3JZ3A

Structure of the cytoplasmic segment of histidine kinase qsec
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
178
structure length
151
Chain Sequence
ALLQLHGIDRATRLVDQLLTLSRLDSLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHSIKRTGQPLLLSLLVRNLLDNAVRYSPQGSVVDVTLNADNFIVRDNGPLGLSIVQRIAKLHGMNVEFGNAEQGGFEAKVSWLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein qseC
publication title Structure of the Cytoplasmic Segment of Histidine Kinase Receptor QseC, a Key Player in Bacterial Virulence.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 39
structure length 151
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00512 HisKA His Kinase A (phospho-acceptor) domain
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3jz3A01
1UY7A 2XCMA 1UYDA 2Q8GA 4K4OA 4O09A 2YKEA 4O07A 4LWEA 2YI0A 1Z5CA 1ZXMA 5CTYA 2QG0A 4YKWA 4I5SA 2QF6A 2VCIA 2BTZA 3G75A 4R3MA 3ZXOA 2XX2A 2IWSA 3SL2A 3TZ5A 1U2OA 1QY8A 4L8ZA 2YE8A 4PL9A 3TZ2A 4AS9A 3GIFA 5IDMA 2XDUA 4XDMA 5BODA 4GQTA 3OWDA 4H7QA 1Y8OA 5BOCA 3VHCA 2CH4A 4WUCA 5IN9A 4MP2A 4KSHA 1QZRA 5D7CA 2YEGA 4U93A 3DGEA 1L0OA 3CWVA 3R4MA 4YKZA 3FT8A 4EGHA 3H4LA 4LWGA 3R4OA 5IDJA 5J71A 5D7RA 4NH8A 1I5AA 2C2AA 3R4PA 4CWTA 2HCHA 2XJXA 1AJ6A 4CWPA 1YT0A 2QG2A 4V26A 4FCQA 1YESA 4HYMA 4HY6A 4JAVA 2O1WA 3A0RA 4BQGA 5C93A 5D6PA 1I5BA 4YKUA 3EHFA 2GFDA 4JAUA 2YGEA 2BU7A 3IEDA 3A0WA 4U7OA 4XKKA 3INXA 2YEEA 1H7UA 4ASBA 3C0EA 3HYYA 4O04A 4O05A 2Q8IA 3ZXQA 1UY9A 4HY1A 4V25A 2WI5A 1AM1A 2XJGA 1UYHA 4AWQA 4XIQA 2Q8HA 2BU8A 2XDXA 2QFOA 3LPSA 4HZ5A 2BT0A 5CTUA 4KFGA 1NHJA 3RKZA 1YC1A 4WUBA 3VHAA 2WI1A 4CWOA 3K97A 2YKJA 3TZ4A 3B26A 4P7AA 2YKCA 1I5CA 2HKJA 1YT1A 4UROA 2WI3A 2YE6A 4YKRA 3Q5LA 4URNA 2BRCA 5CF0A 2IOPA 4EGIA 1BGQA 4DZYA 2O1VA 3O6OA 2YGFA 5J6AA 1JM6A 1UYMA 5GGZA 4MB9A 4BIZA 1Z5AA 2VWCA 1TIDA 1ZW9A 4H81A 3CRKA 1EI1A 1BYQA 2YEFA 3CRLA 2H8MA 4CE2A 1B62A 3A0YA 4XTJA 2WERA 5F5RA 4ASFA 1Y8PA 1EA6A 3B28A 3NMQA 4CWFA 4XD8A 1NHIA 4CE1A 3HEKA 1ZWHA 3R91A 3FV5A 1YS3A 3D36A 1GKZA 4L90A 3KE6A 2FXSA 2VW5A 1YERA 2Q8FA 1YSZA 2BU5A 3T0HA 3FT5A 3RLPA 3TZ0A 2XHXA 4WUDA 4MPEA 4B7PA 4CWQA 4URMA 4LPBA 1BXDA 2YEDA 4Q20A 1TC0A 1PVGA 3EHGA 4PU9A 4PRVA 1US7A 2CCSA 3PEHA 3WHAA 3WQ9A 5FNFA 4HZ0A 4JQLA 4KSGA 4H85A 3RLRA 3D0BA 1I5DA 4KQVA 1Z59A 2YEBA 1TILA 3OWBA 3PEJA 3H80A 3ZM7A 2XX4A 4MBCA 5M4KA 4EMVA 4CWSA 1TBWA 3A0ZA 3A0TA 2YI5A 4L94A 2XHRA 4P8OA 4XKOA 4X9LA 1A4HA 2YE9A 4AWOA 1MU5A 1UY8A 4GEEA 3HZ5A 3K60A 2YKIA 1OSFA 4LP0A 3EHHA 3JZ3A 2XDLA 2YGAA 1UYFA 2XDKA 4BAEA 3U2KA 4W7TA 2GQPA 3TTZA 2BYHA 2BZ5A 2XK2A 2YE7A 4GCZA 3K98A 2FWYA 3OPDA 1UYLA 1UY6A 4XC0A 2YEHA 4GGLA 3T2SA 3HHUA 2IORA 1Y4UA 2YE5A 5M4PA 1THNA 4XIPA 3A0XA 4NH9A 4O0BA 2BU2A 4FCPA 2VCJA 2PNRA 1UYGA 4XCJA 4YKXA 1UYIA 1GJVA 3ZKBA 4ZKIA 2ZDXA 3K99A 3TUHA 1AH6A 3Q5KA 1B3QA 1NHHA 1TH8A 4QPJA 4CWRA 4CWNA 4ZVIA 2XHTA 2YEJA 3CGZA 1UYCA 4FMTA 4LWIA 5D6QA 1BKNA 3HZ1A 4HXWA 1MX0A 4L91A 4LWFA 4LWHA 5CTWA 4YKYA 1H7SA 4BXIA 4B6CA 3R4NA 4XKAA 2BREA 1YC4A 3HYZA 5FNCA 2YK2A 1QYEA 4PRXA 4MPCA 4EFTA 2XD6A 4FPPA 4JASA 3GIGA 4AWPA 3EKRA 1B63A 3T0ZA 4YKTA 2CGFA 2IOQA 2WEQA 4CE3A 2YEAA 2WI7A 2XX5A 3B27A 4MPNA 2HG1A 4R3AA 2YJXA 1I59A 2ZDYA 4EFUA 4U7NA 3BMYA 2YI7A 3EHJA 2YI6A 2H55A 3GIGB 1YC3A 3OMUA 1S16A 1ID0A 4GT8A 4BIUA 2WI4A 3QDDA 4E02A 4QPKA 3D2RA 3T10A 1YT2A 1Y8NA 2AKPA 3ZKDA 1GKXA 4KP4A 4MP7A 4I3HA 4BQJA 1TC6A 3Q5JA 2FWZA 4HYPA 5FWKA 2JKIA 4URLA 3R92A 1S14A 2EXLA 2WI2A 2YE4A 5F3KA 3O2FA 5M4NA 1U0ZA 1AH8A 1UYKA 5FNDA 2XDSA 2ZBKB 1YSRA 3C11A 3U2DA 1Z5BA 3O0IA 3B24A 3INWA 4EGKA 2XABA 2FYPA 2UWDA 2IWXA 2E0AA 2IWUA 2XJJA 3CGYA 3OW6A 3T1KA 3VHDA 4E01A 3U67A 1ZXNA 2JJCA 5M4HA 1KIJA 4XCLA 4KTNA 4ASAA 4MOTA 3G7EA 5M4EA 5CPHA 1I58A 3B25A 1R62A 2YKBA 1KZNA 4HXZA 4ASGA 4EEHA 2YECA 4GFNA 3QTFA 1AMWA 4YKQA 3BM9A 2CCTA 4EM7A 2WEPA 2BYIA 3LNUA 2YK9A 2CG9A 4R1FA 4FCRA 2WI6A 2O1UA 4E00A 3G7BA 2CCUA 2YE3A 5M4MA 2BU6A 2ZKJA 2Q2EB 3MNRP 4L93A 4DUHA 1UYEA 1YETA 2K5BA 2YJWA 3RLQA 4XIRA 4NH7A 2BSMA 1Y4SA 2ESAA 5CTXA 5L3JA 3VADA 4XE2A 3GIEA 2YE2A 2YEIA 5D7DA 4XITA 3EKOA
chains in the Genus database with same CATH superfamily
1UY7A 2XCMA 1UYDA 2Q8GA 4K4OA 4O09A 2YKEA 4O07A 4LWEA 2YI0A 1Z5CA 1ZXMA 5CTYA 2QG0A 4YKWA 4I5SA 2QF6A 2VCIA 2BTZA 3G75A 4R3MA 3ZXOA 2XX2A 2IWSA 3SL2A 4E72A 3TZ5A 1U2OA 1QY8A 4L8ZA 2YE8A 4PL9A 3TZ2A 4AS9A 3GIFA 5IDMA 2XDUA 4XDMA 5BODA 4GQTA 3OWDA 4H7QA 1Y8OA 5BOCA 3VHCA 2CH4A 4WUCA 5IN9A 4MP2A 2C1IA 4KSHA 1QZRA 2HHIA 5D7CA 2YEGA 4U93A 3DGEA 1L0OA 3CWVA 2C1GA 3R4MA 4YKZA 3FT8A 4EGHA 1F51A 3H4LA 3CYGA 3R4OA 4LWGA 5IDJA 5J71A 5D7RA 4NH8A 1I5AA 2C2AA 3R4PA 4CWTA 2HCHA 2XJXA 1AJ6A 4CWPA 1YT0A 2QG2A 4V26A 4FCQA 1YESA 4HYMA 4HY6A 4JAVA 2O1WA 3A0RA 4BQGA 5C93A 5D6PA 1I5BA 4YKUA 3EHFA 2GFDA 4JAUA 2YGEA 2BU7A 3IEDA 3A0WA 4U7OA 4XKKA 3INXA 2YEEA 1H7UA 4ASBA 3C0EA 3HYYA 4O04A 4O05A 2Q8IA 3ZXQA 1UY9A 4HY1A 4V25A 2WI5A 1AM1A 2FTKA 2XJGA 1UYHA 4AWQA 4XIQA 2Q8HA 2BU8A 2XDXA 2QFOA 3LPSA 4HZ5A 2BT0A 5CTUA 4KFGA 1NHJA 3RKZA 1YC1A 4WUBA 3VHAA 2WI1A 4CWOA 3K97A 2YKJA 3TZ4A 3B26A 4P7AA 2YKCA 1I5CA 2HKJA 1YT1A 4UROA 2WI3A 2YE6A 4YKRA 3Q5LA 4URNA 2BRCA 5CF0A 2IOPA 4EGIA 1BGQA 4DZYA 2O1VA 3O6OA 2YGFA 1IXMA 5J6AA 1JM6A 1UYMA 5GGZA 4MB9A 4BIZA 1Z5AA 2VWCA 1TIDA 1ZW9A 4H81A 3CRKA 1EI1A 1BYQA 2YEFA 3CRLA 2H8MA 4CE2A 1B62A 3A0YA 4XTJA 2WERA 5F5RA 4ASFA 1Y8PA 1EA6A 3B28A 3NMQA 4CWFA 4XD8A 1NHIA 4CE1A 3HEKA 1ZWHA 3R91A 3FV5A 1YS3A 3D36A 1GKZA 4L90A 3KE6A 2FXSA 2VW5A 1YERA 2Q8FA 1YSZA 2BU5A 3T0HA 3FT5A 3RLPA 3TZ0A 2XHXA 4WUDA 4MPEA 4B7PA 4CWQA 4URMA 4LPBA 1BXDA 2YEDA 4Q20A 1TC0A 1PVGA 3EHGA 4PU9A 4PRVA 1US7A 2CCSA 3PEHA 3WHAA 3WQ9A 5FNFA 4HZ0A 4JQLA 4KSGA 4H85A 3RLRA 3D0BA 5JENA 1I5DA 4KQVA 1Z59A 2YEBA 1TILA 3OWBA 3PEJA 3H80A 3ZM7A 2XX4A 4MBCA 5M4KA 4EMVA 4CWSA 1TBWA 3A0ZA 3A0TA 2YI5A 4L94A 2XHRA 4P8OA 4XKOA 4X9LA 1A4HA 2YE9A 4AWOA 1MU5A 1UY8A 4GEEA 3HZ5A 3K60A 2YKIA 1OSFA 4LP0A 3EHHA 3JZ3A 2XDLA 2YGAA 1UYFA 2XDKA 4BAEA 3U2KA 4W7TA 2GQPA 3TTZA 2BYHA 2BZ5A 2XK2A 2YE7A 4GCZA 3K98A 2FWYA 3OPDA 1UYLA 1UY6A 4XC0A 2YEHA 4GGLA 3T2SA 3HHUA 2IORA 1Y4UA 2YE5A 5M4PA 1THNA 4XIPA 3A0XA 4NH9A 4O0BA 2BU2A 4FCPA 2VCJA 2PNRA 1UYGA 4XCJA 4YKXA 1UYIA 1GJVA 3ZKBA 4ZKIA 2ZDXA 3K99A 3TUHA 1AH6A 3Q5KA 1B3QA 1NHHA 3S5TA 1TH8A 4QPJA 4CWRA 4CWNA 4ZVIA 2XHTA 2YEJA 3CGZA 1UYCA 4FMTA 4LWIA 5D6QA 1BKNA 3HZ1A 4HXWA 1MX0A 4L91A 4LWFA 4LWHA 5CTWA 4YKYA 1H7SA 4BXIA 4B6CA 3R4NA 4XKAA 2BREA 1YC4A 3HYZA 5FNCA 2YK2A 1QYEA 4PRXA 4MPCA 4EFTA 2XD6A 4FPPA 4JASA 3GIGA 4AWPA 3EKRA 1B63A 3T0ZA 4YKTA 2CGFA 2IOQA 2WEQA 4CE3A 2YEAA 2WI7A 2XX5A 3B27A 4MPNA 2HG1A 4R3AA 2YJXA 1I59A 2ZDYA 4EFUA 4U7NA 3BMYA 2YI7A 3EHJA 2YI6A 2H55A 3GIGB 1YC3A 3OMUA 1S16A 1ID0A 4GT8A 4BIUA 2WI4A 3QDDA 4E02A 4QPKA 3D2RA 3T10A 1YT2A 1Y8NA 2AKPA 3ZKDA 1GKXA 4KP4A 4MP7A 4I3HA 4BQJA 1TC6A 3Q5JA 2FWZA 4HYPA 5FWKA 2JKIA 4URLA 3R92A 1S14A 2EXLA 2WI2A 2YE4A 5F3KA 3O2FA 5M4NA 1U0ZA 1AH8A 1UYKA 5FNDA 2XDSA 2ZBKB 1YSRA 3C11A 3U2DA 1Z5BA 3O0IA 3B24A 3INWA 4EGKA 2XABA 2FYPA 2UWDA 2IWXA 2E0AA 2IWUA 2XJJA 3CGYA 3OW6A 3T1KA 3VHDA 4E01A 3U67A 1ZXNA 2JJCA 5M4HA 1KIJA 4XCLA 4KTNA 4ASAA 4MOTA 3G7EA 5M4EA 5CPHA 1I58A 3LMMA 3B25A 1R62A 2YKBA 1KZNA 4HXZA 4ASGA 4EEHA 2YECA 4GFNA 3QTFA 1AMWA 4YKQA 3BM9A 2CCTA 4EM7A 2WEPA 2BYIA 3LNUA 2YK9A 2CG9A 4R1FA 4FCRA 2WI6A 2O1UA 4E00A 3G7BA 2CCUA 2YE3A 5M4MA 2BU6A 2ZKJA 2Q2EB 3MNRP 4L93A 4DUHA 1UYEA 1YETA 2K5BA 2YJWA 3RLQA 4XIRA 4NH7A 2BSMA 1Y4SA 2ESAA 5CTXA 5L3JA 3VADA 4XE2A 3GIEA 2YE2A 2YEIA 5D7DA 4XITA 3EKOA
chains in the Genus database with same CATH topology
1UY7A 2XCMA 1UYDA 2Q8GA 4K4OA 4O09A 2YKEA 4O07A 4LWEA 2YI0A 1Z5CA 1ZXMA 5CTYA 2QG0A 4YKWA 4I5SA 2QF6A 2VCIA 2BTZA 3G75A 4R3MA 3ZXOA 2XX2A 2IWSA 3SL2A 3TZ5A 1U2OA 1QY8A 4L8ZA 2YE8A 4PL9A 3TZ2A 4AS9A 3GIFA 5IDMA 2XDUA 4XDMA 5BODA 4GQTA 3OWDA 4H7QA 1Y8OA 5BOCA 3VHCA 2CH4A 4WUCA 5IN9A 4MP2A 4KSHA 1QZRA 5D7CA 2YEGA 4U93A 3DGEA 1L0OA 3CWVA 3R4MA 4YKZA 3FT8A 4EGHA 3H4LA 4LWGA 3R4OA 5IDJA 5J71A 5D7RA 4NH8A 1I5AA 2C2AA 3R4PA 4CWTA 2HCHA 2XJXA 1AJ6A 4CWPA 1YT0A 2QG2A 4V26A 4FCQA 1YESA 4HYMA 4HY6A 4JAVA 2O1WA 3A0RA 4BQGA 5C93A 5D6PA 1I5BA 4YKUA 3EHFA 2GFDA 4JAUA 2YGEA 2BU7A 3IEDA 3A0WA 4U7OA 4XKKA 3INXA 2YEEA 1H7UA 4ASBA 3C0EA 3HYYA 4O04A 4O05A 2Q8IA 3ZXQA 1UY9A 4HY1A 4V25A 2WI5A 1AM1A 2XJGA 1UYHA 4AWQA 4XIQA 2Q8HA 2BU8A 2XDXA 2QFOA 3LPSA 4HZ5A 2BT0A 5CTUA 4KFGA 1NHJA 3RKZA 1YC1A 4WUBA 3VHAA 2WI1A 4CWOA 3K97A 2YKJA 3TZ4A 3B26A 4P7AA 2YKCA 1I5CA 2HKJA 1YT1A 4UROA 2WI3A 2YE6A 4YKRA 3Q5LA 4URNA 2BRCA 5CF0A 2IOPA 4EGIA 1BGQA 4DZYA 2O1VA 3O6OA 2YGFA 5J6AA 1JM6A 1UYMA 5GGZA 4MB9A 4BIZA 1Z5AA 2VWCA 1TIDA 1ZW9A 4H81A 3CRKA 1EI1A 1BYQA 2YEFA 3CRLA 2H8MA 4CE2A 1B62A 3A0YA 4XTJA 2WERA 5F5RA 4ASFA 1Y8PA 1EA6A 3B28A 3NMQA 4CWFA 4XD8A 1NHIA 4CE1A 3HEKA 1ZWHA 3R91A 3FV5A 1YS3A 3D36A 1GKZA 4L90A 3KE6A 2FXSA 2VW5A 1YERA 2Q8FA 1YSZA 2BU5A 3T0HA 3FT5A 3RLPA 3TZ0A 2XHXA 4WUDA 4MPEA 4B7PA 4CWQA 4URMA 4LPBA 1BXDA 2YEDA 4Q20A 1TC0A 1PVGA 3EHGA 4PU9A 4PRVA 1US7A 2CCSA 3PEHA 3WHAA 3WQ9A 5FNFA 4HZ0A 4JQLA 4KSGA 4H85A 3RLRA 3D0BA 1I5DA 4KQVA 1Z59A 2YEBA 1TILA 3OWBA 3PEJA 3H80A 3ZM7A 2XX4A 4MBCA 5M4KA 4EMVA 4CWSA 1TBWA 3A0ZA 3A0TA 2YI5A 4L94A 2XHRA 4P8OA 4XKOA 4X9LA 1A4HA 2YE9A 4AWOA 1MU5A 1UY8A 4GEEA 3HZ5A 3K60A 2YKIA 1OSFA 4LP0A 3EHHA 3JZ3A 2XDLA 2YGAA 1UYFA 2XDKA 4BAEA 3U2KA 4W7TA 2GQPA 3TTZA 2BYHA 2BZ5A 2XK2A 2YE7A 4GCZA 3K98A 2FWYA 3OPDA 1UYLA 1UY6A 4XC0A 2YEHA 4GGLA 3T2SA 3HHUA 2IORA 1Y4UA 2YE5A 5M4PA 1THNA 4XIPA 3A0XA 4NH9A 4O0BA 2BU2A 4FCPA 2VCJA 2PNRA 1UYGA 4XCJA 4YKXA 1UYIA 1GJVA 3ZKBA 4ZKIA 2ZDXA 3K99A 3TUHA 1AH6A 3Q5KA 1B3QA 1NHHA 1TH8A 4QPJA 4CWRA 4CWNA 4ZVIA 2XHTA 2YEJA 3CGZA 1UYCA 4FMTA 4LWIA 5D6QA 1BKNA 3HZ1A 4HXWA 1MX0A 4L91A 4LWFA 4LWHA 5CTWA 4YKYA 1H7SA 4BXIA 4B6CA 3R4NA 4XKAA 2BREA 1YC4A 3HYZA 5FNCA 2YK2A 1QYEA 4PRXA 4MPCA 4EFTA 2XD6A 4FPPA 4JASA 3GIGA 4AWPA 3EKRA 1B63A 3T0ZA 4YKTA 2CGFA 2IOQA 2WEQA 4CE3A 2YEAA 2WI7A 2XX5A 3B27A 4MPNA 2HG1A 4R3AA 2YJXA 1I59A 2ZDYA 4EFUA 4U7NA 3BMYA 2YI7A 3EHJA 2YI6A 2H55A 3GIGB 1YC3A 3OMUA 1S16A 1ID0A 4GT8A 4BIUA 2WI4A 3QDDA 4E02A 4QPKA 3D2RA 3T10A 1YT2A 1Y8NA 2AKPA 3ZKDA 1GKXA 4KP4A 4MP7A 4I3HA 4BQJA 1TC6A 3Q5JA 2FWZA 4HYPA 5FWKA 2JKIA 4URLA 3R92A 1S14A 2EXLA 2WI2A 2YE4A 5F3KA 3O2FA 5M4NA 1U0ZA 1AH8A 1UYKA 5FNDA 2XDSA 2ZBKB 1YSRA 3C11A 3U2DA 1Z5BA 3O0IA 3B24A 3INWA 4EGKA 2XABA 2FYPA 2UWDA 2IWXA 2E0AA 2IWUA 2XJJA 3CGYA 3OW6A 3T1KA 3VHDA 4E01A 3U67A 1ZXNA 2JJCA 5M4HA 1KIJA 4XCLA 4KTNA 4ASAA 4MOTA 3G7EA 5M4EA 5CPHA 1I58A 3B25A 1R62A 2YKBA 1KZNA 4HXZA 4ASGA 4EEHA 2YECA 4GFNA 3QTFA 1AMWA 4YKQA 3BM9A 2CCTA 4EM7A 2WEPA 2BYIA 3LNUA 2YK9A 2CG9A 4R1FA 4FCRA 2WI6A 2O1UA 4E00A 3G7BA 2CCUA 2YE3A 5M4MA 2BU6A 2ZKJA 2Q2EB 3MNRP 4L93A 4DUHA 1UYEA 1YETA 2K5BA 2YJWA 3RLQA 4XIRA 4NH7A 2BSMA 1Y4SA 2ESAA 5CTXA 5L3JA 3VADA 4XE2A 3GIEA 2YE2A 2YEIA 5D7DA 4XITA 3EKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY7 A;  2XCM A;  1UYD A;  2Q8G A;  4K4O A;  4O09 A;  2YKE A;  4O07 A;  4LWE A;  2YI0 A;  1Z5C A;  1ZXM A;  5CTY A;  2QG0 A;  4YKW A;  4I5S A;  2QF6 A;  2VCI A;  2BTZ A;  3G75 A;  4R3M A;  3ZXO A;  2XX2 A;  2IWS A;  3SL2 A;  3TZ5 A;  1U2O A;  1QY8 A;  4L8Z A;  2YE8 A;  4PL9 A;  3TZ2 A;  4AS9 A;  3GIF A;  5IDM A;  2XDU A;  4XDM A;  5BOD A;  4GQT A;  3OWD A;  4H7Q A;  1Y8O A;  5BOC A;  3VHC A;  2CH4 A;  4WUC A;  5IN9 A;  4MP2 A;  4KSH A;  1QZR A;  5D7C A;  2YEG A;  4U93 A;  3DGE A;  1L0O A;  3CWV A;  3R4M A;  4YKZ A;  3FT8 A;  4EGH A;  3H4L A;  4LWG A;  3R4O A;  5IDJ A;  5J71 A;  5D7R A;  4NH8 A;  1I5A A;  2C2A A;  3R4P A;  4CWT A;  2HCH A;  2XJX A;  1AJ6 A;  4CWP A;  1YT0 A;  2QG2 A;  4V26 A;  4FCQ A;  1YES A;  4HYM A;  4HY6 A;  4JAV A;  2O1W A;  3A0R A;  4BQG A;  5C93 A;  5D6P A;  1I5B A;  4YKU A;  3EHF A;  2GFD A;  4JAU A;  2YGE A;  2BU7 A;  3IED A;  3A0W A;  4U7O A;  4XKK A;  3INX A;  2YEE A;  1H7U A;  4ASB A;  3C0E A;  3HYY A;  4O04 A;  4O05 A;  2Q8I A;  3ZXQ A;  1UY9 A;  4HY1 A;  4V25 A;  2WI5 A;  1AM1 A;  2XJG A;  1UYH A;  4AWQ A;  4XIQ A;  2Q8H A;  2BU8 A;  2XDX A;  2QFO A;  3LPS A;  4HZ5 A;  2BT0 A;  5CTU A;  4KFG A;  1NHJ A;  3RKZ A;  1YC1 A;  4WUB A;  3VHA A;  2WI1 A;  4CWO A;  3K97 A;  2YKJ A;  3TZ4 A;  3B26 A;  4P7A A;  2YKC A;  1I5C A;  2HKJ A;  1YT1 A;  4URO A;  2WI3 A;  2YE6 A;  4YKR A;  3Q5L A;  4URN A;  2BRC A;  5CF0 A;  2IOP A;  4EGI A;  1BGQ A;  4DZY A;  2O1V A;  3O6O A;  2YGF A;  5J6A A;  1JM6 A;  1UYM A;  5GGZ A;  4MB9 A;  4BIZ A;  1Z5A A;  2VWC A;  1TID A;  1ZW9 A;  4H81 A;  3CRK A;  1EI1 A;  1BYQ A;  2YEF A;  3CRL A;  2H8M A;  4CE2 A;  1B62 A;  3A0Y A;  4XTJ A;  2WER A;  5F5R A;  4ASF A;  1Y8P A;  1EA6 A;  3B28 A;  3NMQ A;  4CWF A;  4XD8 A;  1NHI A;  4CE1 A;  3HEK A;  1ZWH A;  3R91 A;  3FV5 A;  1YS3 A;  3D36 A;  1GKZ A;  4L90 A;  3KE6 A;  2FXS A;  2VW5 A;  1YER A;  2Q8F A;  1YSZ A;  2BU5 A;  3T0H A;  3FT5 A;  3RLP A;  3TZ0 A;  2XHX A;  4WUD A;  4MPE A;  4B7P A;  4CWQ A;  4URM A;  4LPB A;  1BXD A;  2YED A;  4Q20 A;  1TC0 A;  1PVG A;  3EHG A;  4PU9 A;  4PRV A;  1US7 A;  2CCS A;  3PEH A;  3WHA A;  3WQ9 A;  5FNF A;  4HZ0 A;  4JQL A;  4KSG A;  4H85 A;  3RLR A;  3D0B A;  1I5D A;  4KQV A;  1Z59 A;  2YEB A;  1TIL A;  3OWB A;  3PEJ A;  3H80 A;  3ZM7 A;  2XX4 A;  4MBC A;  5M4K A;  4EMV A;  4CWS A;  1TBW A;  3A0Z A;  3A0T A;  2YI5 A;  4L94 A;  2XHR A;  4P8O A;  4XKO A;  4X9L A;  1A4H A;  2YE9 A;  4AWO A;  1MU5 A;  1UY8 A;  4GEE A;  3HZ5 A;  3K60 A;  2YKI A;  1OSF A;  4LP0 A;  3EHH A;  3JZ3 A;  2XDL A;  2YGA A;  1UYF A;  2XDK A;  4BAE A;  3U2K A;  4W7T A;  2GQP A;  3TTZ A;  2BYH A;  2BZ5 A;  2XK2 A;  2YE7 A;  4GCZ A;  3K98 A;  2FWY A;  3OPD A;  1UYL A;  1UY6 A;  4XC0 A;  2YEH A;  4GGL A;  3T2S A;  3HHU A;  2IOR A;  1Y4U A;  2YE5 A;  5M4P A;  1THN A;  4XIP A;  3A0X A;  4NH9 A;  4O0B A;  2BU2 A;  4FCP A;  2VCJ A;  2PNR A;  1UYG A;  4XCJ A;  4YKX A;  1UYI A;  1GJV A;  3ZKB A;  4ZKI A;  2ZDX A;  3K99 A;  3TUH A;  1AH6 A;  3Q5K A;  1B3Q A;  1NHH A;  1TH8 A;  4QPJ A;  4CWR A;  4CWN A;  4ZVI A;  2XHT A;  2YEJ A;  3CGZ A;  1UYC A;  4FMT A;  4LWI A;  5D6Q A;  1BKN A;  3HZ1 A;  4HXW A;  1MX0 A;  4L91 A;  4LWF A;  4LWH A;  5CTW A;  4YKY A;  1H7S A;  4BXI A;  4B6C A;  3R4N A;  4XKA A;  2BRE A;  1YC4 A;  3HYZ A;  5FNC A;  2YK2 A;  1QYE A;  4PRX A;  4MPC A;  4EFT A;  2XD6 A;  4FPP A;  4JAS A;  3GIG A;  4AWP A;  3EKR A;  1B63 A;  3T0Z A;  4YKT A;  2CGF A;  2IOQ A;  2WEQ A;  4CE3 A;  2YEA A;  2WI7 A;  2XX5 A;  3B27 A;  4MPN A;  2HG1 A;  4R3A A;  2YJX A;  1I59 A;  2ZDY A;  4EFU A;  4U7N A;  3BMY A;  2YI7 A;  3EHJ A;  2YI6 A;  2H55 A;  3GIG B;  1YC3 A;  3OMU A;  1S16 A;  1ID0 A;  4GT8 A;  4BIU A;  2WI4 A;  3QDD A;  4E02 A;  4QPK A;  3D2R A;  3T10 A;  1YT2 A;  1Y8N A;  2AKP A;  3ZKD A;  1GKX A;  4KP4 A;  4MP7 A;  4I3H A;  4BQJ A;  1TC6 A;  3Q5J A;  2FWZ A;  4HYP A;  5FWK A;  2JKI A;  4URL A;  3R92 A;  1S14 A;  2EXL A;  2WI2 A;  2YE4 A;  5F3K A;  3O2F A;  5M4N A;  1U0Z A;  1AH8 A;  1UYK A;  5FND A;  2XDS A;  2ZBK B;  1YSR A;  3C11 A;  3U2D A;  1Z5B A;  3O0I A;  3B24 A;  3INW A;  4EGK A;  2XAB A;  2FYP A;  2UWD A;  2IWX A;  2E0A A;  2IWU A;  2XJJ A;  3CGY A;  3OW6 A;  3T1K A;  3VHD A;  4E01 A;  3U67 A;  1ZXN A;  2JJC A;  5M4H A;  1KIJ A;  4XCL A;  4KTN A;  4ASA A;  4MOT A;  3G7E A;  5M4E A;  5CPH A;  1I58 A;  3B25 A;  1R62 A;  2YKB A;  1KZN A;  4HXZ A;  4ASG A;  4EEH A;  2YEC A;  4GFN A;  3QTF A;  1AMW A;  4YKQ A;  3BM9 A;  2CCT A;  4EM7 A;  2WEP A;  2BYI A;  3LNU A;  2YK9 A;  2CG9 A;  4R1F A;  4FCR A;  2WI6 A;  2O1U A;  4E00 A;  3G7B A;  2CCU A;  2YE3 A;  5M4M A;  2BU6 A;  2ZKJ A;  2Q2E B;  3MNR P;  4L93 A;  4DUH A;  1UYE A;  1YET A;  2K5B A;  2YJW A;  3RLQ A;  4XIR A;  4NH7 A;  2BSM A;  1Y4S A;  2ESA A;  5CTX A;  5L3J A;  3VAD A;  4XE2 A;  3GIE A;  2YE2 A;  2YEI A;  5D7D A;  4XIT A;  3EKO A; 
#chains in the Genus database with same CATH topology
 1UY7 A;  2XCM A;  1UYD A;  2Q8G A;  4K4O A;  4O09 A;  2YKE A;  4O07 A;  4LWE A;  2YI0 A;  1Z5C A;  1ZXM A;  5CTY A;  2QG0 A;  4YKW A;  4I5S A;  2QF6 A;  2VCI A;  2BTZ A;  3G75 A;  4R3M A;  3ZXO A;  2XX2 A;  2IWS A;  3SL2 A;  4E72 A;  3TZ5 A;  1U2O A;  1QY8 A;  4L8Z A;  2YE8 A;  4PL9 A;  3TZ2 A;  4AS9 A;  3GIF A;  5IDM A;  2XDU A;  4XDM A;  5BOD A;  4GQT A;  3OWD A;  4H7Q A;  1Y8O A;  5BOC A;  3VHC A;  2CH4 A;  4WUC A;  5IN9 A;  4MP2 A;  2C1I A;  4KSH A;  1QZR A;  2HHI A;  5D7C A;  2YEG A;  4U93 A;  3DGE A;  1L0O A;  3CWV A;  2C1G A;  3R4M A;  4YKZ A;  3FT8 A;  4EGH A;  1F51 A;  3H4L A;  3CYG A;  3R4O A;  4LWG A;  5IDJ A;  5J71 A;  5D7R A;  4NH8 A;  1I5A A;  2C2A A;  3R4P A;  4CWT A;  2HCH A;  2XJX A;  1AJ6 A;  4CWP A;  1YT0 A;  2QG2 A;  4V26 A;  4FCQ A;  1YES A;  4HYM A;  4HY6 A;  4JAV A;  2O1W A;  3A0R A;  4BQG A;  5C93 A;  5D6P A;  1I5B A;  4YKU A;  3EHF A;  2GFD A;  4JAU A;  2YGE A;  2BU7 A;  3IED A;  3A0W A;  4U7O A;  4XKK A;  3INX A;  2YEE A;  1H7U A;  4ASB A;  3C0E A;  3HYY A;  4O04 A;  4O05 A;  2Q8I A;  3ZXQ A;  1UY9 A;  4HY1 A;  4V25 A;  2WI5 A;  1AM1 A;  2FTK A;  2XJG A;  1UYH A;  4AWQ A;  4XIQ A;  2Q8H A;  2BU8 A;  2XDX A;  2QFO A;  3LPS A;  4HZ5 A;  2BT0 A;  5CTU A;  4KFG A;  1NHJ A;  3RKZ A;  1YC1 A;  4WUB A;  3VHA A;  2WI1 A;  4CWO A;  3K97 A;  2YKJ A;  3TZ4 A;  3B26 A;  4P7A A;  2YKC A;  1I5C A;  2HKJ A;  1YT1 A;  4URO A;  2WI3 A;  2YE6 A;  4YKR A;  3Q5L A;  4URN A;  2BRC A;  5CF0 A;  2IOP A;  4EGI A;  1BGQ A;  4DZY A;  2O1V A;  3O6O A;  2YGF A;  1IXM A;  5J6A A;  1JM6 A;  1UYM A;  5GGZ A;  4MB9 A;  4BIZ A;  1Z5A A;  2VWC A;  1TID A;  1ZW9 A;  4H81 A;  3CRK A;  1EI1 A;  1BYQ A;  2YEF A;  3CRL A;  2H8M A;  4CE2 A;  1B62 A;  3A0Y A;  4XTJ A;  2WER A;  5F5R A;  4ASF A;  1Y8P A;  1EA6 A;  3B28 A;  3NMQ A;  4CWF A;  4XD8 A;  1NHI A;  4CE1 A;  3HEK A;  1ZWH A;  3R91 A;  3FV5 A;  1YS3 A;  3D36 A;  1GKZ A;  4L90 A;  3KE6 A;  2FXS A;  2VW5 A;  1YER A;  2Q8F A;  1YSZ A;  2BU5 A;  3T0H A;  3FT5 A;  3RLP A;  3TZ0 A;  2XHX A;  4WUD A;  4MPE A;  4B7P A;  4CWQ A;  4URM A;  4LPB A;  1BXD A;  2YED A;  4Q20 A;  1TC0 A;  1PVG A;  3EHG A;  4PU9 A;  4PRV A;  1US7 A;  2CCS A;  3PEH A;  3WHA A;  3WQ9 A;  5FNF A;  4HZ0 A;  4JQL A;  4KSG A;  4H85 A;  3RLR A;  3D0B A;  5JEN A;  1I5D A;  4KQV A;  1Z59 A;  2YEB A;  1TIL A;  3OWB A;  3PEJ A;  3H80 A;  3ZM7 A;  2XX4 A;  4MBC A;  5M4K A;  4EMV A;  4CWS A;  1TBW A;  3A0Z A;  3A0T A;  2YI5 A;  4L94 A;  2XHR A;  4P8O A;  4XKO A;  4X9L A;  1A4H A;  2YE9 A;  4AWO A;  1MU5 A;  1UY8 A;  4GEE A;  3HZ5 A;  3K60 A;  2YKI A;  1OSF A;  4LP0 A;  3EHH A;  3JZ3 A;  2XDL A;  2YGA A;  1UYF A;  2XDK A;  4BAE A;  3U2K A;  4W7T A;  2GQP A;  3TTZ A;  2BYH A;  2BZ5 A;  2XK2 A;  2YE7 A;  4GCZ A;  3K98 A;  2FWY A;  3OPD A;  1UYL A;  1UY6 A;  4XC0 A;  2YEH A;  4GGL A;  3T2S A;  3HHU A;  2IOR A;  1Y4U A;  2YE5 A;  5M4P A;  1THN A;  4XIP A;  3A0X A;  4NH9 A;  4O0B A;  2BU2 A;  4FCP A;  2VCJ A;  2PNR A;  1UYG A;  4XCJ A;  4YKX A;  1UYI A;  1GJV A;  3ZKB A;  4ZKI A;  2ZDX A;  3K99 A;  3TUH A;  1AH6 A;  3Q5K A;  1B3Q A;  1NHH A;  3S5T A;  1TH8 A;  4QPJ A;  4CWR A;  4CWN A;  4ZVI A;  2XHT A;  2YEJ A;  3CGZ A;  1UYC A;  4FMT A;  4LWI A;  5D6Q A;  1BKN A;  3HZ1 A;  4HXW A;  1MX0 A;  4L91 A;  4LWF A;  4LWH A;  5CTW A;  4YKY A;  1H7S A;  4BXI A;  4B6C A;  3R4N A;  4XKA A;  2BRE A;  1YC4 A;  3HYZ A;  5FNC A;  2YK2 A;  1QYE A;  4PRX A;  4MPC A;  4EFT A;  2XD6 A;  4FPP A;  4JAS A;  3GIG A;  4AWP A;  3EKR A;  1B63 A;  3T0Z A;  4YKT A;  2CGF A;  2IOQ A;  2WEQ A;  4CE3 A;  2YEA A;  2WI7 A;  2XX5 A;  3B27 A;  4MPN A;  2HG1 A;  4R3A A;  2YJX A;  1I59 A;  2ZDY A;  4EFU A;  4U7N A;  3BMY A;  2YI7 A;  3EHJ A;  2YI6 A;  2H55 A;  3GIG B;  1YC3 A;  3OMU A;  1S16 A;  1ID0 A;  4GT8 A;  4BIU A;  2WI4 A;  3QDD A;  4E02 A;  4QPK A;  3D2R A;  3T10 A;  1YT2 A;  1Y8N A;  2AKP A;  3ZKD A;  1GKX A;  4KP4 A;  4MP7 A;  4I3H A;  4BQJ A;  1TC6 A;  3Q5J A;  2FWZ A;  4HYP A;  5FWK A;  2JKI A;  4URL A;  3R92 A;  1S14 A;  2EXL A;  2WI2 A;  2YE4 A;  5F3K A;  3O2F A;  5M4N A;  1U0Z A;  1AH8 A;  1UYK A;  5FND A;  2XDS A;  2ZBK B;  1YSR A;  3C11 A;  3U2D A;  1Z5B A;  3O0I A;  3B24 A;  3INW A;  4EGK A;  2XAB A;  2FYP A;  2UWD A;  2IWX A;  2E0A A;  2IWU A;  2XJJ A;  3CGY A;  3OW6 A;  3T1K A;  3VHD A;  4E01 A;  3U67 A;  1ZXN A;  2JJC A;  5M4H A;  1KIJ A;  4XCL A;  4KTN A;  4ASA A;  4MOT A;  3G7E A;  5M4E A;  5CPH A;  1I58 A;  3LMM A;  3B25 A;  1R62 A;  2YKB A;  1KZN A;  4HXZ A;  4ASG A;  4EEH A;  2YEC A;  4GFN A;  3QTF A;  1AMW A;  4YKQ A;  3BM9 A;  2CCT A;  4EM7 A;  2WEP A;  2BYI A;  3LNU A;  2YK9 A;  2CG9 A;  4R1F A;  4FCR A;  2WI6 A;  2O1U A;  4E00 A;  3G7B A;  2CCU A;  2YE3 A;  5M4M A;  2BU6 A;  2ZKJ A;  2Q2E B;  3MNR P;  4L93 A;  4DUH A;  1UYE A;  1YET A;  2K5B A;  2YJW A;  3RLQ A;  4XIR A;  4NH7 A;  2BSM A;  1Y4S A;  2ESA A;  5CTX A;  5L3J A;  3VAD A;  4XE2 A;  3GIE A;  2YE2 A;  2YEI A;  5D7D A;  4XIT A;  3EKO A; 
#chains in the Genus database with same CATH homology
 1UY7 A;  2XCM A;  1UYD A;  2Q8G A;  4K4O A;  4O09 A;  2YKE A;  4O07 A;  4LWE A;  2YI0 A;  1Z5C A;  1ZXM A;  5CTY A;  2QG0 A;  4YKW A;  4I5S A;  2QF6 A;  2VCI A;  2BTZ A;  3G75 A;  4R3M A;  3ZXO A;  2XX2 A;  2IWS A;  3SL2 A;  3TZ5 A;  1U2O A;  1QY8 A;  4L8Z A;  2YE8 A;  4PL9 A;  3TZ2 A;  4AS9 A;  3GIF A;  5IDM A;  2XDU A;  4XDM A;  5BOD A;  4GQT A;  3OWD A;  4H7Q A;  1Y8O A;  5BOC A;  3VHC A;  2CH4 A;  4WUC A;  5IN9 A;  4MP2 A;  4KSH A;  1QZR A;  5D7C A;  2YEG A;  4U93 A;  3DGE A;  1L0O A;  3CWV A;  3R4M A;  4YKZ A;  3FT8 A;  4EGH A;  3H4L A;  4LWG A;  3R4O A;  5IDJ A;  5J71 A;  5D7R A;  4NH8 A;  1I5A A;  2C2A A;  3R4P A;  4CWT A;  2HCH A;  2XJX A;  1AJ6 A;  4CWP A;  1YT0 A;  2QG2 A;  4V26 A;  4FCQ A;  1YES A;  4HYM A;  4HY6 A;  4JAV A;  2O1W A;  3A0R A;  4BQG A;  5C93 A;  5D6P A;  1I5B A;  4YKU A;  3EHF A;  2GFD A;  4JAU A;  2YGE A;  2BU7 A;  3IED A;  3A0W A;  4U7O A;  4XKK A;  3INX A;  2YEE A;  1H7U A;  4ASB A;  3C0E A;  3HYY A;  4O04 A;  4O05 A;  2Q8I A;  3ZXQ A;  1UY9 A;  4HY1 A;  4V25 A;  2WI5 A;  1AM1 A;  2XJG A;  1UYH A;  4AWQ A;  4XIQ A;  2Q8H A;  2BU8 A;  2XDX A;  2QFO A;  3LPS A;  4HZ5 A;  2BT0 A;  5CTU A;  4KFG A;  1NHJ A;  3RKZ A;  1YC1 A;  4WUB A;  3VHA A;  2WI1 A;  4CWO A;  3K97 A;  2YKJ A;  3TZ4 A;  3B26 A;  4P7A A;  2YKC A;  1I5C A;  2HKJ A;  1YT1 A;  4URO A;  2WI3 A;  2YE6 A;  4YKR A;  3Q5L A;  4URN A;  2BRC A;  5CF0 A;  2IOP A;  4EGI A;  1BGQ A;  4DZY A;  2O1V A;  3O6O A;  2YGF A;  5J6A A;  1JM6 A;  1UYM A;  5GGZ A;  4MB9 A;  4BIZ A;  1Z5A A;  2VWC A;  1TID A;  1ZW9 A;  4H81 A;  3CRK A;  1EI1 A;  1BYQ A;  2YEF A;  3CRL A;  2H8M A;  4CE2 A;  1B62 A;  3A0Y A;  4XTJ A;  2WER A;  5F5R A;  4ASF A;  1Y8P A;  1EA6 A;  3B28 A;  3NMQ A;  4CWF A;  4XD8 A;  1NHI A;  4CE1 A;  3HEK A;  1ZWH A;  3R91 A;  3FV5 A;  1YS3 A;  3D36 A;  1GKZ A;  4L90 A;  3KE6 A;  2FXS A;  2VW5 A;  1YER A;  2Q8F A;  1YSZ A;  2BU5 A;  3T0H A;  3FT5 A;  3RLP A;  3TZ0 A;  2XHX A;  4WUD A;  4MPE A;  4B7P A;  4CWQ A;  4URM A;  4LPB A;  1BXD A;  2YED A;  4Q20 A;  1TC0 A;  1PVG A;  3EHG A;  4PU9 A;  4PRV A;  1US7 A;  2CCS A;  3PEH A;  3WHA A;  3WQ9 A;  5FNF A;  4HZ0 A;  4JQL A;  4KSG A;  4H85 A;  3RLR A;  3D0B A;  1I5D A;  4KQV A;  1Z59 A;  2YEB A;  1TIL A;  3OWB A;  3PEJ A;  3H80 A;  3ZM7 A;  2XX4 A;  4MBC A;  5M4K A;  4EMV A;  4CWS A;  1TBW A;  3A0Z A;  3A0T A;  2YI5 A;  4L94 A;  2XHR A;  4P8O A;  4XKO A;  4X9L A;  1A4H A;  2YE9 A;  4AWO A;  1MU5 A;  1UY8 A;  4GEE A;  3HZ5 A;  3K60 A;  2YKI A;  1OSF A;  4LP0 A;  3EHH A;  3JZ3 A;  2XDL A;  2YGA A;  1UYF A;  2XDK A;  4BAE A;  3U2K A;  4W7T A;  2GQP A;  3TTZ A;  2BYH A;  2BZ5 A;  2XK2 A;  2YE7 A;  4GCZ A;  3K98 A;  2FWY A;  3OPD A;  1UYL A;  1UY6 A;  4XC0 A;  2YEH A;  4GGL A;  3T2S A;  3HHU A;  2IOR A;  1Y4U A;  2YE5 A;  5M4P A;  1THN A;  4XIP A;  3A0X A;  4NH9 A;  4O0B A;  2BU2 A;  4FCP A;  2VCJ A;  2PNR A;  1UYG A;  4XCJ A;  4YKX A;  1UYI A;  1GJV A;  3ZKB A;  4ZKI A;  2ZDX A;  3K99 A;  3TUH A;  1AH6 A;  3Q5K A;  1B3Q A;  1NHH A;  1TH8 A;  4QPJ A;  4CWR A;  4CWN A;  4ZVI A;  2XHT A;  2YEJ A;  3CGZ A;  1UYC A;  4FMT A;  4LWI A;  5D6Q A;  1BKN A;  3HZ1 A;  4HXW A;  1MX0 A;  4L91 A;  4LWF A;  4LWH A;  5CTW A;  4YKY A;  1H7S A;  4BXI A;  4B6C A;  3R4N A;  4XKA A;  2BRE A;  1YC4 A;  3HYZ A;  5FNC A;  2YK2 A;  1QYE A;  4PRX A;  4MPC A;  4EFT A;  2XD6 A;  4FPP A;  4JAS A;  3GIG A;  4AWP A;  3EKR A;  1B63 A;  3T0Z A;  4YKT A;  2CGF A;  2IOQ A;  2WEQ A;  4CE3 A;  2YEA A;  2WI7 A;  2XX5 A;  3B27 A;  4MPN A;  2HG1 A;  4R3A A;  2YJX A;  1I59 A;  2ZDY A;  4EFU A;  4U7N A;  3BMY A;  2YI7 A;  3EHJ A;  2YI6 A;  2H55 A;  3GIG B;  1YC3 A;  3OMU A;  1S16 A;  1ID0 A;  4GT8 A;  4BIU A;  2WI4 A;  3QDD A;  4E02 A;  4QPK A;  3D2R A;  3T10 A;  1YT2 A;  1Y8N A;  2AKP A;  3ZKD A;  1GKX A;  4KP4 A;  4MP7 A;  4I3H A;  4BQJ A;  1TC6 A;  3Q5J A;  2FWZ A;  4HYP A;  5FWK A;  2JKI A;  4URL A;  3R92 A;  1S14 A;  2EXL A;  2WI2 A;  2YE4 A;  5F3K A;  3O2F A;  5M4N A;  1U0Z A;  1AH8 A;  1UYK A;  5FND A;  2XDS A;  2ZBK B;  1YSR A;  3C11 A;  3U2D A;  1Z5B A;  3O0I A;  3B24 A;  3INW A;  4EGK A;  2XAB A;  2FYP A;  2UWD A;  2IWX A;  2E0A A;  2IWU A;  2XJJ A;  3CGY A;  3OW6 A;  3T1K A;  3VHD A;  4E01 A;  3U67 A;  1ZXN A;  2JJC A;  5M4H A;  1KIJ A;  4XCL A;  4KTN A;  4ASA A;  4MOT A;  3G7E A;  5M4E A;  5CPH A;  1I58 A;  3B25 A;  1R62 A;  2YKB A;  1KZN A;  4HXZ A;  4ASG A;  4EEH A;  2YEC A;  4GFN A;  3QTF A;  1AMW A;  4YKQ A;  3BM9 A;  2CCT A;  4EM7 A;  2WEP A;  2BYI A;  3LNU A;  2YK9 A;  2CG9 A;  4R1F A;  4FCR A;  2WI6 A;  2O1U A;  4E00 A;  3G7B A;  2CCU A;  2YE3 A;  5M4M A;  2BU6 A;  2ZKJ A;  2Q2E B;  3MNR P;  4L93 A;  4DUH A;  1UYE A;  1YET A;  2K5B A;  2YJW A;  3RLQ A;  4XIR A;  4NH7 A;  2BSM A;  1Y4S A;  2ESA A;  5CTX A;  5L3J A;  3VAD A;  4XE2 A;  3GIE A;  2YE2 A;  2YEI A;  5D7D A;  4XIT A;  3EKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...