3JYMA

Crystal structure of the 3 fkbp domains of wheat fkbp73
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
354
structure length
301
Chain Sequence
GEENEWDTPEVGDEVEVHYTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein (FKBP) from wheat
publication title Crystal structure of the three FK506 binding protein domains of wheat FKBP73: evidence for a unique wFK73_2 domain
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Isomerase
total genus 62
structure length 301
sequence length 354
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jymA03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jymA02
3.30.1670.20 Alpha Beta 2-Layer Sandwich 3-mercaptopyruvate sulfurtransferase, domain 3 3-mercaptopyruvate sulfurtransferase, domain 3 3jymA01
4W9OA 4R0XA 5HW8A 4ODNA 3RFWA 3O5PA 4JYSA 1T11A 3O5EA 1J4RA 1P5QA 1YW5A 4ODKA 3KAHA 2MPHA 2FKEA 2PV2A 3O5JA 2MF9A 2JZVA 1FKRA 2ZQSA 3B7XA 4QT2A 4DROA 1L1PA 1TCOC 1FKIA 2LKNA 4ODLA 3PRBA 1FD9A 1ZK6A 3LUOA 2ZQVA 3TC5A 4G50A 2F21A 1HXVA 1FKTA 1FKFA 1C9HA 2PPOA 2UZ5A 2XPBA 4DH0A 4FAPA 4U85A 1ZCNA 2PV3A 2ZR4A 3O5FA 4JFMA 4W9PA 4GIVA 4IQ2A 4MGVA 3NI6A 4QT3A 2LJ4A 5HWCA 1FKBA 1QPLA 3O5OA 3JXVA 3MDYB 1QPFA 2DG4A 4LAWA 3KCEA 4U84A 2KE0A 3OOBA 5HKGA 3O5MA 1U79A 1BL4A 2RQSA 1N1AA 4BF8A 4ITZA 1FKKA 3JYMA 1F40A 1W26A 3GPKA 2F2DA 1FKLA 4JFJA 2FAPA 5D75A 5GPGA 4ODRA 4DZ3A 2D9FA 2XPAA 2PPPA 3UQBA 1KT0A 2MLYA 1D7IA 2OFNA 3O5IA 4JFIA 3CGMA 1J4IA 2ZR6A 4IPXA 3I6CA 3VAWA 1D6OA 5HT1A 3IK8A 2XP4A 3UQAA 5HTGA 1NSGA 4MSPA 3RGCA 4DRIA 4DT4A 2Y78A 1JVWA 4DRMA 2KGJA 3O5KA 5HWBA 3PA7A 4TX0A 1M5YA 5J6EA 1JNTA 1Q6UA 2Q5AA 2ZQTA 1J6YA 2IF4A 2M1IA 3WH0A 4TYOA 3O5GA 2F4EA 1ROUA 2L2SA 3KZ7A 3TCZA 3UI4A 5B8IC 3H9RB 3IKDA 1ROTA 1D7HA 2ITKA 1EYMA 2XP6A 3TDBA 2RUQA 1JNSA 2K8IA 3KAGA 4ODMA 3O5LA 2N87A 2KR7A 3KAFA 2KFWA 4U86A 1YATA 3UQIA 2ZQUA 3O5QA 2RUDA 1F8AB 1Q1CA 2PBCA 3O5DA 3O5RA 2DG9A 1FKSA 1NMVA 3KAIA 3NRKA 4ODPA 3UI5A 1BKFA 4FN2A 4LAVA 2XP8A 1KT1A 1J4HA 4DRJA 4G2PA 4J4OA 5HUAA 4TW6A 2RURA 2LPVA 3KABA 1FKDA 5I98A 4DZ2A 4ODOA 5HW6A 2RUCA 4DRKA 5DIUA 4ODQA 1EQ3A 2MLXA 4DRQA 3IKGA 1PBKA 1NMWA 2PV1A 3FAPA 4JFKA 1Q6IA 4DRNA 1Y0OA 2XP5A 2XP7A 4N19A 2MNTA 3NTPA 3PRDA 1D7JA 4GGQA 4NNRA 2AWGA 1Q6HA 3KADA 1FJDA 1FKHA 1FAPA 1PINA 3IHZA 4LAXA 4O2TA 5BXJA 4TW8A 4DRHA 2VN1A 4DIPA 1B6CA 1FKGA 2KI3A 3CGNA 2LGOA 3UF8A 2VCDA 2RSEA 2ZR5A 2XP9A 4W9QA 1FKJA 1R9HA 2PPNA 2DG3A 5DIVA 4TNSA 2MLZA 4LAYA 4DRPA 4QIBA 1QZ2A 2M08A 5HW7A 3EY6A 1A7XA 3KACA 4TW7A 5DITA 4IQCA 4C02B 3JYJA 2KO7A 3UI6A 2M2AA 2XP3A 4JFLA 4J4NA 3ODKA
chains in the Genus database with same CATH superfamily
4R0XA 3W4RA 3RFWA 4JYSA 3O5EA 4MPKA 4ODKA 2WM0A 2ZQSA 3B7XA 3PRBA 4G50A 4DH0A 3O5FA 3AS0A 4JFMA 4GIVA 3MDYB 4U84A 3OOBA 4PTMA 4AY1A 1HKMA 3G6LA 2RQSA 1W1PA 4BF8A 1F40A 2DSWA 3JYMA 4Z2GA 3WD0A 1FKLA 1LL6A 3UQBA 1E6RA 3WD3A 4JFIA 1JCHB 2F23A 3B9AA 1RD6A 1X6LA 3IK8A 2Y78A 1JVWA 3AS1A 4DRMA 5HWBA 2G41A 1TFVA 5J6EA 2M1IA 3O5GA 4WKAA 2F4EA 2L2SA 3UI4A 1LG1A 3OA5A 4WIWA 4NZCA 1EYMA 2RUQA 1JNSA 1ZBCA 2K8IA 3KAGA 3O5LA 3KAFA 3BMBA 1F8AB 1FFRA 1VF8A 2DG9A 1GPFA 3NRKA 1BKFA 3CHCA 3ARTA 3WKZA 4LAVA 1OGGA 1OGBA 1NWRA 3AQUA 1FKDA 1OWQA 2G8ZA 1WAWA 4ODQA 1EQ3A 2MLXA 1PBKA 2PV1A 4JFKA 4DZ2A 4WKFA 2XP5A 2XP7A 3GU0A 2MNTA 3NTPA 1E44A 1SR0A 1Q6HA 1X6NA 3KADA 4WKHA 3WL0A 1FJDA 2YBTA 5BXJA 1LJYA 4DRHA 1B6CA 2LGOA 2DT3A 2DT1A 1H0GA 1EHNA 3WQVA 1HKIA 2A3AA 1W9VA 4TW7A 1KFWA 3B9EA 3JYJA 4XAKA 2KO7A 4MNJA 1OKGA 3PRDA 2FDMA 4NSBA 3ALGA 3QOKA 5DO2A 4Q7NA 1YW5A 3KAHA 2FKEA 2MF9A 1L1PA 1TCOC 2LKNA 1ZK6A 2ZQVA 1HJVA 1FKTA 5HKGA 2PPOA 2XPBA 3BXWA 2PV3A 1LG2A 4IQ2A 1QPLA 3O5OA 3JXVA 4LAWA 3KCEA 3O5MA 1BL4A 4ITZA 1W26A 4JFJA 5GPGA 5D75A 2PPPA 2OFNA 3ARQA 3VAWA 1HJWA 3I6CA 1D6OA 2XP4A 3UQAA 3RGCA 2PI6A 2KGJA 3RM4A 4TX0A 5DEZA 1J6YA 1EIBA 5B8IC 1HKJA 3IKDA 1ROTA 1D7HA 2XP6A 3G6MA 2P4VA 4ZPWR 2ZQUA 4HARA 3O5DA 4ZPTR 3UI5A 1EDQA 3ARRA 1D2KA 2A3EA 4Z2IA 4G2PA 4J4OA 1UR9A 2B5UB 2RUCA 5DIUA 1GOIA 4Q22A 1NMWA 3FAPA 4DRNA 4NNRA 3ARVA 1D7JA 2AWGA 4HBEA 3WL1A 1PINA 2ESCA 3CZ8A 4O2TA 1FKGA 1WB0A 3CGNA 3UF8A 2VCDA 2XP9A 3PRAA 1W1TA 5DIVA 4LAYA 1ZU8A 1E6NA 2M08A 2ETNA 3EY6A 1NWUA 5DITA 1W9UA 4C02B 4ODNA 1W9PA 1NH6A 4W5UA 4W9OA 4ML4A 1T11A 1J4RA 1HJXA 2MPHA 2JZVA 1FKRA 4QT2A 4DROA 1FKIA 3FY1A 1HXVA 2UZ5A 1C9HA 1XRVA 2ZR4A 4IT6A 3NI6A 1ZBKA 4DWSA 3RMEA 4Z2HA 3ARXA 4KR0B 4Z2LA 3ALFA 1FKKA 2AOSA 2F2DA 1E6ZA 4P8UA 2MLYA 3O5IA 1J4IA 2ZR6A 3ARZA 5HT1A 1NSGA 4DT4A 3PA7A 1M5YA 1W1VA 1JNTA 1Q6UA 2Q5AA 3WIJA 2IF4A 4L3NA 4ZS6A 3WH0A 1E15A 1ROUA 3TCZA 1GRJA 2ITKA 1ZBVA 2DSZA 2KFWA 3UQIA 1YATA 2WLYA 3O5QA 2PN0A 2RUDA 2PBCA 1JNEA 3O5RA 1NWSA 1FKSA 1NWTA 4ODPA 1CTNA 4DWSC 4IT4A 3AS2A 1KT1A 4DRJA 1LQ0A 1GUVA 2A3CA 5HUAA 2RURA 2B31A 3CHDA 3RM9A 4P8XA 4DRKA 3ARYA 2OLHA 1ZBWA 1O6IA 3IKGA 4MNMA 3PR9A 4WK9A 3CHEA 3B8SA 4TW6A 1ITXA 1E9LA 1FKHA 1FAPA 3IHZA 1W1YA 2KI3A 4S3JA 2RSEA 1K9TA 2PPNA 3B9DA 3ARSA 4TNSA 4DRPA 4QIBA 3ARPA 4UDMA 4LGXA 2WLZA 5HBFA 5HW7A 3KACA 4WJXA 1HKKA 4Z2KA 5DF0A 3UI6A 1ZB5A 4MTVA 2DPEA 5HW8A 4ZPVR 3WD1A 3O5PA 1XHGA 1P5QA 3O5JA 4MNKA 4P8WA 2PV2A 4ODLA 1FD9A 3LUOA 3TC5A 4DWSD 2F21A 1FKFA 4FAPA 4U85A 1ZCNA 2QF8A 4W9PA 5GPRA 4MGVA 2IUZA 4QT3A 2LJ4A 5HWCA 1FKBA 4S3KA 1QPFA 2DG4A 2WK2A 2KE0A 1U79A 1LL7A 1N1AA 3WD4A 3CHFA 3GPKA 2DT2A 2FAPA 4ODRA 4DZ3A 2D9FA 1ZL1A 2XPAA 4MNLA 1KT0A 1JNDA 1D7IA 3AROA 3CGMA 4IPXA 4HBOA 3ARUA 5HTGA 4DRIA 4MSPA 3O5KA 2ZQTA 5GQBA 4TYOA 4Z2JA 3KZ7A 1FFQA 5JH8A 4P8VA 3H9RB 1LL4A 3TDBA 4DWSB 3GTYX 1SYTA 4ODMA 2DSUA 1E6PA 2KR7A 2N87A 3WQWA 4U86A 1Q1CA 1NMVA 3KAIA 4QZVB 4L72B 4FN2A 2O92A 2XP8A 2O9OA 3FXYA 1J4HA 4KQZA 2DSVA 2DT0A 2LPVA 3KABA 5I98A 4ODOA 5HW6A 1WNOA 4URIA 4R5EA 4DRQA 3ARWA 3RM8A 1Q6IA 1Y0OA 4N19A 4GGQA 4LAXA 4MAVA 4TW8A 3CH9A 2VN1A 2YBUA 4DIPA 3EIPA 2ZR5A 4W9QA 1FKJA 1R9HA 2DG3A 2MLZA 1QZ2A 2A3BA 2EULA 1IX5A 1A7XA 3WD2A 1UR8A 4IQCA 1H0IA 2M2AA 2XP3A 3AS3A 4JFLA 4J4NA 3ODKA
chains in the Genus database with same CATH topology
4R0XA 3W4RA 3RFWA 4JYSA 3O5EA 4MPKA 4ODKA 2WM0A 2ZQSA 3B7XA 3PRBA 4G50A 4DH0A 3O5FA 3AS0A 4JFMA 4GIVA 3MDYB 4U84A 3OOBA 4PTMA 4AY1A 1HKMA 3G6LA 2RQSA 1W1PA 4BF8A 1F40A 2DSWA 3JYMA 4Z2GA 3WD0A 1FKLA 1LL6A 3UQBA 1E6RA 3WD3A 4JFIA 3B9AA 1RD6A 1X6LA 3IK8A 2Y78A 1JVWA 3AS1A 4DRMA 5HWBA 2G41A 1TFVA 5J6EA 2M1IA 3O5GA 4WKAA 2F4EA 2L2SA 3UI4A 1LG1A 3OA5A 4WIWA 4NZCA 1EYMA 2RUQA 1JNSA 1ZBCA 2K8IA 3KAGA 3O5LA 3KAFA 1F8AB 1FFRA 1VF8A 2DG9A 1GPFA 3NRKA 1BKFA 3CHCA 3ARTA 3WKZA 4LAVA 1OGGA 1OGBA 1NWRA 3AQUA 1FKDA 1OWQA 2G8ZA 1WAWA 4ODQA 1EQ3A 2MLXA 1PBKA 2PV1A 4JFKA 4DZ2A 4WKFA 2XP5A 2XP7A 2MNTA 3NTPA 1SR0A 1Q6HA 1X6NA 3KADA 4WKHA 3WL0A 1FJDA 2YBTA 5BXJA 1LJYA 4DRHA 1B6CA 2LGOA 2DT3A 2DT1A 1H0GA 1EHNA 3WQVA 1HKIA 2A3AA 1W9VA 4TW7A 1KFWA 3B9EA 3JYJA 4XAKA 2KO7A 4MNJA 1OKGA 3PRDA 2FDMA 4NSBA 3ALGA 3QOKA 5DO2A 4Q7NA 1YW5A 3KAHA 2FKEA 2MF9A 1L1PA 1TCOC 2LKNA 1ZK6A 2ZQVA 1HJVA 1FKTA 5HKGA 2PPOA 2XPBA 3BXWA 2PV3A 1LG2A 4IQ2A 1QPLA 3O5OA 3JXVA 4LAWA 3KCEA 3O5MA 1BL4A 4ITZA 1W26A 4JFJA 5GPGA 5D75A 2PPPA 2OFNA 3ARQA 3VAWA 1HJWA 3I6CA 1D6OA 2XP4A 3UQAA 3RGCA 2PI6A 2KGJA 3RM4A 4TX0A 5DEZA 1J6YA 1EIBA 5B8IC 1HKJA 3IKDA 1ROTA 1D7HA 2XP6A 3G6MA 4ZPWR 2ZQUA 4HARA 3O5DA 4ZPTR 3UI5A 1EDQA 3ARRA 1D2KA 2A3EA 4Z2IA 4G2PA 4J4OA 1UR9A 2RUCA 5DIUA 1GOIA 4Q22A 1NMWA 3FAPA 4DRNA 4NNRA 1D7JA 3ARVA 2AWGA 4HBEA 3WL1A 1PINA 2ESCA 3CZ8A 4O2TA 1FKGA 1WB0A 3CGNA 3UF8A 2VCDA 2XP9A 3PRAA 1W1TA 5DIVA 4LAYA 1ZU8A 1E6NA 2M08A 3EY6A 1NWUA 5DITA 1W9UA 4C02B 4ODNA 1W9PA 1NH6A 4W5UA 4W9OA 4ML4A 1T11A 1J4RA 1HJXA 2MPHA 2JZVA 1FKRA 4QT2A 4DROA 1FKIA 3FY1A 1HXVA 2UZ5A 1C9HA 1XRVA 2ZR4A 4IT6A 3NI6A 1ZBKA 4DWSA 3RMEA 4Z2HA 3ARXA 4KR0B 4Z2LA 3ALFA 1FKKA 2AOSA 2F2DA 1E6ZA 4P8UA 2MLYA 3O5IA 1J4IA 2ZR6A 3ARZA 5HT1A 1NSGA 4DT4A 3PA7A 1M5YA 1W1VA 1JNTA 1Q6UA 2Q5AA 3WIJA 2IF4A 4L3NA 4ZS6A 3WH0A 1E15A 1ROUA 3TCZA 2ITKA 1ZBVA 2DSZA 2KFWA 3UQIA 1YATA 2WLYA 3O5QA 2RUDA 2PBCA 1JNEA 3O5RA 1NWSA 1FKSA 1NWTA 4ODPA 1CTNA 4DWSC 4IT4A 3AS2A 1KT1A 4DRJA 1LQ0A 1GUVA 2A3CA 5HUAA 2RURA 2B31A 3CHDA 3RM9A 4P8XA 4DRKA 3ARYA 2OLHA 1ZBWA 1O6IA 3IKGA 4MNMA 3PR9A 4WK9A 3CHEA 3B8SA 4TW6A 1ITXA 1E9LA 1FKHA 1FAPA 3IHZA 1W1YA 2KI3A 4S3JA 2RSEA 1K9TA 2PPNA 3B9DA 3ARSA 4TNSA 4DRPA 4QIBA 3ARPA 4LGXA 2WLZA 5HBFA 5HW7A 3KACA 4WJXA 1HKKA 4Z2KA 5DF0A 3UI6A 1ZB5A 4MTVA 2DPEA 5HW8A 4ZPVR 3WD1A 3O5PA 1XHGA 1P5QA 3O5JA 4MNKA 4P8WA 2PV2A 4ODLA 1FD9A 3LUOA 3TC5A 4DWSD 2F21A 1FKFA 4FAPA 4U85A 1ZCNA 2QF8A 4W9PA 5GPRA 4MGVA 2IUZA 4QT3A 2LJ4A 5HWCA 1FKBA 4S3KA 1QPFA 2DG4A 2WK2A 2KE0A 1U79A 1LL7A 1N1AA 3WD4A 3CHFA 3GPKA 2DT2A 2FAPA 4ODRA 4DZ3A 2D9FA 1ZL1A 2XPAA 4MNLA 1KT0A 1JNDA 1D7IA 3AROA 3CGMA 4IPXA 4HBOA 3ARUA 5HTGA 4DRIA 4MSPA 3O5KA 2ZQTA 5GQBA 4TYOA 4Z2JA 3KZ7A 1FFQA 5JH8A 4P8VA 3H9RB 1LL4A 3TDBA 4DWSB 1SYTA 4ODMA 2DSUA 1E6PA 2KR7A 2N87A 3WQWA 4U86A 1Q1CA 1NMVA 3KAIA 4QZVB 4L72B 4FN2A 2O92A 2XP8A 2O9OA 3FXYA 1J4HA 4KQZA 2DSVA 2DT0A 2LPVA 3KABA 5I98A 4ODOA 5HW6A 1WNOA 4URIA 4R5EA 4DRQA 3ARWA 3RM8A 1Q6IA 1Y0OA 4N19A 4GGQA 4LAXA 4MAVA 4TW8A 3CH9A 2VN1A 2YBUA 4DIPA 2ZR5A 4W9QA 1FKJA 1R9HA 2DG3A 2MLZA 1QZ2A 2A3BA 1IX5A 1A7XA 3WD2A 1UR8A 4IQCA 1H0IA 2M2AA 2XP3A 3AS3A 4JFLA 4J4NA 3ODKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9O A;  4R0X A;  5HW8 A;  4ODN A;  3RFW A;  3O5P A;  4JYS A;  1T11 A;  3O5E A;  1J4R A;  1P5Q A;  1YW5 A;  4ODK A;  3KAH A;  2MPH A;  2FKE A;  2PV2 A;  3O5J A;  2MF9 A;  2JZV A;  1FKR A;  2ZQS A;  3B7X A;  4QT2 A;  4DRO A;  1L1P A;  1TCO C;  1FKI A;  2LKN A;  4ODL A;  3PRB A;  1FD9 A;  1ZK6 A;  3LUO A;  2ZQV A;  3TC5 A;  4G50 A;  2F21 A;  1HXV A;  1FKT A;  1FKF A;  1C9H A;  2PPO A;  2UZ5 A;  2XPB A;  4DH0 A;  4FAP A;  4U85 A;  1ZCN A;  2PV3 A;  2ZR4 A;  3O5F A;  4JFM A;  4W9P A;  4GIV A;  4IQ2 A;  4MGV A;  3NI6 A;  4QT3 A;  2LJ4 A;  5HWC A;  1FKB A;  1QPL A;  3O5O A;  3JXV A;  3MDY B;  1QPF A;  2DG4 A;  4LAW A;  3KCE A;  4U84 A;  2KE0 A;  3OOB A;  5HKG A;  3O5M A;  1U79 A;  1BL4 A;  2RQS A;  1N1A A;  4BF8 A;  4ITZ A;  1FKK A;  3JYM A;  1F40 A;  1W26 A;  3GPK A;  2F2D A;  1FKL A;  4JFJ A;  2FAP A;  5D75 A;  5GPG A;  4ODR A;  4DZ3 A;  2D9F A;  2XPA A;  2PPP A;  3UQB A;  1KT0 A;  2MLY A;  1D7I A;  2OFN A;  3O5I A;  4JFI A;  3CGM A;  1J4I A;  2ZR6 A;  4IPX A;  3I6C A;  3VAW A;  1D6O A;  5HT1 A;  3IK8 A;  2XP4 A;  3UQA A;  5HTG A;  1NSG A;  4MSP A;  3RGC A;  4DRI A;  4DT4 A;  2Y78 A;  1JVW A;  4DRM A;  2KGJ A;  3O5K A;  5HWB A;  3PA7 A;  4TX0 A;  1M5Y A;  5J6E A;  1JNT A;  1Q6U A;  2Q5A A;  2ZQT A;  1J6Y A;  2IF4 A;  2M1I A;  3WH0 A;  4TYO A;  3O5G A;  2F4E A;  1ROU A;  2L2S A;  3KZ7 A;  3TCZ A;  3UI4 A;  5B8I C;  3H9R B;  3IKD A;  1ROT A;  1D7H A;  2ITK A;  1EYM A;  2XP6 A;  3TDB A;  2RUQ A;  1JNS A;  2K8I A;  3KAG A;  4ODM A;  3O5L A;  2N87 A;  2KR7 A;  3KAF A;  2KFW A;  4U86 A;  1YAT A;  3UQI A;  2ZQU A;  3O5Q A;  2RUD A;  1F8A B;  1Q1C A;  2PBC A;  3O5D A;  3O5R A;  2DG9 A;  1FKS A;  1NMV A;  3KAI A;  3NRK A;  4ODP A;  3UI5 A;  1BKF A;  4FN2 A;  4LAV A;  2XP8 A;  1KT1 A;  1J4H A;  4DRJ A;  4G2P A;  4J4O A;  5HUA A;  4TW6 A;  2RUR A;  2LPV A;  3KAB A;  1FKD A;  5I98 A;  4DZ2 A;  4ODO A;  5HW6 A;  2RUC A;  4DRK A;  5DIU A;  4ODQ A;  1EQ3 A;  2MLX A;  4DRQ A;  3IKG A;  1PBK A;  1NMW A;  2PV1 A;  3FAP A;  4JFK A;  1Q6I A;  4DRN A;  1Y0O A;  2XP5 A;  2XP7 A;  4N19 A;  2MNT A;  3NTP A;  3PRD A;  1D7J A;  4GGQ A;  4NNR A;  2AWG A;  1Q6H A;  3KAD A;  1FJD A;  1FKH A;  1FAP A;  1PIN A;  3IHZ A;  4LAX A;  4O2T A;  5BXJ A;  4TW8 A;  4DRH A;  2VN1 A;  4DIP A;  1B6C A;  1FKG A;  2KI3 A;  3CGN A;  2LGO A;  3UF8 A;  2VCD A;  2RSE A;  2ZR5 A;  2XP9 A;  4W9Q A;  1FKJ A;  1R9H A;  2PPN A;  2DG3 A;  5DIV A;  4TNS A;  2MLZ A;  4LAY A;  4DRP A;  4QIB A;  1QZ2 A;  2M08 A;  5HW7 A;  3EY6 A;  1A7X A;  3KAC A;  4TW7 A;  5DIT A;  4IQC A;  4C02 B;  3JYJ A;  2KO7 A;  3UI6 A;  2M2A A;  2XP3 A;  4JFL A;  4J4N A;  3ODK A; 
#chains in the Genus database with same CATH topology
 4R0X A;  3W4R A;  3RFW A;  4JYS A;  3O5E A;  4MPK A;  4ODK A;  2WM0 A;  2ZQS A;  3B7X A;  3PRB A;  4G50 A;  4DH0 A;  3O5F A;  3AS0 A;  4JFM A;  4GIV A;  3MDY B;  4U84 A;  3OOB A;  4PTM A;  4AY1 A;  1HKM A;  3G6L A;  2RQS A;  1W1P A;  4BF8 A;  1F40 A;  2DSW A;  3JYM A;  4Z2G A;  3WD0 A;  1FKL A;  1LL6 A;  3UQB A;  1E6R A;  3WD3 A;  4JFI A;  1JCH B;  2F23 A;  3B9A A;  1RD6 A;  1X6L A;  3IK8 A;  2Y78 A;  1JVW A;  3AS1 A;  4DRM A;  5HWB A;  2G41 A;  1TFV A;  5J6E A;  2M1I A;  3O5G A;  4WKA A;  2F4E A;  2L2S A;  3UI4 A;  1LG1 A;  3OA5 A;  4WIW A;  4NZC A;  1EYM A;  2RUQ A;  1JNS A;  1ZBC A;  2K8I A;  3KAG A;  3O5L A;  3KAF A;  3BMB A;  1F8A B;  1FFR A;  1VF8 A;  2DG9 A;  1GPF A;  3NRK A;  1BKF A;  3CHC A;  3ART A;  3WKZ A;  4LAV A;  1OGG A;  1OGB A;  1NWR A;  3AQU A;  1FKD A;  1OWQ A;  2G8Z A;  1WAW A;  4ODQ A;  1EQ3 A;  2MLX A;  1PBK A;  2PV1 A;  4JFK A;  4DZ2 A;  4WKF A;  2XP5 A;  2XP7 A;  3GU0 A;  2MNT A;  3NTP A;  1E44 A;  1SR0 A;  1Q6H A;  1X6N A;  3KAD A;  4WKH A;  3WL0 A;  1FJD A;  2YBT A;  5BXJ A;  1LJY A;  4DRH A;  1B6C A;  2LGO A;  2DT3 A;  2DT1 A;  1H0G A;  1EHN A;  3WQV A;  1HKI A;  2A3A A;  1W9V A;  4TW7 A;  1KFW A;  3B9E A;  3JYJ A;  4XAK A;  2KO7 A;  4MNJ A;  1OKG A;  3PRD A;  2FDM A;  4NSB A;  3ALG A;  3QOK A;  5DO2 A;  4Q7N A;  1YW5 A;  3KAH A;  2FKE A;  2MF9 A;  1L1P A;  1TCO C;  2LKN A;  1ZK6 A;  2ZQV A;  1HJV A;  1FKT A;  5HKG A;  2PPO A;  2XPB A;  3BXW A;  2PV3 A;  1LG2 A;  4IQ2 A;  1QPL A;  3O5O A;  3JXV A;  4LAW A;  3KCE A;  3O5M A;  1BL4 A;  4ITZ A;  1W26 A;  4JFJ A;  5GPG A;  5D75 A;  2PPP A;  2OFN A;  3ARQ A;  3VAW A;  1HJW A;  3I6C A;  1D6O A;  2XP4 A;  3UQA A;  3RGC A;  2PI6 A;  2KGJ A;  3RM4 A;  4TX0 A;  5DEZ A;  1J6Y A;  1EIB A;  5B8I C;  1HKJ A;  3IKD A;  1ROT A;  1D7H A;  2XP6 A;  3G6M A;  2P4V A;  4ZPW R;  2ZQU A;  4HAR A;  3O5D A;  4ZPT R;  3UI5 A;  1EDQ A;  3ARR A;  1D2K A;  2A3E A;  4Z2I A;  4G2P A;  4J4O A;  1UR9 A;  2B5U B;  2RUC A;  5DIU A;  1GOI A;  4Q22 A;  1NMW A;  3FAP A;  4DRN A;  4NNR A;  3ARV A;  1D7J A;  2AWG A;  4HBE A;  3WL1 A;  1PIN A;  2ESC A;  3CZ8 A;  4O2T A;  1FKG A;  1WB0 A;  3CGN A;  3UF8 A;  2VCD A;  2XP9 A;  3PRA A;  1W1T A;  5DIV A;  4LAY A;  1ZU8 A;  1E6N A;  2M08 A;  2ETN A;  3EY6 A;  1NWU A;  5DIT A;  1W9U A;  4C02 B;  4ODN A;  1W9P A;  1NH6 A;  4W5U A;  4W9O A;  4ML4 A;  1T11 A;  1J4R A;  1HJX A;  2MPH A;  2JZV A;  1FKR A;  4QT2 A;  4DRO A;  1FKI A;  3FY1 A;  1HXV A;  2UZ5 A;  1C9H A;  1XRV A;  2ZR4 A;  4IT6 A;  3NI6 A;  1ZBK A;  4DWS A;  3RME A;  4Z2H A;  3ARX A;  4KR0 B;  4Z2L A;  3ALF A;  1FKK A;  2AOS A;  2F2D A;  1E6Z A;  4P8U A;  2MLY A;  3O5I A;  1J4I A;  2ZR6 A;  3ARZ A;  5HT1 A;  1NSG A;  4DT4 A;  3PA7 A;  1M5Y A;  1W1V A;  1JNT A;  1Q6U A;  2Q5A A;  3WIJ A;  2IF4 A;  4L3N A;  4ZS6 A;  3WH0 A;  1E15 A;  1ROU A;  3TCZ A;  1GRJ A;  2ITK A;  1ZBV A;  2DSZ A;  2KFW A;  3UQI A;  1YAT A;  2WLY A;  3O5Q A;  2PN0 A;  2RUD A;  2PBC A;  1JNE A;  3O5R A;  1NWS A;  1FKS A;  1NWT A;  4ODP A;  1CTN A;  4DWS C;  4IT4 A;  3AS2 A;  1KT1 A;  4DRJ A;  1LQ0 A;  1GUV A;  2A3C A;  5HUA A;  2RUR A;  2B31 A;  3CHD A;  3RM9 A;  4P8X A;  4DRK A;  3ARY A;  2OLH A;  1ZBW A;  1O6I A;  3IKG A;  4MNM A;  3PR9 A;  4WK9 A;  3CHE A;  3B8S A;  4TW6 A;  1ITX A;  1E9L A;  1FKH A;  1FAP A;  3IHZ A;  1W1Y A;  2KI3 A;  4S3J A;  2RSE A;  1K9T A;  2PPN A;  3B9D A;  3ARS A;  4TNS A;  4DRP A;  4QIB A;  3ARP A;  4UDM A;  4LGX A;  2WLZ A;  5HBF A;  5HW7 A;  3KAC A;  4WJX A;  1HKK A;  4Z2K A;  5DF0 A;  3UI6 A;  1ZB5 A;  4MTV A;  2DPE A;  5HW8 A;  4ZPV R;  3WD1 A;  3O5P A;  1XHG A;  1P5Q A;  3O5J A;  4MNK A;  4P8W A;  2PV2 A;  4ODL A;  1FD9 A;  3LUO A;  3TC5 A;  4DWS D;  2F21 A;  1FKF A;  4FAP A;  4U85 A;  1ZCN A;  2QF8 A;  4W9P A;  5GPR A;  4MGV A;  2IUZ A;  4QT3 A;  2LJ4 A;  5HWC A;  1FKB A;  4S3K A;  1QPF A;  2DG4 A;  2WK2 A;  2KE0 A;  1U79 A;  1LL7 A;  1N1A A;  3WD4 A;  3CHF A;  3GPK A;  2DT2 A;  2FAP A;  4ODR A;  4DZ3 A;  2D9F A;  1ZL1 A;  2XPA A;  4MNL A;  1KT0 A;  1JND A;  1D7I A;  3ARO A;  3CGM A;  4IPX A;  4HBO A;  3ARU A;  5HTG A;  4DRI A;  4MSP A;  3O5K A;  2ZQT A;  5GQB A;  4TYO A;  4Z2J A;  3KZ7 A;  1FFQ A;  5JH8 A;  4P8V A;  3H9R B;  1LL4 A;  3TDB A;  4DWS B;  3GTY X;  1SYT A;  4ODM A;  2DSU A;  1E6P A;  2KR7 A;  2N87 A;  3WQW A;  4U86 A;  1Q1C A;  1NMV A;  3KAI A;  4QZV B;  4L72 B;  4FN2 A;  2O92 A;  2XP8 A;  2O9O A;  3FXY A;  1J4H A;  4KQZ A;  2DSV A;  2DT0 A;  2LPV A;  3KAB A;  5I98 A;  4ODO A;  5HW6 A;  1WNO A;  4URI A;  4R5E A;  4DRQ A;  3ARW A;  3RM8 A;  1Q6I A;  1Y0O A;  4N19 A;  4GGQ A;  4LAX A;  4MAV A;  4TW8 A;  3CH9 A;  2VN1 A;  2YBU A;  4DIP A;  3EIP A;  2ZR5 A;  4W9Q A;  1FKJ A;  1R9H A;  2DG3 A;  2MLZ A;  1QZ2 A;  2A3B A;  2EUL A;  1IX5 A;  1A7X A;  3WD2 A;  1UR8 A;  4IQC A;  1H0I A;  2M2A A;  2XP3 A;  3AS3 A;  4JFL A;  4J4N A;  3ODK A; 
#chains in the Genus database with same CATH homology
 4R0X A;  3W4R A;  3RFW A;  4JYS A;  3O5E A;  4MPK A;  4ODK A;  2WM0 A;  2ZQS A;  3B7X A;  3PRB A;  4G50 A;  4DH0 A;  3O5F A;  3AS0 A;  4JFM A;  4GIV A;  3MDY B;  4U84 A;  3OOB A;  4PTM A;  4AY1 A;  1HKM A;  3G6L A;  2RQS A;  1W1P A;  4BF8 A;  1F40 A;  2DSW A;  3JYM A;  4Z2G A;  3WD0 A;  1FKL A;  1LL6 A;  3UQB A;  1E6R A;  3WD3 A;  4JFI A;  3B9A A;  1RD6 A;  1X6L A;  3IK8 A;  2Y78 A;  1JVW A;  3AS1 A;  4DRM A;  5HWB A;  2G41 A;  1TFV A;  5J6E A;  2M1I A;  3O5G A;  4WKA A;  2F4E A;  2L2S A;  3UI4 A;  1LG1 A;  3OA5 A;  4WIW A;  4NZC A;  1EYM A;  2RUQ A;  1JNS A;  1ZBC A;  2K8I A;  3KAG A;  3O5L A;  3KAF A;  1F8A B;  1FFR A;  1VF8 A;  2DG9 A;  1GPF A;  3NRK A;  1BKF A;  3CHC A;  3ART A;  3WKZ A;  4LAV A;  1OGG A;  1OGB A;  1NWR A;  3AQU A;  1FKD A;  1OWQ A;  2G8Z A;  1WAW A;  4ODQ A;  1EQ3 A;  2MLX A;  1PBK A;  2PV1 A;  4JFK A;  4DZ2 A;  4WKF A;  2XP5 A;  2XP7 A;  2MNT A;  3NTP A;  1SR0 A;  1Q6H A;  1X6N A;  3KAD A;  4WKH A;  3WL0 A;  1FJD A;  2YBT A;  5BXJ A;  1LJY A;  4DRH A;  1B6C A;  2LGO A;  2DT3 A;  2DT1 A;  1H0G A;  1EHN A;  3WQV A;  1HKI A;  2A3A A;  1W9V A;  4TW7 A;  1KFW A;  3B9E A;  3JYJ A;  4XAK A;  2KO7 A;  4MNJ A;  1OKG A;  3PRD A;  2FDM A;  4NSB A;  3ALG A;  3QOK A;  5DO2 A;  4Q7N A;  1YW5 A;  3KAH A;  2FKE A;  2MF9 A;  1L1P A;  1TCO C;  2LKN A;  1ZK6 A;  2ZQV A;  1HJV A;  1FKT A;  5HKG A;  2PPO A;  2XPB A;  3BXW A;  2PV3 A;  1LG2 A;  4IQ2 A;  1QPL A;  3O5O A;  3JXV A;  4LAW A;  3KCE A;  3O5M A;  1BL4 A;  4ITZ A;  1W26 A;  4JFJ A;  5GPG A;  5D75 A;  2PPP A;  2OFN A;  3ARQ A;  3VAW A;  1HJW A;  3I6C A;  1D6O A;  2XP4 A;  3UQA A;  3RGC A;  2PI6 A;  2KGJ A;  3RM4 A;  4TX0 A;  5DEZ A;  1J6Y A;  1EIB A;  5B8I C;  1HKJ A;  3IKD A;  1ROT A;  1D7H A;  2XP6 A;  3G6M A;  4ZPW R;  2ZQU A;  4HAR A;  3O5D A;  4ZPT R;  3UI5 A;  1EDQ A;  3ARR A;  1D2K A;  2A3E A;  4Z2I A;  4G2P A;  4J4O A;  1UR9 A;  2RUC A;  5DIU A;  1GOI A;  4Q22 A;  1NMW A;  3FAP A;  4DRN A;  4NNR A;  1D7J A;  3ARV A;  2AWG A;  4HBE A;  3WL1 A;  1PIN A;  2ESC A;  3CZ8 A;  4O2T A;  1FKG A;  1WB0 A;  3CGN A;  3UF8 A;  2VCD A;  2XP9 A;  3PRA A;  1W1T A;  5DIV A;  4LAY A;  1ZU8 A;  1E6N A;  2M08 A;  3EY6 A;  1NWU A;  5DIT A;  1W9U A;  4C02 B;  4ODN A;  1W9P A;  1NH6 A;  4W5U A;  4W9O A;  4ML4 A;  1T11 A;  1J4R A;  1HJX A;  2MPH A;  2JZV A;  1FKR A;  4QT2 A;  4DRO A;  1FKI A;  3FY1 A;  1HXV A;  2UZ5 A;  1C9H A;  1XRV A;  2ZR4 A;  4IT6 A;  3NI6 A;  1ZBK A;  4DWS A;  3RME A;  4Z2H A;  3ARX A;  4KR0 B;  4Z2L A;  3ALF A;  1FKK A;  2AOS A;  2F2D A;  1E6Z A;  4P8U A;  2MLY A;  3O5I A;  1J4I A;  2ZR6 A;  3ARZ A;  5HT1 A;  1NSG A;  4DT4 A;  3PA7 A;  1M5Y A;  1W1V A;  1JNT A;  1Q6U A;  2Q5A A;  3WIJ A;  2IF4 A;  4L3N A;  4ZS6 A;  3WH0 A;  1E15 A;  1ROU A;  3TCZ A;  2ITK A;  1ZBV A;  2DSZ A;  2KFW A;  3UQI A;  1YAT A;  2WLY A;  3O5Q A;  2RUD A;  2PBC A;  1JNE A;  3O5R A;  1NWS A;  1FKS A;  1NWT A;  4ODP A;  1CTN A;  4DWS C;  4IT4 A;  3AS2 A;  1KT1 A;  4DRJ A;  1LQ0 A;  1GUV A;  2A3C A;  5HUA A;  2RUR A;  2B31 A;  3CHD A;  3RM9 A;  4P8X A;  4DRK A;  3ARY A;  2OLH A;  1ZBW A;  1O6I A;  3IKG A;  4MNM A;  3PR9 A;  4WK9 A;  3CHE A;  3B8S A;  4TW6 A;  1ITX A;  1E9L A;  1FKH A;  1FAP A;  3IHZ A;  1W1Y A;  2KI3 A;  4S3J A;  2RSE A;  1K9T A;  2PPN A;  3B9D A;  3ARS A;  4TNS A;  4DRP A;  4QIB A;  3ARP A;  4LGX A;  2WLZ A;  5HBF A;  5HW7 A;  3KAC A;  4WJX A;  1HKK A;  4Z2K A;  5DF0 A;  3UI6 A;  1ZB5 A;  4MTV A;  2DPE A;  5HW8 A;  4ZPV R;  3WD1 A;  3O5P A;  1XHG A;  1P5Q A;  3O5J A;  4MNK A;  4P8W A;  2PV2 A;  4ODL A;  1FD9 A;  3LUO A;  3TC5 A;  4DWS D;  2F21 A;  1FKF A;  4FAP A;  4U85 A;  1ZCN A;  2QF8 A;  4W9P A;  5GPR A;  4MGV A;  2IUZ A;  4QT3 A;  2LJ4 A;  5HWC A;  1FKB A;  4S3K A;  1QPF A;  2DG4 A;  2WK2 A;  2KE0 A;  1U79 A;  1LL7 A;  1N1A A;  3WD4 A;  3CHF A;  3GPK A;  2DT2 A;  2FAP A;  4ODR A;  4DZ3 A;  2D9F A;  1ZL1 A;  2XPA A;  4MNL A;  1KT0 A;  1JND A;  1D7I A;  3ARO A;  3CGM A;  4IPX A;  4HBO A;  3ARU A;  5HTG A;  4DRI A;  4MSP A;  3O5K A;  2ZQT A;  5GQB A;  4TYO A;  4Z2J A;  3KZ7 A;  1FFQ A;  5JH8 A;  4P8V A;  3H9R B;  1LL4 A;  3TDB A;  4DWS B;  1SYT A;  4ODM A;  2DSU A;  1E6P A;  2KR7 A;  2N87 A;  3WQW A;  4U86 A;  1Q1C A;  1NMV A;  3KAI A;  4QZV B;  4L72 B;  4FN2 A;  2O92 A;  2XP8 A;  2O9O A;  3FXY A;  1J4H A;  4KQZ A;  2DSV A;  2DT0 A;  2LPV A;  3KAB A;  5I98 A;  4ODO A;  5HW6 A;  1WNO A;  4URI A;  4R5E A;  4DRQ A;  3ARW A;  3RM8 A;  1Q6I A;  1Y0O A;  4N19 A;  4GGQ A;  4LAX A;  4MAV A;  4TW8 A;  3CH9 A;  2VN1 A;  2YBU A;  4DIP A;  2ZR5 A;  4W9Q A;  1FKJ A;  1R9H A;  2DG3 A;  2MLZ A;  1QZ2 A;  2A3B A;  1IX5 A;  1A7X A;  3WD2 A;  1UR8 A;  4IQC A;  1H0I A;  2M2A A;  2XP3 A;  3AS3 A;  4JFL A;  4J4N A;  3ODK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...