3JYUA

Crystal structure of the n-terminal domains of the ubiquitin specific peptidase 4 (usp4)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
SRERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDGTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase
publication title Crystal structure of the N-terminal domains of the ubiquitin specific peptidase 4 (USP4)
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 58
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3jyuA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3jyuA01
2KVRA 5HKHA 2W9NA 3MTNB 4W9GA 2CKHB 4EZJA 2REXA 3A9KB 1R4NI 1LFDA 4DXAB 1JRUA 1U4AA 1ZKHA 4MGIE 3ZDTA 4F8CB 3IBEA 2L7RA 2EMSA 4IM2A 4W9IA 1GC6A 5KHQA 1M94A 3ZNHB 4NY0A 2XK5A 3KYCD 1IP9A 4EZLA 4N9F4 4PS3A 2NPTB 4WQOB 1Z2MA 2GOWA 4BBNC 3WAOA 2JT4B 1L2NA 2CHWA 4YL8A 2MP2A 1X1MA 4K1RB 4ICUA 4XZ4A 3IVFA 1RFAA 4ANXA 2K8HA 1H4RA 4HJKA 3ZRFA 4W9JA 1VD2A 3B08A 3GZNI 3T8MA 1GG3A 2A4ZA 2LGYA 1TGZB 1V80A 2Z59B 2LJ5A 4GOCA 4W9HA 1C3TA 4W9CA 3PRMB 3KVFB 3U7DA 3ECIA 5FR6A 3QQ8B 5JZEB 1WJUA 3SHQA 1P98A 2MBQA 1WM3A 2MLBA 5E6OA 4CHKA 2FCQA 3QWZB 2PEAA 4G0NB 4MGYE 3TCAA 1XD3B 3PRZA 2BYEA 3TL5A 1KLVA 4KZCA 1WGHA 1WY8A 4DWFA 1MG8A 3L0WB 2L3ZA 2KK8A 1E5WA 1RLFA 2GBKA 1J0GA 1AARA 3JSVA 3KUCB 1P1AA 1NDDA 2JY6A 4GIVA 4MJSA 3PVLA 2DZJA 2GBNA 2DZIA 5E6NA 1CMXB 2KN5A 3VUXA 4ZDVA 3M3JA 4TQ1A 3L08A 1S1QB 5GMVA 4A3PA 2PPHA 2BPSA 3RCZA 5AEKB 3L17A 2FIDA 4IW0A 4DDID 1GJZA 1F9JA 4FLHA 4WJOA 2JZZA 3VTWA 2KLCA 5CHWA 4AJWA 4B9KA 2G4SA 1E8YA 1TZ1A 2G3QB 1J19A 1WF9A 2JWZA 3H1UA 2EMTA 3VVWB 4BKGA 2XBBC 5EDSA 3O65B 5E6PA 4EOYA 2G45B 4LJPB 2LGDA 1KJTA 2MRPA 2N7DA 2BWES 5CTRC 2KTRB 2M0XA 3WAMA 4II2B 4FJZA 1WRDB 4KIKA 4DHJB 4EUTA 2MSED 2JZ3B 4LDTB 1WIAA 4PS7A 4ANUA 2WWZA 3VTVA 1KM7A 2DYMA 3V61A 2C9WB 2KDIA 3D32A 2L00B 2N7EA 3R7RA 4W9FA 4LJOB 1WX8A 3WIMA 4IM3A 4GB9A 2ZEQA 4MGZE 3H7SA 2WX1A 2AWTA 2AL6A 3WA0A 1SE9A 3RZFA 4IWPA 3OLMD 2AL3A 4OVVA 5KHOA 3CSTA 2DZKA 4MH0E 3WAPA 2N4FA 3CF6E 4DHJD 3PV1A 1EUVB 2CHZA 4TV3A 5IA7A 3PSEB 4BOZB 3V60A 4HCPB 2BKRB 3AXCA 3ONSA 3SDLC 3U30A 1BT0A 2KO3A 1Z5SB 3ALBA 3KH0A 1A5RA 5JHBA 1LXDA 3APDA 1RRBA 4A20A 1PQSA 2LASA 3M62B 3A9KA 2IO1B 4EKUA 4AWJA 1UGMA 2EKEC 3LJ3A 2IO0B 3ZW3A 2MBHA 3MHSD 5C23A 3BINA 3JVZX 3H6NA 3PREA 5AZFA 4FA6A 1WXSA 3Q3FA 5CHFA 4ANVA 2K6QA 2NPTA 3H9DA 4HPMB 2KX3A 2V1YA 4KSLC 3N32A 1WH3A 4JL9A 2BF8B 4DHZE 2FIFA 3ZNZB 1E8WA 3PPAA 5TR5A 1WMHB 2PJHA 2K39A 5DPSA 2GBMA 2N9PC 1WE6A 1GNUA 2LRUA 2UWQA 2KQ7A 4HPLB 3JW0X 4HDOA 2D3GA 4W9DA 3GOEA 1UBQA 3PLVA 3PGEA 4IWOA 2LVOA 2KJRA 2NBUA 3KYDD 4KDLB 2L05A 1VCBA 1OGWA 2MBEA 4NJ7A 1V49A 4WAAA 3DVGX 1WZ0A 3VAWA 2J0JA 1R4MI 3ML9A 3K9OB 3PRPB 1WXMA 2Y5BB 4GMVA 4ZRIA 3RULA 3W1YA 2ZZPB 3PS6A 4GDLB 3ZDMC 4JLCA 3AULA 2OJRA 3ZNID 3UGBB 3WANA 4AJYB 1J8CA 1EO6A 2O6VD 3QAQA 3ZVVA 1NI2A 2MCNB 5J2RA 1L7YA 1WR6E 2FCNA 2HTHA 1WE7A 3UIOB 3DBSA 4I6PA 4URKA 2DX5B 3TMPB 2C5LC 2M1MA 1E7VA 4ZRKA 3B1LX 2DYOA 3RZWC 1V6EA 4XC2A 4IC7B 1D3ZA 3RD2A 3QHTA 3DPDA 2J0KA 3DBLI 3HM6X 2KTRA 5BO4B 1H8CA 2KFKA 4LCDE 2AEHA 4M8NA 1EF5A 4GDKB 4XX5A 3IFWB 2L76A 3IHPC 5L95C 3DOWA 3DVGY 3V6EB 2LXAA 4GU2A 3S2AA 4NQLB 2V4LA 2CS4A 3VH4B 4X57B 1KOTA 3P2BA 5IAAC 3TIXA 3EFUA 4BKSD 4ANWA 3NZSA 3PHXB 2BWFA 1YX6B 1GC7A 2FCSA 3B0AA 4FBJB 4NQKE 1WFYA 1XT9B 2K8CA 4MELA 2IY0B 1WZ3A 3EECA 1E8XA 2K6DB 5D94A 2KC2A 4CO7A 1E7UA 1OEYJ 3ZLZA 4RMAA 4E3CA 2LI5A 4TUUA 2KDFB 2NR2A 1HE8A 4HWIB 2HE7A 4A3OA 2KQSA 3H7PA 2C7HA 1ZW7A 1XQQA 1V5OA 3A1QB 2KMAA 5AZGA 3V62A 4GN1A 4WWNA 3QC8B 4WJNA 1V81A 4M0WB 4E71A 2DAFA 2N1VA 2RD0A 5L83A 4ZYNA 2I1KA 3A9JA 5G2NA 2DHZA 1UH6A 4GXBA 4DDGD 5LXIB 1WM2A 2DENB 2KD0A 2L0TA 4MDKE 4PS8A 4MJSB 4CYEA 2IBIB 1V86A 1WJ4A 3R7QA 3DBRI 1SIFA 4FJYA 2LUEA 2D11A 2UYZB 3HM3A 4HLEA 4MSMB 3R66C 4WWPA 2KNBA 2G4DB 3WALA 3ZTDA 2O2VA 2Z0EB 1WGGA 2IYDB 4K7SA 4PYUA 2ZPNA 2DYBA 2JRHA 1ZGUB 2K25A 3NS8A 1V5TA 1WYWB 2MA9B 4ZRJA 3K9PB 1W6VA 1UELA 3I3TB 2V3SA 1LQBA 2BGFA 3OAWA 1RAXA 2M8SA 1WR1A 2NCNA 1TBEA 2LD9A 4JIOU 2FUHB 3RT3B 5J18A 3CMMB 4FHJA 4K7UA 2NS5A 2KC1A 1V2YA 1C1YB 2ZPYA 2CR5A 1WXVA 2ZJDA 1Q5WB 5J17A 2KDEB 2N9XA 3DBHI 2FCMA 2WX0A 4DK5A 3QA8A 2BKFA 3UQBA 2BYFA 3BY4B 2YLMA 1WGDA 2LWPA 3QX1A 1I42A 3VH3B 3LMNA 1NBFC 2M17A 2MBOA 1P9DU 2Z0DB 4MM3A 3L10B 2HD5B 2C60A 4NPNA 4G50A 3DQVA 1Y8RC 2O6VB 3W1SC 4EZKA 2DAJA 3VXWA 4B6WA 1WX9A 3A4SC 2J0MA 2K8BA 1WGRA 3HIZA 2L0FA 3PT2B 2J7QB 3V6CB 3NZUA 4E74A 2OOBB 3L54A 4HCNB 2LRWA 2PE9A 4G3XB 2LVQA 1WJ6A 3OJ3A 2NBWB 3QCAA 5DCNA 4B95A 3PZDA 2WYQA 5AZHA 5C1ZA 1IPGA 1YD8U 4AP4C 4KSKC 4WWOA 3SD5A 1UD7A 1WJNA 4WJQA 4GDKA 3QIJA 2ZNVC 4IM0A 2N1WA 4NAWB 3ZUNA 3Q3JA 3RUIB 2FAZA 5JHAA 1YIWA 4NJ6A 3VHTC 1OEYA 3VDZA 2KTFA 1V9JA 4EFOA 5LXHA 5CHVC 3NHEB 2AYOB 1P3QU 2RGFA 2YVCA 4K81A 2ZVNA 2KWVB 2ASQA 1Q1OA 2C7MB 3KUDB 2MX2A 2JVCA 1OTRB 2L8JA 2MBBB 4F7ZA 4FADA 2GBJA 4WJPA 2NVUI 3DVNU 3U8ZA 2KWCA 1IYFA 2PE6B 2M4NA 5DPWA 4HVBA 1UBIA 3PLUA 2MWSB 1GUAB 3ZNGC 2JPHA 4ASWC 4MSQB 3VTUA 4PYZA 4GSWA 3N3KB 2KLGA 1YJ1A 2R2OA 2KX0A 3X23A 2JRIB 2BYVE 2FNJB 4BVUC 3TJPA 3QARA 4GGQA 2XK5B 2ZNVB 3A1QA 3OJ4B 4KV2A 4EEWA 4DBGA 3M95A 3JYUA 2ZVOA 3LDZE 2MQJA 4G11A 2CHXA 3RYTA 3PHWB 3A33B 3EHVA 3ML8A 3NOBA 2MP2B 2GBRA 4IG7B 2D10A 3AI5A 4W9KA 3ZO5B 2KDBA 4RM8A 3T9LA 3DCGA 2IO2B 4II3B 5D2MB 2K1FA 3NY5A 2IO3B 1K8RB 4IWQA 3SU8X 5CX3A 2ZCCA 4IUMB 4AOFA 2HJ8A 2NBVB 5D7GA 3DVNV 4HK2A 2LGXA 1SGHA 1UZXB 1P0RA 5DPTA 4MGKE 1Q0WB 2C7NB 4BBNF 3C0RB 1WX7A 4JGHB 4TKNA 2QHOA 4FN2A 2KFKB 2KKCA 3JSVB 3VUWA 4BKTA 2LXCA 3VFKA 4P7IA 2KFJA 3VQIA 3TBLD 3VUYA 2B3AA 1TTNA 3ZKJC 3X0WA 4FJVB 1WMHA 2KXJA 2VRRB 1EF1A 3M63B 2KOXA 1YX5B 2D2QA 3MJWA 1WI0A 4AUQC 2MW5A 2D07B 3KUZA 4M8MA 1E90A 2R2QA 4BOSC 1I35A 1WGYA 2JF5A 2JUOA 2RSUA 1LM8B 2O6VA 3DDCB 2CU1A 2IY1B 2KHWB 3KW5B 1E8ZA 2IZVB 4OVUA 5G55A 3ZTCA 3ENEA 3UQAA 4BFRA 3L13A 5DPRA 3APCA 5JH5C 2GMIC 4RM9A 3ZRCA 2JXXA 3UF8A 2KMCA 3APFA 1OQYA 2KJ6A 4LDTD 4J6IA 4F1SA 1FXTB 1S3SG 2KJHB 4KIKB 2XEWA 3L16A 4JQWC 4HDQA 4K7WA 4FULA 4ICVA 2DZMA 1WXAA 4GDLA 3CSFA 3H7PB 2KZRA 3HHMA 3QK0A 5LLIA 2LVPA 4NAWA 1ISNA 2KWUB 3HK0A 3EC8A 3N30A 5D6JB 4W9EA 2ZCBA 3PTFC 3A9JB 2WDTB 4KDIC 4MEMA 4TQ0A 1G6JA 4I6NB 1QZEA 1T0YA 4W9LA 4FHKA 4DHZB 3R3MA 3IG3A 3ZIMA 1YQBA 2LZ6A 3QJZA 3UINB 4NNJB 2A5UA 3AU5A 4BKSA 2KANA 2I1JA 4KVGB 3W1SA 4HXDA 3AU4A 4KZ0A 2O2VB 2RPQA 2RR9A 2N9EB 3UIPB 4I6LB 3A4RA
chains in the Genus database with same CATH superfamily
4N59A 3MTNB 5G5HA 2CKHB 3RPFC 4EZJA 1U4AA 1ZKHA 4F8CB 2KYWA 4IM2A 3ZJTA 1M94A 1XLPA 3RNFC 1CQVA 1IP9A 4N9F4 3T3NA 1Z2MA 2GOWA 2CHWA 2MP2A 3I63C 4K1RB 2IGGA 1YN4A 4MM3B 1TGZB 2Z59B 1JWSD 1T6BX 3KVFB 3PRMB 4REZA 3ZXVA 2DWQA 3ECIA 5JZEB 2MBQA 2MLBA 1WM3A 3Q8BA 4G0NB 3TCAA 2WXHA 3TL5A 4LNNA 2B76B 1WY8A 1UWXA 3KUCB 4MJSA 2DZJA 1CMXB 2KN5A 2WXOA 3M3JA 3L08A 1S1QB 5GMVA 3RCZA 5AEKB 3FC4A 2BVCA 3AEGB 4IW0A 1T3QA 3VTWA 1FXIA 2V3NA 2G4SA 1WF9A 2EMTA 2XBBC 5E6PA 3SFDB 2G45B 3AMZA 1F77A 2MRPA 2N7DA 5CTRC 2KTRB 4P1BC 3WAMA 2LHEA 1Q10A 4KIKA 4DHJB 4XWWA 1WIAA 2WWZA 2KDIA 1SE4A 4S17A 2ON8A 4W9FA 1WX8A 3BVZA 3WIMA 5EE3A 2WX1A 3MC0B 3AE1B 3WA0A 1RFKA 5KHOA 1TJEA 4TV3A 2CHZA 4HCPB 3NZ3A 4M00A 1RWSA 1IUEA 1FNUA 1PQSA 2LASA 3M62B 3A9KA 4EKUA 1VDVA 4AWJA 1L4DB 1KLGD 1UGMA 2EKEC 3LJ3A 2IO0B 3ZW3A 2MBHA 1E0ZA 2Z8LA 3H6NA 4FA6A 3AEAB 3Q3NC 2NPTA 1XEEA 2BB6A 3H9DA 2V9HA 2JU6X 1A70A 4KSLC 2WQYB 2INDC 2BF8B 2H88B 2PJHA 1YMHE 5BMHA 2KQ7A 3V05A 4HDOA 2D3GA 4W9DA 3R8BA 3CWIA 1AN8A 1L4ZB 1OGWA 4NJ7A 1WZ0A 1TT5B 1WXMA 2Y5BB 2K3UA 2ZZPB 4GDLB 2MEKA 3ZDMC 1TY0A 3AULA 2JXTA 2OJRA 2LFIA 1FRRA 2AQ1B 1I4GA 3ZGZA 3QAQA 4C4VA 3ZVVA 4ZHPA 2FCNA 3UIOB 1GB4A 3B1LX 1V6EA 4XC2A 1D3ZA 3QHTA 2J0KA 3NVYA 1TZOA 4B0EA 2KFKA 4LCDE 4WIPA 5L95C 2L76A 3DOWA 3V6EB 3VH4B 2CS4A 2VZKD 2HDEA 3P2BA 3AE9B 3PHXB 1FCLA 1GC7A 2I2YA 2FCSA 4TMAB 1XT9B 3UI3A 3DBHB 2IY0B 2INCC 1OEYJ 1ZDVA 1MJDA 4TUUA 2KDFB 1XCTL 1NEKB 1DOXA 1MG4A 4XWTA 4GN1A 1F2RI 3A9JA 2DHZA 1UH6A 2V0GA 1NYQA 1WM2A 4B0MA 2KVZA 3PZ7A 4MJSB 1V86A 1WJ4A 1LGRA 1SIFA 4GLSC 2UYZB 3E56A 4WWPA 3KLSX 3WALA 3ZTDA 2H89B 2IYDB 3E9SA 4ARIA 1ZGUB 2K25A 1OQQA 3DHHC 1AW7A 4FHJA 2NS5A 3GS2A 1V2YA 4LK0M 3EFCA 4N58A 3U52E 5J17A 2Y3AA 2WX0A 2BKFA 4FXCA 3UQBA 1V97A 2BYFA 1UF0A 3P4PB 3VH3B 1P9DU 2VH1A 2SAKA 5TSSA 2C60A 1N5XA 3AEEB 1HTOA 3DQVA 3GB1A 3AM9A 3NZUA 2QDFA 2LVQA 1WGKA 1BUIC 3Q69A 1IPGA 3I5JC 4R3DA 4P6VF 4AP4C 4WWOA 2JWUA 3RNGC 1WJNA 1YIWA 2GI9A 1V9JA 4EFOA 1K51A 4AQ7A 2KWVB 2MX2A 3LXFA 4C00A 2MBBB 1QOFA 3TEZA 2NVUI 3DVNU 3U8ZA 3PLUA 1GUAB 3ZNGC 3SR6A 2JPHA 3VTUA 5IO9A 2KLGA 2JRIB 3MJ5A 4BVUC 3OJ4B 2ZNVB 4WAFA 4DBGA 1JWUD 2ZVOA 3FILA 4G11A 3OG5A 3ML8A 2GBRA 4IG7B 4LTUA 5I4DA 4RM8A 3T9LA 2Q5WD 1V1OA 5D2MB 2K1FA 2ACZB 4JWSC 2CJNA 5CX3A 4IUMB 1LO5D 2NBVB 3Q8CA 3AEFB 3DVNV 1XLNA 1I4QA 1P0RA 5DPTA 1Q0WB 1JW9D 4US8A 4H2AA 3AE6B 3C0RB 3NS1A 2QHOA 3V3XA 2KFKB 2KKCA 3JSVB 3VUWA 4KX6B 3VFKA 4ZHOA 3VQIA 1YN3A 2WXNA 3VUYA 2B3AA 2KXJA 2D2QA 5H8YE 3BK1A 3AE8B 2JF5A 1ZXIA 2O6VA 5D3IB 1R4MB 3W9CB 2CU1A 3KW5B 3UQAA 5JH5C 1NENB 2GMIC 2JXXA 1EM7A 1N5WA 2PLPA 2KMCA 3UF8A 5IKCM 4F1SA 2PTLA 2BBCA 1S3SG 2XEWA 4ICVA 3CSFA 2BW2A 4NAWA 2KWUB 3EC8A 1VZ6A 2ZCBA 3PTFC 3A9JB 4MEMA 4KDIC 1G6JA 4I6NB 1QZEA 1T0YA 4P1CC 4FHKA 4DHZB 3R3MA 3NVZA 3UINB 2WU5B 3I57A 4BKSA 3GP7A 2N9LA 2W54A 2N9EB 2BTEA 4I6LB 1F2RC 2KVRA 5HKHA 4W9GA 1R4NI 1VRAB 2W55A 3IBEA 4W9IA 1GC6A 2PKOA 5KHQA 3ZNHB 4NY0A 2XK5A 3KYCD 2OHFA 2QCZA 1UGJA 4A8XC 1YJJA 3RNCC 3P42A 1L2NA 1L0YB 1L0XB 3URYA 3AN1A 3IVFA 2K8HA 4HJKA 3ZRFA 3B08A 3GZNI 2LEKA 1V80A 2LJ5A 2ZW0A 3AEDB 1SF0A 3H8HA 1WJUA 2MJDA 1P98A 2D3CA 1VJKA 4JE3B 2PEAA 1XD3B 3PRZA 3WCQA 1WGHA 1YOVB 2MJ3A 3MFGA 1E5WA 1J0GA 1AARA 2QEJC 3PVLA 2GBNA 2YEPF 1GPXA 1ZPSA 4TQ1A 2FIDA 2NTTA 4KGTA 4IKGA 1GJZA 2JZZA 2KLCA 1E8YA 2G3QB 5EDSA 1TY2A 2JWZA 3H1UA 2V3PA 3VVWB 4LNIA 1UNSA 2LGDA 1KJTA 4OHJA 2M0XA 3RNAC 1KTKA 4II2B 4XDDA 4M02A 2JZ3B 4ANUA 3D32A 3R7RA 2I38A 4LJOB 4IM3A 2ZEQA 4MGZE 3H7SA 2MJEA 3Q3OC 3ETRA 2GRIA 2AL3A 1K53A 5IOIA 2LJIA 2QIEB 4DHJD 2KWDA 5IA7A 3PSEB 2QSDA 3V60A 3AXCA 1A5RA 2KACA 3APDA 2D5GA 1XXGA 1FXAA 2J52A 4ITKA 5AZFA 1HXYD 1IBXA 5CHFA 3N1ZC 2KX3A 4YSXB 3BIID 3N32A 1GAQB 2FIFA 2EELA 3PPAA 5TR5A 5EE1A 5BYRA 1JALA 1GNUA 2LHDA 1L6UA 1ESFA 3JW0X 4CQNA 1C78A 1HEZE 1UBQA 3HRDD 3PGEA 4IWOA 1E7PB 2NBUA 3KYDD 4KDLB 2MBEA 4WAAA 3ML9A 3K9OB 3RULA 4JWUC 2L83A 1QLBB 4L1BA 2N7JA 5T8IA 3UGBB 4OZAA 1J8CA 3TEXA 2N9KA 3TEYA 4HROA 5J2RA 2CU3A 3IT4B 3DBSA 1TS5A 2DYOA 3RZWC 2J42A 4IC7B 2MHJA 1TYGB 2AEHA 4M8NA 1EF5A 1QOAA 4GDKB 3S2AA 2V4LA 4P16A 3TIXA 5C3JB 3P4QB 1KLUD 1L6VA 4FBJB 1EWCA 4DXGA 2K8CA 3IAS1 3IXSA 3EECA 4DXFA 5D94A 2KC2A 3N1XC 3RFZB 2LI5A 2NR2A 2GB1A 3AB5A 4A3OA 2C7HA 1V5OA 3V62A 4WJNA 4M0WB 3U7ZA 2DAFA 1MHHE 4GXBA 1KFYB 1SEBD 2DENB 2JSVX 2L0TA 5LXIB 2M56B 4HRSA 3R2TA 3R7QA 3DBRI 4HLEA 2WHIA 1D5ZC 1WGGA 4K7SA 4PYUA 1ROEA 1PUTA 2ZPNA 2DYBA 2JRHA 3NS8A 1V5TA 1WYWB 4ZRJA 3I3TB 5HFYA 2V3SA 2BGFA 2M8SA 1WR1A 1TBEA 4JIOU 2DBYA 2ICIA 2KC1A 4YTNB 1C1YB 4XYCA 2ZPYA 2CR5A 2WXGA 2W3SA 1Q5WB 3DBHI 3QA8A 1WGDA 2LWPA 3QX1A 1NBFC 4HKZE 2JX5A 2Z0DB 1OQRA 1Y8RC 4B6WA 1WX9A 1SE2A 3A4SC 2L0FA 2J7QB 1N61A 3L54A 4G3XB 2KQ4X 3OJ3A 2NBWB 1AWDA 4B95A 1J7CA 3BYTB 1YD8U 1JRPA 2PIAA 1E9MA 2N1WA 3RUIB 2SEBD 5JHAA 1XCQL 2KTFA 3AH7A 1STEA 5CHVC 1WWTA 1IBXB 2RGFA 2ZVNA 4RGNA 2ASQA 2C7MB 3BVMA 1OTRB 2X38A 2JZPA 4FADA 1E6EB 3Q2AC 4N6EB 4ASWC 2IDYA 2KX0A 2FNJB 1TKYA 4GGQA 3A1QA 2X8XX 3AE4B 4KKIA 2MQJA 2CHXA 5EE0A 1SJHD 3NOBA 2MP2B 1JWMD 4W9KA 3Q3MC 1F1HA 3DCGA 2IO2B 4NZLB 1WSPA 3NY5A 3FAHA 1K8RB 4AOFA 1PFDA 3W2DA 2LMCA 4A90A 3NG0A 4EE2A 1M4VA 1I4XA 1UUPA 4MGKE 2D3AA 1C77A 4BBNF 4M01A 4TKNA 4FN2A 4P7IA 1TKEA 4LNKA 1TTNA 3X0WA 1JQ4A 1WMHA 1KRHA 2KOXA 1B9RA 3KUZA 4BOSC 1C9FA 4MH8A 1L0VB 2KHWB 2IZVB 2CJOA 4BFRA 3L13A 3APFA 1OQYA 2KJ6A 1MI0A 2KJHB 2Y5PA 4KIKB 4JQWC 1XLQA 2KZRA 3HHMA 3QK0A 5LLIA 2LVPA 3HVZA 3N30A 2FBWB 4W9EA 4YXDB 3ZIMA 1YQBA 4Q2JA 3P1MA 3QJZA 3BWUD 3AU5A 2KANA 2I1JA 1J7BA 3NRZA 2RR9A 3UIPB 2W3RA 2W9NA 2QILA 3A9KB 4C7ZA 2NMQA 1QOBA 4EZLA 3KWLA 2NPTB 4LNOA 2IGDA 3WAOA 4BBNC 4YL8A 4ICUA 4ANXA 1H4RA 4W9JA 3T8MA 1GG3A 3EA6A 5H92C 4ZRPA 4DQOC 2L52A 1I4HA 4GOCA 4W9HA 1C3TA 4W9CA 3U7DA 1PGXA 5FR6A 2M19A 3SHQA 5E6OA 2FCQA 3AEBB 3QWZB 4MGYE 3L0WB 4LNFA 1RLFA 1TKGA 2J53A 3RNBC 1NDDA 1XF5L 5E6NA 2DZIA 2BPSA 4C4VB 4KGRA 4DDID 4FLHA 4AJWA 4B9KA 5FKAC 1F0ZA 1C4AA 1C79A 3O65B 4LJPB 1V1PA 2BWES 2M0AA 4BZAA 4YSZB 3TUOA 1WRDB 4EUTA 2MSED 3VR8B 4PS7A 4YTMB 3VTVA 1KM7A 2DYMA 1EU3A 2N7EA 2WU2B 1VZ7A 1I4PA 2WXKA 1ZDXA 4GB9A 2AWTA 4L2YA 1SE9A 3RZFA 4IWPA 1K50A 3Q8EA 4OVVA 2QC8A 3ZQ4A 3CSTA 2DZKA 3RNEC 1PYWD 3CF6E 3PV1A 1EUVB 4BOZB 4MACA 3ONSA 3SDLC 2KO3A 1Z5SB 5JHBA 1RRBA 2VH2A 2IO1B 2XN9C 3MHSD 5C23A 3JVZX 1T5XD 1WXSA 3Q3FA 1WRIA 4ANVA 4HPMB 2V1YA 3AV8A 4RH6A 2IPKD 2BQQA 4OW0A 1ZOYB 2K9XA 2OJWA 4JL9A 4DHZE 2BT6A 1NI3A 1WMHB 2K39A 2GBMA 1QT9A 1WE6A 2LRUA 4PT5A 2WXLA 3ABVB 1FPYA 2LVOA 2ONQA 2KJRA 5HHDG 2L05A 1V49A 2J0JA 3KQ4A 3PRPB 4GMVA 4ZRIA 3W1YA 3TSSA 2AX5A 1EO6A 2MH7A 2O6VD 1FEHA 2YEPB 4IDIA 1NI2A 2MCNB 1ZXHA 4URKA 1J7AA 3OWEB 2WXFA 2C5LC 1V8CA 2M1MA 4RCOA 1E7VA 4ZRKA 2KT7A 3B2GA 3C8YA 3DPDA 3DBLI 4K3CA 3MHZA 2IJ0A 5BO4B 2KTRA 2WP9B 4XX5A 3U4EG 1DYQA 3Q8AA 2LXAA 4GU2A 3B2FA 5FR3A 5BYSA 3RMKC 4C80A 4BKSD 4ANWA 3NZSA 2TSSA 2BWFA 1YX6B 1FFUA 2WXJA 4ZYSA 3VRBB 1WZ3A 2Y5CA 2PVGC 1FM0D 2K6DB 3I9V1 4USAA 3ZXRA 3ZLZA 4RMAA 4E3CA 2QJLA 3H7PA 1SB3C 4WWNA 3QC8B 4E71A 1FRDA 1V81A 3FILB 2N1VA 2RD0A 1FO4A 2K0PA 4DDGD 2KD0A 1HZ6A 1ZE3D 4PS8A 4HJGE 1WXQA 3EUB2 4FJYA 4MSMB 1ENFA 1R4NB 3R66C 2O2VA 5BYQA 1VZ8A 3W5UB 4RF1A 3OAWA 1LQBA 2NCNA 3P4SB 2LD9A 3RT3B 2FUHB 5J18A 3NVWA 1WXVA 1HQRD 3GZNB 2N9XA 2FCMA 1GB1A 3BY4B 2YLMA 1RM6C 2E6XA 1I42A 3TEWA 2M17A 1VLBA 5BMGA 3DHIC 2HD5B 4NPNA 2O6VB 3VXWA 2J0MA 1WGRA 3HIZA 4E74A 4HCNB 2OOBB 2LRWA 5DCNA 1WJ6A 4KKJA 5AZHA 5C1ZA 2BS4B 1JCKB 4KSKC 3SD5A 1D6EC 4WJQA 3QIJA 3ZUNA 4NAWB 1JWBD 2PVOD 2RDGA 3VHTC 1OEYA 3VDZA 1P7FA 2AYOB 1P3QU 1DOYA 4K81A 4S0RA 1Q1OA 3MC9A 3BVGA 1SJED 4F7ZA 3L4PA 2GBJA 4WJPA 1IYFA 2PE6B 5DPWA 1WYGA 1UBIA 2MWSB 1FFVA 3SEBA 2XNAC 1KH0A 2W82A 4C56C 1YJ1A 3X23A 1MHXA 2WDQB 4WWMA 3TJPA 3QARA 2XK5B 2RPVA 3M95A 3LDZE 3RYTA 3EHVA 1TS4A 1D4BA 2D10A 3AI5A 4RNAA 1N60A 2KDBA 4RF0A 1CK1A 2WLBA 4II3B 1B1ZA 5D7GA 1N63A 3R2IA 4A9AA 4HK2A 2R61A 1SGHA 4YSYB 2L1AA 2C7NB 4OZCA 3DHGC 1AYFA 4RFBA 2RDHA 4BKTA 4WQMA 2KFJA 4NAMA 1ACCA 3Q14C 2VRRB 3M63B 1EF1A 3NUHB 1SXTA 3MJWA 4AUQC 2MW5A 2INPE 1I35A 1KF6B 2JUOA 1PGBA 1YN5A 2IY1B 5G55A 4OVUA 5DPRA 3APCA 4RM9A 3ZRCA 2G9HD 4LDTD 4J6IA 3L16A 4K7WA 3AE3B 4FULA 1SBBB 2DZMA 4J3OD 3H7PB 5EE9A 3N20C 3N1YC 3HK0A 5D6JB 4TQ0A 4W9LA 2UU7A 3IG3A 1JMLA 4RGOS 4NNJB 2A5UA 4KVGB 1R7SA 3W1SA 1L5PA 3AU4A 4HXDA 1JWAD 1TIFA 2O2VB 3A4RA 1N6ZA 4UDUC 4US9A 2REXA 1LFDA 4DXAB 1JRUA 2RDBC 4MGIE 2RMMA 3ZDTA 3ZJUA 5MPOA 2L7RA 2BYTA 2EMSA 2WXQA 3NJTA 3KWVA 4PS3A 4ARCA 1T0RC 2K22A 4K3BA 4WQOB 1FD6A 2JT4B 5LNK1 1X1MA 4XZ4A 1RFAA 4PK1A 3T3OA 1VD2A 1XLOA 2A4ZA 2LGYA 2V4IB 5D3DA 3QQ8B 2LGIA 4CHKA 4HPPA 2BYEA 1C4CA 1KLVA 3DBRB 4KZCA 4DWFA 1MG8A 3IAM1 2KK8A 2L3ZA 2GBKA 3JSVA 4GIVA 1P1AA 2JY6A 1GOZA 2KMMA 3VUXA 4ZDVA 4A3PA 2PPHA 3HVDA 2EKIA 3L17A 3MP9A 1F9JA 4WJOA 4JPSA 1I7HA 5CHWA 2FUG1 1EU4A 1TZ1A 1J19A 3B9JA 1TS2A 2HJ1A 4BKGA 1CZPA 4EOYA 5JXVA 3NVVA 4BAXA 3W5VB 4FJZA 2WGSA 4LDTB 3V61A 2C9WB 2LGSA 2D3BA 2L00B 1T0SC 2AL6A 5BMIA 1FCCC 5E6JA 3OLMD 3AE2B 1NVID 4MH0E 1UWMA 3WAPA 2N4FA 3RN9C 1QF6A 3U30A 2BKRB 1BT0A 3KH0A 1FNWA 3ALBA 1LXDA 4WURA 4A20A 3PO0A 3BZDB 3SFEB 1PDXA 2KAJA 3BINA 3PREA 1MPEA 2K6QA 3HUIA 1WH3A 3IT6B 3P4RB 4ACFA 2GLSA 3ZNZB 1E8WA 5DPSA 2N9PC 2KN4A 3ZJVA 2UWQA 4HPLB 3GE8C 2WS3B 1YQ3B 4IOIE 1NYRA 3GOEA 3PLVA 3RI7C 1ET6A 1T0QC 1VCBA 1JROA 3DVGX 3VAWA 1R4MI 1VR9A 3AE7B 1HA5A 3PS6A 2QMTA 4JLCA 1Y56A 3ZNID 3WANA 4AJYB 4A6QA 4LLGM 2VZKB 1L7YA 1WR6E 2HTHA 1WE7A 4I6PA 5HI1A 1N62A 2DX5B 3TMPB 4ZRQA 1HZ5A 5C2TB 1SE3A 3RD2A 3Q6BA 3HM6X 2JQRB 1H8CA 4HKQA 3IFWB 1C4PA 3IHPC 3DVGY 4NQLB 3LB8C 4X57B 1KOTA 5IAAC 3DWGC 3EFUA 4YTPB 3B0AA 2HTME 4NQKE 1WFYA 4MELA 2DLBA 1E8XA 3PZ8A 2AQ2B 4CO7A 1E7UA 5FK9C 2BB5A 3EGRA 4HWIB 1HE8A 2HE7A 2KQSA 1ZW7A 1XQQA 1SIJA 3A1QB 2KMAA 5AZGA 3J9CA 2PW9A 4JX1C 2AQ3B 5L83A 3AECB 2I1KA 5G2NA 4ZYNA 4C7YA 4MDKE 1TS3A 2INNE 4CYEA 2IBIB 3BYYB 2LUEA 2D11A 3HM3A 3U2SC 1I4RA 2KNBA 2G4DB 2Z0EB 2WNMA 4XE0A 2ZW1A 2MA9B 4HEA1 3K9PB 1W6VA 1MFWA 1UELA 1RAXA 5AUKA 3CMMB 4K7UA 3LYYA 3GE3C 1OFFA 4MT5A 4XGAB 4YT0B 2ZJDA 3FKYA 2KDEB 4O1NA 4DK5A 5GXGB 1E10A 3LMNA 2MBOA 5IN7A 1CJEA 4MM3A 3VRAB 1EWYC 3L10B 4G50A 1P7EA 3ZYYX 1FNVA 2WXRA 3O13A 2DAJA 3W1SC 4EZKA 2K8BA 3PT2B 4D2KA 3V6CB 1SSNA 4RGTA 1C76A 3CIRB 2PE9A 3QCAA 3PZDA 2WYQA 2WDRB 4OVZA 1K52A 1UD7A 4GDKA 2ZNVC 4IM0A 3Q3JA 1IGDA 2FAZA 4NJ6A 5LXHA 3NHEB 2YVCA 2FE8A 3KUDB 4OZBA 2JVCA 2L8JA 2N0SB 5HG2A 2BS2B 2WXMA 5AUIA 1RYJA 2KWCA 2M4NA 4HVBA 1MVKA 2KDMA 4MSQB 4PYZA 4GSWA 3N3KB 1XO3A 2R2OA 2BYVE 4RGMA 1QQRA 4KV2A 4EEWA 3JYUA 3C19A 3MC8A 4M0WA 4TSSA 3PHWB 3A33B 1QKZA 4YWGG 2OEDA 3BK2A 4L23A 4ZOHC 3ZO5B 2E3TA 2K5PA 3Q8FA 2DNFA 1DGJA 4NJCA 2J4XA 2IO3B 3SU8X 4IWQA 2WDVB 2ZCCA 2HJ8A 1PGAA 1D5XC 1D5MC 2LGXA 1UZXB 2WXIA 4KGSA 4QAYA 1BMLC 2BS3B 3DWMA 1FMAD 1WX7A 4JGHB 1QILA 2LXCA 3TBLD 1HTQA 3ZKJC 4FJVB 2JYEA 1F52A 1DOIA 1YX5B 1WI0A 1YJIA 2JYTA 2D07B 4M8MA 1E90A 2R2QA 1WGYA 2RSUA 1LM8B 2L32A 3DDCB 4AS1A 1E8ZA 1V1PB 3ZTCA 3ENEA 1ET9A 1ZUD2 2IGHA 4WH4A 5IP4D 2G1EA 1FXTB 3P63A 4HDQA 1WXAA 4GDLA 1FIQA 1ISNA 2WXPA 2WDTB 4XDCA 2NTSA 3VR9B 1BXTA 1YQ4B 2LZ6A 2LUMA 3N9YC 3DBLB 5G5GA 1YNTE 4A55A 3AE5B 1IGCA 2PMVA 1ZP0B 2RPQA 4KZ0A 1QOGA
chains in the Genus database with same CATH topology
2KVRA 5HKHA 2W9NA 3MTNB 4W9GA 2CKHB 4EZJA 2REXA 3A9KB 1R4NI 1LFDA 4DXAB 1JRUA 1U4AA 1ZKHA 4MGIE 3ZDTA 4F8CB 3IBEA 2L7RA 2EMSA 4IM2A 4W9IA 1GC6A 5KHQA 1M94A 3ZNHB 4NY0A 2XK5A 3KYCD 1IP9A 4EZLA 4N9F4 4PS3A 2NPTB 4WQOB 1Z2MA 2GOWA 4BBNC 3WAOA 2JT4B 1L2NA 2CHWA 4YL8A 2MP2A 1X1MA 4K1RB 4ICUA 4XZ4A 3IVFA 1RFAA 4ANXA 2K8HA 1H4RA 4HJKA 3ZRFA 4W9JA 1VD2A 3B08A 3GZNI 3T8MA 1GG3A 2A4ZA 2LGYA 1TGZB 1V80A 2Z59B 2LJ5A 4GOCA 4W9HA 1C3TA 4W9CA 3PRMB 3KVFB 3U7DA 3ECIA 5FR6A 3QQ8B 5JZEB 1WJUA 3SHQA 1P98A 2MBQA 1WM3A 2MLBA 5E6OA 4CHKA 2FCQA 3QWZB 2PEAA 4G0NB 4MGYE 3TCAA 1XD3B 3PRZA 2BYEA 3TL5A 1KLVA 4KZCA 1WGHA 1WY8A 4DWFA 1MG8A 3L0WB 2L3ZA 2KK8A 1E5WA 1RLFA 2GBKA 1J0GA 1AARA 3JSVA 3KUCB 1P1AA 1NDDA 2JY6A 4GIVA 4MJSA 3PVLA 2DZJA 2GBNA 2DZIA 5E6NA 1CMXB 2KN5A 3VUXA 4ZDVA 3M3JA 4TQ1A 3L08A 1S1QB 5GMVA 4A3PA 2PPHA 2BPSA 3RCZA 5AEKB 3L17A 2FIDA 4IW0A 4DDID 1GJZA 1F9JA 4FLHA 4WJOA 2JZZA 3VTWA 2KLCA 5CHWA 4AJWA 4B9KA 2G4SA 1E8YA 1TZ1A 2G3QB 1J19A 1WF9A 2JWZA 3H1UA 2EMTA 3VVWB 4BKGA 2XBBC 5EDSA 3O65B 5E6PA 4EOYA 2G45B 4LJPB 2LGDA 1KJTA 2MRPA 2N7DA 2BWES 5CTRC 2KTRB 2M0XA 3WAMA 4II2B 4FJZA 1WRDB 4KIKA 4DHJB 4EUTA 2MSED 2JZ3B 4LDTB 1WIAA 4PS7A 4ANUA 2WWZA 3VTVA 1KM7A 2DYMA 3V61A 2C9WB 2KDIA 3D32A 2L00B 2N7EA 3R7RA 4W9FA 4LJOB 1WX8A 3WIMA 4IM3A 4GB9A 2ZEQA 4MGZE 3H7SA 2WX1A 2AWTA 2AL6A 3WA0A 1SE9A 3RZFA 4IWPA 3OLMD 2AL3A 4OVVA 5KHOA 3CSTA 2DZKA 4MH0E 3WAPA 2N4FA 3CF6E 4DHJD 3PV1A 1EUVB 2CHZA 4TV3A 5IA7A 3PSEB 4BOZB 3V60A 4HCPB 2BKRB 3AXCA 3ONSA 3SDLC 3U30A 1BT0A 2KO3A 1Z5SB 3ALBA 3KH0A 1A5RA 5JHBA 1LXDA 3APDA 1RRBA 4A20A 1PQSA 2LASA 3M62B 3A9KA 2IO1B 4EKUA 4AWJA 1UGMA 2EKEC 3LJ3A 2IO0B 3ZW3A 2MBHA 3MHSD 5C23A 3BINA 3JVZX 3H6NA 3PREA 5AZFA 4FA6A 1WXSA 3Q3FA 5CHFA 4ANVA 2K6QA 2NPTA 3H9DA 4HPMB 2KX3A 2V1YA 4KSLC 3N32A 1WH3A 4JL9A 2BF8B 4DHZE 2FIFA 3ZNZB 1E8WA 3PPAA 5TR5A 1WMHB 2PJHA 2K39A 5DPSA 2GBMA 2N9PC 1WE6A 1GNUA 2LRUA 2UWQA 2KQ7A 4HPLB 3JW0X 4HDOA 2D3GA 4W9DA 3GOEA 1UBQA 3PLVA 3PGEA 4IWOA 2LVOA 2KJRA 2NBUA 3KYDD 4KDLB 2L05A 1VCBA 1OGWA 2MBEA 4NJ7A 1V49A 4WAAA 3DVGX 1WZ0A 3VAWA 2J0JA 1R4MI 3ML9A 3K9OB 3PRPB 1WXMA 2Y5BB 4GMVA 4ZRIA 3RULA 3W1YA 2ZZPB 3PS6A 4GDLB 3ZDMC 4JLCA 3AULA 2OJRA 3ZNID 3UGBB 3WANA 4AJYB 1J8CA 1EO6A 2O6VD 3QAQA 3ZVVA 1NI2A 2MCNB 5J2RA 1L7YA 1WR6E 2FCNA 2HTHA 1WE7A 3UIOB 3DBSA 4I6PA 4URKA 2DX5B 3TMPB 2C5LC 2M1MA 1E7VA 4ZRKA 3B1LX 2DYOA 3RZWC 1V6EA 4XC2A 4IC7B 1D3ZA 3RD2A 3QHTA 3DPDA 2J0KA 3DBLI 3HM6X 2KTRA 5BO4B 1H8CA 2KFKA 4LCDE 2AEHA 4M8NA 1EF5A 4GDKB 4XX5A 3IFWB 2L76A 3IHPC 5L95C 3DOWA 3DVGY 3V6EB 2LXAA 4GU2A 3S2AA 4NQLB 2V4LA 2CS4A 3VH4B 4X57B 1KOTA 3P2BA 5IAAC 3TIXA 3EFUA 4BKSD 4ANWA 3NZSA 3PHXB 2BWFA 1YX6B 1GC7A 2FCSA 3B0AA 4FBJB 4NQKE 1WFYA 1XT9B 2K8CA 4MELA 2IY0B 1WZ3A 3EECA 1E8XA 2K6DB 5D94A 2KC2A 4CO7A 1E7UA 1OEYJ 3ZLZA 4RMAA 4E3CA 2LI5A 4TUUA 2KDFB 2NR2A 1HE8A 4HWIB 2HE7A 4A3OA 2KQSA 3H7PA 2C7HA 1ZW7A 1XQQA 1V5OA 3A1QB 2KMAA 5AZGA 3V62A 4GN1A 4WWNA 3QC8B 4WJNA 1V81A 4M0WB 4E71A 2DAFA 2N1VA 2RD0A 5L83A 4ZYNA 2I1KA 3A9JA 5G2NA 2DHZA 1UH6A 4GXBA 4DDGD 5LXIB 1WM2A 2DENB 2KD0A 2L0TA 4MDKE 4PS8A 4MJSB 4CYEA 2IBIB 1V86A 1WJ4A 3R7QA 3DBRI 1SIFA 4FJYA 2LUEA 2D11A 2UYZB 3HM3A 4HLEA 4MSMB 3R66C 4WWPA 2KNBA 2G4DB 3WALA 3ZTDA 2O2VA 2Z0EB 1WGGA 2IYDB 4K7SA 4PYUA 2ZPNA 2DYBA 2JRHA 1ZGUB 2K25A 3NS8A 1V5TA 1WYWB 2MA9B 4ZRJA 3K9PB 1W6VA 1UELA 3I3TB 2V3SA 1LQBA 2BGFA 3OAWA 1RAXA 2M8SA 1WR1A 2NCNA 1TBEA 2LD9A 4JIOU 2FUHB 3RT3B 5J18A 3CMMB 4FHJA 4K7UA 2NS5A 2KC1A 1V2YA 1C1YB 2ZPYA 2CR5A 1WXVA 2ZJDA 1Q5WB 5J17A 2KDEB 2N9XA 3DBHI 2FCMA 2WX0A 4DK5A 3QA8A 2BKFA 3UQBA 2BYFA 3BY4B 2YLMA 1WGDA 2LWPA 3QX1A 1I42A 3VH3B 3LMNA 1NBFC 2M17A 2MBOA 1P9DU 2Z0DB 4MM3A 3L10B 2HD5B 2C60A 4NPNA 4G50A 3DQVA 1Y8RC 2O6VB 3W1SC 4EZKA 2DAJA 3VXWA 4B6WA 1WX9A 3A4SC 2J0MA 2K8BA 1WGRA 3HIZA 2L0FA 3PT2B 2J7QB 3V6CB 3NZUA 4E74A 2OOBB 3L54A 4HCNB 2LRWA 2PE9A 4G3XB 2LVQA 1WJ6A 3OJ3A 2NBWB 3QCAA 5DCNA 4B95A 3PZDA 2WYQA 5AZHA 5C1ZA 1IPGA 1YD8U 4AP4C 4KSKC 4WWOA 3SD5A 1UD7A 1WJNA 4WJQA 4GDKA 3QIJA 2ZNVC 4IM0A 2N1WA 4NAWB 3ZUNA 3Q3JA 3RUIB 2FAZA 5JHAA 1YIWA 4NJ6A 3VHTC 1OEYA 3VDZA 2KTFA 1V9JA 4EFOA 5LXHA 5CHVC 3NHEB 2AYOB 1P3QU 2RGFA 2YVCA 4K81A 2ZVNA 2KWVB 2ASQA 1Q1OA 2C7MB 3KUDB 2MX2A 2JVCA 1OTRB 2L8JA 2MBBB 4F7ZA 4FADA 2GBJA 4WJPA 2NVUI 3DVNU 3U8ZA 2KWCA 1IYFA 2PE6B 2M4NA 5DPWA 4HVBA 1UBIA 3PLUA 2MWSB 1GUAB 3ZNGC 2JPHA 4ASWC 4MSQB 3VTUA 4PYZA 4GSWA 3N3KB 2KLGA 1YJ1A 2R2OA 2KX0A 3X23A 2JRIB 2BYVE 2FNJB 4BVUC 3TJPA 3QARA 4GGQA 2XK5B 2ZNVB 3A1QA 3OJ4B 4KV2A 4EEWA 4DBGA 3M95A 3JYUA 2ZVOA 3LDZE 2MQJA 4G11A 2CHXA 3RYTA 3PHWB 3A33B 3EHVA 3ML8A 3NOBA 2MP2B 2GBRA 4IG7B 2D10A 3AI5A 4W9KA 3ZO5B 2KDBA 4RM8A 3T9LA 3DCGA 2IO2B 4II3B 5D2MB 2K1FA 3NY5A 2IO3B 1K8RB 4IWQA 3SU8X 5CX3A 2ZCCA 4IUMB 4AOFA 2HJ8A 2NBVB 5D7GA 3DVNV 4HK2A 2LGXA 1SGHA 1UZXB 1P0RA 5DPTA 4MGKE 1Q0WB 2C7NB 4BBNF 3C0RB 1WX7A 4JGHB 4TKNA 2QHOA 4FN2A 2KFKB 2KKCA 3JSVB 3VUWA 4BKTA 2LXCA 3VFKA 4P7IA 2KFJA 3VQIA 3TBLD 3VUYA 2B3AA 1TTNA 3ZKJC 3X0WA 4FJVB 1WMHA 2KXJA 2VRRB 1EF1A 3M63B 2KOXA 1YX5B 2D2QA 3MJWA 1WI0A 4AUQC 2MW5A 2D07B 3KUZA 4M8MA 1E90A 2R2QA 4BOSC 1I35A 1WGYA 2JF5A 2JUOA 2RSUA 1LM8B 2O6VA 3DDCB 2CU1A 2IY1B 2KHWB 3KW5B 1E8ZA 2IZVB 4OVUA 5G55A 3ZTCA 3ENEA 3UQAA 4BFRA 3L13A 5DPRA 3APCA 5JH5C 2GMIC 4RM9A 3ZRCA 2JXXA 3UF8A 2KMCA 3APFA 1OQYA 2KJ6A 4LDTD 4J6IA 4F1SA 1FXTB 1S3SG 2KJHB 4KIKB 2XEWA 3L16A 4JQWC 4HDQA 4K7WA 4FULA 4ICVA 2DZMA 1WXAA 4GDLA 3CSFA 3H7PB 2KZRA 3HHMA 3QK0A 5LLIA 2LVPA 4NAWA 1ISNA 2KWUB 3HK0A 3EC8A 3N30A 5D6JB 4W9EA 2ZCBA 3PTFC 3A9JB 2WDTB 4KDIC 4MEMA 4TQ0A 1G6JA 4I6NB 1QZEA 1T0YA 4W9LA 4FHKA 4DHZB 3R3MA 3IG3A 3ZIMA 1YQBA 2LZ6A 3QJZA 3UINB 4NNJB 2A5UA 3AU5A 4BKSA 2KANA 2I1JA 4KVGB 3W1SA 4HXDA 3AU4A 4KZ0A 2O2VB 2RPQA 2RR9A 2N9EB 3UIPB 4I6LB 3A4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVR A;  5HKH A;  2W9N A;  3MTN B;  4W9G A;  2CKH B;  4EZJ A;  2REX A;  3A9K B;  1R4N I;  1LFD A;  4DXA B;  1JRU A;  1U4A A;  1ZKH A;  4MGI E;  3ZDT A;  4F8C B;  3IBE A;  2L7R A;  2EMS A;  4IM2 A;  4W9I A;  1GC6 A;  5KHQ A;  1M94 A;  3ZNH B;  4NY0 A;  2XK5 A;  3KYC D;  1IP9 A;  4EZL A;  4N9F 4;  4PS3 A;  2NPT B;  4WQO B;  1Z2M A;  2GOW A;  4BBN C;  3WAO A;  2JT4 B;  1L2N A;  2CHW A;  4YL8 A;  2MP2 A;  1X1M A;  4K1R B;  4ICU A;  4XZ4 A;  3IVF A;  1RFA A;  4ANX A;  2K8H A;  1H4R A;  4HJK A;  3ZRF A;  4W9J A;  1VD2 A;  3B08 A;  3GZN I;  3T8M A;  1GG3 A;  2A4Z A;  2LGY A;  1TGZ B;  1V80 A;  2Z59 B;  2LJ5 A;  4GOC A;  4W9H A;  1C3T A;  4W9C A;  3PRM B;  3KVF B;  3U7D A;  3ECI A;  5FR6 A;  3QQ8 B;  5JZE B;  1WJU A;  3SHQ A;  1P98 A;  2MBQ A;  1WM3 A;  2MLB A;  5E6O A;  4CHK A;  2FCQ A;  3QWZ B;  2PEA A;  4G0N B;  4MGY E;  3TCA A;  1XD3 B;  3PRZ A;  2BYE A;  3TL5 A;  1KLV A;  4KZC A;  1WGH A;  1WY8 A;  4DWF A;  1MG8 A;  3L0W B;  2L3Z A;  2KK8 A;  1E5W A;  1RLF A;  2GBK A;  1J0G A;  1AAR A;  3JSV A;  3KUC B;  1P1A A;  1NDD A;  2JY6 A;  4GIV A;  4MJS A;  3PVL A;  2DZJ A;  2GBN A;  2DZI A;  5E6N A;  1CMX B;  2KN5 A;  3VUX A;  4ZDV A;  3M3J A;  4TQ1 A;  3L08 A;  1S1Q B;  5GMV A;  4A3P A;  2PPH A;  2BPS A;  3RCZ A;  5AEK B;  3L17 A;  2FID A;  4IW0 A;  4DDI D;  1GJZ A;  1F9J A;  4FLH A;  4WJO A;  2JZZ A;  3VTW A;  2KLC A;  5CHW A;  4AJW A;  4B9K A;  2G4S A;  1E8Y A;  1TZ1 A;  2G3Q B;  1J19 A;  1WF9 A;  2JWZ A;  3H1U A;  2EMT A;  3VVW B;  4BKG A;  2XBB C;  5EDS A;  3O65 B;  5E6P A;  4EOY A;  2G45 B;  4LJP B;  2LGD A;  1KJT A;  2MRP A;  2N7D A;  2BWE S;  5CTR C;  2KTR B;  2M0X A;  3WAM A;  4II2 B;  4FJZ A;  1WRD B;  4KIK A;  4DHJ B;  4EUT A;  2MSE D;  2JZ3 B;  4LDT B;  1WIA A;  4PS7 A;  4ANU A;  2WWZ A;  3VTV A;  1KM7 A;  2DYM A;  3V61 A;  2C9W B;  2KDI A;  3D32 A;  2L00 B;  2N7E A;  3R7R A;  4W9F A;  4LJO B;  1WX8 A;  3WIM A;  4IM3 A;  4GB9 A;  2ZEQ A;  4MGZ E;  3H7S A;  2WX1 A;  2AWT A;  2AL6 A;  3WA0 A;  1SE9 A;  3RZF A;  4IWP A;  3OLM D;  2AL3 A;  4OVV A;  5KHO A;  3CST A;  2DZK A;  4MH0 E;  3WAP A;  2N4F A;  3CF6 E;  4DHJ D;  3PV1 A;  1EUV B;  2CHZ A;  4TV3 A;  5IA7 A;  3PSE B;  4BOZ B;  3V60 A;  4HCP B;  2BKR B;  3AXC A;  3ONS A;  3SDL C;  3U30 A;  1BT0 A;  2KO3 A;  1Z5S B;  3ALB A;  3KH0 A;  1A5R A;  5JHB A;  1LXD A;  3APD A;  1RRB A;  4A20 A;  1PQS A;  2LAS A;  3M62 B;  3A9K A;  2IO1 B;  4EKU A;  4AWJ A;  1UGM A;  2EKE C;  3LJ3 A;  2IO0 B;  3ZW3 A;  2MBH A;  3MHS D;  5C23 A;  3BIN A;  3JVZ X;  3H6N A;  3PRE A;  5AZF A;  4FA6 A;  1WXS A;  3Q3F A;  5CHF A;  4ANV A;  2K6Q A;  2NPT A;  3H9D A;  4HPM B;  2KX3 A;  2V1Y A;  4KSL C;  3N32 A;  1WH3 A;  4JL9 A;  2BF8 B;  4DHZ E;  2FIF A;  3ZNZ B;  1E8W A;  3PPA A;  5TR5 A;  1WMH B;  2PJH A;  2K39 A;  5DPS A;  2GBM A;  2N9P C;  1WE6 A;  1GNU A;  2LRU A;  2UWQ A;  2KQ7 A;  4HPL B;  3JW0 X;  4HDO A;  2D3G A;  4W9D A;  3GOE A;  1UBQ A;  3PLV A;  3PGE A;  4IWO A;  2LVO A;  2KJR A;  2NBU A;  3KYD D;  4KDL B;  2L05 A;  1VCB A;  1OGW A;  2MBE A;  4NJ7 A;  1V49 A;  4WAA A;  3DVG X;  1WZ0 A;  3VAW A;  2J0J A;  1R4M I;  3ML9 A;  3K9O B;  3PRP B;  1WXM A;  2Y5B B;  4GMV A;  4ZRI A;  3RUL A;  3W1Y A;  2ZZP B;  3PS6 A;  4GDL B;  3ZDM C;  4JLC A;  3AUL A;  2OJR A;  3ZNI D;  3UGB B;  3WAN A;  4AJY B;  1J8C A;  1EO6 A;  2O6V D;  3QAQ A;  3ZVV A;  1NI2 A;  2MCN B;  5J2R A;  1L7Y A;  1WR6 E;  2FCN A;  2HTH A;  1WE7 A;  3UIO B;  3DBS A;  4I6P A;  4URK A;  2DX5 B;  3TMP B;  2C5L C;  2M1M A;  1E7V A;  4ZRK A;  3B1L X;  2DYO A;  3RZW C;  1V6E A;  4XC2 A;  4IC7 B;  1D3Z A;  3RD2 A;  3QHT A;  3DPD A;  2J0K A;  3DBL I;  3HM6 X;  2KTR A;  5BO4 B;  1H8C A;  2KFK A;  4LCD E;  2AEH A;  4M8N A;  1EF5 A;  4GDK B;  4XX5 A;  3IFW B;  2L76 A;  3IHP C;  5L95 C;  3DOW A;  3DVG Y;  3V6E B;  2LXA A;  4GU2 A;  3S2A A;  4NQL B;  2V4L A;  2CS4 A;  3VH4 B;  4X57 B;  1KOT A;  3P2B A;  5IAA C;  3TIX A;  3EFU A;  4BKS D;  4ANW A;  3NZS A;  3PHX B;  2BWF A;  1YX6 B;  1GC7 A;  2FCS A;  3B0A A;  4FBJ B;  4NQK E;  1WFY A;  1XT9 B;  2K8C A;  4MEL A;  2IY0 B;  1WZ3 A;  3EEC A;  1E8X A;  2K6D B;  5D94 A;  2KC2 A;  4CO7 A;  1E7U A;  1OEY J;  3ZLZ A;  4RMA A;  4E3C A;  2LI5 A;  4TUU A;  2KDF B;  2NR2 A;  1HE8 A;  4HWI B;  2HE7 A;  4A3O A;  2KQS A;  3H7P A;  2C7H A;  1ZW7 A;  1XQQ A;  1V5O A;  3A1Q B;  2KMA A;  5AZG A;  3V62 A;  4GN1 A;  4WWN A;  3QC8 B;  4WJN A;  1V81 A;  4M0W B;  4E71 A;  2DAF A;  2N1V A;  2RD0 A;  5L83 A;  4ZYN A;  2I1K A;  3A9J A;  5G2N A;  2DHZ A;  1UH6 A;  4GXB A;  4DDG D;  5LXI B;  1WM2 A;  2DEN B;  2KD0 A;  2L0T A;  4MDK E;  4PS8 A;  4MJS B;  4CYE A;  2IBI B;  1V86 A;  1WJ4 A;  3R7Q A;  3DBR I;  1SIF A;  4FJY A;  2LUE A;  2D11 A;  2UYZ B;  3HM3 A;  4HLE A;  4MSM B;  3R66 C;  4WWP A;  2KNB A;  2G4D B;  3WAL A;  3ZTD A;  2O2V A;  2Z0E B;  1WGG A;  2IYD B;  4K7S A;  4PYU A;  2ZPN A;  2DYB A;  2JRH A;  1ZGU B;  2K25 A;  3NS8 A;  1V5T A;  1WYW B;  2MA9 B;  4ZRJ A;  3K9P B;  1W6V A;  1UEL A;  3I3T B;  2V3S A;  1LQB A;  2BGF A;  3OAW A;  1RAX A;  2M8S A;  1WR1 A;  2NCN A;  1TBE A;  2LD9 A;  4JIO U;  2FUH B;  3RT3 B;  5J18 A;  3CMM B;  4FHJ A;  4K7U A;  2NS5 A;  2KC1 A;  1V2Y A;  1C1Y B;  2ZPY A;  2CR5 A;  1WXV A;  2ZJD A;  1Q5W B;  5J17 A;  2KDE B;  2N9X A;  3DBH I;  2FCM A;  2WX0 A;  4DK5 A;  3QA8 A;  2BKF A;  3UQB A;  2BYF A;  3BY4 B;  2YLM A;  1WGD A;  2LWP A;  3QX1 A;  1I42 A;  3VH3 B;  3LMN A;  1NBF C;  2M17 A;  2MBO A;  1P9D U;  2Z0D B;  4MM3 A;  3L10 B;  2HD5 B;  2C60 A;  4NPN A;  4G50 A;  3DQV A;  1Y8R C;  2O6V B;  3W1S C;  4EZK A;  2DAJ A;  3VXW A;  4B6W A;  1WX9 A;  3A4S C;  2J0M A;  2K8B A;  1WGR A;  3HIZ A;  2L0F A;  3PT2 B;  2J7Q B;  3V6C B;  3NZU A;  4E74 A;  2OOB B;  3L54 A;  4HCN B;  2LRW A;  2PE9 A;  4G3X B;  2LVQ A;  1WJ6 A;  3OJ3 A;  2NBW B;  3QCA A;  5DCN A;  4B95 A;  3PZD A;  2WYQ A;  5AZH A;  5C1Z A;  1IPG A;  1YD8 U;  4AP4 C;  4KSK C;  4WWO A;  3SD5 A;  1UD7 A;  1WJN A;  4WJQ A;  4GDK A;  3QIJ A;  2ZNV C;  4IM0 A;  2N1W A;  4NAW B;  3ZUN A;  3Q3J A;  3RUI B;  2FAZ A;  5JHA A;  1YIW A;  4NJ6 A;  3VHT C;  1OEY A;  3VDZ A;  2KTF A;  1V9J A;  4EFO A;  5LXH A;  5CHV C;  3NHE B;  2AYO B;  1P3Q U;  2RGF A;  2YVC A;  4K81 A;  2ZVN A;  2KWV B;  2ASQ A;  1Q1O A;  2C7M B;  3KUD B;  2MX2 A;  2JVC A;  1OTR B;  2L8J A;  2MBB B;  4F7Z A;  4FAD A;  2GBJ A;  4WJP A;  2NVU I;  3DVN U;  3U8Z A;  2KWC A;  1IYF A;  2PE6 B;  2M4N A;  5DPW A;  4HVB A;  1UBI A;  3PLU A;  2MWS B;  1GUA B;  3ZNG C;  2JPH A;  4ASW C;  4MSQ B;  3VTU A;  4PYZ A;  4GSW A;  3N3K B;  2KLG A;  1YJ1 A;  2R2O A;  2KX0 A;  3X23 A;  2JRI B;  2BYV E;  2FNJ B;  4BVU C;  3TJP A;  3QAR A;  4GGQ A;  2XK5 B;  2ZNV B;  3A1Q A;  3OJ4 B;  4KV2 A;  4EEW A;  4DBG A;  3M95 A;  3JYU A;  2ZVO A;  3LDZ E;  2MQJ A;  4G11 A;  2CHX A;  3RYT A;  3PHW B;  3A33 B;  3EHV A;  3ML8 A;  3NOB A;  2MP2 B;  2GBR A;  4IG7 B;  2D10 A;  3AI5 A;  4W9K A;  3ZO5 B;  2KDB A;  4RM8 A;  3T9L A;  3DCG A;  2IO2 B;  4II3 B;  5D2M B;  2K1F A;  3NY5 A;  2IO3 B;  1K8R B;  4IWQ A;  3SU8 X;  5CX3 A;  2ZCC A;  4IUM B;  4AOF A;  2HJ8 A;  2NBV B;  5D7G A;  3DVN V;  4HK2 A;  2LGX A;  1SGH A;  1UZX B;  1P0R A;  5DPT A;  4MGK E;  1Q0W B;  2C7N B;  4BBN F;  3C0R B;  1WX7 A;  4JGH B;  4TKN A;  2QHO A;  4FN2 A;  2KFK B;  2KKC A;  3JSV B;  3VUW A;  4BKT A;  2LXC A;  3VFK A;  4P7I A;  2KFJ A;  3VQI A;  3TBL D;  3VUY A;  2B3A A;  1TTN A;  3ZKJ C;  3X0W A;  4FJV B;  1WMH A;  2KXJ A;  2VRR B;  1EF1 A;  3M63 B;  2KOX A;  1YX5 B;  2D2Q A;  3MJW A;  1WI0 A;  4AUQ C;  2MW5 A;  2D07 B;  3KUZ A;  4M8M A;  1E90 A;  2R2Q A;  4BOS C;  1I35 A;  1WGY A;  2JF5 A;  2JUO A;  2RSU A;  1LM8 B;  2O6V A;  3DDC B;  2CU1 A;  2IY1 B;  2KHW B;  3KW5 B;  1E8Z A;  2IZV B;  4OVU A;  5G55 A;  3ZTC A;  3ENE A;  3UQA A;  4BFR A;  3L13 A;  5DPR A;  3APC A;  5JH5 C;  2GMI C;  4RM9 A;  3ZRC A;  2JXX A;  3UF8 A;  2KMC A;  3APF A;  1OQY A;  2KJ6 A;  4LDT D;  4J6I A;  4F1S A;  1FXT B;  1S3S G;  2KJH B;  4KIK B;  2XEW A;  3L16 A;  4JQW C;  4HDQ A;  4K7W A;  4FUL A;  4ICV A;  2DZM A;  1WXA A;  4GDL A;  3CSF A;  3H7P B;  2KZR A;  3HHM A;  3QK0 A;  5LLI A;  2LVP A;  4NAW A;  1ISN A;  2KWU B;  3HK0 A;  3EC8 A;  3N30 A;  5D6J B;  4W9E A;  2ZCB A;  3PTF C;  3A9J B;  2WDT B;  4KDI C;  4MEM A;  4TQ0 A;  1G6J A;  4I6N B;  1QZE A;  1T0Y A;  4W9L A;  4FHK A;  4DHZ B;  3R3M A;  3IG3 A;  3ZIM A;  1YQB A;  2LZ6 A;  3QJZ A;  3UIN B;  4NNJ B;  2A5U A;  3AU5 A;  4BKS A;  2KAN A;  2I1J A;  4KVG B;  3W1S A;  4HXD A;  3AU4 A;  4KZ0 A;  2O2V B;  2RPQ A;  2RR9 A;  2N9E B;  3UIP B;  4I6L B;  3A4R A; 
#chains in the Genus database with same CATH topology
 4N59 A;  3MTN B;  5G5H A;  2CKH B;  3RPF C;  4EZJ A;  1U4A A;  1ZKH A;  4F8C B;  2KYW A;  4IM2 A;  3ZJT A;  1M94 A;  1XLP A;  3RNF C;  1CQV A;  1IP9 A;  4N9F 4;  3T3N A;  1Z2M A;  2GOW A;  2CHW A;  2MP2 A;  3I63 C;  4K1R B;  2IGG A;  1YN4 A;  4MM3 B;  1TGZ B;  2Z59 B;  1JWS D;  1T6B X;  3KVF B;  3PRM B;  4REZ A;  3ZXV A;  2DWQ A;  3ECI A;  5JZE B;  2MBQ A;  2MLB A;  1WM3 A;  3Q8B A;  4G0N B;  3TCA A;  2WXH A;  3TL5 A;  4LNN A;  2B76 B;  1WY8 A;  1UWX A;  3KUC B;  4MJS A;  2DZJ A;  1CMX B;  2KN5 A;  2WXO A;  3M3J A;  3L08 A;  1S1Q B;  5GMV A;  3RCZ A;  5AEK B;  3FC4 A;  2BVC A;  3AEG B;  4IW0 A;  1T3Q A;  3VTW A;  1FXI A;  2V3N A;  2G4S A;  1WF9 A;  2EMT A;  2XBB C;  5E6P A;  3SFD B;  2G45 B;  3AMZ A;  1F77 A;  2MRP A;  2N7D A;  5CTR C;  2KTR B;  4P1B C;  3WAM A;  2LHE A;  1Q10 A;  4KIK A;  4DHJ B;  4XWW A;  1WIA A;  2WWZ A;  2KDI A;  1SE4 A;  4S17 A;  2ON8 A;  4W9F A;  1WX8 A;  3BVZ A;  3WIM A;  5EE3 A;  2WX1 A;  3MC0 B;  3AE1 B;  3WA0 A;  1RFK A;  5KHO A;  1TJE A;  4TV3 A;  2CHZ A;  4HCP B;  3NZ3 A;  4M00 A;  1RWS A;  1IUE A;  1FNU A;  1PQS A;  2LAS A;  3M62 B;  3A9K A;  4EKU A;  1VDV A;  4AWJ A;  1L4D B;  1KLG D;  1UGM A;  2EKE C;  3LJ3 A;  2IO0 B;  3ZW3 A;  2MBH A;  1E0Z A;  2Z8L A;  3H6N A;  4FA6 A;  3AEA B;  3Q3N C;  2NPT A;  1XEE A;  2BB6 A;  3H9D A;  2V9H A;  2JU6 X;  1A70 A;  4KSL C;  2WQY B;  2IND C;  2BF8 B;  2H88 B;  2PJH A;  1YMH E;  5BMH A;  2KQ7 A;  3V05 A;  4HDO A;  2D3G A;  4W9D A;  3R8B A;  3CWI A;  1AN8 A;  1L4Z B;  1OGW A;  4NJ7 A;  1WZ0 A;  1TT5 B;  1WXM A;  2Y5B B;  2K3U A;  2ZZP B;  4GDL B;  2MEK A;  3ZDM C;  1TY0 A;  3AUL A;  2JXT A;  2OJR A;  2LFI A;  1FRR A;  2AQ1 B;  1I4G A;  3ZGZ A;  3QAQ A;  4C4V A;  3ZVV A;  4ZHP A;  2FCN A;  3UIO B;  1GB4 A;  3B1L X;  1V6E A;  4XC2 A;  1D3Z A;  3QHT A;  2J0K A;  3NVY A;  1TZO A;  4B0E A;  2KFK A;  4LCD E;  4WIP A;  5L95 C;  2L76 A;  3DOW A;  3V6E B;  3VH4 B;  2CS4 A;  2VZK D;  2HDE A;  3P2B A;  3AE9 B;  3PHX B;  1FCL A;  1GC7 A;  2I2Y A;  2FCS A;  4TMA B;  1XT9 B;  3UI3 A;  3DBH B;  2IY0 B;  2INC C;  1OEY J;  1ZDV A;  1MJD A;  4TUU A;  2KDF B;  1XCT L;  1NEK B;  1DOX A;  1MG4 A;  4XWT A;  4GN1 A;  1F2R I;  3A9J A;  2DHZ A;  1UH6 A;  2V0G A;  1NYQ A;  1WM2 A;  4B0M A;  2KVZ A;  3PZ7 A;  4MJS B;  1V86 A;  1WJ4 A;  1LGR A;  1SIF A;  4GLS C;  2UYZ B;  3E56 A;  4WWP A;  3KLS X;  3WAL A;  3ZTD A;  2H89 B;  2IYD B;  3E9S A;  4ARI A;  1ZGU B;  2K25 A;  1OQQ A;  3DHH C;  1AW7 A;  4FHJ A;  2NS5 A;  3GS2 A;  1V2Y A;  4LK0 M;  3EFC A;  4N58 A;  3U52 E;  5J17 A;  2Y3A A;  2WX0 A;  2BKF A;  4FXC A;  3UQB A;  1V97 A;  2BYF A;  1UF0 A;  3P4P B;  3VH3 B;  1P9D U;  2VH1 A;  2SAK A;  5TSS A;  2C60 A;  1N5X A;  3AEE B;  1HTO A;  3DQV A;  3GB1 A;  3AM9 A;  3NZU A;  2QDF A;  2LVQ A;  1WGK A;  1BUI C;  3Q69 A;  1IPG A;  3I5J C;  4R3D A;  4P6V F;  4AP4 C;  4WWO A;  2JWU A;  3RNG C;  1WJN A;  1YIW A;  2GI9 A;  1V9J A;  4EFO A;  1K51 A;  4AQ7 A;  2KWV B;  2MX2 A;  3LXF A;  4C00 A;  2MBB B;  1QOF A;  3TEZ A;  2NVU I;  3DVN U;  3U8Z A;  3PLU A;  1GUA B;  3ZNG C;  3SR6 A;  2JPH A;  3VTU A;  5IO9 A;  2KLG A;  2JRI B;  3MJ5 A;  4BVU C;  3OJ4 B;  2ZNV B;  4WAF A;  4DBG A;  1JWU D;  2ZVO A;  3FIL A;  4G11 A;  3OG5 A;  3ML8 A;  2GBR A;  4IG7 B;  4LTU A;  5I4D A;  4RM8 A;  3T9L A;  2Q5W D;  1V1O A;  5D2M B;  2K1F A;  2ACZ B;  4JWS C;  2CJN A;  5CX3 A;  4IUM B;  1LO5 D;  2NBV B;  3Q8C A;  3AEF B;  3DVN V;  1XLN A;  1I4Q A;  1P0R A;  5DPT A;  1Q0W B;  1JW9 D;  4US8 A;  4H2A A;  3AE6 B;  3C0R B;  3NS1 A;  2QHO A;  3V3X A;  2KFK B;  2KKC A;  3JSV B;  3VUW A;  4KX6 B;  3VFK A;  4ZHO A;  3VQI A;  1YN3 A;  2WXN A;  3VUY A;  2B3A A;  2KXJ A;  2D2Q A;  5H8Y E;  3BK1 A;  3AE8 B;  2JF5 A;  1ZXI A;  2O6V A;  5D3I B;  1R4M B;  3W9C B;  2CU1 A;  3KW5 B;  3UQA A;  5JH5 C;  1NEN B;  2GMI C;  2JXX A;  1EM7 A;  1N5W A;  2PLP A;  2KMC A;  3UF8 A;  5IKC M;  4F1S A;  2PTL A;  2BBC A;  1S3S G;  2XEW A;  4ICV A;  3CSF A;  2BW2 A;  4NAW A;  2KWU B;  3EC8 A;  1VZ6 A;  2ZCB A;  3PTF C;  3A9J B;  4MEM A;  4KDI C;  1G6J A;  4I6N B;  1QZE A;  1T0Y A;  4P1C C;  4FHK A;  4DHZ B;  3R3M A;  3NVZ A;  3UIN B;  2WU5 B;  3I57 A;  4BKS A;  3GP7 A;  2N9L A;  2W54 A;  2N9E B;  2BTE A;  4I6L B;  1F2R C;  2KVR A;  5HKH A;  4W9G A;  1R4N I;  1VRA B;  2W55 A;  3IBE A;  4W9I A;  1GC6 A;  2PKO A;  5KHQ A;  3ZNH B;  4NY0 A;  2XK5 A;  3KYC D;  2OHF A;  2QCZ A;  1UGJ A;  4A8X C;  1YJJ A;  3RNC C;  3P42 A;  1L2N A;  1L0Y B;  1L0X B;  3URY A;  3AN1 A;  3IVF A;  2K8H A;  4HJK A;  3ZRF A;  3B08 A;  3GZN I;  2LEK A;  1V80 A;  2LJ5 A;  2ZW0 A;  3AED B;  1SF0 A;  3H8H A;  1WJU A;  2MJD A;  1P98 A;  2D3C A;  1VJK A;  4JE3 B;  2PEA A;  1XD3 B;  3PRZ A;  3WCQ A;  1WGH A;  1YOV B;  2MJ3 A;  3MFG A;  1E5W A;  1J0G A;  1AAR A;  2QEJ C;  3PVL A;  2GBN A;  2YEP F;  1GPX A;  1ZPS A;  4TQ1 A;  2FID A;  2NTT A;  4KGT A;  4IKG A;  1GJZ A;  2JZZ A;  2KLC A;  1E8Y A;  2G3Q B;  5EDS A;  1TY2 A;  2JWZ A;  3H1U A;  2V3P A;  3VVW B;  4LNI A;  1UNS A;  2LGD A;  1KJT A;  4OHJ A;  2M0X A;  3RNA C;  1KTK A;  4II2 B;  4XDD A;  4M02 A;  2JZ3 B;  4ANU A;  3D32 A;  3R7R A;  2I38 A;  4LJO B;  4IM3 A;  2ZEQ A;  4MGZ E;  3H7S A;  2MJE A;  3Q3O C;  3ETR A;  2GRI A;  2AL3 A;  1K53 A;  5IOI A;  2LJI A;  2QIE B;  4DHJ D;  2KWD A;  5IA7 A;  3PSE B;  2QSD A;  3V60 A;  3AXC A;  1A5R A;  2KAC A;  3APD A;  2D5G A;  1XXG A;  1FXA A;  2J52 A;  4ITK A;  5AZF A;  1HXY D;  1IBX A;  5CHF A;  3N1Z C;  2KX3 A;  4YSX B;  3BII D;  3N32 A;  1GAQ B;  2FIF A;  2EEL A;  3PPA A;  5TR5 A;  5EE1 A;  5BYR A;  1JAL A;  1GNU A;  2LHD A;  1L6U A;  1ESF A;  3JW0 X;  4CQN A;  1C78 A;  1HEZ E;  1UBQ A;  3HRD D;  3PGE A;  4IWO A;  1E7P B;  2NBU A;  3KYD D;  4KDL B;  2MBE A;  4WAA A;  3ML9 A;  3K9O B;  3RUL A;  4JWU C;  2L83 A;  1QLB B;  4L1B A;  2N7J A;  5T8I A;  3UGB B;  4OZA A;  1J8C A;  3TEX A;  2N9K A;  3TEY A;  4HRO A;  5J2R A;  2CU3 A;  3IT4 B;  3DBS A;  1TS5 A;  2DYO A;  3RZW C;  2J42 A;  4IC7 B;  2MHJ A;  1TYG B;  2AEH A;  4M8N A;  1EF5 A;  1QOA A;  4GDK B;  3S2A A;  2V4L A;  4P16 A;  3TIX A;  5C3J B;  3P4Q B;  1KLU D;  1L6V A;  4FBJ B;  1EWC A;  4DXG A;  2K8C A;  3IAS 1;  3IXS A;  3EEC A;  4DXF A;  5D94 A;  2KC2 A;  3N1X C;  3RFZ B;  2LI5 A;  2NR2 A;  2GB1 A;  3AB5 A;  4A3O A;  2C7H A;  1V5O A;  3V62 A;  4WJN A;  4M0W B;  3U7Z A;  2DAF A;  1MHH E;  4GXB A;  1KFY B;  1SEB D;  2DEN B;  2JSV X;  2L0T A;  5LXI B;  2M56 B;  4HRS A;  3R2T A;  3R7Q A;  3DBR I;  4HLE A;  2WHI A;  1D5Z C;  1WGG A;  4K7S A;  4PYU A;  1ROE A;  1PUT A;  2ZPN A;  2DYB A;  2JRH A;  3NS8 A;  1V5T A;  1WYW B;  4ZRJ A;  3I3T B;  5HFY A;  2V3S A;  2BGF A;  2M8S A;  1WR1 A;  1TBE A;  4JIO U;  2DBY A;  2ICI A;  2KC1 A;  4YTN B;  1C1Y B;  4XYC A;  2ZPY A;  2CR5 A;  2WXG A;  2W3S A;  1Q5W B;  3DBH I;  3QA8 A;  1WGD A;  2LWP A;  3QX1 A;  1NBF C;  4HKZ E;  2JX5 A;  2Z0D B;  1OQR A;  1Y8R C;  4B6W A;  1WX9 A;  1SE2 A;  3A4S C;  2L0F A;  2J7Q B;  1N61 A;  3L54 A;  4G3X B;  2KQ4 X;  3OJ3 A;  2NBW B;  1AWD A;  4B95 A;  1J7C A;  3BYT B;  1YD8 U;  1JRP A;  2PIA A;  1E9M A;  2N1W A;  3RUI B;  2SEB D;  5JHA A;  1XCQ L;  2KTF A;  3AH7 A;  1STE A;  5CHV C;  1WWT A;  1IBX B;  2RGF A;  2ZVN A;  4RGN A;  2ASQ A;  2C7M B;  3BVM A;  1OTR B;  2X38 A;  2JZP A;  4FAD A;  1E6E B;  3Q2A C;  4N6E B;  4ASW C;  2IDY A;  2KX0 A;  2FNJ B;  1TKY A;  4GGQ A;  3A1Q A;  2X8X X;  3AE4 B;  4KKI A;  2MQJ A;  2CHX A;  5EE0 A;  1SJH D;  3NOB A;  2MP2 B;  1JWM D;  4W9K A;  3Q3M C;  1F1H A;  3DCG A;  2IO2 B;  4NZL B;  1WSP A;  3NY5 A;  3FAH A;  1K8R B;  4AOF A;  1PFD A;  3W2D A;  2LMC A;  4A90 A;  3NG0 A;  4EE2 A;  1M4V A;  1I4X A;  1UUP A;  4MGK E;  2D3A A;  1C77 A;  4BBN F;  4M01 A;  4TKN A;  4FN2 A;  4P7I A;  1TKE A;  4LNK A;  1TTN A;  3X0W A;  1JQ4 A;  1WMH A;  1KRH A;  2KOX A;  1B9R A;  3KUZ A;  4BOS C;  1C9F A;  4MH8 A;  1L0V B;  2KHW B;  2IZV B;  2CJO A;  4BFR A;  3L13 A;  3APF A;  1OQY A;  2KJ6 A;  1MI0 A;  2KJH B;  2Y5P A;  4KIK B;  4JQW C;  1XLQ A;  2KZR A;  3HHM A;  3QK0 A;  5LLI A;  2LVP A;  3HVZ A;  3N30 A;  2FBW B;  4W9E A;  4YXD B;  3ZIM A;  1YQB A;  4Q2J A;  3P1M A;  3QJZ A;  3BWU D;  3AU5 A;  2KAN A;  2I1J A;  1J7B A;  3NRZ A;  2RR9 A;  3UIP B;  2W3R A;  2W9N A;  2QIL A;  3A9K B;  4C7Z A;  2NMQ A;  1QOB A;  4EZL A;  3KWL A;  2NPT B;  4LNO A;  2IGD A;  3WAO A;  4BBN C;  4YL8 A;  4ICU A;  4ANX A;  1H4R A;  4W9J A;  3T8M A;  1GG3 A;  3EA6 A;  5H92 C;  4ZRP A;  4DQO C;  2L52 A;  1I4H A;  4GOC A;  4W9H A;  1C3T A;  4W9C A;  3U7D A;  1PGX A;  5FR6 A;  2M19 A;  3SHQ A;  5E6O A;  2FCQ A;  3AEB B;  3QWZ B;  4MGY E;  3L0W B;  4LNF A;  1RLF A;  1TKG A;  2J53 A;  3RNB C;  1NDD A;  1XF5 L;  5E6N A;  2DZI A;  2BPS A;  4C4V B;  4KGR A;  4DDI D;  4FLH A;  4AJW A;  4B9K A;  5FKA C;  1F0Z A;  1C4A A;  1C79 A;  3O65 B;  4LJP B;  1V1P A;  2BWE S;  2M0A A;  4BZA A;  4YSZ B;  3TUO A;  1WRD B;  4EUT A;  2MSE D;  3VR8 B;  4PS7 A;  4YTM B;  3VTV A;  1KM7 A;  2DYM A;  1EU3 A;  2N7E A;  2WU2 B;  1VZ7 A;  1I4P A;  2WXK A;  1ZDX A;  4GB9 A;  2AWT A;  4L2Y A;  1SE9 A;  3RZF A;  4IWP A;  1K50 A;  3Q8E A;  4OVV A;  2QC8 A;  3ZQ4 A;  3CST A;  2DZK A;  3RNE C;  1PYW D;  3CF6 E;  3PV1 A;  1EUV B;  4BOZ B;  4MAC A;  3ONS A;  3SDL C;  2KO3 A;  1Z5S B;  5JHB A;  1RRB A;  2VH2 A;  2IO1 B;  2XN9 C;  3MHS D;  5C23 A;  3JVZ X;  1T5X D;  1WXS A;  3Q3F A;  1WRI A;  4ANV A;  4HPM B;  2V1Y A;  3AV8 A;  4RH6 A;  2IPK D;  2BQQ A;  4OW0 A;  1ZOY B;  2K9X A;  2OJW A;  4JL9 A;  4DHZ E;  2BT6 A;  1NI3 A;  1WMH B;  2K39 A;  2GBM A;  1QT9 A;  1WE6 A;  2LRU A;  4PT5 A;  2WXL A;  3ABV B;  1FPY A;  2LVO A;  2ONQ A;  2KJR A;  5HHD G;  2L05 A;  1V49 A;  2J0J A;  3KQ4 A;  3PRP B;  4GMV A;  4ZRI A;  3W1Y A;  3TSS A;  2AX5 A;  1EO6 A;  2MH7 A;  2O6V D;  1FEH A;  2YEP B;  4IDI A;  1NI2 A;  2MCN B;  1ZXH A;  4URK A;  1J7A A;  3OWE B;  2WXF A;  2C5L C;  1V8C A;  2M1M A;  4RCO A;  1E7V A;  4ZRK A;  2KT7 A;  3B2G A;  3C8Y A;  3DPD A;  3DBL I;  4K3C A;  3MHZ A;  2IJ0 A;  5BO4 B;  2KTR A;  2WP9 B;  4XX5 A;  3U4E G;  1DYQ A;  3Q8A A;  2LXA A;  4GU2 A;  3B2F A;  5FR3 A;  5BYS A;  3RMK C;  4C80 A;  4BKS D;  4ANW A;  3NZS A;  2TSS A;  2BWF A;  1YX6 B;  1FFU A;  2WXJ A;  4ZYS A;  3VRB B;  1WZ3 A;  2Y5C A;  2PVG C;  1FM0 D;  2K6D B;  3I9V 1;  4USA A;  3ZXR A;  3ZLZ A;  4RMA A;  4E3C A;  2QJL A;  3H7P A;  1SB3 C;  4WWN A;  3QC8 B;  4E71 A;  1FRD A;  1V81 A;  3FIL B;  2N1V A;  2RD0 A;  1FO4 A;  2K0P A;  4DDG D;  2KD0 A;  1HZ6 A;  1ZE3 D;  4PS8 A;  4HJG E;  1WXQ A;  3EUB 2;  4FJY A;  4MSM B;  1ENF A;  1R4N B;  3R66 C;  2O2V A;  5BYQ A;  1VZ8 A;  3W5U B;  4RF1 A;  3OAW A;  1LQB A;  2NCN A;  3P4S B;  2LD9 A;  3RT3 B;  2FUH B;  5J18 A;  3NVW A;  1WXV A;  1HQR D;  3GZN B;  2N9X A;  2FCM A;  1GB1 A;  3BY4 B;  2YLM A;  1RM6 C;  2E6X A;  1I42 A;  3TEW A;  2M17 A;  1VLB A;  5BMG A;  3DHI C;  2HD5 B;  4NPN A;  2O6V B;  3VXW A;  2J0M A;  1WGR A;  3HIZ A;  4E74 A;  4HCN B;  2OOB B;  2LRW A;  5DCN A;  1WJ6 A;  4KKJ A;  5AZH A;  5C1Z A;  2BS4 B;  1JCK B;  4KSK C;  3SD5 A;  1D6E C;  4WJQ A;  3QIJ A;  3ZUN A;  4NAW B;  1JWB D;  2PVO D;  2RDG A;  3VHT C;  1OEY A;  3VDZ A;  1P7F A;  2AYO B;  1P3Q U;  1DOY A;  4K81 A;  4S0R A;  1Q1O A;  3MC9 A;  3BVG A;  1SJE D;  4F7Z A;  3L4P A;  2GBJ A;  4WJP A;  1IYF A;  2PE6 B;  5DPW A;  1WYG A;  1UBI A;  2MWS B;  1FFV A;  3SEB A;  2XNA C;  1KH0 A;  2W82 A;  4C56 C;  1YJ1 A;  3X23 A;  1MHX A;  2WDQ B;  4WWM A;  3TJP A;  3QAR A;  2XK5 B;  2RPV A;  3M95 A;  3LDZ E;  3RYT A;  3EHV A;  1TS4 A;  1D4B A;  2D10 A;  3AI5 A;  4RNA A;  1N60 A;  2KDB A;  4RF0 A;  1CK1 A;  2WLB A;  4II3 B;  1B1Z A;  5D7G A;  1N63 A;  3R2I A;  4A9A A;  4HK2 A;  2R61 A;  1SGH A;  4YSY B;  2L1A A;  2C7N B;  4OZC A;  3DHG C;  1AYF A;  4RFB A;  2RDH A;  4BKT A;  4WQM A;  2KFJ A;  4NAM A;  1ACC A;  3Q14 C;  2VRR B;  3M63 B;  1EF1 A;  3NUH B;  1SXT A;  3MJW A;  4AUQ C;  2MW5 A;  2INP E;  1I35 A;  1KF6 B;  2JUO A;  1PGB A;  1YN5 A;  2IY1 B;  5G55 A;  4OVU A;  5DPR A;  3APC A;  4RM9 A;  3ZRC A;  2G9H D;  4LDT D;  4J6I A;  3L16 A;  4K7W A;  3AE3 B;  4FUL A;  1SBB B;  2DZM A;  4J3O D;  3H7P B;  5EE9 A;  3N20 C;  3N1Y C;  3HK0 A;  5D6J B;  4TQ0 A;  4W9L A;  2UU7 A;  3IG3 A;  1JML A;  4RGO S;  4NNJ B;  2A5U A;  4KVG B;  1R7S A;  3W1S A;  1L5P A;  3AU4 A;  4HXD A;  1JWA D;  1TIF A;  2O2V B;  3A4R A;  1N6Z A;  4UDU C;  4US9 A;  2REX A;  1LFD A;  4DXA B;  1JRU A;  2RDB C;  4MGI E;  2RMM A;  3ZDT A;  3ZJU A;  5MPO A;  2L7R A;  2BYT A;  2EMS A;  2WXQ A;  3NJT A;  3KWV A;  4PS3 A;  4ARC A;  1T0R C;  2K22 A;  4K3B A;  4WQO B;  1FD6 A;  2JT4 B;  5LNK 1;  1X1M A;  4XZ4 A;  1RFA A;  4PK1 A;  3T3O A;  1VD2 A;  1XLO A;  2A4Z A;  2LGY A;  2V4I B;  5D3D A;  3QQ8 B;  2LGI A;  4CHK A;  4HPP A;  2BYE A;  1C4C A;  1KLV A;  3DBR B;  4KZC A;  4DWF A;  1MG8 A;  3IAM 1;  2KK8 A;  2L3Z A;  2GBK A;  3JSV A;  4GIV A;  1P1A A;  2JY6 A;  1GOZ A;  2KMM A;  3VUX A;  4ZDV A;  4A3P A;  2PPH A;  3HVD A;  2EKI A;  3L17 A;  3MP9 A;  1F9J A;  4WJO A;  4JPS A;  1I7H A;  5CHW A;  2FUG 1;  1EU4 A;  1TZ1 A;  1J19 A;  3B9J A;  1TS2 A;  2HJ1 A;  4BKG A;  1CZP A;  4EOY A;  5JXV A;  3NVV A;  4BAX A;  3W5V B;  4FJZ A;  2WGS A;  4LDT B;  3V61 A;  2C9W B;  2LGS A;  2D3B A;  2L00 B;  1T0S C;  2AL6 A;  5BMI A;  1FCC C;  5E6J A;  3OLM D;  3AE2 B;  1NVI D;  4MH0 E;  1UWM A;  3WAP A;  2N4F A;  3RN9 C;  1QF6 A;  3U30 A;  2BKR B;  1BT0 A;  3KH0 A;  1FNW A;  3ALB A;  1LXD A;  4WUR A;  4A20 A;  3PO0 A;  3BZD B;  3SFE B;  1PDX A;  2KAJ A;  3BIN A;  3PRE A;  1MPE A;  2K6Q A;  3HUI A;  1WH3 A;  3IT6 B;  3P4R B;  4ACF A;  2GLS A;  3ZNZ B;  1E8W A;  5DPS A;  2N9P C;  2KN4 A;  3ZJV A;  2UWQ A;  4HPL B;  3GE8 C;  2WS3 B;  1YQ3 B;  4IOI E;  1NYR A;  3GOE A;  3PLV A;  3RI7 C;  1ET6 A;  1T0Q C;  1VCB A;  1JRO A;  3DVG X;  3VAW A;  1R4M I;  1VR9 A;  3AE7 B;  1HA5 A;  3PS6 A;  2QMT A;  4JLC A;  1Y56 A;  3ZNI D;  3WAN A;  4AJY B;  4A6Q A;  4LLG M;  2VZK B;  1L7Y A;  1WR6 E;  2HTH A;  1WE7 A;  4I6P A;  5HI1 A;  1N62 A;  2DX5 B;  3TMP B;  4ZRQ A;  1HZ5 A;  5C2T B;  1SE3 A;  3RD2 A;  3Q6B A;  3HM6 X;  2JQR B;  1H8C A;  4HKQ A;  3IFW B;  1C4P A;  3IHP C;  3DVG Y;  4NQL B;  3LB8 C;  4X57 B;  1KOT A;  5IAA C;  3DWG C;  3EFU A;  4YTP B;  3B0A A;  2HTM E;  4NQK E;  1WFY A;  4MEL A;  2DLB A;  1E8X A;  3PZ8 A;  2AQ2 B;  4CO7 A;  1E7U A;  5FK9 C;  2BB5 A;  3EGR A;  4HWI B;  1HE8 A;  2HE7 A;  2KQS A;  1ZW7 A;  1XQQ A;  1SIJ A;  3A1Q B;  2KMA A;  5AZG A;  3J9C A;  2PW9 A;  4JX1 C;  2AQ3 B;  5L83 A;  3AEC B;  2I1K A;  5G2N A;  4ZYN A;  4C7Y A;  4MDK E;  1TS3 A;  2INN E;  4CYE A;  2IBI B;  3BYY B;  2LUE A;  2D11 A;  3HM3 A;  3U2S C;  1I4R A;  2KNB A;  2G4D B;  2Z0E B;  2WNM A;  4XE0 A;  2ZW1 A;  2MA9 B;  4HEA 1;  3K9P B;  1W6V A;  1MFW A;  1UEL A;  1RAX A;  5AUK A;  3CMM B;  4K7U A;  3LYY A;  3GE3 C;  1OFF A;  4MT5 A;  4XGA B;  4YT0 B;  2ZJD A;  3FKY A;  2KDE B;  4O1N A;  4DK5 A;  5GXG B;  1E10 A;  3LMN A;  2MBO A;  5IN7 A;  1CJE A;  4MM3 A;  3VRA B;  1EWY C;  3L10 B;  4G50 A;  1P7E A;  3ZYY X;  1FNV A;  2WXR A;  3O13 A;  2DAJ A;  3W1S C;  4EZK A;  2K8B A;  3PT2 B;  4D2K A;  3V6C B;  1SSN A;  4RGT A;  1C76 A;  3CIR B;  2PE9 A;  3QCA A;  3PZD A;  2WYQ A;  2WDR B;  4OVZ A;  1K52 A;  1UD7 A;  4GDK A;  2ZNV C;  4IM0 A;  3Q3J A;  1IGD A;  2FAZ A;  4NJ6 A;  5LXH A;  3NHE B;  2YVC A;  2FE8 A;  3KUD B;  4OZB A;  2JVC A;  2L8J A;  2N0S B;  5HG2 A;  2BS2 B;  2WXM A;  5AUI A;  1RYJ A;  2KWC A;  2M4N A;  4HVB A;  1MVK A;  2KDM A;  4MSQ B;  4PYZ A;  4GSW A;  3N3K B;  1XO3 A;  2R2O A;  2BYV E;  4RGM A;  1QQR A;  4KV2 A;  4EEW A;  3JYU A;  3C19 A;  3MC8 A;  4M0W A;  4TSS A;  3PHW B;  3A33 B;  1QKZ A;  4YWG G;  2OED A;  3BK2 A;  4L23 A;  4ZOH C;  3ZO5 B;  2E3T A;  2K5P A;  3Q8F A;  2DNF A;  1DGJ A;  4NJC A;  2J4X A;  2IO3 B;  3SU8 X;  4IWQ A;  2WDV B;  2ZCC A;  2HJ8 A;  1PGA A;  1D5X C;  1D5M C;  2LGX A;  1UZX B;  2WXI A;  4KGS A;  4QAY A;  1BML C;  2BS3 B;  3DWM A;  1FMA D;  1WX7 A;  4JGH B;  1QIL A;  2LXC A;  3TBL D;  1HTQ A;  3ZKJ C;  4FJV B;  2JYE A;  1F52 A;  1DOI A;  1YX5 B;  1WI0 A;  1YJI A;  2JYT A;  2D07 B;  4M8M A;  1E90 A;  2R2Q A;  1WGY A;  2RSU A;  1LM8 B;  2L32 A;  3DDC B;  4AS1 A;  1E8Z A;  1V1P B;  3ZTC A;  3ENE A;  1ET9 A;  1ZUD 2;  2IGH A;  4WH4 A;  5IP4 D;  2G1E A;  1FXT B;  3P63 A;  4HDQ A;  1WXA A;  4GDL A;  1FIQ A;  1ISN A;  2WXP A;  2WDT B;  4XDC A;  2NTS A;  3VR9 B;  1BXT A;  1YQ4 B;  2LZ6 A;  2LUM A;  3N9Y C;  3DBL B;  5G5G A;  1YNT E;  4A55 A;  3AE5 B;  1IGC A;  2PMV A;  1ZP0 B;  2RPQ A;  4KZ0 A;  1QOG A; 
#chains in the Genus database with same CATH homology
 2KVR A;  5HKH A;  2W9N A;  3MTN B;  4W9G A;  2CKH B;  4EZJ A;  2REX A;  3A9K B;  1R4N I;  1LFD A;  4DXA B;  1JRU A;  1U4A A;  1ZKH A;  4MGI E;  3ZDT A;  4F8C B;  3IBE A;  2L7R A;  2EMS A;  4IM2 A;  4W9I A;  1GC6 A;  5KHQ A;  1M94 A;  3ZNH B;  4NY0 A;  2XK5 A;  3KYC D;  1IP9 A;  4EZL A;  4N9F 4;  4PS3 A;  2NPT B;  4WQO B;  1Z2M A;  2GOW A;  4BBN C;  3WAO A;  2JT4 B;  1L2N A;  2CHW A;  4YL8 A;  2MP2 A;  1X1M A;  4K1R B;  4ICU A;  4XZ4 A;  3IVF A;  1RFA A;  4ANX A;  2K8H A;  1H4R A;  4HJK A;  3ZRF A;  4W9J A;  1VD2 A;  3B08 A;  3GZN I;  3T8M A;  1GG3 A;  2A4Z A;  2LGY A;  1TGZ B;  1V80 A;  2Z59 B;  2LJ5 A;  4GOC A;  4W9H A;  1C3T A;  4W9C A;  3PRM B;  3KVF B;  3U7D A;  3ECI A;  5FR6 A;  3QQ8 B;  5JZE B;  1WJU A;  3SHQ A;  1P98 A;  2MBQ A;  1WM3 A;  2MLB A;  5E6O A;  4CHK A;  2FCQ A;  3QWZ B;  2PEA A;  4G0N B;  4MGY E;  3TCA A;  1XD3 B;  3PRZ A;  2BYE A;  3TL5 A;  1KLV A;  4KZC A;  1WGH A;  1WY8 A;  4DWF A;  1MG8 A;  3L0W B;  2L3Z A;  2KK8 A;  1E5W A;  1RLF A;  2GBK A;  1J0G A;  1AAR A;  3JSV A;  3KUC B;  1P1A A;  1NDD A;  2JY6 A;  4GIV A;  4MJS A;  3PVL A;  2DZJ A;  2GBN A;  2DZI A;  5E6N A;  1CMX B;  2KN5 A;  3VUX A;  4ZDV A;  3M3J A;  4TQ1 A;  3L08 A;  1S1Q B;  5GMV A;  4A3P A;  2PPH A;  2BPS A;  3RCZ A;  5AEK B;  3L17 A;  2FID A;  4IW0 A;  4DDI D;  1GJZ A;  1F9J A;  4FLH A;  4WJO A;  2JZZ A;  3VTW A;  2KLC A;  5CHW A;  4AJW A;  4B9K A;  2G4S A;  1E8Y A;  1TZ1 A;  2G3Q B;  1J19 A;  1WF9 A;  2JWZ A;  3H1U A;  2EMT A;  3VVW B;  4BKG A;  2XBB C;  5EDS A;  3O65 B;  5E6P A;  4EOY A;  2G45 B;  4LJP B;  2LGD A;  1KJT A;  2MRP A;  2N7D A;  2BWE S;  5CTR C;  2KTR B;  2M0X A;  3WAM A;  4II2 B;  4FJZ A;  1WRD B;  4KIK A;  4DHJ B;  4EUT A;  2MSE D;  2JZ3 B;  4LDT B;  1WIA A;  4PS7 A;  4ANU A;  2WWZ A;  3VTV A;  1KM7 A;  2DYM A;  3V61 A;  2C9W B;  2KDI A;  3D32 A;  2L00 B;  2N7E A;  3R7R A;  4W9F A;  4LJO B;  1WX8 A;  3WIM A;  4IM3 A;  4GB9 A;  2ZEQ A;  4MGZ E;  3H7S A;  2WX1 A;  2AWT A;  2AL6 A;  3WA0 A;  1SE9 A;  3RZF A;  4IWP A;  3OLM D;  2AL3 A;  4OVV A;  5KHO A;  3CST A;  2DZK A;  4MH0 E;  3WAP A;  2N4F A;  3CF6 E;  4DHJ D;  3PV1 A;  1EUV B;  2CHZ A;  4TV3 A;  5IA7 A;  3PSE B;  4BOZ B;  3V60 A;  4HCP B;  2BKR B;  3AXC A;  3ONS A;  3SDL C;  3U30 A;  1BT0 A;  2KO3 A;  1Z5S B;  3ALB A;  3KH0 A;  1A5R A;  5JHB A;  1LXD A;  3APD A;  1RRB A;  4A20 A;  1PQS A;  2LAS A;  3M62 B;  3A9K A;  2IO1 B;  4EKU A;  4AWJ A;  1UGM A;  2EKE C;  3LJ3 A;  2IO0 B;  3ZW3 A;  2MBH A;  3MHS D;  5C23 A;  3BIN A;  3JVZ X;  3H6N A;  3PRE A;  5AZF A;  4FA6 A;  1WXS A;  3Q3F A;  5CHF A;  4ANV A;  2K6Q A;  2NPT A;  3H9D A;  4HPM B;  2KX3 A;  2V1Y A;  4KSL C;  3N32 A;  1WH3 A;  4JL9 A;  2BF8 B;  4DHZ E;  2FIF A;  3ZNZ B;  1E8W A;  3PPA A;  5TR5 A;  1WMH B;  2PJH A;  2K39 A;  5DPS A;  2GBM A;  2N9P C;  1WE6 A;  1GNU A;  2LRU A;  2UWQ A;  2KQ7 A;  4HPL B;  3JW0 X;  4HDO A;  2D3G A;  4W9D A;  3GOE A;  1UBQ A;  3PLV A;  3PGE A;  4IWO A;  2LVO A;  2KJR A;  2NBU A;  3KYD D;  4KDL B;  2L05 A;  1VCB A;  1OGW A;  2MBE A;  4NJ7 A;  1V49 A;  4WAA A;  3DVG X;  1WZ0 A;  3VAW A;  2J0J A;  1R4M I;  3ML9 A;  3K9O B;  3PRP B;  1WXM A;  2Y5B B;  4GMV A;  4ZRI A;  3RUL A;  3W1Y A;  2ZZP B;  3PS6 A;  4GDL B;  3ZDM C;  4JLC A;  3AUL A;  2OJR A;  3ZNI D;  3UGB B;  3WAN A;  4AJY B;  1J8C A;  1EO6 A;  2O6V D;  3QAQ A;  3ZVV A;  1NI2 A;  2MCN B;  5J2R A;  1L7Y A;  1WR6 E;  2FCN A;  2HTH A;  1WE7 A;  3UIO B;  3DBS A;  4I6P A;  4URK A;  2DX5 B;  3TMP B;  2C5L C;  2M1M A;  1E7V A;  4ZRK A;  3B1L X;  2DYO A;  3RZW C;  1V6E A;  4XC2 A;  4IC7 B;  1D3Z A;  3RD2 A;  3QHT A;  3DPD A;  2J0K A;  3DBL I;  3HM6 X;  2KTR A;  5BO4 B;  1H8C A;  2KFK A;  4LCD E;  2AEH A;  4M8N A;  1EF5 A;  4GDK B;  4XX5 A;  3IFW B;  2L76 A;  3IHP C;  5L95 C;  3DOW A;  3DVG Y;  3V6E B;  2LXA A;  4GU2 A;  3S2A A;  4NQL B;  2V4L A;  2CS4 A;  3VH4 B;  4X57 B;  1KOT A;  3P2B A;  5IAA C;  3TIX A;  3EFU A;  4BKS D;  4ANW A;  3NZS A;  3PHX B;  2BWF A;  1YX6 B;  1GC7 A;  2FCS A;  3B0A A;  4FBJ B;  4NQK E;  1WFY A;  1XT9 B;  2K8C A;  4MEL A;  2IY0 B;  1WZ3 A;  3EEC A;  1E8X A;  2K6D B;  5D94 A;  2KC2 A;  4CO7 A;  1E7U A;  1OEY J;  3ZLZ A;  4RMA A;  4E3C A;  2LI5 A;  4TUU A;  2KDF B;  2NR2 A;  1HE8 A;  4HWI B;  2HE7 A;  4A3O A;  2KQS A;  3H7P A;  2C7H A;  1ZW7 A;  1XQQ A;  1V5O A;  3A1Q B;  2KMA A;  5AZG A;  3V62 A;  4GN1 A;  4WWN A;  3QC8 B;  4WJN A;  1V81 A;  4M0W B;  4E71 A;  2DAF A;  2N1V A;  2RD0 A;  5L83 A;  4ZYN A;  2I1K A;  3A9J A;  5G2N A;  2DHZ A;  1UH6 A;  4GXB A;  4DDG D;  5LXI B;  1WM2 A;  2DEN B;  2KD0 A;  2L0T A;  4MDK E;  4PS8 A;  4MJS B;  4CYE A;  2IBI B;  1V86 A;  1WJ4 A;  3R7Q A;  3DBR I;  1SIF A;  4FJY A;  2LUE A;  2D11 A;  2UYZ B;  3HM3 A;  4HLE A;  4MSM B;  3R66 C;  4WWP A;  2KNB A;  2G4D B;  3WAL A;  3ZTD A;  2O2V A;  2Z0E B;  1WGG A;  2IYD B;  4K7S A;  4PYU A;  2ZPN A;  2DYB A;  2JRH A;  1ZGU B;  2K25 A;  3NS8 A;  1V5T A;  1WYW B;  2MA9 B;  4ZRJ A;  3K9P B;  1W6V A;  1UEL A;  3I3T B;  2V3S A;  1LQB A;  2BGF A;  3OAW A;  1RAX A;  2M8S A;  1WR1 A;  2NCN A;  1TBE A;  2LD9 A;  4JIO U;  2FUH B;  3RT3 B;  5J18 A;  3CMM B;  4FHJ A;  4K7U A;  2NS5 A;  2KC1 A;  1V2Y A;  1C1Y B;  2ZPY A;  2CR5 A;  1WXV A;  2ZJD A;  1Q5W B;  5J17 A;  2KDE B;  2N9X A;  3DBH I;  2FCM A;  2WX0 A;  4DK5 A;  3QA8 A;  2BKF A;  3UQB A;  2BYF A;  3BY4 B;  2YLM A;  1WGD A;  2LWP A;  3QX1 A;  1I42 A;  3VH3 B;  3LMN A;  1NBF C;  2M17 A;  2MBO A;  1P9D U;  2Z0D B;  4MM3 A;  3L10 B;  2HD5 B;  2C60 A;  4NPN A;  4G50 A;  3DQV A;  1Y8R C;  2O6V B;  3W1S C;  4EZK A;  2DAJ A;  3VXW A;  4B6W A;  1WX9 A;  3A4S C;  2J0M A;  2K8B A;  1WGR A;  3HIZ A;  2L0F A;  3PT2 B;  2J7Q B;  3V6C B;  3NZU A;  4E74 A;  2OOB B;  3L54 A;  4HCN B;  2LRW A;  2PE9 A;  4G3X B;  2LVQ A;  1WJ6 A;  3OJ3 A;  2NBW B;  3QCA A;  5DCN A;  4B95 A;  3PZD A;  2WYQ A;  5AZH A;  5C1Z A;  1IPG A;  1YD8 U;  4AP4 C;  4KSK C;  4WWO A;  3SD5 A;  1UD7 A;  1WJN A;  4WJQ A;  4GDK A;  3QIJ A;  2ZNV C;  4IM0 A;  2N1W A;  4NAW B;  3ZUN A;  3Q3J A;  3RUI B;  2FAZ A;  5JHA A;  1YIW A;  4NJ6 A;  3VHT C;  1OEY A;  3VDZ A;  2KTF A;  1V9J A;  4EFO A;  5LXH A;  5CHV C;  3NHE B;  2AYO B;  1P3Q U;  2RGF A;  2YVC A;  4K81 A;  2ZVN A;  2KWV B;  2ASQ A;  1Q1O A;  2C7M B;  3KUD B;  2MX2 A;  2JVC A;  1OTR B;  2L8J A;  2MBB B;  4F7Z A;  4FAD A;  2GBJ A;  4WJP A;  2NVU I;  3DVN U;  3U8Z A;  2KWC A;  1IYF A;  2PE6 B;  2M4N A;  5DPW A;  4HVB A;  1UBI A;  3PLU A;  2MWS B;  1GUA B;  3ZNG C;  2JPH A;  4ASW C;  4MSQ B;  3VTU A;  4PYZ A;  4GSW A;  3N3K B;  2KLG A;  1YJ1 A;  2R2O A;  2KX0 A;  3X23 A;  2JRI B;  2BYV E;  2FNJ B;  4BVU C;  3TJP A;  3QAR A;  4GGQ A;  2XK5 B;  2ZNV B;  3A1Q A;  3OJ4 B;  4KV2 A;  4EEW A;  4DBG A;  3M95 A;  3JYU A;  2ZVO A;  3LDZ E;  2MQJ A;  4G11 A;  2CHX A;  3RYT A;  3PHW B;  3A33 B;  3EHV A;  3ML8 A;  3NOB A;  2MP2 B;  2GBR A;  4IG7 B;  2D10 A;  3AI5 A;  4W9K A;  3ZO5 B;  2KDB A;  4RM8 A;  3T9L A;  3DCG A;  2IO2 B;  4II3 B;  5D2M B;  2K1F A;  3NY5 A;  2IO3 B;  1K8R B;  4IWQ A;  3SU8 X;  5CX3 A;  2ZCC A;  4IUM B;  4AOF A;  2HJ8 A;  2NBV B;  5D7G A;  3DVN V;  4HK2 A;  2LGX A;  1SGH A;  1UZX B;  1P0R A;  5DPT A;  4MGK E;  1Q0W B;  2C7N B;  4BBN F;  3C0R B;  1WX7 A;  4JGH B;  4TKN A;  2QHO A;  4FN2 A;  2KFK B;  2KKC A;  3JSV B;  3VUW A;  4BKT A;  2LXC A;  3VFK A;  4P7I A;  2KFJ A;  3VQI A;  3TBL D;  3VUY A;  2B3A A;  1TTN A;  3ZKJ C;  3X0W A;  4FJV B;  1WMH A;  2KXJ A;  2VRR B;  1EF1 A;  3M63 B;  2KOX A;  1YX5 B;  2D2Q A;  3MJW A;  1WI0 A;  4AUQ C;  2MW5 A;  2D07 B;  3KUZ A;  4M8M A;  1E90 A;  2R2Q A;  4BOS C;  1I35 A;  1WGY A;  2JF5 A;  2JUO A;  2RSU A;  1LM8 B;  2O6V A;  3DDC B;  2CU1 A;  2IY1 B;  2KHW B;  3KW5 B;  1E8Z A;  2IZV B;  4OVU A;  5G55 A;  3ZTC A;  3ENE A;  3UQA A;  4BFR A;  3L13 A;  5DPR A;  3APC A;  5JH5 C;  2GMI C;  4RM9 A;  3ZRC A;  2JXX A;  3UF8 A;  2KMC A;  3APF A;  1OQY A;  2KJ6 A;  4LDT D;  4J6I A;  4F1S A;  1FXT B;  1S3S G;  2KJH B;  4KIK B;  2XEW A;  3L16 A;  4JQW C;  4HDQ A;  4K7W A;  4FUL A;  4ICV A;  2DZM A;  1WXA A;  4GDL A;  3CSF A;  3H7P B;  2KZR A;  3HHM A;  3QK0 A;  5LLI A;  2LVP A;  4NAW A;  1ISN A;  2KWU B;  3HK0 A;  3EC8 A;  3N30 A;  5D6J B;  4W9E A;  2ZCB A;  3PTF C;  3A9J B;  2WDT B;  4KDI C;  4MEM A;  4TQ0 A;  1G6J A;  4I6N B;  1QZE A;  1T0Y A;  4W9L A;  4FHK A;  4DHZ B;  3R3M A;  3IG3 A;  3ZIM A;  1YQB A;  2LZ6 A;  3QJZ A;  3UIN B;  4NNJ B;  2A5U A;  3AU5 A;  4BKS A;  2KAN A;  2I1J A;  4KVG B;  3W1S A;  4HXD A;  3AU4 A;  4KZ0 A;  2O2V B;  2RPQ A;  2RR9 A;  2N9E B;  3UIP B;  4I6L B;  3A4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...