3JZ7A

Crystal structure of the extracellular domains of coxsackie & adenovirus receptor from mouse (mcar)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
PEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The coxsackievirus-adenovirus receptor reveals complex homophilic and heterophilic interactions on neural cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Coxsackievirus and adenovirus receptor homolog
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2009-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A02
4KJPD 5TDOA 2NNAB 2WP3O 2XXCB 4KJQC 5I1GH 4L4VA 4N0UE 5E1HB 3PWUB 5KVDL 4NO2B 1M71B 2LV4A 3TO4D 4FTVD 3MRQA 3CXDH 3QQ9D 5EPMB 1JZ4A 4NRZB 4ELME 1F4AA 3RZCA 3VGHA 4PP1C 1MFBL 4MHHI 1CIDA 1FL6B 3E3QC 4LLUB 1TCRA 5IHLB 1U58A 3QG6B 1NGQH 5I8KH 2WSKA 5E9DB 2DQHL 4LNRB 1MHEB 2F53E 2M1KA 4I5BA 4OCXL 1NUGA 4DQOH 2F19H 3G9AB 5DEGB 4AQOA 1GPOH 3ESVF 4KRPD 3C5ZD 2GSGB 1JK8B 1I1YB 5B8CA 4F7MB 4Q9BA 1DLFH 2XG5A 1MHPH 3T0WA 1G9MH 2OL3B 3IKCA 4F37F 3PJSB 2F5BL 4NZUH 3VFUB 5IFAH 2AK4B 4PJ7B 3QIUB 4QCIA 5IWLC 3NCEB 4GXUN 4L9LC 1OAQH 3QHFL 1XGPB 5FCUH 1MCLA 4QYOB 5GS2H 3MRMA 2BSTB 2P5EA 1TQCB 2H1PL 4OD2A 5KW9H 5DD6A 3UJIL 3NA9L 2Y5TA 1WCQA 3EO0A 3VDAA 1XCTB 4DZBB 4R4ND 3U79A 1NC4D 4I3RH 3T04D 5A16B 5BXFB 3JZ7A 3UO1L 5GZOD 1L9NA 1LO0H 4I13B 3LHPH 1U8HA 2UVEA 3MLZL 4I48A 4KHTH 3PWUA 1NLDL 5FO9A 1J7VR 4JREB 1KIUA 4UTAL 3K8LA 4MDJB 4UT6H 5BRZD 1BD2E 4V1DE 2IBBA 4LCCA 4QXGL 3ZE1E 5D96C 5CMAA 3D39D 3REWB 5DZOA 5ICXB 1BD2B 4KI1A 2DM2A 1ZLUH 1T89A 5EIVA 5EZIH 5AYQA 3I6GA 4S1RH 2PXYD 2JJVA 5BZDA 3A6BL 4E0RA 5KSAD 4P9HH 1HHIB 1IGYA 2AK4D 3PIQA 4PTTB 3KPSD 1H9VA 5SX4H 3T77A 4C56A 2M26A 4ODVH 4FZEH 1HXYB 3QXTA 4B7LA 4XP4L 4YX2H 1Q9LB 3FOMB 2VLLA 3SBWA 4MB4A 4YDLB 4HGWB 1R3HA 4LKCA 4XPTL 1D7FA 2DWDA 2AK4A 4PJ7A 1UENA 5D2NA 3NVQA 4ZUUB 1HYSD 3EDFA 1QSFE 3QZWA 1PKOA 4PJDA 3PNWB 1QVOB 2VLME 5GRUL 4QOKA 3U0PA 3BIAX 2HKFL 3KPLB 5EOQL 4U1HA 4K7FB 5IV2A 5HDLA 4NZUL 5BVJA 3WNPA 3TA3A 2ZCLL 4DEPB 2VQ1B 3FRUB 1HIML 3N06B 4FTVB 3VXRA 5KVGL 1QSZA 5FM8A 4NN7B 4XCFH 3LRSA 4NO5B 4NM8H 5IBTH 1ZHLB 2A6IA 3TNNA 3NCBB 1JVKA 1N6QH 2P44B 4H5SA 3RGVD 2X1PA 3QQ4B 1FZJB 2JK5B 2J3SA 2OSLA 3WLWC 1MUJB 2AEIT 3MODL 4OCSL 5H94B 3QT2A 3UAJC 3W2DL 1JFQL 4JFHE 5C0FB 1KLUB 3ZE2E 5HYIA 4ZSOA 3TA3C 3PWLB 4Y4HC 5KANI 5CLWA 3E8UL 1U8QA 2IANB 2XG4A 1RZIB 3V52H 4TN9A 5E8NB 4WO4B 4IMKC 4U1GC 3OKEB 1V05A 3RA7H 4RQQA 1HXYA 4HUWB 4M61B 4R97B 3UC0H 7CGTA 1EMTH 3TBWB 1LO4L 5F1IA 3IJYB 3MBXH 5DD1H 2AXFB 4LSTH 5FUOL 5A2JH 3AY4A 1DSFL 2NXZD 5B4MD 4PJIE 5F70A 4QHLB 4QRRB 3MLXL 1YZZA 3P4OA 4NKOA 5E5MB 3W9EA 4Y1AE 2E7MA 3FFCB 4I18C 5EU5B 5TDOB 2YD5A 1FVCB 1IGTB 1MCCA 1T3FA 2FJFA 3BZDA 5JR1H 3H3KA 2FCBA 3VXNA 2JIXD 4P5KA 2FLRT 5IIEA 2XRAL 4Z7OF 4PJAA 1A1NB 3QFJD 3RVTD 4KWUA 4JM2F 1D5ZA 2OJEA 2XA8L 4YUEL 1RZFH 1QBBA 3PF2A 4WNQB 4M5ZH 4DGVL 1DBJL 1MRDH 32C2A 3HPJA 4LK4A 4Q2ZA 4HDIB 1KTDA 4LOUC 1CCZA 4O2FB 3HZKB 1JGEB 2AQ2A 4X6CB 1I75A 2Z91B 3MACL 4P57A 1NCUA 1VFUA 4BQ8A 2GY5A 1ORQB 2C9AA 5C0JA 2BVEA 3OKLA 3B5HA 2VOTA 5D1XA 3MXVL 3S35L 1CDUA 1ZMYA 3LY6A 5D7KE 5HY9B 4CMMB 1LILA 2D03H 2FEEI 2HFEA 4MCYA 4QOKE 1IZKA 5I9QB 1O0VA 4ZO8A 3U30B 3CH1B 2OJZL 3LN5B 5MENA 3OXSB 4P46A 2X1XR 1VGKB 2DLFL 1NH6A 1AGFB 4L4TE 4XWOD 3WSQH 4ZUTB 1KJMA 5ACLA 3WFBL 2VXVH 4KKAC 2BSED 4YQXL 2Y5TB 4M7JL 4MJ5A 3HC4H 3ILQD 3JWDH 3B5GA 1F6AB 2Q3ZA 4X6CF 5I1AA 1JNLH 3WUZA 1T7YA 4UUJA 2DLEA 4J3WA 1M4KA 1UA6L 5C09B 1I3RB 2XZQH 1GC1C 3T0EE 1RUMH 2R2BB 5JW5B 4FMKA 2UZIL 4RMQA 5H2BB 2QTEA 1QSED 3NPSB 2GT9B 3UTPD 3RY6A 3RZCC 3IS0X 4F7TA 4NNPH 2BDNH 3NFSH 2NY5H 35C8H 4G9FA 1I7RB 2HLAA 4KQ4H 5T1DL 4PGEB 4OFYD 3LSOB 3P3YA 5I71C 2CDEB 3RVXC 3D6GA 4HPOL 1A6PA 4FS0A 2NTFA 1KFAH 3KLSA 5D1XB 4PJ8C 4Q9RL 3QEGL 1ITBB 4HW6A 1DUYA 2ZJSL 3PHQA 2F15A 2X09A 4MXVE 3SN6N 1NFDF 5L2JB 2DOCA 1T0MB 3VJ6A 2Y72A 4YAQB 5CHNB 3VFGH 4ZFZA 2CLZB 2H32B 4ZOBA 1RJLB 4MSWA 5EBMA 4NKDA 1HIMH 3G5ZA 5DK2A 5C0AA 1UB6B 43CAA 1NMAH 3BX7C 2I27N 2Z93B 4Y16B 4PD4J 3KPLA 2MHAB 1R0AH 2ADGA 2LE9A 4NP4L 3NCMA 3LRGA 4UNTA 4XMKH 5J6GB 3VXMB 4IRZH 4EI5B 4K07A 2C1PA 5KSUA 1C08A 1ZANL 4FFVC 1ZHLA 1DEEB 3GMOA 1BEYH 4UB0H 2AJXL 1ZLVK 4GG8B 3BYTA 3EOYG 1PEZA 3RIAF 5LAXA 2AV1B 3DMMC 3JWDC 1JPSL 4JFXB 1YMMA 4KXZI 3MV8E 1L7IH 2J4WH 2QQKH 3FOLB 2AQ1A 2C4FU 1U8LA 2X7LB 3OR6B 4NZTL 3TYGH 1UYWH 2R9HC 4O51A 2GUOA 3ULVL 1FL3A 3BEWA 3MRQB 3O0RH 5AZEL 3GBNH 1FZKB 3RJDA 2IWGA 2OP4L 4WW2B 5DJCB 3FB7B 3FB5A 4OLUL 3OKEA 4R8WL 1DBJH 4L3ED 2EO1A 3JTSB 5I1CH 1S9XA 3PHQB 1RZ7H 1T4KB 2MJWA 4OM0H 2MCG1 4P4KC 4P3WA 3BMWA 3E8UH 4JM2A 4JPKH 4W68A 4AMKL 3TESA 1BECA 1EHXA 4UIKL 1Y6NR 3EHBC 2NZ9C 5FGCE 1NCAL 4ODUA 1Z2KA 4NM4L 3VXME 4G6FD 5L8LB 1A3QA 1JWMA 4EJ1C 5T3XE 4NBYB 3KYOB 5E5UB 1RULH 1T21B 3PJSA 3HE6D 3D2UB 1GZPA 4KK6C 4OZHA 1FG9C 5F9JB 2PXYA 1IAIL 1XGUB 8FABA 3VXNB 3MC0A 1C16B 5I1KH 1FGNH 4W6XB 4WI4A 4YDJB 5DHVH 1VADB 2VLJA 3LRHA 5BRZA 1J9CT 1MHCB 5GGRA 2QADB 1SVCP 3EYOB 4J3SA 3WFDL 5I1IL 2X70A 4W4OA 2VZTA 4JY6B 5ANMB 4RGMC 5D7JD 4JFED 3FT2B 1QRND 4X6FA 4XNXL 1DE4A 3D0VB 5C0JB 3FO9B 4U6XA 1KCVH 4AZ8A 3OKLB 4MAYC 3K8MA 5F7EH 2VLKE 4M6MH 3SGDH 3VD4A 3P0VH 5DYOA 2FWOA 3C5ZA 2OZ4L 3LV3A 4FZEL 1UXWB 4XPGL 5IEHA 4WO4D 1JNJA 1J8HE 5CINL 2C5DC 1EMTL 2VZSA 5IB4B 4I1NB 3QEHA 3QG7L 3DMMB 5KTEH 5T33L 1REIA 3HUJE 4YPGB 2YPVH 5C08B 3BZFA 3KJ4B 3QXAA 4JCLA 4QRPB 2V5SA 2C3HA 5CEXB 1KTLA 2OTPA 4HIIB 4LLQB 4L5FH 1HE7A 2VLMD 4PRHE 5J1AB 2ZOLB 5T1DH 3KPNA 5TDPA 4PJDB 5D71H 1BQUA 3ECBA 1MI5B 2GJ6D 4XVTL 3QJFB 2YC1A 2WK2A 3OKMA 2DDQH 2FX7L 3LDBB 3ULUC 1Z3GH 1YPZB 2VNCA 1I7RA 3TH2T 3ULVF 3K46A 2X70B 3CFBB 4D9QD 3ARDA 3LKSB 5DA4A 3BD4A 5K9QI 3QCUL 4HIXH 4S1RL 4K2UL 3U46B 5CEYB 4PLJD 5HDBE 4IHOA 1ROWA 1OL0A 4L5FL 1JZ6A 3MXWL 1GGBH 2DM4A 2EXYC 3WNLA 1CDIA 5FKPB 1P5UA 4NC2B 1WFUA 1PBYA 3CFDA 2SEBB 3RX7A 4Y1AD 3WXWH 5F3BB 1K8IA 3IU4H 1U92B 4D0DA 1XF2A 4Y4HB 3Q6FA 5JMOC 5L7XH 3MRCA 2BMKB 1UYWL 4AL8H 4NJ9H 1AR1D 2VR9A 4M7KH 2JELH 3Q3GB 5CGYD 2E27H 4A6YA 2X4TB 3FT3A 3U4EB 1TJGH 4JFEE 1CGXA 3SGKC 2K3TA 5IB5B 4FN0A 1NC4A 2IF7A 3FT4B 3GHEH 3NPZB 4KGLA 4HPYL 2OQJB 2W9DH 1EFXD 2V5MA 1R3JB 4NDMA 4P2QA 2CKNA 4ONOA 3W9EB 4N0CD 5DHXB 1G7MB 1UQSB 3B3IB 4HX1A 2EE2A 1UB5A 2O61B 2Q1EA 3RY6C 2UWEA 3O2DH 3UZQA 1FVDB 4UDUA 5JNYB 4JY4A 3DRTA 4NO2A 4PV9B 2ED7A 1QFHA 2MKLC 4TTDD 4TVPH 1LEIB 1RUPL 4R6UA 5C07E 5DS8B 3BH8B 3EDKA 4MNGA 4GQPH 1P4LB 2FNBA 1JNHA 1HHGA 3UBXG 4RGNB 4XPBH 3G5YB 5C07B 3QO0B 2HH0H 4OLVL 5FKPA 1GOGA 1TIUA 4HS6A 1G7IB 5E6IC 4JGUA 1K3ZA 1U58B 3QG6A 3EGSB 1OTSC 3H2WA 2EDWA 4PJCF 5IW1A 4TPRL 3IDMB 2FECL 5SWSA 4CVZB 1KLGB 2AJZA 1N5YH 1LEKA 5C8JB 1WTGT 3IDIA 4OLUH 4MZ3A 3H3PL 1T5XB 1YJDC 3STZA 1Q1JL 4UTAH 3EUUA 2RGSA 1A6UL 4B0MM 1K9TA 4PRPA 1CFSB 4XHQA 3BQUD 3FQWA 3QIUC 3KS0H 1C16A 1QHOA 3L7EB 4V1DB 1FH5L 3UBXI 5MENB 3Q2CA 2D4FA 2VXTH 3TZVA 1ZLWH 3LQAL 3GSOA 3GRWL 3O4OC 1BJ1J 3ZKNC 2AJYL 3BISA 3T0XA 4PGBA 2I07A 3RWJB 3V5KB 4MA7L 3GI8H 3WIHL 1GC1H 3BKJH 2FGWH 3ARGA 3FT2A 4MJ6A 1F4YL 4NUGH 4X6FB 1UVQB 2HJFB 2R0KH 4N1CA 5I75C 1CN4A 4X7EC 2QKIB 5J4MA 1ZHNB 2I5YL 4PV9A 5KSBA 2BVQB 5EH1A 2HT4C 1IGIL 3TA3D 3GKWH 1F6LL 3OZ9H 3GGWB 3LV3B 3HCVB 2D0FA 4GG6B 3NCYS 1HNGA 3HAEB 1UXSB 1HDMB 4P46D 5HDOA 3QDJA 1UCBH 5TFSH 4NSKA 4GSDL 3KWWA 3OHXA 4JZJB 4LSPH 4C83A 2NLJA 3X11A 5T1KB 1KV3A 4JANB 2VXUH 2EDQA 4ZSOE 1XR8B 4I0PB 4JFOA 4APQB 2IBZY 4IMKA 1U3ZA 4CNIB 3S96A 4WW1A 2V9TA 3ARQA 4LIQH 4LASH 1IM9A 3L95B 5EU7C 2GFBB 3RX8A 3KHQA 1G9EA 3CSGA 5IHBA 4YK4B 4BZ1H 3QDJD 5EO1B 1OM3L 5C0AB 1S3KH 1RZJC 2Z93A 1YJDH 1Q94A 1MHPL 4TSAL 1XMWA 1P7HL 3EFFB 4M43L 2NY2D 5FB8A 1ADQA 2IMNA 1JWSA 4R0LA 1PJ9A 4WFFE 3KYKH 1GGTA 4WFFD 2C1PB 3LQZB 4I8DA 3C2SA 5FGBC 2ZOKA 3V6OA 1LK3H 5E03A 5IOPB 4N5UA 3GJEB 1X9QA 4K71C 4GG8A 3O3BB 4G8FB 2GQHA 2BVQA 5JW3L 1QACA 2Q76A 4K9EH 2VLKA 2DKSA 4X9BA 4WI8A 5D1QA 2IAMB 3WFBH 4QRQA 3PGDB 4RRPA 5GS0L 4FQXA 4F15C 1B4JL 5HSFA 4NHUA 5D96B 4G8GA 4QHMB 1NCWH 2XV6B 4OD1L 1UACL 5BOPA 1FNLA 1PKQA 2WNGA 1R5WB 3RPIB 1IGJA 4JQVC 2X2YA 3WD5H 1VDGA 4JDZA 4OTXL 4DKFL 1TJIL 1Z0NA 1T03H 4KKBC 1V8HA 3GDBA 5JTWA 2FJHA 3TBWA 1OP3K 3VFSA 3NH7H 4WIQA 3WKML 1ZT4B 3KJ4C 5F7FA 2VDRL 3G5XB 1NAML 2XZAL 4YEFA 4Y8DC 4J3VA 4JG1H 4P9MH 5D2LF 1U8JA 1MCOH 3QA3B 2NYYC 5E5MA 2C4FT 1PG7L 3QXDA 4OCYL 3O11B 3FFCA 4PJBB 3SHSA 4JFYA 5ICYB 1SBBA 3EYUH 1MIML 3S6CA 5F88A 2R4SL 2Y25A 4DGYL 1UB5B 4M7ZC 1A4JA 1KCSL 5GS1C 3BEVA 1MCQA 2X9YA 2VXQL 3O2WL 2OYPA 4YNYB 4JN1L 3OAUL 3C60B 4FTVA 2R8SL 3PQYE 1IBGL 1P53A 1U8IA 2ATPA 2J2ZA 4OCXH 5L2KA 4UNVA 3F7QA 5DQ9B 4LVNB 4TSAH 2ADIA 4HUVA 1H15A 1AGCB 2AV7A 1WBXA 3KPMA 4Z0BL 4KTDL 5F6IB 4LDLB 3ARED 5E7BA 5I18L 3O3BA 4N0FA 1OQXA 1HH6B 1IQWH 4WDIB 5CJQL 1GGCL 1AIFA 1HOCA 4LSUH 1AXTL 3VD9A 4YDVB 3MV8B 3UTZB 4MJIB 4O58H 3I2CL 3SKNB 2QJDA 5D7KD 4NPYB 5HY9A 2Y4SA 4JRYE 3MOBH 5J3HD 4ONFH 2A2QT 2BVPB 4GXUM 5FUCC 2H3NA 1WC7B 4X5WB 3RNQA 3CSPA 3RY4A 4PY8I 3L7EA 4XBEL 2FB4L 5IEHB 3PQYA 3QIUA 4QCIB 4E42A 3QDGD 1ZT4A 1CG9B 1E4JA 4APQD 1I8IA 2PTTB 2Q7YA 4XH2B 3GK8H 4QRPE 3OAZH 4YPGA 5AAMA 3TO2B 3MREA 3QXDB 4HT1L 4DN3L 2XI9A 5CJXC 2AEQH 2CUMA 4Z6AT 1OAXH 2YA2A 3VG0L 5J6HA 3TT3L 1OAYH 4B53A 1JYXA 1YEKL 1MJ8H 2Z0BA 2HFTA 1FVCA 3MUY1 3V2AR 4DVBB 1JPFA 2XPGA 4P5KB 1FVEB 4OV5B 1P5VA 5FGRA 1GC1L 1CLYL 3O41A 1SJXA 4XVUC 4YNYA 4U1MA 4CMHC 4UBDC 5EU6E 1CFTA 2FBOJ 4YHPA 3P4NA 1EGJL 1QSEE 4X80H 3WFEH 5JW4Q 2UZYB 4U3CA 4HWBL 5J9PB 3DXAA 3BI9X 1V3KA 4PGEA 1CFVL 4P2OA 1JN6B 5FYKU 4WDIA 1H3GA 4YDKL 3SO5A 1J5OH 3QDJB 2Z91A 4P57B 4U1IA 2XT1B 1C7TA 1SYSB 5HHOA 4F9LC 4LGSB 4PJEF 5T1KA 1TZHA 4M7LL 5SX5K 5L2KD 1A3LH 1MRDL 4PJ5D 5JW3H 1VEOA 4KJQD 1UWXK 3AXLA 5A3IC 5KJRL 3OGOE 1Q1JH 1CD8A 5E7FA 1F4HA 1TZIA 2UUDH 4HIEA 4Z77B 3T2OA 2ZUTA 3L95A 1WWWX 3V6OE 4NKIL 3SGKA 5LCVL 4OF6A 3QI9C 2WWKO 1JZ7A 5JZ7D 3QULB 2JCCE 1KPVA 2W9EH 1LMKA 2YUXA 4TNWK 3MZTA 5BVJB 2DQTL 3ZDZE 4LSSL 1PX3A 4TULH 4EOWH 3LB6C 4K23L 5IB5A 2XKNB 4X83A 1FIGH 3J7HA 1NPUA 5ALCH 5A2LH 4EXPX 1L6XA 4YFEA 2OZ4H 1QFWM 3KPSB 3GI9H 4C4KT 1RZGA 5FDYA 5DVMA 3BKML 4FQ2H 1LWRA 4G8GD 1CGTA 1DBAH 1XF4B 8CGTA 2R4SH 2XN9A 3TYFA 5EIIA 5GGSY 5T33H 3L3OB 2H1PH 2MTPA 1HI6A 3LS4H 4JE4B 5ISZB 1K6QL 3KLHC 2GUOB 4D9LL 1L0QA 1IAIM 4OZGA 3F65A 3QWQB 4IOSD 2X4PA 4U1KB 4OF7A 5GS3A 5CEZD 3MV9A 1UKTA 3IVKB 4GBXD 5DSCB 5F7KC 1XZ0A 2XTJC 3GMNB 2E27L 4TTGA 3TN0B 2YD1A 5BMFL 4KUCD 4JDZB 2VDPH 4HS6B 1L4IA 2R56L 1OAKL 5I8OL 5J06A 1N8ZA 4S0TD 2NXYC 4WI5A 2D7TL 4ZMAT 5IW1B 3G04B 2IPKB 5I71B 5I1HL 3ULSA 5I73C 2CO6B 2NX5E 3BWUC 5FGBA 4Y19E 3KJ6L 1FZMA 4BFBD 1W2KT 2Y36L 3PWVA 2W0KA 1QEWA 3AGVA 4TUKL 2B5IB 2DQJL 1DQDL 1EXUA 4Y16A 4ZO6A 2DQDH 3VWKC 3QQ3B 3SE3A 4AG4H 4OV6F 1AQDB 3VXPB 3VGFA 1LDSA 2YSSB 5JW4M 1PG7H 4OCYH 1INQB 1FBIH 2HWZL 4YDJA 2YWYA 3QXUA 3VXOB 2EH8H 1MHHA 4I0PC 1D5BA 4M6NH 5K9QG 4QF1A 3T3PF 2WBJD 4X9IA 2ADIB 4XZUA 3ULUD 3BPCA 2AV7B 4AIXA 2ZUVA 1YY9C 4XPAL 5JHDE 2NY4B 5J12C 6CGTA 2ARJB 1HOCB 4RBPK 5KN5B 1E27A 4HIHA 4JO2H 3T3PE 3DVNA 1LDPH 1CGYA 2YBRA 3CX5K 4FQ1L 4MQ7B 4MXWH 4K3EH 2GSIA 5FO7B 2H32H 3THML 4QRTB 5JXEC 4G6JH 1E4WL 1G7LA 3UTOA 3HI1B 2APBA 4PRIA 3NCYP 5FHBH 4BKLB 4LSPL 3B2UD 4K8RC 5HDBF 2NW3A 5MEPA 1HZHL 4OQTH 3PV6B 3DNKA 5BQ7A 1Z9OA 5E9DA 4LRNL 3LEYL 3KXFD 2PXYC 4AT6A 2VDRH 1U8OA 1QFPA 1UA6H 2VL4A 3R8BB 4ZTOH 1WFNA 5CKAA 4YHIB 3DV4A 4K7PH 3U9PL 4EIZC 1K2DB 2FX8L 3R0NA 3OG6B 5LWYL 1NCCH 3VFUA 2QADC 5I66A 5J7CC 1GZPB 1ZXQA 2D31A 2V2TA 3EO1A 4KMTH 1BVZA 4DVBA 4Y88A 4WGWB 1ZVHA 3T3MF 5EU4B 4BZ2H 3KVQA 4WY7H 3IDGB 4XNQA 5TDNA 2D7OA 4WWKD 1DQDH 2GJ6E 3VMNA 1FQ9C 5BS0D 2ZCHH 3TJHC 4X99A 5GRYA 5TJWK 1B88A 1D9KD 1C8PA 1CFQB 2F58L 3FQTA 3S3PA 4ZNCD 1OAUL 4CVXA 1AXTH 1H0DA 1BIIA 2EDKA 4D9QE 2NY5L 3I50H 3MFFB 3HKFA 4NQEE 1VFAB 1GIGH 5B38A 3ZTNL 2F74B 2YBRB 4MQ7A 3W0WD 3KYMA 3VXRD 2X10A 3PL6B 4FQPA 5C08D 4HV8A 4HIEB 2YMXL 4Y4HD 3BP4A 2JTDA 4DGIL 4I3SL 1MVUA 3OBAA 2FB4H 3GZKA 3P0YL 1T1YB 4F80A 1E4WH 4R26H 3RIFK 5DI8A 1KEMH 1B0GB 1X4YA 4WUKH 2DQEH 1PW3A 5JUEL 4WI6A 1F11A 3QDHA 1DCLA 1X7QA 3G5XA 2YKLH 4OT1L 5IVXF 4J8RA 5I1HH 1TNMA 1AJ7H 1EFXB 1CICD 1JNLL 4G6MH 1DFBL 1CGSH 3CCHB 2R0LL 3M8OH 5F6HJ 3PNWA 3VFTB 4P5MB 1G84A 2E8ZA 2NY1C 1FN4A 2NY1D 1LP9F 3BYYA 4NIKB 4PJ5E 3SDXA 2WWMC 3QJFA 1JPGB 3ARTA 1YEDB 5E95B 3V52L 5I17A 4LLMB 1G6RH 5M94B 4O51B 4BK4A 2YZ1A 1SMOA 1FL3B 4DCQB 4M9PA 2V7HA 1QSFB 3MV9B 3IXTB 3WIFA 3MJ9H 1RIUL 2FX9L 1QLRB 4GW5B 4M1DL 1U36A 2VZVA 4NQDD 1UJ3C 3O2VH 4Z7VF 5D7IB 3QHZL 2QLVB 3BDYL 5DMGD 3KYMB 1U8KB 1F58H 5H94A 1T22B 3DO3A 1FPTH 3ZYJA 4D2NA 1KTKE 2HVJB 3INUH 5I1KL 1XR9B 2OX5A 3TNMB 4KRLB 5EA0L 3PWLA 3WO4C 1KB5H 2G60L 1MFBH 4YO0A 1MOEA 1B0WA 4XHJD 5JOPD 1DQQA 1FNFA 5DEFA 1RY7B 2B8OT 3U36A 1GH7A 2YRZA 3NACL 3UDWC 2ICCA 2YEZB 5IWLA 1ZKAA 4QXTB 1JGUL 2A83A 4HG4K 2D7QA 4U1NB 2NY2C 2EKSB 2KZWA 4XVSL 3RVXD 3ZT7A 1I3GH 1T83C 5I1GL 4NHCH 3U48A 1HWHB 5L88H 1Q9KB 5EOTB 3CCHA 3BPCB 1TJGL 4N8VA 3THMH 4HJ0D 3VFTA 3SE4A 4TSBH 1OTTC 4ODVL 4AIOA 1QBMH 4HWUA 3QH3B 4KRMB 1INDH 4WFHD 4JZNB 2BERA 4LGRB 4JFDD 4ZPVB 5C0CA 3MBED 3GSVA 1RQ5A 4KAQH 5GRJL 2Y23A 4F3FB 4P2RD 1WZMA 2W07A 3PWPD 4CGTA 3AREC 1BEYL 3T2NH 4GOSA 4AH2B 1PZUB 32C2B 3U2SA 5AZ2L 3MLVH 1K5NA 1RURL 1RUAL 1VENA 4PJBE 3V9FA 5E08L 3C5SA 4L3EB 4EVNB 1BF2A 1JNNH 4Z78B 4HGKC 3IFPB 1U8PB 4YBQD 4Y5YC 3EKCA 4HKZA 3IDIB 4I0PA 1XR8A 3LOWA 4HK3J 4R90L 2WUBL 3CGTA 1OGAE 1DBMH 4PJBF 4ZOAA 4PJCA 3GRWH 3GHBL 3LD8B 1I8MA 2EYRA 2UY7A 4O2CB 5A2FA 4EN3A 1D5MB 3EAKA 2CKBB 2NCMA 1LVEA 2ZUSA 5GS1B 5IR1B 1OSPL 1MH5A 2BRRH 1NCBH 1BM3L 1RZJL 3HUJB 4J1UA 3FAXA 4ORZC 3KPRD 4J6RH 5EBWA 3G6JA 2W60B 3LKNB 3PXHA 4LL9A 2ZKHL 1CXIA 1L7TL 2WV3A 2DL9A 4XX1G 2XNAA 4YFDB 5DR5L 2QSTA 3WO4B 1E28A 2AKRA 2AXHA 2EDYA 1F6AA 4PG2A 3ARBA 3LRSB 4NYLB 3QCVL 1AHWB 5FYJL 4PG9B 3VFMA 2ENSA 5SX4I 1BLNB 4OJFL 1FGNL 4LFHG 2XZCH 2Q76B 4MXWL 3MV9D 1MUJA 4N5EC 1FNGA 4PRAA 4UV7H 1XIWD 4XTRD 5HD8C 4EDXB 3HR6A 1OW0A 5GGSB 4U1LA 1NCDL 4LU5H 4MS8C 3WHXA 4M00A 5TE7L 1HDMA 5M7QA 1IZJA 4ZDHB 3NFNA 2BVOA 3STBA 5JHLH 3OKOA 1A1OB 2MQ3A 4O4YL 3E6FB 1VHPA 1G7PA 2B7DT 2EDHA 5CKGA 1ND0B 3VFSB 3AAZA 5DHYA 3BFOA 4KZEL 4H0GA 1B4RA 1F11B 1X7QB 2N1KA 2VLLB 4LSUL 1EGJA 1HH9A 4HKJA 3DETC 3MGTB 4S1QH 4PG2C 2DWDB 3TIDA 3SDCD 1J11A 4PJBA 4W6WB 1FYTE 2BFVL 4GAJL 3UP1A 2GKIA 2A6JB 3BSZH 1G7MA 2FH8A 4GKNB 4UILL 4LAQL 3NIGF 4NZJA 3VWJD 3EFFA 4LCWA 2NX5B 2F19L 2YUWA 3L3KB 4G8EA 4U7SA 5CZKA 4PGCB 2XNAB 3SDXE 4EI5A 3GSXB 2AKRB 3LPFA 4MD0B 1MAKA 1RHHB 4LPCA 3QFJB 1RU9L 1KPUB 4OM0L 3GIZH 5F97E 5HHOD 3GJEA 4Q6IC 3VU2A 3EW3B 4N0FB 4MNQB 1UH4A 1EJ6A 4HMCA 3EYQD 5J56B 3FMGH 5I76B 2JLLA 1OAYL 3TEUA 2R39A 3DGGA 4Q9QH 2CDFB 3PGDA 1KLGA 4EXKA 2F8XC 1G6RA 3CLEH 4MQXC 5JIKA 1WITA 2DQGL 1MQKL 1WC7A 3QIWC 1U8QB 2IANA 3SDDD 3ILPA 4XNUH 3SQBA 3O6LH 3UTSD 4I9WE 1IQDA 3CPLB 1A02N 1KJMB 1RIVL 2D4DA 5C0BD 1G9NL 3RFZC 5GGRY 3P9MB 3MRMB 1WF5A 4YHIA 1S5HA 2BNRE 4AEFA 2ZG1A 1Q0YH 3P73A 1AFVH 3KYOA 2DM7A 4OGAC 5AWNL 3VXQA 4ERSL 1Z0MA 3QDGA 4OUUB 3TIEA 3H9SA 4U1MB 4JFPB 1EBPA 2FO4B 3IDGA 5CGYC 4ETYA 5HYSB 5KSBB 3LEVH 4Y0GA 2ZG2A 1X5YA 1G0DA 1P9MC 4LCCB 2IPUK 2HLFD 3CDGA 1NUNB 3MLRL 3DRQB 2DLTA 1AGCA 1K8DB 2WBKA 4RX4A 4JY6A 4WCYL 5ANMA 2VKWA 4TOYL 4FXKB 3HN3A 1GRWA 4NCDA 4X9GA 1UXSA 3EOTH 1BJ8A 3V4VL 3WUWG 1F97A 4DGIH 4YXLH 2XWBB 2MQCA 2A6DB 2RR3A 3PIQB 1IMHC 2EXYD 2LAAA 3T77B 3OR7B 2FGZA 2APVA 4NQDB 4ZO7A 4Z0BH 5F6HI 1RZJH 4K94H 5TFSL 2H45A 1C1EL 1KOAA 5EUOE 2X4QB 4JEGB 3N9GL 5ITBL 3H3BC 3RU8L 2CPCA 4LKCB 3QXVA 1URLA 1S5IL 5F9WB 1CFVH 1JHLH 2FECI 3CH1A 4PJ9D 4QRUA 3W0WB 4YBLB 3OXSA 1X6NA 3OAYH 2DYPA 4XBPB 4LHUA 2IAMC 3G6JB 3ARFD 2OMNA 4K7FA 1JTOA 4XMLH 3FFCD 4HXAL 5F96L 1V7NH 4M6ML 1BM3H 4Y4FD 2PW2B 3RNKB 3UAJD 1MCKA 4NKQB 1RZ7L 1WAAE 4P2QE 1YY9D 2BNQE 4HWEH 1N5AB 4WWKB 3GMPB 1WWBX 2QR0A 1FAIH 1HHKA 1Y0LA 1XF4A 2WWMD 3K1DA 5GZOC 5D9SA 4RMTA 5E4EC 1OT1A 4HLZH 5CD3A 4G9FD 3AU1B 4UMGA 1KTRL 1K8DA 3HNSL 3IXAA 2GAZA 5ADPH 3SJVA 1IT9H 4L8SA 5ALCL 3SQOH 3IVKA 2BP3A 2Q6WB 2GTZA 2EEAA 1HSBA 3I6KA 4ZDHA 2BY3A 3UPRA 3O4LA 3PL6D 2X89A 3OKOB 4M62L 4M02A 2VLRE 2EC9T 5HDQH 3QZWG 4PLJC 4ZXBB 2Q7NA 2NY7H 3RGVB 2XA8H 3E3QE 1KC5H 3H9SE 4YHOL 5F1IB 1H3TA 3AVEA 4Y4FC 5HYQA 4QHLA 4QRRA 2CMRH 3OF6A 2YN3A 1OD7A 1QFWH 2W0FB 5BS0B 4F7CB 1KUMA 4OZHB 43CAB 1IILE 2FEDC 1A8JH 1J0IA 3DX7B 4R2GC 1FZOB 2NX5A 3QEQB 3L3KA 2A83B 3BEVB 2GEEA 2HFGH 2LQRA 1N6QL 4L9LB 1MHHB 4X5XA 5KSAC 2MSPA 2OCFD 1L7IL 3DUUB 4JM4H 4YBHA 1T80A 2EICA 3EYOA 2CGRL 2IANE 4JHWL 3U0TA 5JHDD 3DUSA 3GJFH 4QRSB 2P5WB 1KJ3L 2LTQC 3MJ8B 3F6IA 1XCQA 4X4ZA 4P48A 2Z8VC 4HCRL 4J4PA 1FIEA 2R2EB 3HC3L 3MRDA 5IMOA 3GUTB 4TRPH 4JPVL 3D0VA 3O4OB 3SDYH 4GRLC 3X13A 3ZDXF 3KPPB 1A7PH 5B3NA 2VN4A 3IFOB 1I1AD 4YX2L 4BA8A 4UT6L 3RKDC 3HAEH 4HKXA 5IB2A 3T0BA 3CVHH 3ZHLA 5GRZA 3C5ZB 4H26A 1LK3L 2PYED 2JJUA 2YRLA 3RVVD 1DQJB 1F4XH 1M6OA 4PUBL 4AL8L 4N0YH 4UIMB 4MX7B 1CZ8H 3CZFB 1KJVA 4JJ5B 5DQDL 4QT5B 1H3VA 25C8L 1IM3A 1TNNA 3MLUL 4ODXB 1QO3A 4X7SL 5HVHB 1JWMB 1OAQL 3QHFH 3BKCL 1D6EA 4EQ2A 1KPRB 5EUKB 1RUQH 3BP6A 3BPNC 4OF0A 1OY3B 1MCWM 3O41B 5E99L 5FYLE 3D9AL 4K23H 4JO4L 3Q48A 2Y36H 1LNUB 4KROD 4KY1H 5IJVB 1IBGH 3B9KC 3P4NB 2NY3B 1UCBL 2VWEE 1MJ7H 3UDWA 2NY6C 3CDGB 2Z92B 1NDGA 3JBG7 1WBZB 3MRIA 3QRGH 3IFLH 4IOFC 3TBVA 2BHYA 2HKHH 3OAYK 4KRPB 3IF1B 5TH2B 4PLNC 4HQQH 2CDEA 3IFNL 4K8RL 3PABA 3NGBC 1FFPB 3JWOC 3FO9A 5D5MF 2HT3C 3WNOA 5I19H 4O9HH 4JRWA 1WWCA 4ZFOB 1CVSC 2ENYA 1UJ3A 3GIVB 4OLZL 4YGAB 3GBNL 3RVTC 2DQIH 1Q9OA 3T1WA 3MRCB 3HNSH 4ZYKA 4LF3A 1N59A 2YPKA 2J6EH 1K4DB 3HAEA 1FYTA 1OAKH 3WHXB 2FHFA 1NGPL 2D7TH 4HS8L 3LS5L 2RQ8A 4F58L 4OGYH 4N9GA 2ADGB 2B1HH 4HEPG 4KKCD 5DJDB 3QNYA 1XGRA 1IRAY 4AK1A 4X4YB 4Z76A 2XKNA 5F71A 2R1XA 1YEKH 2VDKL 5FM5O 3TT1L 4NN5C 4D9LH 2ICWJ 2HP4A 5LBSH 1XGYH 2ESVA 4OCRL 1LQSR 1MJJB 4H25B 3HMXL 4DKEH 1TVBA 2IPTH 5AUMA 3SDXB 1FNSH 1U8MA 5HHQB 4PJXF 5IM7A 2CR6A 2UWEB 5D2LE 5T1MB 4F58H 5JNYA 3WUWA 5CD3B 2BOCA 1FRGH 5C0RH 2XQBL 3O3DA 2V9QA 4OFPA 5E2VH 4LNVA 2DF3A 1RULL 5F1NA 1C12B 3I6KB 1YNTB 2FIRT 1X5LA 4JB9H 1A7QH 1LE5A 1R3KA 3U1SL 5C2BH 1SEQL 2QSCH 1QRNE 4NOFA 2OM5A 3T0AA 5C6TL 2F54E 2E7CA 5C3TA 2R1YA 4G7YH 5DXWA 2OL3L 2CUIA 3LKQA 4OIAA 1PG7X 5C0FA 4BFIA 1JRHL 3WLBB 4FA8A 3QIBA 1CE6B 1F90L 1FZMB 4XMKL 1QEWB 3IAGC 1YN6B 4YHMH 3ALPA 4WUUB 3V5HB 2A38A 2WIIA 1H8SA 1U95A 1IGJB 4BM7A 3HRPA 3HLAA 5F9JA 1ADQL 4WVRA 1IJ9A 3LVEA 2Z31A 1S3KL 3VXOA 4GRMB 1EO8H 5D1XC 1XGPA 4KK5D 4LQFH 2OR7A 3QNXA 4XWOC 5ITFA 1MREH 4X80L 3WFEL 1NJ9A 1IE5A 4PBXA 3BOVA 5I75B 5GGRB 2R4RH 1PKQE 4KKAD 3GSWA 5TGBA 3NFPA 1FFRA 3HZVB 3KDMB 3D1MC 1WIOA 1CVRA 1RIUH 2FX9H 3T0ED 3UTTB 1IEAA 1SJHB 2W0LA 3QG7H 5BO1L 4YWGH 1DANU 3TIEB 2CQVA 4TOYH 5DD0L 1CZ8L 2RCSH 4PJHF 2C3VB 4DFHA 3BKJL 2R15A 1B0RB 2IFFL 4ELKB 1A9BB 3IXTA 3WIFB 1KXVC 4OLXL 4H26B 1FC2D 4GRWH 3TBYB 5HGAA 1NLBL 4GFTB 1T7VA 3IDJB 4GH7B 4O02L 1KJ2B 3OB8A 4HH9B 3ZT5A 3SY0A 2AEPH 4M7ZB 1WWAX 4XP9H 3S36L 3OHXB 1MHEA 3LS4L 5HI3C 4P2OC 2DQTH 1VFBB 1LEKB 5C8JA 4P2OD 2WIMA 1F8TL 1MWAA 3HI5H 5D8JH 3WDJA 3VDBA 3G6AB 1T5XA 3D3VA 2EYRB 1CXHA 3WSQL 2EYSA 5EOCJ 3AMKA 1BZ7A 1F00I 1M05A 5FA4B 4LLQA 2I24N 4GT7A 3QZWB 3SDCC 5IMKB 4FFYL 4OD3H 5GRVL 5ID1B 4J1UB 4ZUTA 2HN7B 1MI5A 4OQ1A 1IAOB 4JO3H 3NZ8B 1HCFX 1QLFB 2E8YA 1EHLH 4J23A 3TA3B 2OTUA 4HXBL 1CGSL 1JRHI 2LU7A 4HZLA 4Z7WF 3EOBB 2XZQL 5C86A 1QOKA 4BZ1L 2LTQB 4Y1AA 3UCRA 5HBBA 5IMMB 1A6ZB 1OAZH 4CN4A 4QY8A 1GZQA 5DVKA 4KKNA 5C09A 1I3RA 1IKNC 3TH3T 4UTBL 4Q0XL 2F58H 1T04A 2VXVL 3QBTB 4P49A 4WTWA 1TVDA 1MNUH 4X6BA 2OSLB 2C3VA 1AXSB 1MJUL 4KK6D 4JQVA 3EYUL 3PL6A 3ARDC 4ISVA 5ALBL 1MCIA 3CU1A 5CMAB 3REWA 4M48L 4P2CG 2DTMH 4OSUL 1I9IL 3VWKB 4ENED 3OKDA 1JN6A 2GK2A 1ZAGA 4UI2A 5I1IH 5CUSH 1T66D 3VFRB 3CMGA 5EO0A 1XIWC 4XTRC 5HD8D 3NFNB 1ZEAH 3I6GB 3QEQD 3FFDB 5GXBB 5IHUH 1P84K 5DQJA 4NN5B 2NTFB 4U6HA 3IFPA 4ZUVB 5HHNB 4C83B 5EWIL 3V5DA 5EIQA 3SKOA 4EDWL 4Z7WB 3VH8G 3AXLB 1S7TA 1NGPH 3R4DA 4LMQI 1P7QD 2DKUA 4G43B 2XFXA 1T0MA 4O2CA 3K81A 4P3DA 1KBGH 4MAYD 1V7MH 1X5FA 3T1FA 5K59E 5J13B 3DIFA 3VXRE 3PV7A 4YHML 4RFEB 5EO1A 4PJAF 1NDMA 3EOTL 4EUPB 1TVBB 3G5VB 5AUMB 4Y19B 4J3XA 1OCWH 1S7UB 3SCMD 2A6KA 4AM0A 2W0PA 2KQNA 4ETQB 3O9WC 2E6JA 1JWSB 2IALA 3NOIA 5GQBA 3MRGA 4PJDE 3GSQB 5KJRH 4DCQA 3PE9A 3GBML 1MFCH 1R5IA 2VH5H 4D3CH 1LE5B 3IU4L 1WAAA 2J88L 5TPWH 4KVCH 5K9JH 4GAFB 4H5SB 2IQAA 2P5WA 4X6BB 4MNHA 3U82B 1B6UA 4PB0H 3V4UH 4V1DD 4OFYA 1PY9A 1U8KA 2ORBH 4YHOH 3VXUD 1PZ5A 1U8LB 3GKWL 3JVGA 1TTFA 4U6VH 3V0WH 3CXHK 4ELMF 5I1JH 4Y7MA 4Q74A 4YO0B 2P5WE 3QO1A 3V4PH 2YZ8A 5GGTL 3STZB 1BX2B 3PL6C 3VI3E 2QBWA 3FO2A 4KJPC 2AK4E 4HWEL 4PJ7E 4YJZL 1WZ1L 3I3BA 2MWCA 4XPGH 5HHNA 3LN5A 3AROA 4QNPE 5B8CC 4MX7A 5D71L 1S7TB 2R1WB 4JVWA 2PUQT 4HUKB 3F7YB 1IGIH 3U0WL 2X4NA 4LVHB 3F7RA 3OGCA 4LARL 4NQCD 4OKDA 2OI9C 2VUYA 1IGMH 1JHKH 5E9DE 3TIDB 1GGUA 4MB3A 4WI2A 1YN7A 3DIFB 3MZGB 4RFEA 1N2RA 1XF1A 4GKNA 5B3JF 5INDB 1QTYT 1N3NB 4RWHA 1A3RH 3F5WA 4MNGE 4PLKC 3SGEI 1HYSC 4YHZL 2P5EE 1QSVA 3C5ZC 3MLVL 5DR5H 2ZSVA 3HZYB 4PJFA 3VG9C 2VLRB 3L3GA 4MDIB 1VADA 4C56E 2P47B 2FD6L 4E41D 1NFDA 4ZUWA 4LARH 4HUXA 3I2CH 3BN3B 2GJJA 4DN4H 2HLAB 4CW1B 1NAKH 3R1GL 5F1SA 2ILLA 2VAAA 2ARJA 3MUHL 1KB5B 5J11C 2CLVB 3UZVB 4XC3L 1FPTL 2Q86B 4ZS6D 1SYSA 5HHOB 1A6UH 3WN5B 2VDPL 4JZJA 2ZUQC 2CDFA 1LE9A 4LRIC 1EV2E 2GSIB 2YUVA 5FO7A 3C8HA 3HE7D 3QO1B 3QPQC 1MJUH 3ARSA 2FLBT 3ZKXC 4BQ6A 5FA3B 5F7NC 1MFEH 4LPTA 4MCYB 4P5TD 4FFZL 3MBXL 43C9B 2Z8RA 3RVVC 3QWOA 4JVPA 1G7QA 3QIWB 5GGVL 2YPVL 5IB4A 1FL5B 1U8OB 5GPRA 3HUJA 2WLZA 3MR9B 1J1OH 3U7WH 5IBUG 4X7TB 2MKWA 4LCUA 5HHMB 5JDSB 2IBZX 4GXVH 3RAJH 2EIBA 3L3IB 4OM1L 5E6ID 2FSEB 4NFBA 3C8KB 4X4YA 4Z76B 2DS4A 1IC4H 5FECB 3ZE2F 2Z8WC 2ADJA 1GJIA 1CK0H 4NGHH 4OGZA 4A6YL 3BVNA 1OLZA 4PJ8A 2Z31C 1QBLL 2VLJE 2BSRA 4P0DA 2H2PC 5EC1B 5IVZB 1T5WB 2YHGA 5HGDA 2FJGA 3BUTA 3A6OA 2YC1B 3P0YH 5HHOE 1NBYB 4OZHE 2GAZB 3B8SA 4HXAH 5F96H 3DV6B 3L1OH 2GTZB 4JKMA 4PGJA 2CLVA 3UPRB 4Z7OE 1NMCB 3KLDA 3IETB 5CEZE 5DQJB 5GS2D 1JPTL 4ZUVA 2F74A 4G6AC 3EDEA 3C9NB 3K4AA 1OOAA 4M5YH 4NJ9L 1S7WB 3FN0H 3PP3K 3GHBH 3ULSB 4C4KO 4JM2B 5FA3A 4G43A 1CWVA 1PYWA 4LOUD 4YC2B 2WINB 3HC3H 2X6MA 1PLGL 1P69B 1KN4L 1UFUA 4LSSH 1NBVL 4WTZA 2W65B 4I0KA 4OUOA 5FV1L 4Y4KC 4F7CA 1T1YA 1RZ8B 5GHWL 4K3EL 5E08H 3OJVC 1L9MA 4MA3A 1QFUH 1QBAA 3FN3A 4IDJH 5EORH 2I60L 3ULUH 4Y5VC 1OLLA 4CU8A 4OFIA 3PGCB 4PREB 3D18A 4X9FA 5I1EL 1QP1A 1F13A 1EPFA 3LQAH 3MJ6A 3HG1D 1EFXA 1ZLUK 5CSZA 1KPUA 1P7KA 3BXNA 4NDMB 25C8H 3I84A 4LDEB 4LSRL 1EA9C 3LEVL 3ALWA 3DXAE 3MRDB 4TVPL 3GUTA 5JOFB 1IGCH 1HN1A 1TQCC 3UX9B 2J8UE 3HMWH 3KPPA 2DJSA 3ELAT 2DQEL 3VCLA 3IFOA 4HKXB 4RGOH 2V7HB 2MPAL 3VD5A 3VXMD 4H20H 2PO6A 2QQNL 3FO2B 2H3NB 3WBDA 5FYJH 5CZXD 4YZFF 1YNKH 5IG7B 5LGHH 5FXCH 2OTWA 5F3HB 5DGRA 3C9NA 1KJ3H 3RUGA 4DKDC 5BVPL 3WIHH 3OKKB 1IGCL 4TSCH 1C5CH 1OGAD 4CVZA 4JZJC 4XVUD 2Q7YB 5TE6H 4W4OC 4GQ9H 1QO3B 1MWAB 3H8NA 1BQLH 2D7PA 3PWVB 3G6AA 1E6JL 1QYGL 1GCFA 1RZ8A 4GW1A 3B9KA 3STLB 1OGAB 2D9CA 4KI5E 2YEZA 1RD6A 1W0YT 5EC2B 1GVIA 1A22B 4DK6A 4ZNEE 3REVB 4OUUA 3TZVD 4U1NA 4JRYD 5IJKC 4JFPA 3RGHA 2XKUA 3CXHJ 1D6VL 2FHCA 1VB9A 4WHCA 2VUOA 4UTBH 5B39A 5DK0B 4XC1L 4YGVB 1G6RL 3U7AA 5FF6B 4FQ1H 4KTYA 4JO1L 4DZBA 4EUPG 2VXTL 1EEUA 4XNYL 5K93A 4JFDB 5IHZB 3KPRB 5IMOB 3UBXA 1R24A 1UM6L 4OCMC 1KIQA 3CFDB 5E2TL 1LHZA 1UJ3B 3GIVA 4NQDA 1U91B 1ZWIA 3EYFB 1K3IA 5F9OL 1T2JA 3OAZK 3BP4B 1A6VH 2P49B 2FWOB 1NC2D 1A7NL 4MS8D 5ADOH 1U2HA 5FIEA 2JIXB 5MEPB 2EE9A 2AAVA 1BBDH 2IMMA 1RK1A 3MGAA 3EO9L 2UYLA 4S10A 1EAPB 5D7LA 5EU6D 1IM3B 3RA7L 3X3GL 3L3IA 1IC1A 4BZ2L 3D48R 3P2TA 3WDHA 4KKCC 3JWOL 2L7UA 4PJGB 1FO0H 1NAMH 2XZAH 3CFCH 2EE6A 3KAAA 5ADOL 1X5GA 3O6LL 3MUZ1 3KPSA 1CE1H 5CGTA 1FFNB 4LMQE 5C70A 1TQBC 5TE6L 1B2WH 1OSZB 2PYEE 3B3IA 3VRIA 4PJHB 1W8NA 1KB5L 2G60H 4HZAA 1U8MB 2Y7QB 5IM7B 5HHQA 1NMCC 1CT8B 5GGUB 3W0WE 1T2QH 5E8OB 4P5TB 2ATKA 3I50L 4JPWL 2NW2B 1NBYA 4JVUA 2BY1A 3DRTB 5I30H 3OF6D 5MEOA 3IXAB 1JGUH 3SJVB 4N90D 3VXRB 4JM2C 2K9UA 5DC0A 3IGAB 4ODSL 4DGVH 4U2YA 2XA3A 2D3VA 4JDTL 3W2DH 5ECJE 3U4BH 1UWXH 1YMHA 4IOIB 4AYFA 1KCRL 2IQAB 3LQAC 2R4RL 2FATL 2UUDK 2XY1A 2XACC 1S78C 3VDCA 1U91A 3ARDD 5F3BA 4N0UB 4NZDA 2DQHH 1CDJA 2XICA 1Q9OB 3BH9B 3QUML 5IBTL 1HHJB 2WINA 5B21A 2ZUUA 4EBQL 1EK3A 1QA9B 2P5ED 4ZPTA 4RWYH 5ILTH 3O2VL 1DL7H 4IS6B 5IFHL 4Q9RH 1RK1B 5ERWB 4PJGE 4P2RB 4O9HL 5K9OB 4Q58C 5BS0A 5HHMD 3NIFE 4G6ML 4A6YB 1F42A 2CGRH 4Z7UB 3GIZL 1CLOL 2ADFH 1XGQA 4HUWA 2VDNH 3FQXA 1HINL 3QNXB 3QQ9C 4X5XB 1F4WL 4PJGA 1QFUL 4UDTB 5SWZE 1A4KB 1SYVB 1WTLA 4CU7A 1QSFD 3EO9H 3QDJE 2V9RA 4WHTA 5ABDE 1FGVL 4JQIH 1GAFL 4PJHA 4JO4H 3ARGB 4JN1H 3B6SB 1FHGA 3VFVB 3C6SA 3CFCL 2WBWB 3DVNB 5FYJD 3DURA 3CU7A 5BS0E 2VLRA 1D5ZB 1XGYL 2OJEB 4TSBL 4ELKA 4QWWC 1QSFA 3HMXH 4DKEL 3DBXB 4BKLA 3IU3B 2FBJH 4CW1A 1M6OB 1P4BH 4WTZG 2VR5A 3KLAA 1KTDB 5JXAL 3F6LA 5HHVH 4U1JA 1B3JA 3KYNA 1F4XL 3IDMA 4PRBB 3BHBB 1S78D 4WW2F 5IFJB 5GJTL 4XMLL 4X7DC 3U1SH 4ZPTB 5C2BL 1JHKL 3CDYA 1UWEL 4K55A 5IGXL 2XZCL 2BVPA 2A9NL 1MFAL 2R69L 4PB9L 3RL2A 5KS9E 5JR1L 2D31B 2O26U 2CKBA 4Y19D 4XCFL 4HKBB 5F7HA 3MRJA 5D7LE 5AAWA 4N8CL 4DUXA 3UJJL 2VXSL 3FQXB 4PP1D 2AK1L 1ZT7B 4B41A 4DGYH 3NZ8A 3WXWL 3ZHDA 3E1F1 1HKLH 4KGJA 4XB8A 1M7XA 3IYLW 1A47A 2DB8A 3Q5TA 1KYOJ 4QRRD 3ARGC 3ZL4H 3AY4C 2NY4C 5J12B 1CYGA 4G6KH 1NMBL 3IF1A 2AABH 2A6IB 3BRGC 4PRIE 5FHBL 1UZ8A 1UVQA 2HJFA 3RU8H 1FFPA 3DURB 2QKIA 3BZEA 5I8OH 2BHZA 1MY7A 5IVZA 4RAVA 3VRLE 3VWKD 4JFZH 4HS8H 3T2PA 4H8WH 4JY5L 1QUNA 4MXQD 4M6OL 4F7TB 3P4MB 1A6AA 1A9BA 5DC9B 4BH7B 1W72H 4MWFA 1ZTXH 2IJ0C 3Q6GL 4U1LB 3GMQB 3RX5A 4WI7A 5EUOB 3PP4H 4FXKA 4LSTL 5FUOH 1T1ZB 4I3RL 4P2YA 4G8GB 5J57B 5AWNH 1MCBA 1D5IH 4YIQB 4U0RC 4U1JB 3HE7B 3BDXA 5E8NA 5E4EB 4KMQA 4U2ZA 3S4SG 1BBDL 1GSMA 2QSQA 2A77H 5IVNA 2FJHB 1S7WA 1QFOA 1AQKL 2J8HA 3ROOA 3TVMD 2NXYB 3KXFE 4O02H 2XFXB 2R1XB 4KTEL 4XX1E 1KB9K 1JTPA 2LU4A 5D70L 1L7TH 2GJZB 2RAMA 4WW1B 4I9WD 2DWEB 4FMFA 3A67H 3MV9E 4ELMA 1TJIH 3MQIA 3TPUB 4TULL 4EOWL 1OGTA 4PLKD 4H25A 1KPVB 1YEJL 2BRQA 4MA3B 2EKJA 4F8TA 1ACYH 5FYKD 3SDYL 4UT7L 1S7QB 2NW2A 3N50A 3OJ2C 1G0YR 4R0LB 1S9YB 5KS9B 4JO1H 1WAAF 5HYFA 5D2NC 2R56H 3BKCH 4WWKC 5HGHB 1QLEH 4X6DE 1R0AL 3ARWA 3W81A 1X5XA 2COQA 4KK8D 3KJ6H 4RZCA 4RAVB 2RHEA 4JHAL 1JGEA 4YDVA 2H6PA 1NL0L 3P40A 4Z7QE 1JJUA 2PTUA 3SKNA 5H37G 1HHJA 4L29B 1EFQA 1QA9A 1HILB 1RFDL 4Y4KA 2NY6D 4L8SB 4DK3A 3FRPA 3BKMH 4P5TC 1BX2A 5K9OA 2OBGA 2WIIB 1KLFA 5I15H 2H8PA 1INDL 2MCPH 3ILQC 5C0GA 5IUSA 1XGQB 3NIDF 3PQYB 3GM0A 1S9XB 2DTML 3FTGB 2R1WA 3ROOB 4KJWD 5BO1H 4QGTA 1SYVA 4KJWC 4Z95H 3UYRL 3TO2A 3TT1H 4HC1A 1U8JB 3QA3A 4QO1A 4ACPA 1F4WH 4OLYH 4XVJH 2V7NB 5FUZH 3QQNA 1G9MC 2A6JA 4A2MA 2VDNL 5I1AB 5IFAL 3C6SB 3D87B 5E70A 4DUVA 3H9SB 1YYML 3GSNH 2WP3T 5CBAA 4L9LA 3C5JA 3MJ7A 4XCNB 2IALB 3VG9B 2Y06H 3SOBH 1NCNA 3ROLA 1R5VA 1T0PB 3GSXA 3UC0L 1Q72L 3PP3H 3IDYB 5J1SC 3ZYZA 1J1XH 4U3HA 4HK0B 1T1XA 1BBJB 1R5IB 3KNBB 4HWNA 4Q9QL 2VDKH 3ULUF 4CU6A 3A0OA 4M9OA 3L5XH 4HC1H 3QDMB 4B50A 2HTLC 2YPLD 4Y2DB 4HJJH 4I77L 5TQ0H 4I2XB 3Q0HA 1V7NL 3BUYB 2BCKA 4BQ9A 2A6DA 3H9HA 1YEHH 3JV0A 3T0EB 3B9AA 4LLAA 3O6KL 4L8CB 1LE9B 1YMME 3VXSD 2Z35B 3DPBA 4X4XB 3AREA 1WGOA 5GSVB 1DL7L 2DLGA 3TF7C 4KUZH 4JFZL 3NH7L 2AEWA 3T4AA 1F3JA 1KIRB 5FYJE 3S36X 5I9QC 1TTUA 2JIXA 3A6CL 4PJ5B 1WIUA 1MJ7L 5J0BA 1DBKL 1M7DA 3FTGA 1BZQK 5BZWA 3LN4B 4OI8A 2NY0D 3O8XC 4PFEA 5DDHA 3QUYA 3QEHB 4MAUL 1W0VA 3ARRA 2R2CA 4KDTA 4RGMB 5EBWB 4JJHA 4G8IA 3L5WA 4KUCF 3SJVD 1BGXL 3EOBA 1YEIL 3BZFB 3QXAB 5JUEH 2VDLH 3P73B 1P1ZB 4MA8L 3WL9A 4NWUH 3QJHA 3TM6A 2VXSH 1N2RB 1CR9L 3EYSL 1TZGL 4NWTL 2V2TB 2VE6B 4LVOB 1DEEA 3GMPA 1CFBA 1TETL 3QUXD 4WCYH 1T04B 3AS3A 3CC5B 4DWHA 2FYYB 2Z31D 5HYJD 3ROLB 3ECBB 4J3TA 1R5VB 5LWYH 2E7LC 4WW2C 5HYSA 4EI5C 5IJVA 1BMGA 4MAUH 5HYJE 4YHPB 4H1LG 4NO3B 5F8QC 3ULUE 1NFDB 2E3VA 4MWFB 4JN2A 5KG9B 4YFLI 5D1QC 1EBAA 5IKCA 4E5XB 3FQTB 3OPZL 2JJTA 5HGGS 3CFBA 3MO1A 5KVEH 1UEYA 4Z7NE 5TH2A 3EJYC 1I1FB 2BCKB 3HE7A 3MFFA 4M1CC 2A0LC 1VFAA 4KU1A 5B38B 4RDQF 1BFTA 3WYRA 3OR7A 4Z7NF 1I9RH 2BSSB 1I3GL 1ZLSL 3IT8D 1K8IB 1PYWB 2NY3D 4XP1H 1JFQH 1MF2L 2EIEA 2YPLA 4AQ1B 5CEZH 2QQQA 2W65A 3PDGA 3O3EA 5IQ7L 2BHUA 4IS6A 1MAJA 4KVNH 5CP3A 5FO8A 1KJ2L 3FHAA 1NFKA 4ORGB 3G5VA 1OW0C 1XGUA 3O6FD 3QEQA 4KMTL 2NY0C 3AMLA 3CLFL 5D7JA 2FSEA 5JDJA 3MA9L 2Y07H 2ICEB 1LO5A 3RNKA 4K7PY 4JKLA 1XAUA 4AJ0A 2F5AL 4AG4L 4DW2H 4RSVA 1C5CL 4HAGA 4MQXD 3U4BL 5GS0D 5DUPH 5F8RC 3CC5A 5MP6L 4JRYB 1KCKA 1JF1B 5C1MB 2D2OA 2A0LD 2Q87A 1SBSH 3KGRA 2R0KL 2JJTC 1V3JA 4Y2DD 4LLMA 1HI6B 3QDMD 4L4TA 4E5XA 1G0XA 1IC7H 5DVOA 1BF8A 4QRTA 5EB9A 3QRFM 5JORA 4MJ2A 2XY2A 3DX9B 5DYOB 2JELL 1HSBB 1JZ8A 3TFKC 1RFDH 5EN2A 1U8NB 4LVOC 1PFCA 4OZGF 2B1AL 4S1QL 4LQ1A 1QKZL 5ESAB 2D0GA 1RMFL 1CXKA 2YD6A 4EZMA 1MCJA 3RTQB 4OKVB 1EHLL 1KENH 4WI3A 5JOEA 4X98A 4X9HA 2WW8A 2AQ3A 4FZ8L 3BRFA 4IIQC 3V5HA 3CX2A 3B9KB 3W82A 3MNVA 1WCBB 2E9IA 3DX8B 1RJZB 4PJEE 3NPSC 4O2EA 1AQDA 2JJSC 4XBGB 4ZAKC 5D5MA 1NKRA 2GCYA 3TZVB 4P59L 4WJ5B 2FIKA 1ZT7A 4CDHA 4PJAE 2PYEB 5F7LB 1ZGLP 3SE3C 2Z92A 1H3WM 5DD6B 2CO7B 3EO0B 1RUQL 2JCCF 4JFDA 1JF1A 4NWUL 1J1PH 1WFOA 3ZDZF 1VSCA 1X6LA 4K3DL 2ITDA 1E27B 3T0VA 1CLOH 2MOVA 2XWBA 2HYMA 2Z35A 4X4XA 3DVIA 4R7NA 4DOHE 1HHHA 1DBBL 3W5MA 3MROA 3SDCA 1D6VH 5MERA 1VGEL 1A6AB 3L3HA 1U9KA 4FG6D 1U92A 4D0DB 3T4AB 2HMIC 5FYKE 5ICXA 1A2YB 1Y6KR 4R4FL 2BMKA 1YNLL 3B2VL 5IG7A 2R9HD 4L8BB 1K4DA 4ENEC 4NZTH 4IRJC 5T1KD 5IVOA 2HTKC 3QIWA 3CZFA 5DRXB 1YPZE 4L3CB 3CUPA 4PTUA 1U8PA 3O6ML 4KDWA 1T66C 4QEGA 2ZCHL 3KPSE 3QNYB 2E7BA 3ETBF 4JFDE 1RURH 3RZWA 2GHWB 3L5IA 1I8MB 4UU9A 3RQ3A 3NZHL 5KVDH 4R4BA 3QPXH 4HGWA 3DX8A 4XP1L 2NXYD 4TTDC 4H0HB 2BJML 4P3CH 3O9WA 5T3XH 1OSZA 3REVA 2JB6A 3BP6B 2P7TB 5ID1A 1E6OH 4WJ5A 5C08E 2BY0A 3DARA 2PYEA 3MRHB 4P5TA 4PR5B 4U1HB 5LXGL 4M3JA 4UZGA 1N7ML 1P84J 4TYUA 1DANT 5IKCB 2AXGB 1GOFA 3MA9H 3O9WD 3IDXL 5C9JB 4LSRH 1NDGB 3MRIB 1VFOA 4GG6E 4Y1AB 3PHOB 1ZSDB 3ARPA 3F62A 4KQ3L 5D2NE 3WLWD 4JM2D 1AKJA 4PY7A 3BO8A 1MCSA 4I0PD 3RJQB 5C07A 1DQTA 5DURD 2AJVH 3DVGA 3VXUE 4BZYA 4IEFB 4NKIH 3S35X 2CD0A 2VLKB 1G1CA 2H6PB 1Q0XH 3IJSB 3I3EA 4IDJL 3U83A 1QNZH 4QXWA 4LHUG 1NANI 3UJTH 1F8TH 4FQXB 1PG7W 5C6TH 4LLVB 1MQKH 5KOVC 4GS7B 4PP2B 3GMMA 4GKZB 3TVMB 5KAQF 3IKKA 2CKBH 1A0QH 3DX7A 1G7PB 2CRZA 4V1DA 5DUBB 2AI0L 3BGFB 1MCPL 2GITB 5LGJA 5E6YA 5GGTA 5K59F 4Z7UE 1ZA3A 4EI6B 2AXFA 2KPNA 3S37X 4U49A 1IC7L 1NGYB 4XAKE 3TVMC 1BOYA 5CWSB 3U0TB 2JB6B 5ICYA 2DQJH 4PRHD 3A6BH 4Y19A 1SJHA 3U9UA 3I6LD 4YXLL 2FJFB 2L0DA 4XXCC 3QEQE 2ATKB 1U6AL 4BYHA 4LVEA 5HYEA 1KULA 4OGXL 4ZPVA 2H2SC 4NUGL 5C0CB 4HJJL 2AXGA 5E8DH 3GSVB 1TVHB 3MRGB 1RK0A 4BJLA 2AJUH 4FQLL 3BSZL 4H88L 4YDLC 3MCLH 1FG2A 1DBAL 5D4QA 1PX4A 2Q8AH 4BH8A 4NUJA 4NO0D 3O2DA 1TTGA 1AO7B 5C0BE 4MNHB 4NC1E 5T3ZD 1QG3A 4H1LB 2WBJC 3RUGB 4K9EC 5D1ZA 5I74B 1I3VA 4X6CA 4Y8AA 5IW6A 4XNXH 1WT5C 4N0UA 4UINH 1VFBA 4LEOB 4NFDA 1I1AC 1M7IB 3LZFH 1UM5H 4HWZB 3QAZB 4LLVA 1QZ1A 12E8L 3MRBB 1D9KB 1YN6A 5F9WC 4PJIF 1OGAA 5C0ND 1BZ7B 1M05B 1Q0XL 5C0BB 2DQUH 3VWJB 1AI1H 3ULUL 1MH5B 4E42B 5DURB 5JXEA 4WV1B 1J8HB 5HDQL 4GRMA 2HT4D 3QP3A 4ZG1A 2D9QB 5EU3A 5FB8B 4WFGE 2OTUB 4IM8A 4P23D 1Q9KA 1PLGH 4MJ5B 1Q38A 5TGBB 1FSKC 1TDQA 2R23A 3DHMA 1PSKH 3BW9B 3B6SA 2G2RB 3HRZB 4HBCL 5DJ6A 2ZKHH 3MJ9A 4ZOCA 2P8PB 4HWBH 4DUWA 4N90E 3V6BR 1KIQB 2ZPKL 1CFTB 4MDIA 5E94A 3JTTA 4F33A 2YD8A 3RPKA 1ZWIB 1NC2B 4ZUWB 4CJ0A 3TN0C 2C3WA 2OP4H 3K8KA 5L6YL 3MV7B 4XWGL 2KH2B 4H8WC 1BP3B 3VA2C 3U2SB 5I1LA 4D8PB 4ZODA 3SY0B 5FDWA 3FFDA 1KN2L 3ZKSD 3C5SB 4EVNA 5BMFH 4YZFE 1GIGL 4N9GB 4Z7WA 3SKOB 1FCCA 1O7VA 2NYYD 1BZ9B 3RWDB 3J8F7 3KYKL 3VFNB 5JXAH 4OI9A 3U6RA 4QHNB 4Y4KD 3O9WB 1RJLA 5LG1A 4M5ZL 2V17H 4K3JH 3VRIB 5EU6B 5I16A 1RV6X 4FABH 2HJKB 4S2SB 2F5AH 1QRNB 4ESKA 4AM0B 1B6DA 3DSFL 2BOCB 5EZOL 35C8L 1CF8L 5FECA 2H2SD 1RHHA 1U8IB 1E4XI 4JRXB 1P4IL 1N5AA 3QUZC 4WWKA 4HUVB 1YNTA 4G7VH 1H8NA 3BPLC 1LP9E 1DSFH 4JRYA 5E94B 4HBQA 1A7OH 1DR9A 1PZ5B 5FK9A 5ID0B 4MJIA 2X7LA 3F12A 3M17B 3Q5YA 3FCTB 5IF0B 3QIBB 2X4PB 4U1KA 5CJOH 1MFNA 3MRFB 3U7YL 3KHOA 5D72L 2OR9L 3ZE0F 5JORB 5ERWA 2HG5B 4O00A 3JUZA 4P4KD 1KENL 4LKXB 4M1CD 5EO0B 3SCMA 3TVMA 3D25B 5L2KE 3RKDD 1A1OA 3QWRD 3X3FL 4GAGL 3JTSA 3CPLA 3UTTE 5DUBA 4DKAA 4FFWC 3RKPA 3VFNA 3V6OC 5CJ5A 5SV3A 1ACYL 3AB0B 3JXAA 3WS6A 1HH9B 2DWEA 4LAJH 1CE1L 1FDLL 5ACMA 4OB5L 3WE6B 3AS0A 4YQXH 1UACH 1WCBA 2AI0H 5IT2L 4EUPA 1N3NA 4YHNA 3S98A 2NZIA 5C0EA 3SGJA 3FMGL 3WXVL 2ICWB 1MJ8L 1T6VN 2EXWC 5F7MC 3RWEA 5FYLH 4KFZC 3GSQA 3O6FC 5GGVH 3LD8C 2N7BA 3DUUA 4BSVA 3QFDB 2VRAA 4HF5L 2DI8A 5I6XB 1NFDE 3DUSB 1AE6L 4Q0XH 4QRSA 4P2OB 1QSEB 2HFGL 2FEEL 1I7ZA 1I1CA 4PJFE 3P11H 3C87A 1FJ1B 5KN5A 1I3UA 2CR3A 3T0EC 1TMCB 3ARBC 4M6OH 4XP6L 4JO3L 4U1IB 1NGQL 5I8KL 4UT9H 4U6XB 2W9EL 4G7VL 3WIIL 1NCAH 4PBVC 4PJFF 1G7LB 2UZIH 2R8SH 2D7NA 2O5XH 1ZS8A 2HG5A 5IESL 4Z9KB 4KZEH 1DQJA 2BOBB 5C0GB 1SY6H 3JV5A 5MP6H 3M45A 3LN4A 5BQ7B 5GGVY 4MYWB 4PJGF 5HI3D 4PJHE 5DK3A 12E8H 4JCMA 4RFOH 4YHYB 4JDVA 3QUKA 2OLDA 3JVGC 2VZOA 1L0YA 5FM4A 1V7ML 3LAFA 3ULVH 5TF0A 3P30H 4KI5F 2X44D 1DP0A 4GAYB 4GKOA 3RDTB 3QJHB 2AJSL 1MRCH 1DLHB 4QXUH 2IEPA 1AJ7L 1J5OL 2WQRA 5GJSH 4KK9D 4IMLA 1X5JA 5EBLA 1KPRA 4IRSA 2C3XA 5D93B 3QDGB 3R1GH 4ZUSB 5GS0C 2FATH 3B9DA 4UOW1 4XCNA 4M7LT 3HZYA 4PJFB 1KN2H 1EEYA 3VWJC 2XN9B 5EIIB 4CDGC 3C2AH 3DWTA 4BSVB 3P4MA 4DVRL 4M93C 1T1XB 4HK0A 1GXEA 1F3DJ 3MO1B 1BGXH 3MRRA 4WU5A 1NBZB 3PDOA 3SKJL 1J12A 4CVXB 3HG1B 1KB5A 1GOHA 5FDWB 5HVGB 4CJ1A 4WFED 3HFMH 4YIQA 4IHOB 2NY1B 3RVWC 1UT9A 2X4OA 3GEWB 5T5FL 5TQ2H 3VW3L 3N1FC 3TCLB 4KHXH 2NZ9D 1DBKH 2BSSA 1PDKA 3V5DB 4F7PA 2HAZA 4IBLT 5KSBE 3RGVA 3EYFA 3IFLL 1MEXL 1OSPH 1Y18A 1DQLH 5HGBB 1MFAH 2R69H 4PB9H 4XP4H 1CLCA 1U3JA 3Q6FB 5ESQB 2VH5L 3BRDA 1YEGH 4IRJD 1N59B 2YPKB 4ZOEA 3ZSSA 4WUKL 5I19L 2OR9H 3LN9A 2HLFC 2WUBH 2HMID 5HPOA 4RGOL 3T09A 3QQ3A 4S2SA 2EDDA 3MOBL 4YR6B 4PRHB 1AC6A 1IEBB 2YD2A 4YC2C 3GB7A 3WFCH 1Z9LA 2VJXA 1LO5B 1R3IH 1RUKH 1YC7A 4NQXB 4UOW0 2PO6D 4RMVA 4K3JL 2EDOA 2OQJA 4PRPE 5JO5B 2YD7A 2R29H 1UGNA 5H37H 1A21A 3MLZH 4OQTA 2M8XA 4XT1C 4GAJH 3D69B 1BQHG 1A6TB 3B2UC 3H9SD 5CSGA 1T5WA 2RJMA 4YEEA 5E2VL 1ZLVH 3O6MH 1FVDA 4UDUB 3RWIA 1W72L 1A7RH 3TC9A 3OZ9L 4JY4B 5DO2C 5KG9A 3M17A 3K2MC 1A6WH 4XCCL 3CFKA 1NBZA 3HPLA 1JV5B 5IB2B 2IFFH 4YBLC 3IGAA 4MQSB 1J0HA 4L3AA 2X40A 4OLWL 2PYFA 3OXRA 2VQUA 1NLDH 4MB5A 4H1LA 4PPTA 1JP5A 3Q1SL 3B5TA 2JF1A 4ZXBA 5HGBA 1SHMA 5IROA 2DN7A 2IAND 2BVUA 4JHZA 4TVSa 4X6EA 3GSUA 3HS0B 3DV4B 3K7UA 2VDQH 3OGCB 4FNLL 3VW3H 1HEZB 3CLEL 1K2DA 2R0LH 3SOBL 5AD0A 3MNVB 2G9HB 5E2UH 2XXMB 5CUSL 1D9KA 2V7NA 1YECL 3HMXA 2DAVA 3ULVE 2Q8BL 4ZS7L 4TRPL 1VGEH 4HMEA 2L4OA 1MPAL 3FQWB 5EU4A 1KCRH 5J89A 4QHKI 1JGLL 3D18B 4GLRI 2P5WD 3VXTA 2VDLL 1S7RA 1DVFC 3OB0H 4KVNL 3E6HA 1H3PL 4FQ2L 3S5LA 3V7AG 2V5TA 1BPVA 3QI9D 4MZ2A 1OTSD 3WN5C 4X99B 3CFEA 3HE7C 3QPQD 3HZVA 3KDMA 4PGDA 4ALAH 2X4RA 4M7KL 3ISWA 2GTWB 2Y07L 1MRCL 1I7TB 3UTTA 5IQ9A 4ZFOL 3BW9A 4MJ6B 1P7QA 1IAIH 4FQCH 1XFPA 4NC1C 3MV11 1DN0B 4ZNEA 3MV7E 4P4KA 3TJEL 3LZFL 1GL4B 1UZ6E 4U0QB 1G7JA 2VZ3A 3IDUA 3H3PH 3S4SA 2QEJA 4XP6H 4FFYH 4PJDF 2VWEC 3ARFC 1NCWL 2IC2A 4CL7A 1NGWB 2ZZUT 2LVCA 4FP8H 1GGIH 1QRKA 1S7SA 1BVLA 2NY5C 3CIQA 2EZ0C 5EN2B 3G6DH 5ENWA 1N7MH 4ALAL 2OTWB 5F3HA 3SGJC 3SKUD 5HYJA 1GAFH 1N0XL 2WMPA 5IESH 3HI5L 4AEIL 1PGRB 2F54A 5DDHB 1ONQB 1I8KA 5T1LD 4PRBA 5D7LB 5DI8B 1W0VB 2MFNA 2NLJB 2V2WB 4LCUB 5JDSA 2F53A 1SJVA 1MCOL 3VFPB 1FCGA 3E2HC 3WO3B 1YDPA 4R4BB 1P1ZA 3L3JA 5DRWB 4HUUB 5E6IA 3RL2B 5IT2H 3U6RB 3L6FB 3S36H 4LLWA 2PO6C 4HJGA 1IM9B 5CAYB 2XWJB 4GKSA 4IMLB 5EBLB 3BN9C 3LH2L 4X6DB 5E9DD 1W72A 2ESVB 1FGVH 4JQIL 1FNAA 1OARL 2WQ8A 2C1OA 3H9YA 2WWKT 1Q0YL 5ILTL 5FYLL 2VSCA 2ESVE 3MA7A 2FJGB 3CDCA 1QLFA 4YWGL 2ESVD 4HCRH 5F7WC 1A0QL 2EDEA 2CK2A 5A40E 2WBJB 3ARBB 2GTWA 2J1KA 4WEUD 4JRXA 4NYLA 3MNZB 1F3RB 3RBGA 5D6CA 2VL5A 1AO7E 1KB9J 4XCEB 1FO0A 4RGNC 2HRPH 1J87A 3ULVD 1BLNA 2CH8A 4R7NB 1JPST 3LKPA 1B9ZA 1JHLL 2R1YB 3HR5B 4R2GD 2PR4H 3EFDH 4BH7A 4L4VE 1ETZB 4GAGH 3TNMA 4UQ2B 2AW2A 4ZTOL 5KZCD 4D9RE 4V2BA 1VKXA 5FO8B 2V6HA 4LSVL 5J8OA 1J0JA 1YJDL 3ZDXE 5DLMH 4RFOL 3CUPB 1XF3A 4YR6A 1J88A 1CXLA 1FRGL 1LK2B 1DDHA 3HHRB 3W39B 2B2XL 4NFCA 3D0LA 5DHYB 5LGJB 1P4BL 3HC4L 3UPCA 2P4AB 1QHPA 3BGFC 5DRWA 4H20L 4GBXB 1NJ9B 3D85D 5C7XL 3L6FA 5JO5A 5IB1B 1T7ZA 3NIDE 1BVKB 1R3HB 1P6AB 3PP4L 1AGEA 1S8DB 4W4NA 1OGTB 5GISL 4XNZB 5D7IF 4BK5A 4GW4A 3V6ZB 5F21B 5F88B 4LQFL 3SQOL 1QBML 3BESR 3G08B 2RIKA 5T1MA 3WUWB 4JZNA 4JRXE 2QQKL 4NO0A 5D7IE 5MEOB 1P2CA 1B0RA 3ZTNH 1CDCA 2IG2H 4MJID 3DBXA 4PJXB 2PO6B 5F1NB 3RWCB 2A74A 4Y5YA 4AEEA 2MMXA 4NO5A 3KLAB 3KS0J 4U33A 1CLZL 1KJ2A 4HH9A 5SWZD 3LKPB 4RMSA 2FGWL 2J5LB 1EEZA 3BHBA 3MLYH 2X42A 3MV8A 4XB7A 4XC1H 1EDQA 1ES0B 1WLHA 5ICZB 3WV0A 4LEXL 1R3LA 1G6RB 2N4IA 4L3EE 3WLBA 2VDOL 5CLTA 4YDIH 2DI9A 2KUTA 3CDFA 3MRKA 5BV7H 5CZXC 3D3VB 3RWGA 1ZOXA 1U93A 1IAII 4G5ZL 4X5WA 4OZIB 5DRZB 4EN3B 2B4CH 4HKBA 3R06B 3V79C 4IRSD 4WV1A 5D5MB 3ZTJG 4DN4L 1OP9A 4OZFH 5AYUL 1UH2A 1QQDB 4MAYA 1JF5A 2X4NB 4M61A 1H5BC 1A4KA 3O3UN 5FUCE 1E28B 1YEEL 1I1AA 3O6KH 5CJOL 2C4XA 4LPXA 2B2XH 3SE8L 5EFIA 3UJJH 5C6WH 1T83A 5KAQG 2YXMA 1FNEA 1YQVL 1JIBA 3DMMD 3VFMB 3BMVA 3KPRA 1JPFB 2XPGB 1FVEA 3O45B 2KQMA 5I1DA 4P4KB 2WANA 3C5JB 3MJ7B 5JHLL 3TV3H 2QSCL 3IAQA 4DKFH 2R0WL 1DBML 3QIBD 3MROB 4JKPL 5IK3B 3FQUB 5AZEH 4LPWA 1T6WA 5MERB 3UTPE 3W5NA 4BH8B 5GJTH 1EHNA 2FZ3A 5DJZB 4MLSA 4EKXA 3EZJB 5ETUB 4NBZB 4OM1H 1BAFH 1CF8H 5FKAB 5HVHC 1X5ZA 4UV4H 2AJUL 4FQLH 4O2FA 4U6YA 1MIMH 1XH3B 5IW3A 4NM8L 4JRXD 1KCLA 2F53B 2UV3A 1R3LB 1ORQA 3EBAA 3ZDYF 2YD3A 5E5RB 3TPKA 5GRJH 3O4LD 1WVZA 3HNVL 4XGZA 1U0QA 3F8UB 1S9VA 3F7VB 3SKMB 5IBUB 4QHNA 2VYRE 5DMGC 2NY2B 1IKFH 2EYSB 1JMXA 1G6VK 2XWJA 4GKSB 2HFEB 4U1SB 1G7QB 4EDWH 3MV8D 4RISL 4OI7A 3LS5H 4IIQB 2QQLL 5GGUA 3SDDA 1IAOA 1DQML 4G8EB 5E8OA 3RVUD 3QIBC 3S35H 3QUMB 2P8MA 4MXVF 4YXHH 4YHKL 2IADB 1CL7L 5HGHA 4KK9C 1NUDA 3MNZA 4G9DB 3TBTB 5EOQH 1RU9H 3SBWC 2I9TB 4XCEA 2QR0B 2P42B 5AG9A 4XNUL 1CXEA 2Q20A 3WHE1 5IK3A 5DUMH 2G75B 3QUYD 5L0QC 3VGAB 5B38G 1N64L 2AJVL 4QXGH 1J8KA 4OZGB 3MRFA 2YN5A 1X44A 5EUOA 2Q6WA 2M2DA 1T89C 5FKAA 4LKXA 4R3SB 3CVHL 2VSDA 5DSCA 4UILH 2GIYA 3VXSE 3UJTL 5E6ZA 5C0DA 2V2XB 1DDHB 3VGGA 4KJYA 1YQ2A 5BJTB 5E2WL 5DEZA 2F8VA 4N0RA 5AZ2H 2APWA 3FO0H 4M8VA 1Y6MR 1JWUA 5CIPB 4UDTA 3ZKMC 3HE6C 4HFUL 5DJ2B 3P9MA 3DYPA 2QV2A 3O3EB 1HXMB 5DFTA 5L2JA 1HEZA 5AD0B 3VGEA 4O58L 4LU5L 3T1FB 1V5JA 1VACA 1N0LA 6FABH 2EC8A 1NDMB 3BQUB 4NGHL 2Y9RT 1UB6A 4ZFGH 1S7UA 5T3ZH 3SO3C 3HZMA 4ETQA 2HTKD 5MI0C 1JI2A 3RWEB 3VXTB 2HJLB 4NQUA 4OJFH 4OFDA 5JA9A 2DQGH 1MFDH 3KNBA 4D9RD 3PWNA 4HHAB 3C08L 4XZUB 5GRXG 4P3CL 4Y5YB 4YPJA 1TJHL 3K74B 3N9GH 5ITBH 3C09C 4PGDB 4UIKH 5DC4B 5LCVH 4UOJA 1MI5E 5T1LB 5C07D 5CIPH 2H26A 4WWID 3K2UH 4NP4H 2QQNH 2FRGP 1MCFA 5CJBA 3WKNA 4JG0H 1IL1A 2E6PA 4JFXA 3S3JA 3F12B 2W38A 3AUVA 4LPUA 1CU4L 4NKMB 3FB8B 2X9WA 4NCC2 1CLZH 3H6JA 3QCUH 3MRBA 4FQIH 2WLYA 4L8DB 4ZS7H 1BOGA 2R0ZH 2Q8BH 2NW3B 3D25A 2EDJA 2QSVA 1MPAH 1JGVH 1N26A 1B90A 4KJYB 4UIMA 5MEND 4HFWA 4NQSA 4LCYA 4POZD 5EBGA 1J8HA 4XVTH 1LGVA 5KSBF 1ONQA 3S8WA 1WT5A 3L3DA 3IDNB 1JWUB 4LHUB 5CIPA 5D1ZD 5IVXA 1RJCA 4FOMA 5H35B 4HPOH 1KT2B 4OSUH 5DD1L 4S1DC 4MHHG 2DMCA 1K6QH 2N7AA 1J0KA 3UMTA 2F8OA 3VE0A 3T65B 2LVEA 4HJGB 1ZLSH 5INDA 3O45A 4OCNC 5I1DB 2FBJL 3EHBD 2FIKB 4M62H 2ZSVB 1JMZA 3RL1B 4UV4L 3EOAB 1S7XA 4NO3A 4G42A 1NC2A 5C0AD 1JYVA 3CVHA 3H42L 2FZ3B 2E9JA 5DJZA 2ORBL 3MRRB 4MGXA 5CJXA 1MLCA 1RIHH 4J4PC 5DFVD 1CD0A 1FORH 4RCAA 4FQJH 3MRLB 1J1OL 1JUFA 1YNKL 3ESUF 3ARXA 1XH3A 2NNAA 4NQED 5D7SH 3WN5A 5LKNA 5HJ3A 3TP4A 2C3GA 1KGCD 1X5KA 5T3XL 3RWDA 2VISA 3BPOC 1BAFL 2W9DL 5BCAA 3T2QA 1ZGLM 1SY6A 4ZYKB 2BOBA 2HVKA 2GJ6B 4NC0B 2EZ0D 2Q3AA 5DRXA 5E2TH 1M7DB 2IH1A 1ORSA 4WY7L 3SDAC 2DM3A 4MMXC 1GYAA 2XTJD 5I16B 3T3ME 2ZP0T 1MQ8A 1QRNA 4KQ3H 3MR9A 1EHAA 4GRWF 2R0ZL 5LQBL 2AGJH 1GPOL 4I5BB 1YYLL 3QUMA 1RVFL 4JPVH 3SDAD 4FQXD 3C8KA 2QQLH 5E8EB 1B2WL 3DLQR 2OK0L 2A9NH 4MD4B 2Q8AL 1NGZA 2ADJB 2I9LB 3MOQA 4LHQB 5K9KA 2I9TA 1FFNA 2AVGA 4U6TA 1LO3L 3D39E 1MJJA 3LEYH 4DZ8A 2AK1H 4C56D 5HHVL 4YHKH 5E00B 5I0ZA 2E6QA 4QNPF 3KYAA 4YH6A 5L6YH 1BHGA 2BNQB 1YYLH 3FJTA 3VCLB 4L29A 5HHME 1JV5A 2GI7A 4LLYA 1IVLA 2V5YA 3PHOA 4HLJA 1ZSDA 1P2CB 2CRIA 5EWIH 1MNUL 4EEEA 3NA4A 1KSRA 1O5DT 1C12A 1YC8A 4F2MA 3ARDB 1I1FA 1A7NH 5A16A 4J4PD 5DFVC 1YMHB 2C7UB 1J10A 1KXQE 4HMDA 3S34H 5H8DA 5DFWH 3CSBA 2V2XA 3BT2L 4ZQKB 5BJTA 1VA9A 2VDMH 5B3JE 3PG2A 1U8HB 2IBGA 4OZFB 3IJSA 2XTJB 1FH5H 5GSRB 1XT5A 2QADD 3H0TA 4X98B 1XR9A 1UWGH 4GXVL 4X6DF 1T20B 5LBSL 3FO0L 4OGXH 1J0YA 1FV1A 3FONA 1FE8H 4K2UH 1KCUH 4E41B 4G7YL 4QTIH 3QDME 4OAWA 1HK6A 5JXED 3I75A 4LCCC 3UYOD 1KGCE 3QWRA 4HWBA 1FYTD 2Z8SA 2LABA 4K8RD 4X5LA 4C56B 3S5LB 4CMHB 4P23C 1E0OB 3AC0A 4JFQB 4XXDB 5B39B 3U0WH 2I9LA 2VITB 3RDTD 2A1WH 5GRWA 4ODHL 5GZNC 5FV2A 4LCIL 4OBSA 3A6CH 4N8VB 2X4RB 5EFIB 4DZ8B 4FQIL 5IGXH 1DN0A 3SDAB 4FXGB