZHHB 3EGDC 4XXRA 1JWVA 3EWKA 1K57C 3KSFA 3N6IA 1ERMA 4GLQA 4WYYA 2BTFP 5FQMA 1AXBA 4Q0IA 5CEBA 1XA1A 1OJ5A 4QB8A 4OQ0A 1L0FA 4IBXA 2Y2NA 1W8YA 3WS4A 3UDXA 4Y2FA 1XXMA 3FYZA 4EEPA 2XF3A 3NHQA 1XA7A 4H6JA 4KZ7A 4QJGA 1CEGA 2NUTC 3KYEA 4QY6A 4GN2A 4KQQA 4X55A 4R3AA 1ODVA 3VOZA 3HUOA 3ZVTA 4UHUA 2PT7A 2VV8A 4JLFA 1OTDA 1YLYA 3ZG5A 2JKTM 3NDGA 4N92A 2KOIA 4M3KA 2ACGA 4EBNA 4G3VA 1VM1A 3SH8A 4EUVA 2Z2MB 4MCWA 1K6SA 1WYCA 2QZ6A 1KE0A 4GS9A 4R3BA 3OC2A 5HL1A 4JGQA 1RGZA 3GSGA 1TS0A 4MBKA 4X25A 3LIBA 1NJ4A 3GMWA 3MS6A 1PI5A 4K91A 2ZC7A 5JYOA 3QP6A 2A49A 1LL9A 3HVFA 2H28A 3H82A 4O0PA 1L0DA 2HDQA 3FC7A 1PRQA 4R23A 1SHVA 3MFXA 5CHMA 5F68A 1AWIA 4P6BA 1ESIA 3C7VA 3FV7A 3ZCZA 3VFFA 2HDSA 1MWUA 4WM9A 3IBJA 1V9YA 3CUEC 2OAP1 4BJPA 5EFWA 2PYRA 4IBRA 3G30A 4Y15A 3HLCA 4X56A 4JBFA 2M7UA 4KZ3A 1ES5A 2XA7S 2C5WB 3BFEA 5CGSA 1TVFA 1UWNX 4O8GA 1K54A 1YLPA 1YPRA 2QHKA 2KDKA 3MMHA 3LY3A 2XK1A 2MJ6A 4HJ4A 1YLZA 5U47A 3NBLA 3F1NB 5EUAA 3HLFA 4ZJ1A 1G6OA 3QP1A 4HP4A 1K57A 2DMWA 4PM6A 4HJ3A 3GRJA 3RTYA 5G4ZA 2XROA 1DP9A 2X01A 2ZL1A 4CQHA 2JCHA 4NXGA 1NRJA 2H10A 4PM7A 5CX7A 3MR0A 2R9WA 4UAAA 1GSXA 4S2PA 1ESUA 1JWPA 4HOIA 4WZ4A 1W79A 1BSGA 2W3EA 3BFCA 4OVDA 4F94A 2J7VA 1IOUA 3QNCA 3V3RA 2HGVA 2QJ5A 4JGOA 1FILA 3H7WB 5CHJA 2EA9A 2ZJ9A 5HDSA 4D60A 3WS0A 5EECA 3TW8A 1PWDA 4ETZA 5E43A 1YMXA 3UPNA 2Y2KA 2WGWA 4S2IA 5AVEA 4KUOA 5EVEA 3E4OA 2HV1A 3OPLA 5HFOA 3M6BA 4OONA 4PM5A 4BENA 1NZUA 1XPBA 3A3DA 4F3LA 3NOUC 3LR0A 1MY8A 1N9NA 3BQAA 3SH7A 4EERA 2M7VA 2XLNA 3UO9A 4I5SA 2OLUA 1LL8A 5CRFA 4QHCA 2XSSA 4BWIA 2FFFB 3WWXA 5F1GA 4LPZA 3CPTA 4IHQA 3IBRA 1PIOA 3PYPA 4CLCE 4RA7A 1EI5A 3SW1A 5IS1A 2Y2GA 1HVBA 1T1CA 2D02A 5A93A 3CUEA 5CGXA 5AQAA 5FQJA 5DKKA 2J3TD 4BL2A 1KVLA 4X1MA 1LSWA 3BEBA 4HBTA 4EETB 3H9WA 1CJFA 1QMFA 3IXBA 1S6RA 3OCLA 4Y17A 1MZUA 3BRMA 5GHYA 4C75A 1ZC2A 3W4OA 2WKHA 4R70A 4DKIA 3LIEA 1PI4A 2HP9A 3T12B 3VP0A 4Y13A 2W3GA 2ZQCA 2JKGA 4RX2A 1DJCA 3U2AA 2BG1A 5E2FA 2Y2IA 1PZPA 4HQAA 2VV6A 3LYXA 3HJKA 3BM6A 2HJEA 3S7OA 3W4PA 4S2NA 2G2UA 1T1BA 1BLHA 3UB8A 4LRYC 4KQRA 4R6LA 4MBFA 3A3IA 4P87A 3VOYA 1BLSA 4MMNA 2HPBA 1KE3A 4MN6A 1VQQA 1LSVA 5G4YA 4KQOA 3MJQA 3F1PA 3QP4A 1WYBA 3FKVA 5A91A 4N1XA 4OPRA 2A24A 3FZCA 1MBLA 1OT9A 3L7HA 2PYPA 1D1JA 2W3HA 1GHPA 5HAPA 2XR0A 4RX3A 3GQZA 3MFDA 2QYBA 1V9ZA 4I3IA 1KE4A 3G31A 2P9VB 2BASA 4GS9B 4WUJA 5EVIB 2INWA 3D9YA 4K0XA 3IS2A 3CI6A 1CI8A 2VX8A 1NYYA 5AVFA 1MXOA 3PBSA 2J8YA 4WZ5A 4LGWA 3VOLA 1XKZA 3JVUA 2XEPA 4JXVA 2H5SA 3TRCA 2DRWA 3ZNTA 1ZG4A 5DJUA 1NWZA 4OLGA 3RXWA 2I72A 2VJWA 3OPHA 3SOIA 2Y2PA 4DE2A 1FCOA 1TDLA 3PBQA 3DBAA 2E8IA 3P98A 4JGRA 3UPPA 5HL6A 1UGUA 3ZG7B 3DTEA 3SZTA 1ES2A 5HWTA 4GKUA 5L10A 3GDIA 1KGFA 3LIFA 4OPQA 2WZZA 2ZD8A 4IVIA 3Q1FA 5GLCA 4HI4A 4GJ4A 4ZRRA 2EFUA 2I9VA 3NULA 3MSHA 4GB7A 4YOFA 4DJ3A 1ALQA 4HESA 4JKTA 1H3QA 1SDEA 1KVMA 3DW0A 1SKFA 3VV4A 4JPMA 3BW6A 2VKSA 2ZL1B 2XFTA 5HWVA 2GNXA 5FI7A 2ZC4B 3EOIA 3RH8B 3ZNYA 3UDIA 3DWZA 3UB5P 4FOFA 2YKFA 1K25A 1GA0A 4DJ2A 2K31A 1XFQA 4I3AA 1BLCA 1MWRA 4ZDXA 5DF8A 2ZC5B 2ZLYA 4YFMA 1QMEA 1S1YA 2XD1A 1RCJA 2VA0A 3BFDA 1U60A 1I5QA 2XA7M 3Q7VA 3OLOA 2ZQ7A 3MQOA 2EWVA 1GHIA 1K54C 4DRTA 3EQVA 3MKEA 5F69A 1E4DA 2WGWB 5GLAA 4OQIA 4BL3A 1MWSA 2BLSA 3IF5A 4JF4A 3ZG0A 3B42A 2ZMVA 1H8MA 4FSFA 1HD8A 2VEAA 4DDSA 2HZ5A 3T4QA 2WKIA 3L9KA 4KZ4A 1ZG6A 2WGVA 4PMAA 2WKRA 2GZAA 5KSHA 3GECA 2VZWA 4R1GA 4O7DA 4Y0OA 1LL5A 3VFHA 1NY0A 3E4QA 3O87A 5HD5A 3S22A 3FWLA 3PXPA 4OOYA 2V1AA 3V50A 2J9OA 4ME4A 4AFIA 3MQQA 2J3TC 3HLEA 3E4PA 4LLOB 4DXBA 4PAUA 1IYPA 3ITAA 2WKEA 4RQ9A 1DP8A 1HZOA 4UA9A 1NZOA 4Z9QA 5KIZA 4NXBA 5FSRA 2LB9A 1I2SA 2OLVA 1NRFA 2JN7A 4E04A 4PM9A 4IUHA 3BJNA 3JYIA 1F98A 3MZFA 3DTMA 4PKYG 4C3QA 5L2FA 2XDMA 2W3DA 4NETA 3B33A 2HJ9C 2K7SA 3G34A 4OP8A 3TJZC 3IWOA 2Z2LB 3G2ZA 4E6WA 4X6TA 2WGIA 5DFXA 1WA9A 2V8CA 3LR5A 3LFVA 1K6RA 4S2KA 2P7JA 4LRXC 2C6WB 3N8RA 3NECA 5HPIA 1L0EA 1EWZA 4WBGA 3O3VA 2ZMFA 1MWTA 1VEUA 1NLYA 2GDNA 4JXWA 4EQ1A 3BY8A 4BBTA 5E2HA 2PU4A 4Y3IA 1PZOA 1STZA 1LLBA 3C4PA 1W8QA 1GA9A 1LI9A 4E3OA 2EXBA 4WMCA 4KZ6A 3DAVA 4DDYA 5J8XA 5AQ9A 4NKPA 2WYXA 3UY6A 3V3SA 1H5XA 2W1TA 4MDZA 1Y4OA 2P74A 3LIAA 2NUPC 1BULA 3D4FA 3UNWA 2ZM8A 3MF0A 4LENA 3IS2B 3HREA 4OP5A 4Q8IA 5I5LA 5HW3A 4OKPA 1RP5A 1DJAA 2WAEA 4S2NC 3A3JA 5FATA 2D01A 4QU3A 4PKYA 2R78A 3N8LA 3S7NA 1W63M 3NOPC 4EBLA 5J4EA 1TF1A 2W27A 5FA7A 5CECA 1G6AA 5L09A 1MC0A 5HX9A 2J80A 4OPZA 2VGLM 2LB5A 1NYMA 3ZYTA 3LO7A 1IFQA 3ZG8B 3BQ8A 2V20A 2ZBBA 3HLWA 1SKOB 2V1ZA 1G28A 4I3JA 3KYZA 3OOVA 3SH9A 1ERQA 3IF6A 4B93A 4EESA 2JKFA 3LI8A 4PHTA 3IX3A 3UB6A 1CK3A 3SS3A 4E3LA 4WMCD 1YSQA 1XGIA 3VSKA 2AVXA 2KX6A 3O88A 4U3TA 2WK0A 4QWOA 5EVLA 3V39A 3SS5A 4E3KA 3G2YA 1WE4A 3NJAA 4L9EA 4NXEA 3UE6A 2OWJA 4DF6A 3OBFA 4QD4A 1P9WA 4GW9A 1EROA 2A3UA 1N9BA 1TEMA 1FR6A 5TJJA 3ZG9B 3T4JA 1ES4A 4WZ5C 4CLCA 2ZMAA 4O01A 1DP6A 2IWBA 4DXCA 1K0KA 4Y7PA 3VMAA 3BY9A 4L9GA 1YLWA 5FEGA 3T4OA 2GX5A 1NXYA 2IA2A 2Y8HA 1TDGA 3I7JA 1CF0A 2YKHA 2DCFA 4OQHA 2ZC6B 3VE4A 4ZAMA 5M18A
chains in the Genus database with same CATH topology
3GR2A 4OLGA 3TG9A 3RXWA 5CEBA 1XA1A 4JF5A 2I72A 4QB8A 3OPHA 2ZQ9A 5A92A 4OQ0A 2R9XA 1L0FA 4IBXA 2Y2NA 1W8YA 2Y2PA 3SOIA 5GHZA 3WS4A 1K55A 1Q2QA 4DE2A 1IKIA 3UDXA 1PYYA 4E3MA 1XXMA 1FCOA 2H0YA 5G18A 5M1AA 3FYZA 5D3OA 4JF6A 3M6HA 3ISGA 1TDLA 2Y4AA 3HLGA 3PBQA 4MLLA 2XF3A 3FKWA 3NDEA 5CTMA 2E8IA 5EVID 3M2KA 3P98A 3IHAA 3HL9A 3UPPA 1KGEA 4S2MA 3ZG7B 1XA7A 1YM1A 4KZ7A 3DWKA 1W5DA 4QJGA 1CEGA 1ES2A 3N4IA 4BQMA 5HARA 1PWCA 5JYPA 3PBTA 2VGJA 4GKUA 3UE3A 1KDSA 4GN2A 4QY6A 1CEFA 4CJNA 4KQQA 3Q81A 4X55A 1JVJA 1KDWA 1KGFA 1L0GA 4OPQA 1ONGA 2WZZA 2ZD8A 3MBZA 3Q1FA 4IVIA 5GLCA 3VOZA 5KSCA 1XGJA 1GCEA 2EFUA 3HUOA 3ZVTA 4UHUA 5F83A 4GB7A 5CXWA 5DTSA 3VSLA 2XD5A 3O86A 5F82A 1ALQA 3IT9A 3RJUA 4A5RA 1E3UA 5EOEA 4JLFA 1YLYA 1YMSA 3IHBA 4UA6A 4HESA 3ZG5A 4JKTA 4B88A 5A90A 3NDGA 4N92A 1SDEA 2Q9MA 4N9KA 4M3KA 4BD1A 1IELA 1G68A 1KVMA 3ZFZA 3CMZA 1SKFA 3DW0A 4EBNA 1VM1A 3E2KA 1E25A 3AGFA 3SH8A 4LV0A 1K56D 4JPMA 3HUNA 2Z2MB 4R4RA 5FQKA 3QHYA 2XFTA 1K6SA 1WYCA 3ITBA 4GNUA 1JTGA 2QZ6A 1KE0A 3GVBA 4R3BA 3OC2A 1XX2A 5FI7A 5HL1A 2ZC4B 5EPHA 2EXAA 3N7WA 3N8SA 4WEJA 1Y54A 2Y2OA 4OOLA 4L0LA 4FH4A 1RGYA 1RGZA 3ZNYA 3GSGA 3UDIA 4B4ZA 1FR1A 3DWZA 5FDHA 1K4EA 1K38A 3BFFA 4MBKA 3G32A 2X71A 1K25A 1NJ4A 3GMWA 3HUMA 5GLBA 1GA0A 1PI5A 4K91A 2OSUA 2ZC7A 4C6YA 5JYOA 1ONHA 1W7FA 1SCWA 2A49A 1BLCA 1MWRA 4ZDXA 1LL9A 2ZC5B 2ZLYA 4LV3A 3NI9A 1QMEA 3HVFA 4YFMA 5DF8A 1L0DA 2HDQA 4KG5A 1KGGA 2XD1A 4R23A 2QPNA 2QMIA 1SHVA 4IEDA 1RCJA 3BFDA 5CHMA 1GHMA 1U60A 4PPRA 5FQ9A 3BECA 1I5QA 3VP3A 4OLDA 4P6BA 3Q7VA 4E3NA 3PTEA 1ESIA 3C7VA 3FV7A 4JXSA 3ZCZA 2ZQ7A 2HDSA 3VFFA 1FCNA 1MWUA 4FH2A 4KG2A 3TSGA 1GHIA 4WM9A 1K54C 2Q9NA 4DRTA 4BJPA 3UPOA 3EQVA 5E2GA 5GLDA 1LI0A 2VGKA 3MKEA 4IBRA 4QY5A 1E4DA 5DF7A 3G30A 4ZTKA 2WGWB 3HLCA 4X56A 5GLAA 4EUZA 4JBFA 4OQIA 3HLBA 4BL3A 1L2SA 1MWSA 3ZHHA 4KZ3A 1IKGA 1ES5A 2C5WB 3BFEA 2BLSA 3HLDA 4Y0UA 3IF5A 4JF4A 5CGSA 3ZG0A 1TVFA 5HAQA 4XUZA 4BLMA 1E3UD 1PW8A 1K54A 4FSFA 1YLPA 1HD8A 4B4XA 4DDSA 5HAIA 4DE1A 5F1FA 3LY3A 4E3IA 2XK1A 5EOOA 2WKIA 1OMEA 3Q7VB 4KZ4A 3V5MA 1YLZA 4LV1A 1ZG6A 5U47A 4P85A 3WRZA 2WGVA 3NBLA 4PMAA 3HLFA 5EUAA 5CTNA 4ZJ1A 5KSHA 3GTCA 4EWFA 4KENB 1PW1A 2Y91A 4R1GA 1MPLA 3CG5A 1K57A 4O7DA 2JBFA 3IWIA 4H8RA 4Y0OA 1LL5A 4PM6A 5AQBA 3VFHA 3GRJA 2HP5A 1NY0A 5TGFA 3BLMA 3O87A 1BTLA 4OOMA 3WRTA 1Q2PA 2B5RA 2JC7A 3S22A 2X01A 3FWLA 2RCXA 4OOYA 2EX9A 2PU2A 2JCHA 3B3XA 2WADA 2OV5A 4ZBEA 3V50A 2J9OA 2H10A 2Y2HA 4PM7A 3HBRA 3LEZA 1MKIA 3HLEA 4KZ9A 3LCEA 1K4FA 4DXBA 4ZJ3A 3IH9A 4HEFA 4GDBA 2V2FF 1N4OA 2J9PA 3BFGA 5EE8A 1IYPA 2HDRA 2R9WA 5DTTA 4UAAA 4S2PA 3ITAA 2WKEA 1ESUA 1Z6FA 1JWPA 2WAFA 4LV2A 4WZ4A 1W79A 3MZDA 1HZOA 4UA9A 1NZOA 5CHUA 1BSGA 4Z9QA 3BFCA 4OVDA 1FOFA 4F94A 2J7VA 4KG6A 4CPKA 2IWCA 5FSRA 3OCNA 3OZHA 5CERA 3PBRA 3MZEA 3QNCA 3QNBA 1I2SA 3S1YA 4EBPA 2OLVA 3V3RA 1NRFA 4MBHA 3Q07A 4PM9A 3LY4A 3JYIA 3OPRA 3W4QA 3CZDA 2ZQ8A 4D2OA 5I94A 3MZFA 3WS2A 3DTMA 5CHJA 3UDFA 2ZJ9A 2Y2MA 4C3QA 4R3JA 1IEMA 5L2FA 3WS0A 3RXXA 2Y2JA 5GHXA 5EECA 1I2WA 2XDMA 4MNRA 4NETA 4E6XA 1PWDA 2XH9A 3BYDA 5E43A 3NC8A 1YMXA 5DVAA 3UPNA 3ZDJA 1YLJA 1YT4A 1HTZA 2Y2KA 3G34A 2Y2LA 4OP8A 3WS1A 2HDUA 2WGWA 2XFSA 2Z2LB 3AGEA 3IWOA 3G2ZA 4S2IA 2ZQDA 5FI2A 4EV4A 4E6WA 4X6TA 1J9MA 1DJBA 2WGIA 1O7EA 3OPLA 4GD8A 1IYOA 1K6RA 4S2KA 3P09A 5HFOA 1BUEA 3M6BA 4OONA 4PM5A 4BENA 1FSWA 1NZUA 1XPBA 3A3DA 2C6WB 3N8RA 1S0WA 4KZ8A 1MY8A 3IH8A 4FCFA 3SH7A 1BLPA 2XLNA 3UO9A 1ZKJA 5GL9A 1H8YA 2OLUA 1JTDA 1L0EA 4GD6A 2FFYA 1EWZA 3IQAA 4WEKA 4WBGA 3O3VA 5CRFA 4P0MA 3S4XA 1MWTA 2G2WA 3NY4A 4QHCA 2Y55A 4KZAA 2FFFB 2XGNA 5F1GA 3WWXA 2PBYA 2GDNA 4JXWA 2WUQA 5E2HA 1PIOA 2PU4A 4RA7A 1PZOA 1EI5A 1LLBA 2RL3A 2H0TA 3C4PA 3IWQA 3MXRA 4DE3A 1W8QA 1GA9A 2Y2GA 1LI9A 3AGDA 4E3OA 1HVBA 2EXBA 5A93A 4WMCA 5CGXA 5AQAA 4KZ6A 5FQJA 2ZM2A 3UE1A 5KZHA 1CI9A 3C5AA 4DDYA 1FQGA 4BL2A 5AQ7A 5AQ9A 5J8XA 1KVLA 3NCKA 1K55C 1ES3A 5BOHA 2WYXA 3UY6A 3BEBA 4HBTA 1H5XA 3V3SA 2EX6A 3Q82A 2P74A 1QMFA 2Y59A 3IXBA 1S6RA 1BULA 3PBNA 3OCLA 3A3EA 3M2JA 4GZBA 3D4FA 2EX8A 3UNWA 2ZM8A 4LENA 3BRMA 5E2EA 5GHYA 4C75A 4OP5A 3HREA 4KZ5A 4Q8IA 1ZC2A 3W4OA 5HW3A 2WKHA 1IYSA 4FD8A 4OKPA 5FI6A 5FQQA 1RP5A 1DJAA 4DKIA 2WAEA 4YINA 5DF9A 1PI4A 3GV9A 3A3FA 1XP4A 4OQGA 2HP9A 1C3BA 4LCLA 4S2NC 3A3JA 5FATA 3VP0A 4R0QA 4QU3A 4GOGA 2ZQCA 1M6KA 3N8LA 4RX2A 2X02A 1FCMA 4EBLA 1DJCA 1H8ZA 1M40A 4PM8A 4DE0A 2BG1A 5E2FA 2Y2IA 5FA7A 5CECA 1G6AA 1PZPA 2Y2QA 2ZC3B 5HX9A 3IF6C 4OPZA 5M19A 3BM6A 1PWGA 3WS5A 4OPYA 2EFXA 1NYMA 5FAQA 3W4PA 4S2NA 3C7UA 2G2UA 3LO7A 3ZG8B 3G35A 1BLHA 3TOIA 2V20A 3HLWA 2V1ZA 3SS4A 3PAEA 2IWDA 5EVIC 2EX2A 4KQRA 3IXHA 3VP4A 4N9LA 3MKFA 3SH9A 4MBFA 3A3IA 4P87A 4X53A 3VOYA 1ERQA 1BLSA 5FASA 3IF6A 2HPBA 1IYQA 1KE3A 3IXGA 3ZVWA 4OH0A 1VQQA 5TR7A 1CK3A 3SS3A 4E3LA 4WMCD 3UN7A 3Q7ZA 1XGIA 4IVKA 1LHYA 4S2OA 4Y0TA 3VSKA 3O88A 3E2LA 2DNSA 2P9VA 3BLSA 4KQOA 2WK0A 4U3TA 5EVIA 5EVLA 3V39A 4U0XA 4K0WA 3SS5A 4E3KA 4GDNA 3G2YA 1WYBA 4XUXA 3FKVA 3UE0A 5CEDA 1WE4A 5FAOA 3OPPA 5FQIA 5TFQA 5A91A 4ID4A 3NIAA 4JXGA 3PBOA 2JE5A 4X68A 2XQZA 4HBUA 5DTKA 5KMWA 4N1XA 4OPRA 3MXSA 4DF6A 3FZCA 1MBLA 4QD4A 4ZJ2A 4KZBA 1EROA 2A3UA 3IF6B 1N9BA 1TEMA 4RVAA 1GHPA 5IHVA 1BT5A 1BZAA 1FR6A 4WELA 1SDNA 5HAPA 2XR0A 2CC1A 4RX3A 3W8KA 3GQZA 3MFDA 4UA7A 4MEZA 4X69A 1FSYA 1KE4A 3G31A 3ZG9B 1ES4A 3G4PA 2P9VB 4WZ5C 4S2LA 5EVIB 3VP1A 2HP6A 2ZMAA 3C4OA 3IXDA 1YQSA 3PAGA 1DY6A 4NK3A 3ZGAB 4K0XA 1JWZA 2IWBA 1K56A 4DXCA 4Y7PA 3VMAA 1CI8A 2UWXA 2WZXA 1YLWA 1NYYA 4BD0A 5CGWA 4N1HA 3CJMA 3EQUA 1YLTA 5FAPA 1MXOA 4RYEA 3VP2A 4EQIA 1NXYA 2ZQAA 2J8YA 2ZM0A 3PBSA 1TDGA 4WZ5A 4R4SA 3I7JA 4U0TA 1O07A 1XKZA 2DCFA 4OQHA 4XXRA 4S2JA 1JWVA 2XEPA 2ZC6B 1K57C 4JXVA 4LCMA 4E3JA 2H5SA 3N6IA 4ZAMA 2DRWA 5M18A 3ZNTA 1ERMA 4WYYA 1ZG4A 5FQMA 1AXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR2 A;  4OLG A;  3TG9 A;  3RXW A;  5CEB A;  1XA1 A;  4JF5 A;  2I72 A;  4QB8 A;  3OPH A;  2ZQ9 A;  5A92 A;  4OQ0 A;  2R9X A;  1L0F A;  4IBX A;  2Y2N A;  1W8Y A;  2Y2P A;  3SOI A;  5GHZ A;  3WS4 A;  1K55 A;  1Q2Q A;  4DE2 A;  1IKI A;  3UDX A;  1PYY A;  4E3M A;  1XXM A;  1FCO A;  2H0Y A;  5G18 A;  5M1A A;  3FYZ A;  5D3O A;  4JF6 A;  3M6H A;  3ISG A;  1TDL A;  2Y4A A;  3HLG A;  3PBQ A;  4MLL A;  2XF3 A;  3FKW A;  3NDE A;  5CTM A;  2E8I A;  5EVI D;  3M2K A;  3P98 A;  3IHA A;  3HL9 A;  3UPP A;  1KGE A;  4S2M A;  3ZG7 B;  1XA7 A;  1YM1 A;  4KZ7 A;  3DWK A;  1W5D A;  4QJG A;  1CEG A;  1ES2 A;  3N4I A;  4BQM A;  5HAR A;  1PWC A;  5JYP A;  3PBT A;  2VGJ A;  4GKU A;  3UE3 A;  1KDS A;  4GN2 A;  4QY6 A;  1CEF A;  4CJN A;  4KQQ A;  3Q81 A;  4X55 A;  1JVJ A;  1KDW A;  1KGF A;  1L0G A;  4OPQ A;  1ONG A;  2WZZ A;  2ZD8 A;  3MBZ A;  3Q1F A;  4IVI A;  5GLC A;  3VOZ A;  5KSC A;  1XGJ A;  1GCE A;  2EFU A;  3HUO A;  3ZVT A;  4UHU A;  5F83 A;  4GB7 A;  5CXW A;  5DTS A;  3VSL A;  2XD5 A;  3O86 A;  5F82 A;  1ALQ A;  3IT9 A;  3RJU A;  4A5R A;  1E3U A;  5EOE A;  4JLF A;  1YLY A;  1YMS A;  3IHB A;  4UA6 A;  4HES A;  3ZG5 A;  4JKT A;  4B88 A;  5A90 A;  3NDG A;  4N92 A;  1SDE A;  2Q9M A;  4N9K A;  4M3K A;  4BD1 A;  1IEL A;  1G68 A;  1KVM A;  3ZFZ A;  3CMZ A;  1SKF A;  3DW0 A;  4EBN A;  1VM1 A;  3E2K A;  1E25 A;  3AGF A;  3SH8 A;  4LV0 A;  1K56 D;  4JPM A;  3HUN A;  2Z2M B;  4R4R A;  5FQK A;  3QHY A;  2XFT A;  1K6S A;  1WYC A;  3ITB A;  4GNU A;  1JTG A;  2QZ6 A;  1KE0 A;  3GVB A;  4R3B A;  3OC2 A;  1XX2 A;  5FI7 A;  5HL1 A;  2ZC4 B;  5EPH A;  2EXA A;  3N7W A;  3N8S A;  4WEJ A;  1Y54 A;  2Y2O A;  4OOL A;  4L0L A;  4FH4 A;  1RGY A;  1RGZ A;  3ZNY A;  3GSG A;  3UDI A;  4B4Z A;  1FR1 A;  3DWZ A;  5FDH A;  1K4E A;  1K38 A;  3BFF A;  4MBK A;  3G32 A;  2X71 A;  1K25 A;  1NJ4 A;  3GMW A;  3HUM A;  5GLB A;  1GA0 A;  1PI5 A;  4K91 A;  2OSU A;  2ZC7 A;  4C6Y A;  5JYO A;  1ONH A;  1W7F A;  1SCW A;  2A49 A;  1BLC A;  1MWR A;  4ZDX A;  1LL9 A;  2ZC5 B;  2ZLY A;  4LV3 A;  3NI9 A;  1QME A;  3HVF A;  4YFM A;  5DF8 A;  1L0D A;  2HDQ A;  4KG5 A;  1KGG A;  2XD1 A;  4R23 A;  2QPN A;  2QMI A;  1SHV A;  4IED A;  1RCJ A;  3BFD A;  5CHM A;  1GHM A;  1U60 A;  4PPR A;  5FQ9 A;  3BEC A;  1I5Q A;  3VP3 A;  4OLD A;  4P6B A;  3Q7V A;  4E3N A;  3PTE A;  1ESI A;  3C7V A;  3FV7 A;  4JXS A;  3ZCZ A;  2ZQ7 A;  2HDS A;  3VFF A;  1FCN A;  1MWU A;  4FH2 A;  4KG2 A;  3TSG A;  1GHI A;  4WM9 A;  1K54 C;  2Q9N A;  4DRT A;  4BJP A;  3UPO A;  3EQV A;  5E2G A;  5GLD A;  1LI0 A;  2VGK A;  3MKE A;  4IBR A;  4QY5 A;  1E4D A;  5DF7 A;  3G30 A;  4ZTK A;  2WGW B;  3HLC A;  4X56 A;  5GLA A;  4EUZ A;  4JBF A;  4OQI A;  3HLB A;  4BL3 A;  1L2S A;  1MWS A;  3ZHH A;  4KZ3 A;  1IKG A;  1ES5 A;  2C5W B;  3BFE A;  2BLS A;  3HLD A;  4Y0U A;  3IF5 A;  4JF4 A;  5CGS A;  3ZG0 A;  1TVF A;  5HAQ A;  4XUZ A;  4BLM A;  1E3U D;  1PW8 A;  1K54 A;  4FSF A;  1YLP A;  1HD8 A;  4B4X A;  4DDS A;  5HAI A;  4DE1 A;  5F1F A;  3LY3 A;  4E3I A;  2XK1 A;  5EOO A;  2WKI A;  1OME A;  3Q7V B;  4KZ4 A;  3V5M A;  1YLZ A;  4LV1 A;  1ZG6 A;  5U47 A;  4P85 A;  3WRZ A;  2WGV A;  3NBL A;  4PMA A;  3HLF A;  5EUA A;  5CTN A;  4ZJ1 A;  5KSH A;  3GTC A;  4EWF A;  4KEN B;  1PW1 A;  2Y91 A;  4R1G A;  1MPL A;  3CG5 A;  1K57 A;  4O7D A;  2JBF A;  3IWI A;  4H8R A;  4Y0O A;  1LL5 A;  4PM6 A;  5AQB A;  3VFH A;  3GRJ A;  2HP5 A;  1NY0 A;  5TGF A;  3BLM A;  3O87 A;  1BTL A;  4OOM A;  3WRT A;  1Q2P A;  2B5R A;  2JC7 A;  3S22 A;  2X01 A;  3FWL A;  2RCX A;  4OOY A;  2EX9 A;  2PU2 A;  2JCH A;  3B3X A;  2WAD A;  2OV5 A;  4ZBE A;  3V50 A;  2J9O A;  2H10 A;  2Y2H A;  4PM7 A;  3HBR A;  3LEZ A;  1MKI A;  3HLE A;  4KZ9 A;  3LCE A;  1K4F A;  4DXB A;  4ZJ3 A;  3IH9 A;  4HEF A;  4GDB A;  2V2F F;  1N4O A;  2J9P A;  3BFG A;  5EE8 A;  1IYP A;  2HDR A;  2R9W A;  5DTT A;  4UAA A;  4S2P A;  3ITA A;  2WKE A;  1ESU A;  1Z6F A;  1JWP A;  2WAF A;  4LV2 A;  4WZ4 A;  1W79 A;  3MZD A;  1HZO A;  4UA9 A;  1NZO A;  5CHU A;  1BSG A;  4Z9Q A;  3BFC A;  4OVD A;  1FOF A;  4F94 A;  2J7V A;  4KG6 A;  4CPK A;  2IWC A;  5FSR A;  3OCN A;  3OZH A;  5CER A;  3PBR A;  3MZE A;  3QNC A;  3QNB A;  1I2S A;  3S1Y A;  4EBP A;  2OLV A;  3V3R A;  1NRF A;  4MBH A;  3Q07 A;  4PM9 A;  3LY4 A;  3JYI A;  3OPR A;  3W4Q A;  3CZD A;  2ZQ8 A;  4D2O A;  5I94 A;  3MZF A;  3WS2 A;  3DTM A;  5CHJ A;  3UDF A;  2ZJ9 A;  2Y2M A;  4C3Q A;  4R3J A;  1IEM A;  5L2F A;  3WS0 A;  3RXX A;  2Y2J A;  5GHX A;  5EEC A;  1I2W A;  2XDM A;  4MNR A;  4NET A;  4E6X A;  1PWD A;  2XH9 A;  3BYD A;  5E43 A;  3NC8 A;  1YMX A;  5DVA A;  3UPN A;  3ZDJ A;  1YLJ A;  1YT4 A;  1HTZ A;  2Y2K A;  3G34 A;  2Y2L A;  4OP8 A;  3WS1 A;  2HDU A;  2WGW A;  2XFS A;  2Z2L B;  3AGE A;  3IWO A;  3G2Z A;  4S2I A;  2ZQD A;  5FI2 A;  4EV4 A;  4E6W A;  4X6T A;  1J9M A;  1DJB A;  2WGI A;  1O7E A;  3OPL A;  4GD8 A;  1IYO A;  1K6R A;  4S2K A;  3P09 A;  5HFO A;  1BUE A;  3M6B A;  4OON A;  4PM5 A;  4BEN A;  1FSW A;  1NZU A;  1XPB A;  3A3D A;  2C6W B;  3N8R A;  1S0W A;  4KZ8 A;  1MY8 A;  3IH8 A;  4FCF A;  3SH7 A;  1BLP A;  2XLN A;  3UO9 A;  1ZKJ A;  5GL9 A;  1H8Y A;  2OLU A;  1JTD A;  1L0E A;  4GD6 A;  2FFY A;  1EWZ A;  3IQA A;  4WEK A;  4WBG A;  3O3V A;  5CRF A;  4P0M A;  3S4X A;  1MWT A;  2G2W A;  3NY4 A;  4QHC A;  2Y55 A;  4KZA A;  2FFF B;  2XGN A;  5F1G A;  3WWX A;  2PBY A;  2GDN A;  4JXW A;  2WUQ A;  5E2H A;  1PIO A;  2PU4 A;  4RA7 A;  1PZO A;  1EI5 A;  1LLB A;  2RL3 A;  2H0T A;  3C4P A;  3IWQ A;  3MXR A;  4DE3 A;  1W8Q A;  1GA9 A;  2Y2G A;  1LI9 A;  3AGD A;  4E3O A;  1HVB A;  2EXB A;  5A93 A;  4WMC A;  5CGX A;  5AQA A;  4KZ6 A;  5FQJ A;  2ZM2 A;  3UE1 A;  5KZH A;  1CI9 A;  3C5A A;  4DDY A;  1FQG A;  4BL2 A;  5AQ7 A;  5AQ9 A;  5J8X A;  1KVL A;  3NCK A;  1K55 C;  1ES3 A;  5BOH A;  2WYX A;  3UY6 A;  3BEB A;  4HBT A;  1H5X A;  3V3S A;  2EX6 A;  3Q82 A;  2P74 A;  1QMF A;  2Y59 A;  3IXB A;  1S6R A;  1BUL A;  3PBN A;  3OCL A;  3A3E A;  3M2J A;  4GZB A;  3D4F A;  2EX8 A;  3UNW A;  2ZM8 A;  4LEN A;  3BRM A;  5E2E A;  5GHY A;  4C75 A;  4OP5 A;  3HRE A;  4KZ5 A;  4Q8I A;  1ZC2 A;  3W4O A;  5HW3 A;  2WKH A;  1IYS A;  4FD8 A;  4OKP A;  5FI6 A;  5FQQ A;  1RP5 A;  1DJA A;  4DKI A;  2WAE A;  4YIN A;  5DF9 A;  1PI4 A;  3GV9 A;  3A3F A;  1XP4 A;  4OQG A;  2HP9 A;  1C3B A;  4LCL A;  4S2N C;  3A3J A;  5FAT A;  3VP0 A;  4R0Q A;  4QU3 A;  4GOG A;  2ZQC A;  1M6K A;  3N8L A;  4RX2 A;  2X02 A;  1FCM A;  4EBL A;  1DJC A;  1H8Z A;  1M40 A;  4PM8 A;  4DE0 A;  2BG1 A;  5E2F A;  2Y2I A;  5FA7 A;  5CEC A;  1G6A A;  1PZP A;  2Y2Q A;  2ZC3 B;  5HX9 A;  3IF6 C;  4OPZ A;  5M19 A;  3BM6 A;  1PWG A;  3WS5 A;  4OPY A;  2EFX A;  1NYM A;  5FAQ A;  3W4P A;  4S2N A;  3C7U A;  2G2U A;  3LO7 A;  3ZG8 B;  3G35 A;  1BLH A;  3TOI A;  2V20 A;  3HLW A;  2V1Z A;  3SS4 A;  3PAE A;  2IWD A;  5EVI C;  2EX2 A;  4KQR A;  3IXH A;  3VP4 A;  4N9L A;  3MKF A;  3SH9 A;  4MBF A;  3A3I A;  4P87 A;  4X53 A;  3VOY A;  1ERQ A;  1BLS A;  5FAS A;  3IF6 A;  2HPB A;  1IYQ A;  1KE3 A;  3IXG A;  3ZVW A;  4OH0 A;  1VQQ A;  5TR7 A;  1CK3 A;  3SS3 A;  4E3L A;  4WMC D;  3UN7 A;  3Q7Z A;  1XGI A;  4IVK A;  1LHY A;  4S2O A;  4Y0T A;  3VSK A;  3O88 A;  3E2L A;  2DNS A;  2P9V A;  3BLS A;  4KQO A;  2WK0 A;  4U3T A;  5EVI A;  5EVL A;  3V39 A;  4U0X A;  4K0W A;  3SS5 A;  4E3K A;  4GDN A;  3G2Y A;  1WYB A;  4XUX A;  3FKV A;  3UE0 A;  5CED A;  1WE4 A;  5FAO A;  3OPP A;  5FQI A;  5TFQ A;  5A91 A;  4ID4 A;  3NIA A;  4JXG A;  3PBO A;  2JE5 A;  4X68 A;  2XQZ A;  4HBU A;  5DTK A;  5KMW A;  4N1X A;  4OPR A;  3MXS A;  4DF6 A;  3FZC A;  1MBL A;  4QD4 A;  4ZJ2 A;  4KZB A;  1ERO A;  2A3U A;  3IF6 B;  1N9B A;  1TEM A;  4RVA A;  1GHP A;  5IHV A;  1BT5 A;  1BZA A;  1FR6 A;  4WEL A;  1SDN A;  5HAP A;  2XR0 A;  2CC1 A;  4RX3 A;  3W8K A;  3GQZ A;  3MFD A;  4UA7 A;  4MEZ A;  4X69 A;  1FSY A;  1KE4 A;  3G31 A;  3ZG9 B;  1ES4 A;  3G4P A;  2P9V B;  4WZ5 C;  4S2L A;  5EVI B;  3VP1 A;  2HP6 A;  2ZMA A;  3C4O A;  3IXD A;  1YQS A;  3PAG A;  1DY6 A;  4NK3 A;  3ZGA B;  4K0X A;  1JWZ A;  2IWB A;  1K56 A;  4DXC A;  4Y7P A;  3VMA A;  1CI8 A;  2UWX A;  2WZX A;  1YLW A;  1NYY A;  4BD0 A;  5CGW A;  4N1H A;  3CJM A;  3EQU A;  1YLT A;  5FAP A;  1MXO A;  4RYE A;  3VP2 A;  4EQI A;  1NXY A;  2ZQA A;  2J8Y A;  2ZM0 A;  3PBS A;  1TDG A;  4WZ5 A;  4R4S A;  3I7J A;  4U0T A;  1O07 A;  1XKZ A;  2DCF A;  4OQH A;  4XXR A;  4S2J A;  1JWV A;  2XEP A;  2ZC6 B;  1K57 C;  4JXV A;  4LCM A;  4E3J A;  2H5S A;  3N6I A;  4ZAM A;  2DRW A;  5M18 A;  3ZNT A;  1ERM A;  4WYY A;  1ZG4 A;  5FQM A;  1AXB A; 
#chains in the Genus database with same CATH topology
 2O9A A;  3TG9 A;  3B47 A;  5A92 A;  4X1L A;  5GHZ A;  1Q2Q A;  4XT2 A;  1PYY A;  4E3M A;  2H0Y A;  5G18 A;  5M1A A;  2P08 A;  1TS8 A;  2Y4A A;  4NEE D;  3HLG A;  4MLL A;  4HY8 A;  3NDE A;  2V1B A;  3M2K A;  1PFL A;  3IHA A;  3HL9 A;  3VE3 A;  1KGE A;  2V8F A;  1A0K A;  1YM1 A;  2UV0 E;  3DWK A;  1W5D A;  2QJ7 A;  3NOT C;  5HAR A;  2VGJ A;  1KDS A;  4CJN A;  1L0G A;  5J7E A;  1ONG A;  5FDS A;  5KSC A;  1XGJ A;  1GCE A;  3E0Y A;  4WN5 A;  4WL9 A;  2PRF A;  4NG2 A;  5CXW A;  3VSL A;  2XD5 A;  3G6O A;  1EW0 A;  3O86 A;  3IT9 A;  1E3U A;  5EOE A;  4Q0H A;  3IHB A;  4UA6 A;  1S4R A;  3EEA A;  1PNE A;  2Q9M A;  4N9K A;  1IEL A;  4CLC D;  3CMZ A;  3T50 A;  3E2K A;  4H6J B;  3AGF A;  3HUN A;  4R4R A;  5FEF A;  5FQK A;  4GNU A;  3GVB A;  4MN5 A;  1XX2 A;  2OOL A;  2EXA A;  3N7W A;  3N8S A;  4WEJ A;  1Y54 A;  2Y2O A;  2VV7 A;  4HJ6 A;  5TBM A;  2Z6C A;  2W1R A;  3BFF A;  2X71 A;  2OSU A;  4UQI M;  1W7F A;  4GHI A;  1OTA A;  1KGG A;  2QMI A;  4IED A;  1GHM A;  4PPR A;  5FQ9 A;  3BEC A;  5DKL A;  3T1R A;  4OLD A;  2J3W A;  3T4K A;  4JXS A;  2WKP A;  4FH2 A;  4KG2 A;  3TSG A;  3F1N A;  2Q9N A;  2PDR A;  5DFY A;  1MKM A;  2VGK A;  1N9L A;  2JKR I;  4EUZ A;  5EM0 A;  3HLB A;  1S67 L;  4I39 A;  3V67 A;  3H82 B;  2Y79 A;  4XUZ A;  4BLM A;  1E3U D;  1PW8 A;  1GSW A;  4B4X A;  4IJG A;  3RFB A;  1VET A;  4DE1 A;  3P7N A;  4E3I A;  5EOO A;  1OME A;  4LV1 A;  5CTN A;  3GTC A;  4WLA A;  4KEN B;  2E8J A;  1MPL A;  3CG5 A;  2JBF A;  3IWI A;  5AQB A;  5L07 A;  1W63 Q;  2HP5 A;  3BLM A;  1F5M A;  2L1M A;  5LBR A;  2B5R A;  3C2W A;  2RCX A;  4R38 A;  3TE8 A;  2EX9 A;  3B3X A;  2WAD A;  2OV5 A;  5HPF A;  2Y2H A;  3PHY A;  3HBR A;  3LEZ A;  4KZ9 A;  3LCE A;  4ZJ3 A;  3IH9 A;  2V2F F;  1N4O A;  2J9P A;  1T1A A;  3MZD A;  1OJG A;  2WKQ A;  5CHU A;  3F1O A;  5CER A;  3PBR A;  3QNB A;  2EWW A;  4EBP A;  4MBH A;  3Q07 A;  3OPR A;  3W4Q A;  3CZD A;  2ZQ8 A;  3WS2 A;  4ARZ A;  4R3J A;  2ZOI A;  2Y2J A;  3RXX A;  3T1X A;  1I2W A;  4MNR A;  3T1Q B;  1P97 A;  4EW7 A;  3BYD A;  2M1C A;  3NC8 A;  3ZDJ A;  1YLJ A;  1YT4 A;  1HTZ A;  3D72 A;  5C5K A;  1P0Z A;  2XFS A;  1FIK A;  1DJB A;  1O7E A;  4G3K A;  1FSW A;  3IH8 A;  4FCF A;  1ZKJ A;  1JTD A;  2FFY A;  3CHW P;  4WEK A;  2XRN A;  4YWZ A;  3S4X A;  3NY4 A;  2G2W A;  1G5U A;  1LT0 A;  2PHY A;  3HCY A;  2RL3 A;  3IWQ A;  2H0T A;  3R4K A;  4DE3 A;  5FL3 A;  1OTE A;  2O99 A;  2W3F A;  3AGD A;  3BWL A;  3T4T A;  4F3L B;  5HZH A;  3JPU A;  3UE1 A;  2VLG A;  5KZH A;  5L8M A;  5AQ7 A;  3NCK A;  5MC7 A;  1K55 C;  1ES3 A;  4LFU A;  2JKR M;  2EX6 A;  3Q82 A;  3U4L P;  2Y59 A;  3CPT B;  2L0W A;  3PBN A;  1TS6 A;  3ICY A;  3A3E A;  3M2J A;  4CLC B;  2EX8 A;  2QKP A;  4KZ5 A;  5FI6 A;  4YIN A;  5DF9 A;  4Z1W A;  1C3B A;  4R0Q A;  3UMD A;  4GOG A;  3C30 A;  3R7W A;  1H8Z A;  2V9A A;  4PM8 A;  2OWH A;  3C8C A;  3IF6 C;  1D06 A;  4QPR A;  3WS5 A;  4OPY A;  2EFX A;  3C7U A;  4XT2 B;  3G35 A;  3SS4 A;  3PAE A;  3IXH A;  4P6Z S;  4X53 A;  5FAS A;  1IYQ A;  3IXG A;  1YKD A;  3UN7 A;  3Q7Z A;  4IVK A;  2P9V A;  3C38 A;  5EVI A;  4GDN A;  3QP2 A;  4XUX A;  1S4S A;  4JXG A;  3PBO A;  4HBU A;  4KQD A;  4CLC C;  4MN7 A;  4Q0J A;  4ZJ2 A;  4BBU A;  5IHV A;  1BT5 A;  1SDN A;  3KSH A;  1OPX A;  4UA7 A;  4MEZ A;  1FSY A;  1P9R A;  1J3W A;  2HP6 A;  3C4O A;  3F1P B;  3IX8 A;  1DY6 A;  3ZGA B;  5AJG A;  1OT6 A;  1K56 A;  5TBM B;  2WZX A;  5CGW A;  4N1H A;  4HH3 A;  1S1Z A;  2A24 B;  5FAP A;  4EQI A;  3A0R A;  2ZM0 A;  4R4S A;  1SZV A;  1O07 A;  4GHI B;  4S2J A;  3CWF A;  4LCM A;  4E3J A;  2PAV P;  2CMN A;  3GR2 A;  3LEQ A;  4JF5 A;  2ZQ9 A;  2R9X A;  1K55 A;  1IKI A;  5D3O A;  4JF6 A;  3M6H A;  3ISG A;  1TS7 A;  3FKW A;  5CTM A;  5EVI D;  3KSI A;  4S2M A;  5HWW A;  3A0S A;  3LR3 A;  3N4I A;  4BQM A;  1XFN A;  5JYP A;  1PWC A;  3PBT A;  1XJ3 A;  3UE3 A;  1CEF A;  2PR6 A;  3JVV A;  1VET B;  3Q81 A;  2PD7 A;  1JVJ A;  1KDW A;  3MBZ A;  2JHE A;  5F83 A;  3T1S A;  5A8B A;  3K3C A;  5DTS A;  5F82 A;  3PR6 A;  3RJU A;  4A5R A;  2KLI A;  1YMS A;  4FTX A;  3EEH A;  4B88 A;  5A90 A;  4BD1 A;  4BBV A;  1G68 A;  3ZFZ A;  1E25 A;  5HDC A;  4LV0 A;  1K56 D;  3QHY A;  3EGX C;  3ITB A;  2O9C A;  1JTG A;  1YAX A;  2VK3 A;  5EPH A;  2O0Y A;  4OOL A;  4L0L A;  5HSQ A;  4FH4 A;  1RGY A;  4B4Z A;  3MQ0 A;  1FR1 A;  5FDH A;  4DN0 A;  1K4E A;  1K38 A;  3G32 A;  3HUM A;  4I38 A;  5GLB A;  4JGP A;  1GSV A;  5HD3 A;  4C6Y A;  4ETX A;  3F1O B;  1ONH A;  1SCW A;  5J3W A;  1ACF A;  4LV3 A;  3NI9 A;  1N9O A;  3FG8 A;  4KG5 A;  2QPN A;  3UME A;  1UWP X;  5DJT A;  4ARZ B;  3QP5 A;  2GJ3 A;  3CLO A;  3VP3 A;  3LI9 A;  4E3N A;  3PTE A;  2V0W A;  1FCN A;  4GCZ A;  2B02 A;  3KYQ A;  3D3O A;  3UPO A;  2FZ0 A;  5E2G A;  5GLD A;  4EU0 A;  1LI0 A;  5DF7 A;  4QY5 A;  4LRZ E;  4ZTK A;  3LUQ A;  1L2S A;  3ZHH A;  1IKG A;  3HLD A;  1X0O A;  4Y0U A;  1TD5 A;  4KUK A;  3UB7 A;  5HAQ A;  1T18 A;  2V0U A;  5HAI A;  3O5Y A;  5F1F A;  2K2N A;  3Q7V B;  3V5M A;  3WRZ A;  4P85 A;  4L9F A;  5EM1 A;  3FPW A;  1PW1 A;  2Y91 A;  3T4L A;  4EWF A;  1XJ2 A;  5F5Y A;  4H8R A;  1DRM A;  5TGF A;  1BTL A;  3LIC A;  4WF0 A;  4OOM A;  3WRT A;  1Q2P A;  2A2L A;  3DTI A;  2JC7 A;  1D7E A;  2PU2 A;  1LSX A;  2L4R A;  4ZBE A;  1ZTU A;  1MKI A;  1K4F A;  4EEU A;  4HEF A;  4GDB A;  3BFG A;  5EE8 A;  2HDR A;  5DTT A;  1VB6 A;  3FPV A;  1Z6F A;  2WAF A;  4LV2 A;  2OAQ 1;  5IU1 A;  1FOF A;  4NXF A;  4KG6 A;  1F2K A;  4CPK A;  2IWC A;  2QWS A;  3OCN A;  3OZH A;  3S1Y A;  4DMZ A;  3MZE A;  1XJ6 A;  1JNU A;  3LY4 A;  4D2O A;  3MXQ A;  5I94 A;  3UDF A;  2Y2M A;  1IEM A;  1XJ4 A;  1VHM A;  2B95 A;  5GHX A;  2VGL S;  1T19 A;  4E6X A;  3QP8 A;  2XH9 A;  2O9B A;  4HHD A;  5DVA A;  1NLZ A;  3R7W B;  2Y2L A;  3WS1 A;  5EV0 A;  2HDU A;  3AGE A;  3P01 A;  2ZQD A;  5FI2 A;  4EV4 A;  1J9M A;  3S7Q A;  3DTK A;  4GD8 A;  1IYO A;  4EXO A;  3P09 A;  1BUE A;  5HDD A;  1H0M A;  3K2N A;  1S0W A;  4HP9 A;  4KZ8 A;  1BLP A;  5GL9 A;  1H8Y A;  4UEY A;  4GD6 A;  3IQA A;  4Y5F A;  3CIT A;  4P0M A;  2Y55 A;  4KZA A;  2XGN A;  2PBY A;  2WUQ A;  3MXR A;  5K5B A;  2W0N A;  3UB9 A;  2P04 A;  4YNR A;  1YSP A;  1HLU P;  2ZM2 A;  1OTI A;  1CI9 A;  4B9O A;  3C5A A;  1FQG A;  3LR4 A;  5BOH A;  3E98 A;  3CAX A;  2PR5 A;  3HJI A;  1VEU B;  4BMW A;  3T4S A;  2PD8 A;  3K3D A;  4GZB A;  3KSG A;  1CQA A;  5E2E A;  3S7P A;  3ZQ5 A;  5FQQ A;  1IYS A;  4FD8 A;  3H7W A;  1SKO A;  3GV9 A;  1KOU A;  3A3F A;  1XP4 A;  4OQG A;  2FH5 A;  4LCL A;  4M4X A;  2JKT I;  1M6K A;  2Q0O A;  2X02 A;  1FCM A;  2W1T B;  1M40 A;  4DE0 A;  4HNB A;  2ZC3 B;  2Y2Q A;  4P6Z M;  4ESP A;  1Z09 A;  1OTB A;  5M19 A;  1PWG A;  3ULF A;  2PBD P;  5FAQ A;  3LID A;  2Z6D A;  3TOI A;  5IT5 A;  2IWD A;  5EVI C;  4K08 A;  2EX2 A;  2G7U A;  3VP4 A;  4N9L A;  3MKF A;  3IX4 A;  3ZVW A;  4OH0 A;  5TR7 A;  1LHY A;  4S2O A;  4Y0T A;  3E2L A;  2DNS A;  3BLS A;  2HF6 A;  3KO6 A;  4U0X A;  4K0W A;  4II7 A;  1BYW A;  3UE0 A;  5CED A;  5FAO A;  5FQI A;  3OPP A;  5TFQ A;  4ID4 A;  3NIA A;  4FUW A;  2JE5 A;  4X68 A;  2XQZ A;  5DTK A;  5F6A A;  5KMW A;  3MXS A;  4KZB A;  3IF6 B;  4RVA A;  4HH2 A;  4IUK A;  1BZA A;  4WEL A;  3W8K A;  2CC1 A;  3W2Z A;  1Y28 A;  4X69 A;  3G4P A;  3KX0 X;  4S2L A;  3VP1 A;  3IXD A;  1YQS A;  3PAG A;  4NK3 A;  4UQI S;  1JWZ A;  1F9I A;  2B18 A;  2UWX A;  2ZOH A;  4BD0 A;  4G3W A;  1S66 L;  3CJM A;  3EQU A;  1YLT A;  3A0V A;  3LGO A;  4HIA A;  1L3L A;  4RYE A;  3VP2 A;  2ZQA A;  4U0T A;  1ZHH B;  3EGD C;  4XXR A;  1JWV A;  3EWK A;  1K57 C;  3KSF A;  3N6I A;  1ERM A;  4GLQ A;  4WYY A;  2BTF P;  5FQM A;  1AXB A;  4Q0I A;  5CEB A;  1XA1 A;  1OJ5 A;  4QB8 A;  4OQ0 A;  1L0F A;  4IBX A;  2Y2N A;  1W8Y A;  3WS4 A;  3UDX A;  4Y2F A;  1XXM A;  3FYZ A;  4EEP A;  2XF3 A;  3NHQ A;  1XA7 A;  4H6J A;  4KZ7 A;  4QJG A;  1CEG A;  2NUT C;  3KYE A;  4QY6 A;  4GN2 A;  4KQQ A;  4X55 A;  4R3A A;  1ODV A;  3VOZ A;  3HUO A;  3ZVT A;  4UHU A;  2PT7 A;  2VV8 A;  4JLF A;  1OTD A;  1YLY A;  3ZG5 A;  2JKT M;  3NDG A;  4N92 A;  2KOI A;  4M3K A;  2ACG A;  4EBN A;  4G3V A;  1VM1 A;  3SH8 A;  4EUV A;  2Z2M B;  4MCW A;  1K6S A;  1WYC A;  2QZ6 A;  1KE0 A;  4GS9 A;  4R3B A;  3OC2 A;  5HL1 A;  4JGQ A;  1RGZ A;  3GSG A;  1TS0 A;  4MBK A;  4X25 A;  3LIB A;  1NJ4 A;  3GMW A;  3MS6 A;  1PI5 A;  4K91 A;  2ZC7 A;  5JYO A;  3QP6 A;  2A49 A;  1LL9 A;  3HVF A;  2H28 A;  3H82 A;  4O0P A;  1L0D A;  2HDQ A;  3FC7 A;  1PRQ A;  4R23 A;  1SHV A;  3MFX A;  5CHM A;  5F68 A;  1AWI A;  4P6B A;  1ESI A;  3C7V A;  3FV7 A;  3ZCZ A;  3VFF A;  2HDS A;  1MWU A;  4WM9 A;  3IBJ A;  1V9Y A;  3CUE C;  2OAP 1;  4BJP A;  5EFW A;  2PYR A;  4IBR A;  3G30 A;  4Y15 A;  3HLC A;  4X56 A;  4JBF A;  2M7U A;  4KZ3 A;  1ES5 A;  2XA7 S;  2C5W B;  3BFE A;  5CGS A;  1TVF A;  1UWN X;  4O8G A;  1K54 A;  1YLP A;  1YPR A;  2QHK A;  2KDK A;  3MMH A;  3LY3 A;  2XK1 A;  2MJ6 A;  4HJ4 A;  1YLZ A;  5U47 A;  3NBL A;  3F1N B;  5EUA A;  3HLF A;  4ZJ1 A;  1G6O A;  3QP1 A;  4HP4 A;  1K57 A;  2DMW A;  4PM6 A;  4HJ3 A;  3GRJ A;  3RTY A;  5G4Z A;  2XRO A;  1DP9 A;  2X01 A;  2ZL1 A;  4CQH A;  2JCH A;  4NXG A;  1NRJ A;  2H10 A;  4PM7 A;  5CX7 A;  3MR0 A;  2R9W A;  4UAA A;  1GSX A;  4S2P A;  1ESU A;  1JWP A;  4HOI A;  4WZ4 A;  1W79 A;  1BSG A;  2W3E A;  3BFC A;  4OVD A;  4F94 A;  2J7V A;  1IOU A;  3QNC A;  3V3R A;  2HGV A;  2QJ5 A;  4JGO A;  1FIL A;  3H7W B;  5CHJ A;  2EA9 A;  2ZJ9 A;  5HDS A;  4D60 A;  3WS0 A;  5EEC A;  3TW8 A;  1PWD A;  4ETZ A;  5E43 A;  1YMX A;  3UPN A;  2Y2K A;  2WGW A;  4S2I A;  5AVE A;  4KUO A;  5EVE A;  3E4O A;  2HV1 A;  3OPL A;  5HFO A;  3M6B A;  4OON A;  4PM5 A;  4BEN A;  1NZU A;  1XPB A;  3A3D A;  4F3L A;  3NOU C;  3LR0 A;  1MY8 A;  1N9N A;  3BQA A;  3SH7 A;  4EER A;  2M7V A;  2XLN A;  3UO9 A;  4I5S A;  2OLU A;  1LL8 A;  5CRF A;  4QHC A;  2XSS A;  4BWI A;  2FFF B;  3WWX A;  5F1G A;  4LPZ A;  3CPT A;  4IHQ A;  3IBR A;  1PIO A;  3PYP A;  4CLC E;  4RA7 A;  1EI5 A;  3SW1 A;  5IS1 A;  2Y2G A;  1HVB A;  1T1C A;  2D02 A;  5A93 A;  3CUE A;  5CGX A;  5AQA A;  5FQJ A;  5DKK A;  2J3T D;  4BL2 A;  1KVL A;  4X1M A;  1LSW A;  3BEB A;  4HBT A;  4EET B;  3H9W A;  1CJF A;  1QMF A;  3IXB A;  1S6R A;  3OCL A;  4Y17 A;  1MZU A;  3BRM A;  5GHY A;  4C75 A;  1ZC2 A;  3W4O A;  2WKH A;  4R70 A;  4DKI A;  3LIE A;  1PI4 A;  2HP9 A;  3T12 B;  3VP0 A;  4Y13 A;  2W3G A;  2ZQC A;  2JKG A;  4RX2 A;  1DJC A;  3U2A A;  2BG1 A;  5E2F A;  2Y2I A;  1PZP A;  4HQA A;  2VV6 A;  3LYX A;  3HJK A;  3BM6 A;  2HJE A;  3S7O A;  3W4P A;  4S2N A;  2G2U A;  1T1B A;  1BLH A;  3UB8 A;  4LRY C;  4KQR A;  4R6L A;  4MBF A;  3A3I A;  4P87 A;  3VOY A;  1BLS A;  4MMN A;  2HPB A;  1KE3 A;  4MN6 A;  1VQQ A;  1LSV A;  5G4Y A;  4KQO A;  3MJQ A;  3F1P A;  3QP4 A;  1WYB A;  3FKV A;  5A91 A;  4N1X A;  4OPR A;  2A24 A;  3FZC A;  1MBL A;  1OT9 A;  3L7H A;  2PYP A;  1D1J A;  2W3H A;  1GHP A;  5HAP A;  2XR0 A;  4RX3 A;  3GQZ A;  3MFD A;  2QYB A;  1V9Z A;  4I3I A;  1KE4 A;  3G31 A;  2P9V B;  2BAS A;  4GS9 B;  4WUJ A;  5EVI B;  2INW A;  3D9Y A;  4K0X A;  3IS2 A;  3CI6 A;  1CI8 A;  2VX8 A;  1NYY A;  5AVF A;  1MXO A;  3PBS A;  2J8Y A;  4WZ5 A;  4LGW A;  3VOL A;  1XKZ A;  3JVU A;  2XEP A;  4JXV A;  2H5S A;  3TRC A;  2DRW A;  3ZNT A;  1ZG4 A;  5DJU A;  1NWZ A;  4OLG A;  3RXW A;  2I72 A;  2VJW A;  3OPH A;  3SOI A;  2Y2P A;  4DE2 A;  1FCO A;  1TDL A;  3PBQ A;  3DBA A;  2E8I A;  3P98 A;  4JGR A;  3UPP A;  5HL6 A;  1UGU A;  3ZG7 B;  3DTE A;  3SZT A;  1ES2 A;  5HWT A;  4GKU A;  5L10 A;  3GDI A;  1KGF A;  3LIF A;  4OPQ A;  2WZZ A;  2ZD8 A;  4IVI A;  3Q1F A;  5GLC A;  4HI4 A;  4GJ4 A;  4ZRR A;  2EFU A;  2I9V A;  3NUL A;  3MSH A;  4GB7 A;  4YOF A;  4DJ3 A;  1ALQ A;  4HES A;  4JKT A;  1H3Q A;  1SDE A;  1KVM A;  3DW0 A;  1SKF A;  3VV4 A;  4JPM A;  3BW6 A;  2VKS A;  2ZL1 B;  2XFT A;  5HWV A;  2GNX A;  5FI7 A;  2ZC4 B;  3EOI A;  3RH8 B;  3ZNY A;  3UDI A;  3DWZ A;  3UB5 P;  4FOF A;  2YKF A;  1K25 A;  1GA0 A;  4DJ2 A;  2K31 A;  1XFQ A;  4I3A A;  1BLC A;  1MWR A;  4ZDX A;  5DF8 A;  2ZC5 B;  2ZLY A;  4YFM A;  1QME A;  1S1Y A;  2XD1 A;  1RCJ A;  2VA0 A;  3BFD A;  1U60 A;  1I5Q A;  2XA7 M;  3Q7V A;  3OLO A;  2ZQ7 A;  3MQO A;  2EWV A;  1GHI A;  1K54 C;  4DRT A;  3EQV A;  3MKE A;  5F69 A;  1E4D A;  2WGW B;  5GLA A;  4OQI A;  4BL3 A;  1MWS A;  2BLS A;  3IF5 A;  4JF4 A;  3ZG0 A;  3B42 A;  2ZMV A;  1H8M A;  4FSF A;  1HD8 A;  2VEA A;  4DDS A;  2HZ5 A;  3T4Q A;  2WKI A;  3L9K A;  4KZ4 A;  1ZG6 A;  2WGV A;  4PMA A;  2WKR A;  2GZA A;  5KSH A;  3GEC A;  2VZW A;  4R1G A;  4O7D A;  4Y0O A;  1LL5 A;  3VFH A;  1NY0 A;  3E4Q A;  3O87 A;  5HD5 A;  3S22 A;  3FWL A;  3PXP A;  4OOY A;  2V1A A;  3V50 A;  2J9O A;  4ME4 A;  4AFI A;  3MQQ A;  2J3T C;  3HLE A;  3E4P A;  4LLO B;  4DXB A;  4PAU A;  1IYP A;  3ITA A;  2WKE A;  4RQ9 A;  1DP8 A;  1HZO A;  4UA9 A;  1NZO A;  4Z9Q A;  5KIZ A;  4NXB A;  5FSR A;  2LB9 A;  1I2S A;  2OLV A;  1NRF A;  2JN7 A;  4E04 A;  4PM9 A;  4IUH A;  3BJN A;  3JYI A;  1F98 A;  3MZF A;  3DTM A;  4PKY G;  4C3Q A;  5L2F A;  2XDM A;  2W3D A;  4NET A;  3B33 A;  2HJ9 C;  2K7S A;  3G34 A;  4OP8 A;  3TJZ C;  3IWO A;  2Z2L B;  3G2Z A;  4E6W A;  4X6T A;  2WGI A;  5DFX A;  1WA9 A;  2V8C A;  3LR5 A;  3LFV A;  1K6R A;  4S2K A;  2P7J A;  4LRX C;  2C6W B;  3N8R A;  3NEC A;  5HPI A;  1L0E A;  1EWZ A;  4WBG A;  3O3V A;  2ZMF A;  1MWT A;  1VEU A;  1NLY A;  2GDN A;  4JXW A;  4EQ1 A;  3BY8 A;  4BBT A;  5E2H A;  2PU4 A;  4Y3I A;  1PZO A;  1STZ A;  1LLB A;  3C4P A;  1W8Q A;  1GA9 A;  1LI9 A;  4E3O A;  2EXB A;  4WMC A;  4KZ6 A;  3DAV A;  4DDY A;  5J8X A;  5AQ9 A;  4NKP A;  2WYX A;  3UY6 A;  3V3S A;  1H5X A;  2W1T A;  4MDZ A;  1Y4O A;  2P74 A;  3LIA A;  2NUP C;  1BUL A;  3D4F A;  3UNW A;  2ZM8 A;  3MF0 A;  4LEN A;  3IS2 B;  3HRE A;  4OP5 A;  4Q8I A;  5I5L A;  5HW3 A;  4OKP A;  1RP5 A;  1DJA A;  2WAE A;  4S2N C;  3A3J A;  5FAT A;  2D01 A;  4QU3 A;  4PKY A;  2R78 A;  3N8L A;  3S7N A;  1W63 M;  3NOP C;  4EBL A;  5J4E A;  1TF1 A;  2W27 A;  5FA7 A;  5CEC A;  1G6A A;  5L09 A;  1MC0 A;  5HX9 A;  2J80 A;  4OPZ A;  2VGL M;  2LB5 A;  1NYM A;  3ZYT A;  3LO7 A;  1IFQ A;  3ZG8 B;  3BQ8 A;  2V20 A;  2ZBB A;  3HLW A;  1SKO B;  2V1Z A;  1G28 A;  4I3J A;  3KYZ A;  3OOV A;  3SH9 A;  1ERQ A;  3IF6 A;  4B93 A;  4EES A;  2JKF A;  3LI8 A;  4PHT A;  3IX3 A;  3UB6 A;  1CK3 A;  3SS3 A;  4E3L A;  4WMC D;  1YSQ A;  1XGI A;  3VSK A;  2AVX A;  2KX6 A;  3O88 A;  4U3T A;  2WK0 A;  4QWO A;  5EVL A;  3V39 A;  3SS5 A;  4E3K A;  3G2Y A;  1WE4 A;  3NJA A;  4L9E A;  4NXE A;  3UE6 A;  2OWJ A;  4DF6 A;  3OBF A;  4QD4 A;  1P9W A;  4GW9 A;  1ERO A;  2A3U A;  1N9B A;  1TEM A;  1FR6 A;  5TJJ A;  3ZG9 B;  3T4J A;  1ES4 A;  4WZ5 C;  4CLC A;  2ZMA A;  4O01 A;  1DP6 A;  2IWB A;  4DXC A;  1K0K A;  4Y7P A;  3VMA A;  3BY9 A;  4L9G A;  1YLW A;  5FEG A;  3T4O A;  2GX5 A;  1NXY A;  2IA2 A;  2Y8H A;  1TDG A;  3I7J A;  1CF0 A;  2YKH A;  2DCF A;  4OQH A;  2ZC6 B;  3VE4 A;  4ZAM A;  5M18 A; 
#chains in the Genus database with same CATH homology
 3GR2 A;  4OLG A;  3TG9 A;  3RXW A;  5CEB A;  1XA1 A;  4JF5 A;  2I72 A;  4QB8 A;  3OPH A;  2ZQ9 A;  5A92 A;  4OQ0 A;  2R9X A;  1L0F A;  4IBX A;  2Y2N A;  1W8Y A;  2Y2P A;  3SOI A;  5GHZ A;  3WS4 A;  1K55 A;  1Q2Q A;  4DE2 A;  1IKI A;  3UDX A;  1PYY A;  4E3M A;  1XXM A;  1FCO A;  2H0Y A;  5G18 A;  5M1A A;  3FYZ A;  5D3O A;  4JF6 A;  3M6H A;  3ISG A;  1TDL A;  2Y4A A;  3HLG A;  3PBQ A;  4MLL A;  2XF3 A;  3FKW A;  3NDE A;  5CTM A;  2E8I A;  5EVI D;  3M2K A;  3P98 A;  3IHA A;  3HL9 A;  3UPP A;  1KGE A;  4S2M A;  3ZG7 B;  1XA7 A;  1YM1 A;  4KZ7 A;  3DWK A;  1W5D A;  4QJG A;  1CEG A;  1ES2 A;  3N4I A;  4BQM A;  5HAR A;  1PWC A;  5JYP A;  3PBT A;  2VGJ A;  4GKU A;  3UE3 A;  1KDS A;  4GN2 A;  4QY6 A;  1CEF A;  4CJN A;  4KQQ A;  3Q81 A;  4X55 A;  1JVJ A;  1KDW A;  1KGF A;  1L0G A;  4OPQ A;  1ONG A;  2WZZ A;  2ZD8 A;  3MBZ A;  3Q1F A;  4IVI A;  5GLC A;  3VOZ A;  5KSC A;  1XGJ A;  1GCE A;  2EFU A;  3HUO A;  3ZVT A;  4UHU A;  5F83 A;  4GB7 A;  5CXW A;  5DTS A;  3VSL A;  2XD5 A;  3O86 A;  5F82 A;  1ALQ A;  3IT9 A;  3RJU A;  4A5R A;  1E3U A;  5EOE A;  4JLF A;  1YLY A;  1YMS A;  3IHB A;  4UA6 A;  4HES A;  3ZG5 A;  4JKT A;  4B88 A;  5A90 A;  3NDG A;  4N92 A;  1SDE A;  2Q9M A;  4N9K A;  4M3K A;  4BD1 A;  1IEL A;  1G68 A;  1KVM A;  3ZFZ A;  3CMZ A;  1SKF A;  3DW0 A;  4EBN A;  1VM1 A;  3E2K A;  1E25 A;  3AGF A;  3SH8 A;  4LV0 A;  1K56 D;  4JPM A;  3HUN A;  2Z2M B;  4R4R A;  5FQK A;  3QHY A;  2XFT A;  1K6S A;  1WYC A;  3ITB A;  4GNU A;  1JTG A;  2QZ6 A;  1KE0 A;  3GVB A;  4R3B A;  3OC2 A;  1XX2 A;  5FI7 A;  5HL1 A;  2ZC4 B;  5EPH A;  2EXA A;  3N7W A;  3N8S A;  4WEJ A;  1Y54 A;  2Y2O A;  4OOL A;  4L0L A;  4FH4 A;  1RGY A;  1RGZ A;  3ZNY A;  3GSG A;  3UDI A;  4B4Z A;  1FR1 A;  3DWZ A;  5FDH A;  1K4E A;  1K38 A;  3BFF A;  4MBK A;  3G32 A;  2X71 A;  1K25 A;  1NJ4 A;  3GMW A;  3HUM A;  5GLB A;  1GA0 A;  1PI5 A;  4K91 A;  2OSU A;  2ZC7 A;  4C6Y A;  5JYO A;  1ONH A;  1W7F A;  1SCW A;  2A49 A;  1BLC A;  1MWR A;  4ZDX A;  1LL9 A;  2ZC5 B;  2ZLY A;  4LV3 A;  3NI9 A;  1QME A;  3HVF A;  4YFM A;  5DF8 A;  1L0D A;  2HDQ A;  4KG5 A;  1KGG A;  2XD1 A;  4R23 A;  2QPN A;  2QMI A;  1SHV A;  4IED A;  1RCJ A;  3BFD A;  5CHM A;  1GHM A;  1U60 A;  4PPR A;  5FQ9 A;  3BEC A;  1I5Q A;  3VP3 A;  4OLD A;  4P6B A;  3Q7V A;  4E3N A;  3PTE A;  1ESI A;  3C7V A;  3FV7 A;  4JXS A;  3ZCZ A;  2ZQ7 A;  2HDS A;  3VFF A;  1FCN A;  1MWU A;  4FH2 A;  4KG2 A;  3TSG A;  1GHI A;  4WM9 A;  1K54 C;  2Q9N A;  4DRT A;  4BJP A;  3UPO A;  3EQV A;  5E2G A;  5GLD A;  1LI0 A;  2VGK A;  3MKE A;  4IBR A;  4QY5 A;  1E4D A;  5DF7 A;  3G30 A;  4ZTK A;  2WGW B;  3HLC A;  4X56 A;  5GLA A;  4EUZ A;  4JBF A;  4OQI A;  3HLB A;  4BL3 A;  1L2S A;  1MWS A;  3ZHH A;  4KZ3 A;  1IKG A;  1ES5 A;  2C5W B;  3BFE A;  2BLS A;  3HLD A;  4Y0U A;  3IF5 A;  4JF4 A;  5CGS A;  3ZG0 A;  1TVF A;  5HAQ A;  4XUZ A;  4BLM A;  1E3U D;  1PW8 A;  1K54 A;  4FSF A;  1YLP A;  1HD8 A;  4B4X A;  4DDS A;  5HAI A;  4DE1 A;  5F1F A;  3LY3 A;  4E3I A;  2XK1 A;  5EOO A;  2WKI A;  1OME A;  3Q7V B;  4KZ4 A;  3V5M A;  1YLZ A;  4LV1 A;  1ZG6 A;  5U47 A;  4P85 A;  3WRZ A;  2WGV A;  3NBL A;  4PMA A;  3HLF A;  5EUA A;  5CTN A;  4ZJ1 A;  5KSH A;  3GTC A;  4EWF A;  4KEN B;  1PW1 A;  2Y91 A;  4R1G A;  1MPL A;  3CG5 A;  1K57 A;  4O7D A;  2JBF A;  3IWI A;  4H8R A;  4Y0O A;  1LL5 A;  4PM6 A;  5AQB A;  3VFH A;  3GRJ A;  2HP5 A;  1NY0 A;  5TGF A;  3BLM A;  3O87 A;  1BTL A;  4OOM A;  3WRT A;  1Q2P A;  2B5R A;  2JC7 A;  3S22 A;  2X01 A;  3FWL A;  2RCX A;  4OOY A;  2EX9 A;  2PU2 A;  2JCH A;  3B3X A;  2WAD A;  2OV5 A;  4ZBE A;  3V50 A;  2J9O A;  2H10 A;  2Y2H A;  4PM7 A;  3HBR A;  3LEZ A;  1MKI A;  3HLE A;  4KZ9 A;  3LCE A;  1K4F A;  4DXB A;  4ZJ3 A;  3IH9 A;  4HEF A;  4GDB A;  2V2F F;  1N4O A;  2J9P A;  3BFG A;  5EE8 A;  1IYP A;  2HDR A;  2R9W A;  5DTT A;  4UAA A;  4S2P A;  3ITA A;  2WKE A;  1ESU A;  1Z6F A;  1JWP A;  2WAF A;  4LV2 A;  4WZ4 A;  1W79 A;  3MZD A;  1HZO A;  4UA9 A;  1NZO A;  5CHU A;  1BSG A;  4Z9Q A;  3BFC A;  4OVD A;  1FOF A;  4F94 A;  2J7V A;  4KG6 A;  4CPK A;  2IWC A;  5FSR A;  3OCN A;  3OZH A;  5CER A;  3PBR A;  3MZE A;  3QNC A;  3QNB A;  1I2S A;  3S1Y A;  4EBP A;  2OLV A;  3V3R A;  1NRF A;  4MBH A;  3Q07 A;  4PM9 A;  3LY4 A;  3JYI A;  3OPR A;  3W4Q A;  3CZD A;  2ZQ8 A;  4D2O A;  5I94 A;  3MZF A;  3WS2 A;  3DTM A;  5CHJ A;  3UDF A;  2ZJ9 A;  2Y2M A;  4C3Q A;  4R3J A;  1IEM A;  5L2F A;  3WS0 A;  3RXX A;  2Y2J A;  5GHX A;  5EEC A;  1I2W A;  2XDM A;  4MNR A;  4NET A;  4E6X A;  1PWD A;  2XH9 A;  3BYD A;  5E43 A;  3NC8 A;  1YMX A;  5DVA A;  3UPN A;  3ZDJ A;  1YLJ A;  1YT4 A;  1HTZ A;  2Y2K A;  3G34 A;  2Y2L A;  4OP8 A;  3WS1 A;  2HDU A;  2WGW A;  2XFS A;  2Z2L B;  3AGE A;  3IWO A;  3G2Z A;  4S2I A;  2ZQD A;  5FI2 A;  4EV4 A;  4E6W A;  4X6T A;  1J9M A;  1DJB A;  2WGI A;  1O7E A;  3OPL A;  4GD8 A;  1IYO A;  1K6R A;  4S2K A;  3P09 A;  5HFO A;  1BUE A;  3M6B A;  4OON A;  4PM5 A;  4BEN A;  1FSW A;  1NZU A;  1XPB A;  3A3D A;  2C6W B;  3N8R A;  1S0W A;  4KZ8 A;  1MY8 A;  3IH8 A;  4FCF A;  3SH7 A;  1BLP A;  2XLN A;  3UO9 A;  1ZKJ A;  5GL9 A;  1H8Y A;  2OLU A;  1JTD A;  1L0E A;  4GD6 A;  2FFY A;  1EWZ A;  3IQA A;  4WEK A;  4WBG A;  3O3V A;  5CRF A;  4P0M A;  3S4X A;  1MWT A;  2G2W A;  3NY4 A;  4QHC A;  2Y55 A;  4KZA A;  2FFF B;  2XGN A;  5F1G A;  3WWX A;  2PBY A;  2GDN A;  4JXW A;  2WUQ A;  5E2H A;  1PIO A;  2PU4 A;  4RA7 A;  1PZO A;  1EI5 A;  1LLB A;  2RL3 A;  2H0T A;  3C4P A;  3IWQ A;  3MXR A;  4DE3 A;  1W8Q A;  1GA9 A;  2Y2G A;  1LI9 A;  3AGD A;  4E3O A;  1HVB A;  2EXB A;  5A93 A;  4WMC A;  5CGX A;  5AQA A;  4KZ6 A;  5FQJ A;  2ZM2 A;  3UE1 A;  5KZH A;  1CI9 A;  3C5A A;  4DDY A;  1FQG A;  4BL2 A;  5AQ7 A;  5AQ9 A;  5J8X A;  1KVL A;  3NCK A;  1K55 C;  1ES3 A;  5BOH A;  2WYX A;  3UY6 A;  3BEB A;  4HBT A;  1H5X A;  3V3S A;  2EX6 A;  3Q82 A;  2P74 A;  1QMF A;  2Y59 A;  3IXB A;  1S6R A;  1BUL A;  3PBN A;  3OCL A;  3A3E A;  3M2J A;  4GZB A;  3D4F A;  2EX8 A;  3UNW A;  2ZM8 A;  4LEN A;  3BRM A;  5E2E A;  5GHY A;  4C75 A;  4OP5 A;  3HRE A;  4KZ5 A;  4Q8I A;  1ZC2 A;  3W4O A;  5HW3 A;  2WKH A;  1IYS A;  4FD8 A;  4OKP A;  5FI6 A;  5FQQ A;  1RP5 A;  1DJA A;  4DKI A;  2WAE A;  4YIN A;  5DF9 A;  1PI4 A;  3GV9 A;  3A3F A;  1XP4 A;  4OQG A;  2HP9 A;  1C3B A;  4LCL A;  4S2N C;  3A3J A;  5FAT A;  3VP0 A;  4R0Q A;  4QU3 A;  4GOG A;  2ZQC A;  1M6K A;  3N8L A;  4RX2 A;  2X02 A;  1FCM A;  4EBL A;  1DJC A;  1H8Z A;  1M40 A;  4PM8 A;  4DE0 A;  2BG1 A;  5E2F A;  2Y2I A;  5FA7 A;  5CEC A;  1G6A A;  1PZP A;  2Y2Q A;  2ZC3 B;  5HX9 A;  3IF6 C;  4OPZ A;  5M19 A;  3BM6 A;  1PWG A;  3WS5 A;  4OPY A;  2EFX A;  1NYM A;  5FAQ A;  3W4P A;  4S2N A;  3C7U A;  2G2U A;  3LO7 A;  3ZG8 B;  3G35 A;  1BLH A;  3TOI A;  2V20 A;  3HLW A;  2V1Z A;  3SS4 A;  3PAE A;  2IWD A;  5EVI C;  2EX2 A;  4KQR A;  3IXH A;  3VP4 A;  4N9L A;  3MKF A;  3SH9 A;  4MBF A;  3A3I A;  4P87 A;  4X53 A;  3VOY A;  1ERQ A;  1BLS A;  5FAS A;  3IF6 A;  2HPB A;  1IYQ A;  1KE3 A;  3IXG A;  3ZVW A;  4OH0 A;  1VQQ A;  5TR7 A;  1CK3 A;  3SS3 A;  4E3L A;  4WMC D;  3UN7 A;  3Q7Z A;  1XGI A;  4IVK A;  1LHY A;  4S2O A;  4Y0T A;  3VSK A;  3O88 A;  3E2L A;  2DNS A;  2P9V A;  3BLS A;  4KQO A;  2WK0 A;  4U3T A;  5EVI A;  5EVL A;  3V39 A;  4U0X A;  4K0W A;  3SS5 A;  4E3K A;  4GDN A;  3G2Y A;  1WYB A;  4XUX A;  3FKV A;  3UE0 A;  5CED A;  1WE4 A;  5FAO A;  3OPP A;  5FQI A;  5TFQ A;  5A91 A;  4ID4 A;  3NIA A;  4JXG A;  3PBO A;  2JE5 A;  4X68 A;  2XQZ A;  4HBU A;  5DTK A;  5KMW A;  4N1X A;  4OPR A;  3MXS A;  4DF6 A;  3FZC A;  1MBL A;  4QD4 A;  4ZJ2 A;  4KZB A;  1ERO A;  2A3U A;  3IF6 B;  1N9B A;  1TEM A;  4RVA A;  1GHP A;  5IHV A;  1BT5 A;  1BZA A;  1FR6 A;  4WEL A;  1SDN A;  5HAP A;  2XR0 A;  2CC1 A;  4RX3 A;  3W8K A;  3GQZ A;  3MFD A;  4UA7 A;  4MEZ A;  4X69 A;  1FSY A;  1KE4 A;  3G31 A;  3ZG9 B;  1ES4 A;  3G4P A;  2P9V B;  4WZ5 C;  4S2L A;  5EVI B;  3VP1 A;  2HP6 A;  2ZMA A;  3C4O A;  3IXD A;  1YQS A;  3PAG A;  1DY6 A;  4NK3 A;  3ZGA B;  4K0X A;  1JWZ A;  2IWB A;  1K56 A;  4DXC A;  4Y7P A;  3VMA A;  1CI8 A;  2UWX A;  2WZX A;  1YLW A;  1NYY A;  4BD0 A;  5CGW A;  4N1H A;  3CJM A;  3EQU A;  1YLT A;  5FAP A;  1MXO A;  4RYE A;  3VP2 A;  4EQI A;  1NXY A;  2ZQA A;  2J8Y A;  2ZM0 A;  3PBS A;  1TDG A;  4WZ5 A;  4R4S A;  3I7J A;  4U0T A;  1O07 A;  1XKZ A;  2DCF A;  4OQH A;  4XXR A;  4S2J A;  1JWV A;  2XEP A;  2ZC6 B;  1K57 C;  4JXV A;  4LCM A;  4E3J A;  2H5S A;  3N6I A;  4ZAM A;  2DRW A;  5M18 A;  3ZNT A;  1ERM A;  4WYY A;  1ZG4 A;  5FQM A;  1AXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...