3JYMA

Crystal structure of the 3 fkbp domains of wheat fkbp73
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
354
structure length
301
Chain Sequence
GEENEWDTPEVGDEVEVHYTFKFKLGQGQVIKGWDQGIKTMKKGENALFTIPLQFDVELLSWTSVRDIAKDGGIFKKILKEGDKWENPKDPDEVFVKYEARLEDGTVVSKSEGVEFTVKDGHLCPALAKAVKTMKKGEKVLLAVKPQYGFGEMGRPAAGEGGAVPPNASLVIDLELVSWKTVTEIGDDKKILKKVLKEXEGYERPNEGAVVTVKITGKLQDGTVFLKKGHDEQEPFEFKTDEEAVIEGLDRAVLNMKKGEVALVTIPPEYAYGSTESKQDAIVPPNSTVIYEVELVSFVKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the three FK506 binding protein domains of wheat FKBP73: evidence for a unique wFK73_2 domain
pubmed doi rcsb
source organism Triticum aestivum
molecule tags Isomerase
molecule keywords FK506-binding protein (FKBP) from wheat
total genus 62
structure length 301
sequence length 354
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jymA03
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3jymA02
3.30.1670.20 Alpha Beta 2-Layer Sandwich 3-mercaptopyruvate sulfurtransferase, domain 3 3-mercaptopyruvate sulfurtransferase, domain 3 3jymA01
4LAWA 4DH0A 3ODKA 4ODQA 4MGVA 3UF8A 1FAPA 1ROTA 2MF9A 1NSGA 2RURA 2MPHA 3B7XA 3PA7A 4QT3A 4DT4A 1ZK6A 1JNSA 2VCDA 1FKHA 4ITZA 4TW8A 4TW6A 3KABA 3KZ7A 2XP3A 4QT2A 2XPAA 4QIBA 4IQCA 4TW7A 4G2PA 3TCZA 4BF8A 3UQBA 1FKBA 5GPGA 2N87A 3O5RA 1FKLA 2FKEA 4N19A 3KACA 2ZQVA 1HXVA 1TCOC 2XP4A 2KFWA 3KAIA 3O5MA 1ROUA 1EYMA 2KGJA 3O5LA 4G50A 3TC5A 1J6YA 2KE0A 4JFLA 4O2TA 4DROA 1FKKA 4DRKA 4DRQA 3NRKA 4DZ2A 4J4OA 2ZR4A 2MLXA 4U86A 1L1PA 4LAYA 1Q6UA 2RUCA 1D7HA 2RUDA 4IQ2A 1QPLA 1Q6HA 2PV2A 3LUOA 4NNRA 1F8AB 5DIUA 2K8IA 3JXVA 3EY6A 1FKDA 1QPFA 2D9FA 3O5OA 4TNSA 4ODMA 5HW7A 4J4NA 1T11A 1FD9A 2FAPA 2MNTA 5HWBA 2LGOA 4JFJA 3O5GA 5BXJA 2ZQUA 2LKNA 5B8IC 3KAGA 3O5QA 5DITA 3IK8A 3WH0A 3OOBA 4JFIA 4DIPA 2F2DA 1FKRA 2PBCA 1J4HA 2KI3A 2PV1A 2DG9A 2UZ5A 3IKDA 1Q1CA 1NMWA 1D6OA 2RQSA 1J4IA 3I6CA 1Y0OA 3VAWA 4U84A 4MSPA 1M5YA 2IF4A 4U85A 4DRIA 4LAVA 4ODLA 4DRNA 2F21A 4W9PA 2XP8A 1QZ2A 1N1AA 2PPOA 1BKFA 1KT0A 3NI6A 4ODOA 4TYOA 5HUAA 2M08A 2ZR6A 2MLYA 1KT1A 3JYJA 1C9HA 1YW5A 3KADA 2LPVA 3KCEA 1FKTA 2XP6A 1W26A 1P5QA 1YATA 3O5EA 1FKJA 2DG3A 2XPBA 2ZR5A 1B6CA 2AWGA 2ZQSA 3PRDA 5HKGA 4DRJA 4R0XA 4IPXA 1PINA 4DRPA 2RUQA 2M1IA 4ODPA 2PV3A 4TX0A 2F4EA 5HTGA 3NTPA 2XP7A 4W9QA 4W9OA 4FAPA 1FJDA 1D7IA 1R9HA 3KAHA 1PBKA 2ZQTA 4ODKA 5HT1A 1BL4A 2ITKA 3IHZA 3GPKA 4JYSA 1JVWA 2Y78A 1J4RA 2MLZA 2PPPA 3CGMA 3O5IA 2DG4A 3UQAA 5J6EA 3O5PA 4C02B 3UI6A 1JNTA 3UI5A 5I98A 3H9RB 2L2SA 4DRHA 1NMVA 3RGCA 4JFMA 3CGNA 1EQ3A 1F40A 3UI4A 3RFWA 2OFNA 5DIVA 1Q6IA 4ODNA 3O5KA 1FKIA 5HW8A 2JZVA 3MDYB 4ODRA 5HWCA 1D7JA 1FKGA 2VN1A 1U79A 1FKFA 2PPNA 3O5DA 4DRMA 3UQIA 3O5FA 2M2AA 3PRBA 2RSEA 4LAXA 2KR7A 3KAFA 5D75A 2XP5A 1FKSA 3JYMA 4GGQA 1A7XA 2KO7A 2XP9A 3IKGA 4FN2A 4GIVA 3TDBA 2LJ4A 4DZ3A 2Q5AA 3FAPA 4JFKA 3O5JA 5HW6A 1ZCNA
chains in the Genus database with same CATH superfamily
4DH0A 4XAKA 3UF8A 5HWBA 1FAPA 1ROTA 3B7XA 4DWSD 4TW6A 3KABA 3KZ7A 2XP3A 4QT2A 4TW7A 1HJWA 3TCZA 4LGXA 2N87A 3O5RA 2XP4A 1ROUA 3GTYX 1J6YA 1O6IA 1E9LA 4LAYA 1LQ0A 1NWTA 2RUDA 1QPLA 4WJXA 2PV2A 5DIUA 2K8IA 1D2KA 4P8XA 1ZB5A 4TNSA 3CHEA 2MNTA 3WQVA 2A3EA 3IK8A 2ETNA 1JNDA 3IKDA 1ZBVA 2PV1A 3ARUA 3GU0A 1D6OA 1Y0OA 5GQBA 4DRQA 4LAVA 1TFVA 1BKFA 2M08A 2MLYA 1W1TA 1C9HA 2LPVA 1W26A 1HJVA 1YATA 4WKHA 1XRVA 2ZQSA 3ARRA 3PRDA 4R0XA 4DRPA 4KR0B 2RUQA 1RD6A 2M1IA 4ODPA 1CTNA 5HTGA 4W9OA 4FAPA 1FJDA 1R9HA 4ODKA 3ARTA 3CHFA 2DSVA 1GUVA 2ITKA 3CGMA 2MLZA 5J6EA 1NWUA 5GPRA 3UI6A 5I98A 4ZPTR 4DRHA 3RGCA 2A3AA 3CGNA 1EQ3A 1HKJA 3UI4A 2OFNA 5DEZA 1Q6IA 4ODNA 1FKIA 4HBEA 1D7JA 1ZBWA 1U79A 4Q7NA 3O5DA 4KQZA 1K9TA 1UR9A 2KR7A 3KAFA 1FKSA 4GGQA 1EDQA 1W9UA 2LJ4A 3O5JA 3FY1A 4LAWA 4MGVA 2MF9A 1E6RA 1NSGA 2MPHA 3PA7A 1X6NA 1KFWA 1ZK6A 3PR9A 2DT3A 2XPAA 3UQBA 3ARWA 3WIJA 2FKEA 3KACA 3RM4A 1W9VA 3CHDA 1LJYA 4JFLA 4Q22A 1FKKA 4IT4A 4DRKA 2RUCA 1JCHB 4IQ2A 3LUOA 1OGGA 3JXVA 3PRAA 3EY6A 1QPFA 3O5OA 4L3NA 4ODMA 4J4NA 1T11A 4Z2JA 4NZCA 2LGOA 1ZU8A 1LG1A 3O5GA 2ZQUA 4Z2LA 3KAGA 1VF8A 4MNLA 4DWSB 2F2DA 2KI3A 2UZ5A 2DG9A 4ZPVR 4MTVA 1NMWA 2RQSA 3ALFA 3WL1A 4MNJA 1J4IA 3I6CA 4MSPA 3RMEA 2XP8A 4TYOA 3WD3A 4Z2IA 4QZVB 1ZBKA 1KT1A 3ARZA 1YW5A 3B9AA 3ARSA 1OGBA 1FKTA 4HBOA 3WQWA 3ARPA 1FFQA 1FKJA 3AS3A 2DSWA 4TX0A 1W1PA 1SR0A 3WD1A 4UDMA 3WD0A 4P8UA 4PTMA 5HT1A 2DT0A 4JYSA 2Y78A 1J4RA 3FXYA 1HKIA 5DF0A 4NSBA 1JNTA 1W1VA 2L2SA 1E6PA 3O5KA 2JZVA 1ZBCA 3O5FA 3PRBA 2O9OA 2OLHA 2XP5A 1GPFA 2Q5AA 3AQUA 3FAPA 2P4VA 2VCDA 4Z2GA 3CZ8A 4ODQA 4P8VA 4DT4A 1EIBA 1X6LA 4ML4A 4ITZA 4TW8A 4BF8A 2PN0A 1LL7A 1FKBA 5GPGA 4N19A 1HXVA 3ARVA 1TCOC 2KFWA 3O5LA 2KGJA 4G50A 4MPKA 2DT2A 2KE0A 4DROA 3NRKA 4DZ2A 4DWSA 1SYTA 1L1PA 2B31A 2IUZA 4WK9A 2O92A 2D9FA 3AROA 3ARYA 4DWSC 1NWSA 5HBFA 2FAPA 1FD9A 3ALGA 2WLYA 4W5UA 1E15A 2LKNA 3O5QA 5DITA 1W1YA 3OOBA 1FKRA 2PBCA 1J4HA 3CHCA 4Z2HA 3RM9A 3VAWA 4ODLA 2F21A 3WD4A 1QZ2A 1KT0A 5DO2A 5HUAA 3CH9A 1HKMA 1LL4A 1WNOA 3JYJA 3KADA 2WM0A 3KCEA 4WKFA 2XP6A 4ZS6A 1P5QA 4P8WA 2DG3A 1WB0A 2ZR5A 4URIA 2AWGA 3BXWA 4DRJA 5HKGA 2F4EA 2DSZA 3NTPA 4W9QA 2FDMA 1D7IA 3KAHA 1PBKA 1ZL1A 1HJXA 1BL4A 3IHZA 3GPKA 2YBTA 1JVWA 3UQAA 2DG4A 2DPEA 2F23A 3O5PA 4C02B 3UI5A 1NMVA 2DSUA 3AS2A 1F40A 3RFWA 5DIVA 2A3CA 3OA5A 5HW8A 3WKZA 5HWCA 1FKGA 3ARXA 1FKFA 2AOSA 3UQIA 4LAXA 1GRJA 4MNMA 2XP9A 4GIVA 1GOIA 3QOKA 4JFKA 4R5EA 1WAWA 3G6LA 1ZCNA 4IT6A 1E6NA 5HW6A 3ODKA 3BMBA 2RURA 4QT3A 1JNSA 1FKHA 1FFRA 2PI6A 5JH8A 4QIBA 4IQCA 2G8ZA 4G2PA 1UR8A 1FKLA 4Z2KA 2ZQVA 3KAIA 3O5MA 1EYMA 3TC5A 4ZPWR 4O2TA 1LL6A 4J4OA 2ZR4A 2MLXA 4U86A 1Q6UA 1D7HA 1Q6HA 1EHNA 4NNRA 1W9PA 1F8AB 1IX5A 3W4RA 1FKDA 1OKGA 4AY1A 5HW7A 4JFJA 1LG2A 5BXJA 1OWQA 5B8IC 3AS1A 1ITXA 1H0IA 3WH0A 4JFIA 4DIPA 1NWRA 1Q1CA 2WLZA 4DRIA 4U84A 4U85A 1M5YA 2EULA 2IF4A 3WL0A 3EIPA 4DRNA 4W9PA 1N1AA 2PPOA 4ODOA 3NI6A 3AS0A 2ZR6A 1E44A 2B5UB 3O5EA 2XPBA 1B6CA 4MNKA 4MAVA 4IPXA 1PINA 4L72B 3RM8A 2PV3A 2XP7A 1HKKA 2ZQTA 4WKAA 3O5IA 2PPPA 2DT1A 4S3JA 3B9EA 1E6ZA 4WIWA 3H9RB 3G6MA 4JFMA 3ARQA 2A3BA 4S3KA 4HARA 3MDYB 4ODRA 1JNEA 1NH6A 2VN1A 3B9DA 2PPNA 2QF8A 4DRMA 3B8SA 2M2AA 2ESCA 2RSEA 3WD2A 5D75A 1XHGA 3TDBA 3JYMA 4FN2A 1A7XA 1H0GA 2KO7A 3IKGA 4DZ3A 2YBUA 2WK2A 2G41A
chains in the Genus database with same CATH topology
4DH0A 4XAKA 3UF8A 5HWBA 1FAPA 1ROTA 3B7XA 4DWSD 4TW6A 3KABA 3KZ7A 2XP3A 4QT2A 4TW7A 1HJWA 3TCZA 4LGXA 2N87A 3O5RA 2XP4A 1ROUA 1J6YA 1O6IA 1E9LA 4LAYA 1LQ0A 1NWTA 2RUDA 1QPLA 4WJXA 2PV2A 5DIUA 2K8IA 1D2KA 4P8XA 1ZB5A 4TNSA 3CHEA 2MNTA 3WQVA 2A3EA 3IK8A 1JNDA 1ZBVA 2PV1A 3IKDA 3ARUA 1D6OA 1Y0OA 5GQBA 4DRQA 4LAVA 1TFVA 1BKFA 2M08A 2MLYA 1W1TA 1C9HA 2LPVA 1W26A 1HJVA 1YATA 4WKHA 1XRVA 2ZQSA 3ARRA 3PRDA 4R0XA 4DRPA 4KR0B 2RUQA 1RD6A 2M1IA 4ODPA 1CTNA 5HTGA 4W9OA 4FAPA 1FJDA 1R9HA 4ODKA 3ARTA 3CHFA 2DSVA 1GUVA 2ITKA 3CGMA 2MLZA 5J6EA 1NWUA 5GPRA 3UI6A 5I98A 4ZPTR 4DRHA 3RGCA 2A3AA 3CGNA 1EQ3A 1HKJA 3UI4A 2OFNA 5DEZA 1Q6IA 4ODNA 1FKIA 4HBEA 1D7JA 1ZBWA 1U79A 4Q7NA 3O5DA 4KQZA 1K9TA 1UR9A 2KR7A 3KAFA 1FKSA 4GGQA 1EDQA 1W9UA 2LJ4A 3O5JA 3FY1A 4LAWA 4MGVA 2MF9A 1E6RA 1NSGA 2MPHA 3PA7A 1X6NA 1KFWA 1ZK6A 3PR9A 2DT3A 2XPAA 3UQBA 3ARWA 3WIJA 2FKEA 3KACA 3RM4A 1W9VA 3CHDA 1LJYA 4JFLA 4Q22A 1FKKA 4IT4A 4DRKA 2RUCA 4IQ2A 3LUOA 1OGGA 3JXVA 3PRAA 3EY6A 1QPFA 3O5OA 4L3NA 4ODMA 4J4NA 1T11A 4Z2JA 4NZCA 2LGOA 1ZU8A 1LG1A 3O5GA 2ZQUA 4Z2LA 3KAGA 1VF8A 4MNLA 4DWSB 2F2DA 2KI3A 2UZ5A 2DG9A 4ZPVR 4MTVA 1NMWA 2RQSA 3ALFA 3WL1A 4MNJA 1J4IA 3I6CA 4MSPA 3RMEA 2XP8A 4TYOA 3WD3A 4Z2IA 4QZVB 1ZBKA 1KT1A 3ARZA 1YW5A 3B9AA 3ARSA 1OGBA 1FKTA 4HBOA 3WQWA 3ARPA 1FFQA 1FKJA 3AS3A 2DSWA 4TX0A 1W1PA 1SR0A 3WD1A 3WD0A 4P8UA 4PTMA 5HT1A 2DT0A 4JYSA 2Y78A 1J4RA 3FXYA 1HKIA 5DF0A 4NSBA 1JNTA 1W1VA 2L2SA 1E6PA 3O5KA 2JZVA 1ZBCA 3O5FA 3PRBA 2O9OA 2OLHA 2XP5A 1GPFA 2Q5AA 3AQUA 3FAPA 2VCDA 4Z2GA 3CZ8A 4ODQA 4P8VA 4DT4A 1EIBA 1X6LA 4ML4A 4ITZA 4TW8A 4BF8A 1LL7A 1FKBA 5GPGA 4N19A 1HXVA 3ARVA 1TCOC 2KFWA 3O5LA 2KGJA 4G50A 4MPKA 2DT2A 2KE0A 4DROA 3NRKA 4DZ2A 4DWSA 1SYTA 1L1PA 2B31A 2IUZA 4WK9A 2O92A 2D9FA 3AROA 3ARYA 4DWSC 1NWSA 5HBFA 2FAPA 1FD9A 3ALGA 2WLYA 4W5UA 1E15A 2LKNA 3O5QA 5DITA 1W1YA 3OOBA 1FKRA 2PBCA 1J4HA 3CHCA 4Z2HA 3RM9A 3VAWA 4ODLA 2F21A 3WD4A 1QZ2A 1KT0A 5DO2A 5HUAA 3CH9A 1HKMA 1LL4A 1WNOA 3JYJA 3KADA 2WM0A 3KCEA 4WKFA 2XP6A 4ZS6A 1P5QA 4P8WA 2DG3A 1WB0A 2ZR5A 4URIA 2AWGA 3BXWA 4DRJA 5HKGA 2F4EA 2DSZA 3NTPA 4W9QA 2FDMA 1D7IA 3KAHA 1PBKA 1ZL1A 1HJXA 1BL4A 3IHZA 3GPKA 2YBTA 1JVWA 3UQAA 2DG4A 2DPEA 3O5PA 4C02B 3UI5A 1NMVA 2DSUA 3AS2A 1F40A 3RFWA 5DIVA 2A3CA 3OA5A 5HW8A 3WKZA 5HWCA 1FKGA 3ARXA 1FKFA 2AOSA 3UQIA 4LAXA 4MNMA 2XP9A 4GIVA 1GOIA 3QOKA 4JFKA 4R5EA 1WAWA 4IT6A 3G6LA 1ZCNA 1E6NA 5HW6A 3ODKA 2RURA 4QT3A 1JNSA 1FKHA 1FFRA 2PI6A 5JH8A 4QIBA 4IQCA 2G8ZA 4G2PA 1UR8A 1FKLA 4Z2KA 2ZQVA 3KAIA 3O5MA 1EYMA 3TC5A 4ZPWR 4O2TA 1LL6A 4J4OA 2ZR4A 2MLXA 4U86A 1Q6UA 1D7HA 1Q6HA 1EHNA 4NNRA 1W9PA 1F8AB 1IX5A 3W4RA 1FKDA 1OKGA 4AY1A 5HW7A 4JFJA 1LG2A 5BXJA 1OWQA 5B8IC 3AS1A 1ITXA 1H0IA 3WH0A 4JFIA 4DIPA 1NWRA 1Q1CA 2WLZA 4DRIA 4U84A 4U85A 1M5YA 2IF4A 4DRNA 3WL0A 4W9PA 1N1AA 2PPOA 4ODOA 3NI6A 3AS0A 2ZR6A 3O5EA 2XPBA 1B6CA 4MNKA 4MAVA 4IPXA 1PINA 4L72B 3RM8A 2PV3A 2XP7A 1HKKA 2ZQTA 4WKAA 3O5IA 2PPPA 2DT1A 4S3JA 3B9EA 1E6ZA 4WIWA 3H9RB 3G6MA 4JFMA 3ARQA 2A3BA 4S3KA 4HARA 3MDYB 4ODRA 1JNEA 1NH6A 2VN1A 3B9DA 2PPNA 2QF8A 4DRMA 3B8SA 2M2AA 2ESCA 2RSEA 3WD2A 5D75A 1XHGA 3TDBA 3JYMA 4FN2A 1A7XA 1H0GA 2KO7A 3IKGA 4DZ3A 2YBUA 2WK2A 2G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAW A;  4DH0 A;  3ODK A;  4ODQ A;  4MGV A;  3UF8 A;  1FAP A;  1ROT A;  2MF9 A;  1NSG A;  2RUR A;  2MPH A;  3B7X A;  3PA7 A;  4QT3 A;  4DT4 A;  1ZK6 A;  1JNS A;  2VCD A;  1FKH A;  4ITZ A;  4TW8 A;  4TW6 A;  3KAB A;  3KZ7 A;  2XP3 A;  4QT2 A;  2XPA A;  4QIB A;  4IQC A;  4TW7 A;  4G2P A;  3TCZ A;  4BF8 A;  3UQB A;  1FKB A;  5GPG A;  2N87 A;  3O5R A;  1FKL A;  2FKE A;  4N19 A;  3KAC A;  2ZQV A;  1HXV A;  1TCO C;  2XP4 A;  2KFW A;  3KAI A;  3O5M A;  1ROU A;  1EYM A;  2KGJ A;  3O5L A;  4G50 A;  3TC5 A;  1J6Y A;  2KE0 A;  4JFL A;  4O2T A;  4DRO A;  1FKK A;  4DRK A;  4DRQ A;  3NRK A;  4DZ2 A;  4J4O A;  2ZR4 A;  2MLX A;  4U86 A;  1L1P A;  4LAY A;  1Q6U A;  2RUC A;  1D7H A;  2RUD A;  4IQ2 A;  1QPL A;  1Q6H A;  2PV2 A;  3LUO A;  4NNR A;  1F8A B;  5DIU A;  2K8I A;  3JXV A;  3EY6 A;  1FKD A;  1QPF A;  2D9F A;  3O5O A;  4TNS A;  4ODM A;  5HW7 A;  4J4N A;  1T11 A;  1FD9 A;  2FAP A;  2MNT A;  5HWB A;  2LGO A;  4JFJ A;  3O5G A;  5BXJ A;  2ZQU A;  2LKN A;  5B8I C;  3KAG A;  3O5Q A;  5DIT A;  3IK8 A;  3WH0 A;  3OOB A;  4JFI A;  4DIP A;  2F2D A;  1FKR A;  2PBC A;  1J4H A;  2KI3 A;  2PV1 A;  2DG9 A;  2UZ5 A;  3IKD A;  1Q1C A;  1NMW A;  1D6O A;  2RQS A;  1J4I A;  3I6C A;  1Y0O A;  3VAW A;  4U84 A;  4MSP A;  1M5Y A;  2IF4 A;  4U85 A;  4DRI A;  4LAV A;  4ODL A;  4DRN A;  2F21 A;  4W9P A;  2XP8 A;  1QZ2 A;  1N1A A;  2PPO A;  1BKF A;  1KT0 A;  3NI6 A;  4ODO A;  4TYO A;  5HUA A;  2M08 A;  2ZR6 A;  2MLY A;  1KT1 A;  3JYJ A;  1C9H A;  1YW5 A;  3KAD A;  2LPV A;  3KCE A;  1FKT A;  2XP6 A;  1W26 A;  1P5Q A;  1YAT A;  3O5E A;  1FKJ A;  2DG3 A;  2XPB A;  2ZR5 A;  1B6C A;  2AWG A;  2ZQS A;  3PRD A;  5HKG A;  4DRJ A;  4R0X A;  4IPX A;  1PIN A;  4DRP A;  2RUQ A;  2M1I A;  4ODP A;  2PV3 A;  4TX0 A;  2F4E A;  5HTG A;  3NTP A;  2XP7 A;  4W9Q A;  4W9O A;  4FAP A;  1FJD A;  1D7I A;  1R9H A;  3KAH A;  1PBK A;  2ZQT A;  4ODK A;  5HT1 A;  1BL4 A;  2ITK A;  3IHZ A;  3GPK A;  4JYS A;  1JVW A;  2Y78 A;  1J4R A;  2MLZ A;  2PPP A;  3CGM A;  3O5I A;  2DG4 A;  3UQA A;  5J6E A;  3O5P A;  4C02 B;  3UI6 A;  1JNT A;  3UI5 A;  5I98 A;  3H9R B;  2L2S A;  4DRH A;  1NMV A;  3RGC A;  4JFM A;  3CGN A;  1EQ3 A;  1F40 A;  3UI4 A;  3RFW A;  2OFN A;  5DIV A;  1Q6I A;  4ODN A;  3O5K A;  1FKI A;  5HW8 A;  2JZV A;  3MDY B;  4ODR A;  5HWC A;  1D7J A;  1FKG A;  2VN1 A;  1U79 A;  1FKF A;  2PPN A;  3O5D A;  4DRM A;  3UQI A;  3O5F A;  2M2A A;  3PRB A;  2RSE A;  4LAX A;  2KR7 A;  3KAF A;  5D75 A;  2XP5 A;  1FKS A;  3JYM A;  4GGQ A;  1A7X A;  2KO7 A;  2XP9 A;  3IKG A;  4FN2 A;  4GIV A;  3TDB A;  2LJ4 A;  4DZ3 A;  2Q5A A;  3FAP A;  4JFK A;  3O5J A;  5HW6 A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 4DH0 A;  4XAK A;  3UF8 A;  5HWB A;  1FAP A;  1ROT A;  3B7X A;  4DWS D;  4TW6 A;  3KAB A;  3KZ7 A;  2XP3 A;  4QT2 A;  4TW7 A;  1HJW A;  3TCZ A;  4LGX A;  2N87 A;  3O5R A;  2XP4 A;  1ROU A;  3GTY X;  1J6Y A;  1O6I A;  1E9L A;  4LAY A;  1LQ0 A;  1NWT A;  2RUD A;  1QPL A;  4WJX A;  2PV2 A;  5DIU A;  2K8I A;  1D2K A;  4P8X A;  1ZB5 A;  4TNS A;  3CHE A;  2MNT A;  3WQV A;  2A3E A;  3IK8 A;  2ETN A;  1JND A;  3IKD A;  1ZBV A;  2PV1 A;  3ARU A;  3GU0 A;  1D6O A;  1Y0O A;  5GQB A;  4DRQ A;  4LAV A;  1TFV A;  1BKF A;  2M08 A;  2MLY A;  1W1T A;  1C9H A;  2LPV A;  1W26 A;  1HJV A;  1YAT A;  4WKH A;  1XRV A;  2ZQS A;  3ARR A;  3PRD A;  4R0X A;  4DRP A;  4KR0 B;  2RUQ A;  1RD6 A;  2M1I A;  4ODP A;  1CTN A;  5HTG A;  4W9O A;  4FAP A;  1FJD A;  1R9H A;  4ODK A;  3ART A;  3CHF A;  2DSV A;  1GUV A;  2ITK A;  3CGM A;  2MLZ A;  5J6E A;  1NWU A;  5GPR A;  3UI6 A;  5I98 A;  4ZPT R;  4DRH A;  3RGC A;  2A3A A;  3CGN A;  1EQ3 A;  1HKJ A;  3UI4 A;  2OFN A;  5DEZ A;  1Q6I A;  4ODN A;  1FKI A;  4HBE A;  1D7J A;  1ZBW A;  1U79 A;  4Q7N A;  3O5D A;  4KQZ A;  1K9T A;  1UR9 A;  2KR7 A;  3KAF A;  1FKS A;  4GGQ A;  1EDQ A;  1W9U A;  2LJ4 A;  3O5J A;  3FY1 A;  4LAW A;  4MGV A;  2MF9 A;  1E6R A;  1NSG A;  2MPH A;  3PA7 A;  1X6N A;  1KFW A;  1ZK6 A;  3PR9 A;  2DT3 A;  2XPA A;  3UQB A;  3ARW A;  3WIJ A;  2FKE A;  3KAC A;  3RM4 A;  1W9V A;  3CHD A;  1LJY A;  4JFL A;  4Q22 A;  1FKK A;  4IT4 A;  4DRK A;  2RUC A;  1JCH B;  4IQ2 A;  3LUO A;  1OGG A;  3JXV A;  3PRA A;  3EY6 A;  1QPF A;  3O5O A;  4L3N A;  4ODM A;  4J4N A;  1T11 A;  4Z2J A;  4NZC A;  2LGO A;  1ZU8 A;  1LG1 A;  3O5G A;  2ZQU A;  4Z2L A;  3KAG A;  1VF8 A;  4MNL A;  4DWS B;  2F2D A;  2KI3 A;  2UZ5 A;  2DG9 A;  4ZPV R;  4MTV A;  1NMW A;  2RQS A;  3ALF A;  3WL1 A;  4MNJ A;  1J4I A;  3I6C A;  4MSP A;  3RME A;  2XP8 A;  4TYO A;  3WD3 A;  4Z2I A;  4QZV B;  1ZBK A;  1KT1 A;  3ARZ A;  1YW5 A;  3B9A A;  3ARS A;  1OGB A;  1FKT A;  4HBO A;  3WQW A;  3ARP A;  1FFQ A;  1FKJ A;  3AS3 A;  2DSW A;  4TX0 A;  1W1P A;  1SR0 A;  3WD1 A;  4UDM A;  3WD0 A;  4P8U A;  4PTM A;  5HT1 A;  2DT0 A;  4JYS A;  2Y78 A;  1J4R A;  3FXY A;  1HKI A;  5DF0 A;  4NSB A;  1JNT A;  1W1V A;  2L2S A;  1E6P A;  3O5K A;  2JZV A;  1ZBC A;  3O5F A;  3PRB A;  2O9O A;  2OLH A;  2XP5 A;  1GPF A;  2Q5A A;  3AQU A;  3FAP A;  2P4V A;  2VCD A;  4Z2G A;  3CZ8 A;  4ODQ A;  4P8V A;  4DT4 A;  1EIB A;  1X6L A;  4ML4 A;  4ITZ A;  4TW8 A;  4BF8 A;  2PN0 A;  1LL7 A;  1FKB A;  5GPG A;  4N19 A;  1HXV A;  3ARV A;  1TCO C;  2KFW A;  3O5L A;  2KGJ A;  4G50 A;  4MPK A;  2DT2 A;  2KE0 A;  4DRO A;  3NRK A;  4DZ2 A;  4DWS A;  1SYT A;  1L1P A;  2B31 A;  2IUZ A;  4WK9 A;  2O92 A;  2D9F A;  3ARO A;  3ARY A;  4DWS C;  1NWS A;  5HBF A;  2FAP A;  1FD9 A;  3ALG A;  2WLY A;  4W5U A;  1E15 A;  2LKN A;  3O5Q A;  5DIT A;  1W1Y A;  3OOB A;  1FKR A;  2PBC A;  1J4H A;  3CHC A;  4Z2H A;  3RM9 A;  3VAW A;  4ODL A;  2F21 A;  3WD4 A;  1QZ2 A;  1KT0 A;  5DO2 A;  5HUA A;  3CH9 A;  1HKM A;  1LL4 A;  1WNO A;  3JYJ A;  3KAD A;  2WM0 A;  3KCE A;  4WKF A;  2XP6 A;  4ZS6 A;  1P5Q A;  4P8W A;  2DG3 A;  1WB0 A;  2ZR5 A;  4URI A;  2AWG A;  3BXW A;  4DRJ A;  5HKG A;  2F4E A;  2DSZ A;  3NTP A;  4W9Q A;  2FDM A;  1D7I A;  3KAH A;  1PBK A;  1ZL1 A;  1HJX A;  1BL4 A;  3IHZ A;  3GPK A;  2YBT A;  1JVW A;  3UQA A;  2DG4 A;  2DPE A;  2F23 A;  3O5P A;  4C02 B;  3UI5 A;  1NMV A;  2DSU A;  3AS2 A;  1F40 A;  3RFW A;  5DIV A;  2A3C A;  3OA5 A;  5HW8 A;  3WKZ A;  5HWC A;  1FKG A;  3ARX A;  1FKF A;  2AOS A;  3UQI A;  4LAX A;  1GRJ A;  4MNM A;  2XP9 A;  4GIV A;  1GOI A;  3QOK A;  4JFK A;  4R5E A;  1WAW A;  3G6L A;  1ZCN A;  4IT6 A;  1E6N A;  5HW6 A;  3ODK A;  3BMB A;  2RUR A;  4QT3 A;  1JNS A;  1FKH A;  1FFR A;  2PI6 A;  5JH8 A;  4QIB A;  4IQC A;  2G8Z A;  4G2P A;  1UR8 A;  1FKL A;  4Z2K A;  2ZQV A;  3KAI A;  3O5M A;  1EYM A;  3TC5 A;  4ZPW R;  4O2T A;  1LL6 A;  4J4O A;  2ZR4 A;  2MLX A;  4U86 A;  1Q6U A;  1D7H A;  1Q6H A;  1EHN A;  4NNR A;  1W9P A;  1F8A B;  1IX5 A;  3W4R A;  1FKD A;  1OKG A;  4AY1 A;  5HW7 A;  4JFJ A;  1LG2 A;  5BXJ A;  1OWQ A;  5B8I C;  3AS1 A;  1ITX A;  1H0I A;  3WH0 A;  4JFI A;  4DIP A;  1NWR A;  1Q1C A;  2WLZ A;  4DRI A;  4U84 A;  4U85 A;  1M5Y A;  2EUL A;  2IF4 A;  3WL0 A;  3EIP A;  4DRN A;  4W9P A;  1N1A A;  2PPO A;  4ODO A;  3NI6 A;  3AS0 A;  2ZR6 A;  1E44 A;  2B5U B;  3O5E A;  2XPB A;  1B6C A;  4MNK A;  4MAV A;  4IPX A;  1PIN A;  4L72 B;  3RM8 A;  2PV3 A;  2XP7 A;  1HKK A;  2ZQT A;  4WKA A;  3O5I A;  2PPP A;  2DT1 A;  4S3J A;  3B9E A;  1E6Z A;  4WIW A;  3H9R B;  3G6M A;  4JFM A;  3ARQ A;  2A3B A;  4S3K A;  4HAR A;  3MDY B;  4ODR A;  1JNE A;  1NH6 A;  2VN1 A;  3B9D A;  2PPN A;  2QF8 A;  4DRM A;  3B8S A;  2M2A A;  2ESC A;  2RSE A;  3WD2 A;  5D75 A;  1XHG A;  3TDB A;  3JYM A;  4FN2 A;  1A7X A;  1H0G A;  2KO7 A;  3IKG A;  4DZ3 A;  2YBU A;  2WK2 A;  2G41 A; 
#chains in the Genus database with same CATH homology
 4DH0 A;  4XAK A;  3UF8 A;  5HWB A;  1FAP A;  1ROT A;  3B7X A;  4DWS D;  4TW6 A;  3KAB A;  3KZ7 A;  2XP3 A;  4QT2 A;  4TW7 A;  1HJW A;  3TCZ A;  4LGX A;  2N87 A;  3O5R A;  2XP4 A;  1ROU A;  1J6Y A;  1O6I A;  1E9L A;  4LAY A;  1LQ0 A;  1NWT A;  2RUD A;  1QPL A;  4WJX A;  2PV2 A;  5DIU A;  2K8I A;  1D2K A;  4P8X A;  1ZB5 A;  4TNS A;  3CHE A;  2MNT A;  3WQV A;  2A3E A;  3IK8 A;  1JND A;  1ZBV A;  2PV1 A;  3IKD A;  3ARU A;  1D6O A;  1Y0O A;  5GQB A;  4DRQ A;  4LAV A;  1TFV A;  1BKF A;  2M08 A;  2MLY A;  1W1T A;  1C9H A;  2LPV A;  1W26 A;  1HJV A;  1YAT A;  4WKH A;  1XRV A;  2ZQS A;  3ARR A;  3PRD A;  4R0X A;  4DRP A;  4KR0 B;  2RUQ A;  1RD6 A;  2M1I A;  4ODP A;  1CTN A;  5HTG A;  4W9O A;  4FAP A;  1FJD A;  1R9H A;  4ODK A;  3ART A;  3CHF A;  2DSV A;  1GUV A;  2ITK A;  3CGM A;  2MLZ A;  5J6E A;  1NWU A;  5GPR A;  3UI6 A;  5I98 A;  4ZPT R;  4DRH A;  3RGC A;  2A3A A;  3CGN A;  1EQ3 A;  1HKJ A;  3UI4 A;  2OFN A;  5DEZ A;  1Q6I A;  4ODN A;  1FKI A;  4HBE A;  1D7J A;  1ZBW A;  1U79 A;  4Q7N A;  3O5D A;  4KQZ A;  1K9T A;  1UR9 A;  2KR7 A;  3KAF A;  1FKS A;  4GGQ A;  1EDQ A;  1W9U A;  2LJ4 A;  3O5J A;  3FY1 A;  4LAW A;  4MGV A;  2MF9 A;  1E6R A;  1NSG A;  2MPH A;  3PA7 A;  1X6N A;  1KFW A;  1ZK6 A;  3PR9 A;  2DT3 A;  2XPA A;  3UQB A;  3ARW A;  3WIJ A;  2FKE A;  3KAC A;  3RM4 A;  1W9V A;  3CHD A;  1LJY A;  4JFL A;  4Q22 A;  1FKK A;  4IT4 A;  4DRK A;  2RUC A;  4IQ2 A;  3LUO A;  1OGG A;  3JXV A;  3PRA A;  3EY6 A;  1QPF A;  3O5O A;  4L3N A;  4ODM A;  4J4N A;  1T11 A;  4Z2J A;  4NZC A;  2LGO A;  1ZU8 A;  1LG1 A;  3O5G A;  2ZQU A;  4Z2L A;  3KAG A;  1VF8 A;  4MNL A;  4DWS B;  2F2D A;  2KI3 A;  2UZ5 A;  2DG9 A;  4ZPV R;  4MTV A;  1NMW A;  2RQS A;  3ALF A;  3WL1 A;  4MNJ A;  1J4I A;  3I6C A;  4MSP A;  3RME A;  2XP8 A;  4TYO A;  3WD3 A;  4Z2I A;  4QZV B;  1ZBK A;  1KT1 A;  3ARZ A;  1YW5 A;  3B9A A;  3ARS A;  1OGB A;  1FKT A;  4HBO A;  3WQW A;  3ARP A;  1FFQ A;  1FKJ A;  3AS3 A;  2DSW A;  4TX0 A;  1W1P A;  1SR0 A;  3WD1 A;  3WD0 A;  4P8U A;  4PTM A;  5HT1 A;  2DT0 A;  4JYS A;  2Y78 A;  1J4R A;  3FXY A;  1HKI A;  5DF0 A;  4NSB A;  1JNT A;  1W1V A;  2L2S A;  1E6P A;  3O5K A;  2JZV A;  1ZBC A;  3O5F A;  3PRB A;  2O9O A;  2OLH A;  2XP5 A;  1GPF A;  2Q5A A;  3AQU A;  3FAP A;  2VCD A;  4Z2G A;  3CZ8 A;  4ODQ A;  4P8V A;  4DT4 A;  1EIB A;  1X6L A;  4ML4 A;  4ITZ A;  4TW8 A;  4BF8 A;  1LL7 A;  1FKB A;  5GPG A;  4N19 A;  1HXV A;  3ARV A;  1TCO C;  2KFW A;  3O5L A;  2KGJ A;  4G50 A;  4MPK A;  2DT2 A;  2KE0 A;  4DRO A;  3NRK A;  4DZ2 A;  4DWS A;  1SYT A;  1L1P A;  2B31 A;  2IUZ A;  4WK9 A;  2O92 A;  2D9F A;  3ARO A;  3ARY A;  4DWS C;  1NWS A;  5HBF A;  2FAP A;  1FD9 A;  3ALG A;  2WLY A;  4W5U A;  1E15 A;  2LKN A;  3O5Q A;  5DIT A;  1W1Y A;  3OOB A;  1FKR A;  2PBC A;  1J4H A;  3CHC A;  4Z2H A;  3RM9 A;  3VAW A;  4ODL A;  2F21 A;  3WD4 A;  1QZ2 A;  1KT0 A;  5DO2 A;  5HUA A;  3CH9 A;  1HKM A;  1LL4 A;  1WNO A;  3JYJ A;  3KAD A;  2WM0 A;  3KCE A;  4WKF A;  2XP6 A;  4ZS6 A;  1P5Q A;  4P8W A;  2DG3 A;  1WB0 A;  2ZR5 A;  4URI A;  2AWG A;  3BXW A;  4DRJ A;  5HKG A;  2F4E A;  2DSZ A;  3NTP A;  4W9Q A;  2FDM A;  1D7I A;  3KAH A;  1PBK A;  1ZL1 A;  1HJX A;  1BL4 A;  3IHZ A;  3GPK A;  2YBT A;  1JVW A;  3UQA A;  2DG4 A;  2DPE A;  3O5P A;  4C02 B;  3UI5 A;  1NMV A;  2DSU A;  3AS2 A;  1F40 A;  3RFW A;  5DIV A;  2A3C A;  3OA5 A;  5HW8 A;  3WKZ A;  5HWC A;  1FKG A;  3ARX A;  1FKF A;  2AOS A;  3UQI A;  4LAX A;  4MNM A;  2XP9 A;  4GIV A;  1GOI A;  3QOK A;  4JFK A;  4R5E A;  1WAW A;  4IT6 A;  3G6L A;  1ZCN A;  1E6N A;  5HW6 A;  3ODK A;  2RUR A;  4QT3 A;  1JNS A;  1FKH A;  1FFR A;  2PI6 A;  5JH8 A;  4QIB A;  4IQC A;  2G8Z A;  4G2P A;  1UR8 A;  1FKL A;  4Z2K A;  2ZQV A;  3KAI A;  3O5M A;  1EYM A;  3TC5 A;  4ZPW R;  4O2T A;  1LL6 A;  4J4O A;  2ZR4 A;  2MLX A;  4U86 A;  1Q6U A;  1D7H A;  1Q6H A;  1EHN A;  4NNR A;  1W9P A;  1F8A B;  1IX5 A;  3W4R A;  1FKD A;  1OKG A;  4AY1 A;  5HW7 A;  4JFJ A;  1LG2 A;  5BXJ A;  1OWQ A;  5B8I C;  3AS1 A;  1ITX A;  1H0I A;  3WH0 A;  4JFI A;  4DIP A;  1NWR A;  1Q1C A;  2WLZ A;  4DRI A;  4U84 A;  4U85 A;  1M5Y A;  2IF4 A;  4DRN A;  3WL0 A;  4W9P A;  1N1A A;  2PPO A;  4ODO A;  3NI6 A;  3AS0 A;  2ZR6 A;  3O5E A;  2XPB A;  1B6C A;  4MNK A;  4MAV A;  4IPX A;  1PIN A;  4L72 B;  3RM8 A;  2PV3 A;  2XP7 A;  1HKK A;  2ZQT A;  4WKA A;  3O5I A;  2PPP A;  2DT1 A;  4S3J A;  3B9E A;  1E6Z A;  4WIW A;  3H9R B;  3G6M A;  4JFM A;  3ARQ A;  2A3B A;  4S3K A;  4HAR A;  3MDY B;  4ODR A;  1JNE A;  1NH6 A;  2VN1 A;  3B9D A;  2PPN A;  2QF8 A;  4DRM A;  3B8S A;  2M2A A;  2ESC A;  2RSE A;  3WD2 A;  5D75 A;  1XHG A;  3TDB A;  3JYM A;  4FN2 A;  1A7X A;  1H0G A;  2KO7 A;  3IKG A;  4DZ3 A;  2YBU A;  2WK2 A;  2G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...