3JZ7A

Crystal structure of the extracellular domains of coxsackie & adenovirus receptor from mouse (mcar)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
b'PEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus and adenovirus receptor homolog
publication title The coxsackievirus-adenovirus receptor reveals complex homophilic and heterophilic interactions on neural cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2009-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A02
3TBYA 1BD2B 5D1QC 1QBMH 5K9QI 4JRXA 1O5DT 3CZJA 3FJTA 5FM5M 3CSYB 1GGIL 2OCFD 1AXTH 3LZFL 2NXZB 5TE4H 3VH8B 4O9HL 1PY4A 2EIZA 5JPNA 4GRLB 4O2CA 2LAAA 1OAUL 4P2OC 4NNPL 4J3WA 2NY1B 1OGAD 2EXYC 2JCCA 3BZDA 5ID0A 2EIDA 4HUVB 1AH1A 1KTRL 3KS0H 1D6VL 4HJGB 4LU5H 1P4IH 4P2RD 5CIPB 4LEXH 3VXRD 5TE4L 2MQ3A 4BJLA 2DQCL 4Z7NF 5H2BA 1MY5A 5EU5A 3SE3A 3TVMA 4YHIA 3MLYH 5L2KB 3EW3B 3D18B 2P48B 2X42A 3C6LD 5HVHB 3C8DA 1J8HB 2WQRA 5KOMC 1T1YA 5HDQH 1KTLB 1P4IL 5CJBA 4LEXL 1MQKH 3IDXL 1DEDA 5C3LD 4JREB 1BD2E 5MEQB 4F7TB 4L8DB 3MLYL 2EH8H 3HI1B 3MNZB 3UZQA 2R2HA 3WFZA 4GOSA 4P5TA 3BN9D 2EC9U 4NUJB 2DN7A 2IANA 1Y6NR 1J05A 2ITCA 3UBXI 4MA8H 4L9LA 4XNMA 3IS0X 1MQKL 1OSZB 1MJUH 5HYIA 5F6IB 3OF6D 2ED7A 4Z7UA 1BMGA 5EO0B 1NFDF 4Y4HA 5F7LB 5AG9A 2ZP0T 3F58L 1CVRA 3B83A 1F8TH 1YEKH 5DJ6A 3SDYL 4KXZH 2DWEB 5L2KE 1MFCH 4OF8A 1MJUL 3FB5B 4Y88A 2IQ9L 3IB4A 3DX9A 1T20B 1KYOK 1J8HE 3D69A 2KDGA 3H3BC 3TYFB 1MCJA 3D3VD 4OZ4B 1LEIB 5CEYB 4OZFA 3PP3K 4LKCB 1CXKA 4HFUL 1QO3A 3EO9H 4XGZA 3Q3GA 2ZCLH 1MFCL 4PJ7A 1ND0A 5DJZB 2V2WB 1CDCA 3E1F1 4C4KT 1JNNL 3EYVA 4YWGH 4K55A 4UT6H 5JPMA 1VGKB 2FD6H 5H8DA 1H3TA 4XPAH 4FHBD 3BDXA 1ZT4B 3LRGA 1NCWL 1I7TB 5ILTL 1KIQA 1ZT1A 2A77L 1NDGB 1JUFB 3O0RH 1GZPB 1LE9A 2ZUTA 2FYYA 4NBYB 2VDKH 1A2YA 5B39B 2ZCLL 4FP8H 5IB4A 3GJFH 5TGBB 3O4OB 1RUML 1RUPH 4LVOB 3PDOA 2V2XA 4PR5A 4UT6L 2FD6L 3RZCC 4NKDA 2YUWA 4Y5VB 1F3DH 4LHJB 3KJ6L 3VD9A 3DPBA 3VDCA 4R7NA 3CDCA 4V2CB 4YIQB 5D9SA 3GKWH 4Y5XB 3HR6A 2EYTA 4PRPB 4TSBL 1FVCA 2E7MA 5HDBE 4ZNCD 4YGVB 2VDKL 3QDAA 4L4VA 3E8UH 2Z91B 3C5JA 1BP3B 3HTLX 4K8RC 1RUPL 5C09B 3P9MB 2VDLL 5FYKL 1FL6B 4BK4A 5A1AA 1R3JB 5I9QC 3RVVC 3H9SA 4ONFH 4ZUSA 1SEQH 5F3HB 1F58H 4IOIA 2EDLA 3FB6B 1M4KA 5EIQA 1PBYA 5F70A 2AJ3A 3GKWL 1F02I 3V52H 1NKRA 3MV8A 1RVFH 5I1GH 4HFWB 3PHOA 1N64H 1ED3A 3O6KH 1MJ7H 4PTUB 4OZIA 2WP3T 4RMUA 4Z95H 1U92A 3E8UL 4NQUA 4OT1H 4MAYC 2R1YA 5D8JH 3RUGE 3F12B 4YHOL 3VXNB 3RU8H 2O5ZH 4GAGH 2IALB 4R6UA 3B8SA 3QT2A 3NGBB 2IMMA 1F58L 5K9KB 4BUGA 1NFIB 3V52L 1T7ZA 1TPXB 1GOGA 5GRUH 3FN3A 2HT2D 1SJEA 4CW1A 1T83C 2BY2A 1MJ7L 4C59B 4PLJD 4Z95L 1ACYH 1JPSH 4OT1L 4G6AC 3UTTE 3B9KC 4JY4B 5D8JL 3L5HA 3UPAA 4OAWB 3SJVD 5FDYA 2BVPB 4PRPE 3DETC 4WW2F 1I8KB 3FFCB 1NCUA 1HHJB 4BZ1H 3VGAC 5T1KD 4IS6B 2EDBA 3O11A 2OTWA 1P69B 1W72L 3N06B 1JPSL 4TVSa 4YHMH 4GMTL 2XZZA 2BVOB 1JYVA 5FGRA 3QJHA 5B4MD 1IGIH 4WW1A 1XF5B 3QUMH 3U36A 4YDIH 1Z0NA 4FXKA 2VE6A 2XYCA 3ULVD 1AY1H 2E7CA 4BZ1L 5T1LD 4LSUL 2VKWA 2VLRD 2VAJA 3C08H 3X3FH 1BX2A 4YHML 1NEZG 1I1RA 1WBYB 3A6BL 3MXVH 2GHWB 3CVIH 1IKFL 1IGIL 3MA9H 4U6TA 5JO5B 4ZFOL 1QFWI 1AY1L 2QLVB 1BZ9B 4HGWA 1TCRB 5EFIB 2ITDB 3C9NB 3TA3C 1VENA 1FL3B 4ZQKA 2XWJB 5KSVB 2F19H 2BMKB 3BP6B 4MQXC 3FFCE 3MRGA 3MRPA 3MXVL 3X14A 4LBEB 5FFLA 5EBGA 4PGCB 3RWIA 2GJZA 4ETQA 4E5XB 1D7FA 5I1HH 1RZKH 1XF2A 1V3LA 4F37F 2A9MH 2DMBA 1CZ8H 2XG4A 3SDXA 3DHMA 3FAXA 5J1AB 1G7JB 4EI5A 1P9MC 3S97C 1R0AH 3PP4H 4R3SA 5IK3A 2JIXD 3L3JA 1BOGA 3QUYB 4RX4D 4W4OC 5E2JA 1HHGA 5HYSG 2X4TA 1K8IA 1HHIB 1HZHH 5DK2A 5KSAA 3TO4C 4KU1A 3LPGA 1W0WB 5ANME 3D39E 5KVMC 1RZKL 3MREB 4YHYC 3REWB 4ZPVA 2A9ML 1CZ8L 2P5WD 1CFBA 4IBLT 4XCEB 4EDXA 3ZDYE 2FO4B 3PP4L 1R0AL 4JRYA 5TPWH 1Y18B 5CCKH 2IADB 4BZ2L 4KVNH 3PG2A 4QRSB 3ZTNH 5HYEA 4Z7WF 1KLFA 1QBLH 4PJIB 3GBNH 1B0WA 3RWCA 1ZHNB 1QSFA 4NQXA 2YUZA 4R0LA 1WFOA 3O6FC 3BIBX 2ZSVA 2O5YH 3VXQB 4OFKA 4OD2B 2G5BA 3BJ91 4KDTA 4LLWA 5DRNA 5FYJU 4P4KB 5D2LB 2IBZX 3SKMA 4HK3J 3DSNA 4L8SC 4X4ZA 3ZTNL 4CMMB 2VXQL 4TUOB 3GBNL 4FXGA 4FZEH 1DUYB 2J8HA 3JTSA 4WI5A 3PWNB 1DQJA 1MJJB 1DUZB 2YMXH 1SY6H 5JOFA 2V2TA 3WXVH 2G2RB 4PB0H 1J0IA 5D5ME 4PB9L 4ZXBD 4BKLB 4GRMA 2FWOB 4P2QB 4TVPL 1U8LA 1S7RB 3OJDB 4Y4FD 2BOBB 4ACPA 5I1EH 4GKSA 1NGZB 4LASH 1DVFC 4X5LA 1VKXB 1SY6L 4LSDA 3AB0C 2XZCH 4PB0L 1YY8B 1M7DB 3HCVB 3SO3C 2HFTA 4LCCB 1XH3A 1LEKA 1PKQB 5C0CD 1FL5A 4OLWL 2OK0H 4OFYD 5GS1C 4MJ5B 4NN6C 5D2LE 5I1EL 1EHAA 2VQTA 2YS4A 3DX6A 1QR1B 4P57B 4LASL 4L3EA 1J5OH 1G9EA 1MFBL 3P73A 3B43A 4JO3H 3UYRH 1SJVA 1UWXK 1DANU 5IB3A 2XZCL 5IVNA 4QOKB 4UUJA 3L7EB 5I30H 2ZWLT 1HWHB 2HLAB 3RWEA 3AS3A 4ELMA 2YKLH 1F4YH 3AREC 4OLXL 12E8H 3B6SB 4X80H 3L1OH 4XBGA 1WFNA 5DHYB 2F8VA 5DD6B 4BQ9A 3QI9B 3BPCA 4K94C 1UM5H 3BVNA 4F15B 2EYRA 1NDMA 3T0BA 1J5OL 3UYRL 5AAWA 2IAMC 1I7RB 4PRBA 4R4ND 5EZLA 4XP6L 1HE7A 1QEWB 5DA0B 1KLUB 5EB9A 1W0VB 2GJ6D 5I30L 3V5KB 1JYNA 4EUPH 4H1LG 2XV6B 2A1WL 4KVCH 1CICD 4A2MA 3OKNA 2KZ1B 5FB8A 3QJFB 3QXDA 1F4YL 12E8L 1MJ8H 1NGPH 4I4WB 4I18A 1UM5L 1DL7H 2M8XA 4QYOB 1FNEB 1PKQE 2APVA 3MLPA 3ARED 2FJFB 2Q87A 5KSBB 1HQRA 1UKTA 4M6MH 4LHUD 1QOKA 5I16A 4N0FA 4L4TA 5ESVB 1H8NA 1FGVH 1JBJA 1HIML 3MBEA 1V8HA 2Z31C 4KHTL 1IC7L 4Z76A 1MJ8L 1NGPL 4Z77B 4TSAH 2GFBA 4M7LH 4ZPTB 4ODWA 2VR9A 4M1CC 4Z0XB 4OZHB 4HWUA 3EIFA 4M00A 4LLMB 4TNVF 4M6ML 5KSUB 1I3UA 1UB6A 1F11B 4NFCA 2JELH 5EC2A 4MQSB 4MVBD 3U9PH 1AHWA 3V7AG 3V5HA 1IQDB 1OAQH 1JNJA 2UZYB 3BZFA 4CBPA 1X6LA 5FDWA 2QEJA 3NCEB 2UWEB 4OBSA 3IRZA 4U1SB 4TSAL 3K74B 3L3KA 4IIQC 2OP4H 2JF1A 2PW1B 3HG1D 2F9BT 1KG0A 4XHJC 4L8CB 1J88A 5JZ7C 3MV9D 2VN7A 1IAIH 2AJXH 3K4ZA 4M1CD 1LO0H 4PRIE 3U9PL 1NGXB 3LPWA 1S9XB 4OJFL 5EU6D 1OAKL 3V4UL 1UKQA 1RUKH 3FO2A 4RNRA 4P49A 4K3GA 3GSWB 2HT4D 2OP4L 4FFZH 2EDYA 1TJHH 4RCAA 3KG5A 1KPVB 3CDGA 4FFWD 3RWGA 2E3VA 3PP3H 3GSVB 4DKEH 4PG9B 1Z5LB 5JZ7D 5CFHA 1RUKL 5JR1H 3GUTA 4N90E 1JVKA 2AGJH 4OF5A 2DM7A 4X4YB 4JKPH 2R69L 1KT2B 4O58H 3VMPA 4OCLC 3EJYC 3VFSB 2NY6B 5LWYH 3D85B 4FFZL 4HWZA 5ACLA 3WUWG 4KJYB 5HHNB 4E41A 3EJZD 4N68A 2ZOLB 2X4RB 2D3VA 5EO9B 4DKEL 2UWEE 4M61A 3EDEA 5IIEB 3KYKH 1UXWB 2B1HL 4JPWH 1XGYH 5JR1L 2Y9RT 1PLGL 3TBVA 5INDA 4JKPL 4O58L 1T7YA 1MVUB 5CKAA 1BFVH 1HWGB 2H2PC 5LXGH 4M6NL 2VAAA 3SCMA 1U8JB 5MI0B 1IEHA 3WIIL 2WINB 2BCKB 1R24A 1FNSH 4QRPA 4JPWL 2BERA 4U7MA 2VZ1A 3QNXA 5I66B 1FO0A 3FOMA 5D1QB 1AQDA 3MRFA 5BS0D 2FBJH 4ZFZA 1LK2B 3E0GA 4HWEH 3GSQB 5LXGL 4P59H 3KYNA 1XEDA 5I76B 3MLSH 4LKXB 4OFVA 2CRYA 2H2PD 3O3AB 2NZIA 2APXA 1EEUA 1KPRA 2WWMD 4P2OB 5MP6H 4KI5D 1U2CA 2C4FT 4GXUN 4RIRB 2ZOKB 4KTYA 2COQA 1TZHA 4X7TB 1B0GA 5C0DA 4P59L 3IAQA 4XPFL 5LBSH 4HXAH 3W39A 3DJ9A 4OV5B 2J4WL 2YWYA 1T21B 3W11D 2LVEA 3MLSL 3D9AH 3MNVB 2DMKA 3IXAA 2VQ1B 2VXTH 1LE5A 5MERB 4P5KB 2KQNA 3DVGB 5GGRA 1N0XH 2EC9T 2C9AA 3DYOA 4JY6B 5EU7E 2MCPH 2HT3C 2DM2A 2C1PA 3QAZC 3S96B 4XVSH 1IGJB 3IFOB 1J0ZA 1P6FA 3EDJA 3KYOA 1CE6A 4P2YA 1A9BA 3FTGB 1BVZA 3KYMB 3KPPB 4FQLH 5IQ9A 1DBJH 3MRJB 4P2RE 4M4RA 2G60H 4XT1C 5DUPH 3ZKMC 2VXTL 5IEKA 4KK9D 1T1WA 4RQQA 3K81A 1HKFA 2E9IA 2AJZA 2DQEH 3L3IA 2MCPL 4H0HB 3V6ZA 4XVSL 3GNMH 3IFNL 4BUHA 3T2QA 3LQAH 4PG2C 3SE8H 2R0WH 4XVTL 2HT3D 4ZAKA 3UJJL 4PP2B 2K7PA 1ZLWK 3JWDH 2RIKA 4FQLL 2ADIA 2XFXA 3VXUB 3P9LA 4YBQD 2G60L 5DUPL 1N59B 3OAZH 4KZDL 2V5RA 2YA1A 4UDUA 1GC1H 1NFDA 2DQEL 4XAKD 4IOFC 3WXWH 1N8ZB 3AM8A 2I9LA 3QBTB 2P8LB 4WJ5A 3OX8A 5E6ID 3IETB 3HZVA 4LCYB 3T1FB 1F5WA 2C26A 4GBXA 1BQHB 5CSZA 4DN3H 3ZKXC 1BOYA 5IW1A 5FM4A 3T3ME 1CDYA 1E6OH 4K7PH 3T04D 2IBZY 5HJ3A 1LWRA 2UY7A 1KV3A 3WXWL 3CXDH 3QDGD 1LDPL 1WBXA 3AROA 4HQQL 3UPRB 3MV01 3QEQD 4H25B 2XQYG 4NHUA 3VI4F 5AEAA 4KWUA 3H7BA 3P40A 4Y2DA 4Y5YB 4DN3L 3QWOA 2H3NB 4OCRL 3KPNA 3MLZH 2V5TA 1WTGT 3WHXB 1QSED 1QVOA 1CFNB 3M45A 4K7PL 2QADB 1L0YA 4KQ4H 1PZ5A 1UM6H 4G6JH 3CXDL 1AD0A 4Z9KB 4AG4H 4OIIH 4ZODA 2OM5A 4N8VB 2D0FA 3ES6B 1I8MB 4HC1H 1X5ZA 1U95A 4XWOD 3WNKA 3UAJD 4FS0A 3QRFM 3DGGB 3MLZL 3W0WA 3E2HB 3IJSB 3WSQH 5HHOB 2E7BA 4HUNB 1ETZB 4FQXC 3RZCB 3DV6A 3TCLB 4QHLA 2GW5A 3BP4A 5IB5B 5A3ID 4WWKC 4G6JL 1ZS8B 4AG4L 1MCHA 1W72A 4GW4A 4KRPD 1JGEA 2D7OA 5DJ0A 3AUVA 1FFOB 3I75A 4PJBE 4HC1L 1A1NB 3EFFB 1T22B 4ONOA 3BESR 5DI8B 2I27N 3QWQB 4MHHG 3RL2B 5HYQB 4ZUUA 1YPZA 5T5NG 1BIIB 5I9QB 2YD6A 2UVEA 1I85A 3MRQB 4GSDH 1KC5H 1JTTA 5AD0A 1KJ2H 4LPYA 4MAYB 1I1CA 4ZFOA 5FGBA 1U58B 4KTDH 1KCKA 2Q8BH 4WEMB 3CFBA 1YEHH 1I4FB 5JOPD 1JHKH 2Q8AL 4EQ3A 5CS7A 2NX5B 5C0AA 3K2UH 3UZEA 5HHOE 1A4KB 3MXWH 1PQZB 5IF0B 4QGYA 2FH6A 4BSVB 4K3DL 3GI8H 1OLZA 3B9KB 3SDCC 4I2XB 4N5UA 1MI5B 3U7YL 4EJ1C 4GG6A 2Q8BL 1NBYB 3H8NA 5EN2B 3VXTB 1SEBA 1U3HA 2NW3A 3KPQA 2FBOJ 4TYUA 1TIUA 1PX3A 4HXBH 3VGAB 1XZ0A 1MF2L 4Z7OE 3MXWL 3LS4H 1CL7L 4ALAL 2CLVA 1A7PH 3GHBH 5C0IB 2AEQH 1KXQE 1DQTA 2X7LB 1IAIM 3KXFD 3LN5B 4E0RA 5FYKU 3CAFA 2JJTA 3DXAA 5JA9A 3ZE1F 1T04B 1UJ3C 4XNQA 2XXCB 1UWXH 1HI6B 3BQUA 3SDDA 1P7KA 1DE4A 1DTUA 3FL7A 5DRXA 1A7PL 1M05B 3GHBL 2ATPA 4J6RH 5CZXC 3FN0H 4W4NA 4G8FA 5DJYB 1E4XI 2NX5E 2IPUG 3LSOB 4G8GB 2L0DA 1B90A 1E4WH 4HIIA 2VDQH 4YDJA 1VADB 4R90L 1MI5E 3TA3B 3BHBA 4PYHA 4JZJC 3G08B 4NN7C 4J6RL 3GB7A 1T1ZB 3VWJA 2BHUA 4X6FB 5IB2B 3QO1B 1A7OH 5INCB 3T0XA 3TJHC 1NL0H 4HK3N 2BHYA 5CZXD 3MYJA 1ZVSB 5ESQA 1BF8A 1QFWH 2EXWD 2WANA 5K59F 4M7JH 3D2UB 1TVDA 1NMBH 4LQFH 4RISH 3DX7A 4F9PA 5LCVL 1K85A 3O9WC 5GXBB 2VLMD 1IGTB 2W91A 1A6TA 3RWFA 4HGMA 1KCSL 2YPLA 5E2TH 2Q7YB 1A7OL 4MA1C 1E27B 5FUCC 3TO4B 2XNAA 1CFSA 5I1DB 4M7JL 1YEEH 4IRJD 4LQFL 4EN3A 4YHYB 4RISL 4Y4KC 5E8OA 3ULVH 4PJCA 1TETL 2K3TA 4WUUD 2HFGL 4P3DB 3HZKA 1E28B 3L95B 2BSRA 4G8GE 1IAKB 1N5YH 1KIRA 5E2TL 4X4MA 5I73C 1Z6JT 1FG2B 3O9WD 3LAFA 4X6DA 5GJTL 3SKNB 5A2JH 5F9OH 1OTUC 4G5ZH 5GGQH 3TH3T 3QG6B 5I1JH 1I3RA 1MCPH 1YEEL 3IVKA 5HHXH 3ULVL 1KFAL 5CP7A 4CKVX 5JXEA 1S7SB 3QDJD 4POZD 4W70A 3O6FB 3VE0B 1BLNB 5I71C 3EOAB 4JFDB 1ROWA 4CGTA 4JHBA 4O00A 3N85L 1N5YL 1EEQA 4OLUH 1AKJB 3KPRA 3U46A 4U6VH 4D3CH 5DVKA 5KZCD 4HWNA 4L8SB 4QNPF 1S7QA 1TTFA 4MJIA 5F9OL 3AVEA 2Z0BA 4G5ZL 2WUCH 3DUUA 1MCDA 3G6JF 4X8XA 5GSRB 2ADFL 4YPGA 2PN5A 1ADQH 5HPMB 1S9WB 2H32A 3OSKA 3CX5J 5HHVL 1ZT7A 3JZ7A 3O4LB 2Y06L 3QZWA 3GSNB 4MCZA 2D31B 3EGSB 4IRSC 4CADA 4U6VL 3S88H 3CFKB 3MJ9L 2E7LA 4QY8A 4ODUA 1UG9A 4NHCH 1UYWH 3MRCA 3NACH 1G1YA 4X7CC 2GY7B 3ULUL 4G6KH 1DVFB 1PEZA 3DOSA 4JFXB 2QHRH 4OZGE 1NGYB 3AB0B 1FBIH 4PREA 4ZG1A 1FZOA 1OB1B 4DTGH 4I9WD 3SO3B 2BXZA 5ETUA 4HX1A 4NQSB 1G7HB 4JFDE 3LIZL 3TZVA 4JQIH 4R2GB 4NHCL 2ATKB 5GS1B 4NN6B 2XI9A 4NM8L 3KDMA 3NACL 5T5FH 4JHWL 5JW5A 2R0KL 4U1NB 4OGXH 4OKVB 1IM3B 1FBIL 1WT5A 2HJLB 3BMVA 5E0QA 4DTGL 3MOQA 1OW0A 3BUYA 4F3FB 2DQHL 3OB0K 3VFOB 5GSVB 1I1AD 3O4LE 1FC2D 3F7RA 4JQIL 4KJPC 3BRFA 4Q6YA 1F6LL 2NY3C 5BVJB 5BOZG 1B3JA 1X9QA 4YJZL 5E9DD 5EOQH 4JZNA 2RCSH 5T5FL 3ZT6A 2IAMB 4OGXL 3ILPA 4DGYL 3K0WA 3CUPA 1S8DB 1SQ2N 1P5UA 4X6CF 5IVZB 4P0DA 3I2CL 1Z9MA 3C5ZC 4MNGA 5J57B 3QIUB 4LLDB 1CXEA 2EKSA 5EOQL 5JNYA 3MQIA 2ICWJ 3HZMB 5DURB 1FCGA 3OGCA 3IS1X 5DO2D 3QHZH 4EBQH 2AEIT 4OGAC 5B22A 2X4PA 2VR4A 3U2SB 1FZJB 2LTQC 4OFDA 4WY7H 4PJGA 1EEZB 5L8KB 1HXYB 2GJ6E 5DJ8A 2Z31B 2E27H 4JZOB 3L9RA 5TQ0H 4X98B 1CXHA 1JYXA 2PR4H 4HK0B 4LIQE 2L7UA 4ENED 4GKNB 5DSCB 4HIEA 4XCNB 5ICXA 2BNUA 4O5LL 4F8TA 1MREH 1OGTA 4KGJA 1U3JA 2CDFA 1LNUB 4QRTA 5CHNA 2PO6C 5E03A 1RK1A 4HPOH 2EE3A 4LEOB 3CPLB 5E00B 5DHVH 4X9HA 2E27L 4KDWA 3HAEB 3C60D 1ZHLB 3TN0D 2AXGB 5FKPA 3FO1A 1TVBA 1LMKA 2PR4L 5DMKB 5JDSB 2DLHA 1OPGH 2EDRA 2I60H 3H0TA 4HIHA 4NO0A 1MREL 3WS6A 4LSSH 4KPHH 1JGDA 3FZUC 4NQDD 4GQ9H 1B6UA 5IBLC 2WWKT 4F7EB 4G80A 2XOTA 3Q6GH 1H8SA 1WAAE 4CMHC 4PFEA 3CVHB 1N3NA 4DCQB 5F7MC 3LQZA 1M71B 4P9HC 1X5IA 3HUJB 1AGBA 3X3GL 4PJ8A 5EIIB 4LIQH 4WTWA 2XTJC 3ARDA 1TQBC 4LSQL 5C08B 2Y07L 3MV9E 4R96A 2HG5B 1G9NC 2Z93B 1NMCC 3VJ6A 1M1SA 1ZSDB 2BVYA 2ZUXA 5IBLD 5GGRY 4HF5H 1KB5L 1L4IA 3F7PC 5KOVC 5F93C 4J8RB 1A4JB 2C3WA 3RVUC 4PJFA 3QPXH 3CDYA 1UH3A 3WIHA 5EUOB 1F13A 5BZWB 4NSKB 5CZKA 4PRHB 1FYTB 4UU9B 2XTJD 2VLKB 4M93C 1NLBH 3MC0A 5I8EB 4R4BA 4DZBB 5IKCA 1B2WH 5FA4A 3V0VA 4HF5L 5IROA 2D4FA 3NIDE 4C56D 3KWWA 4HKJA 4NKMA 2LVCA 2OJEA 3QUXB 1UZ8B 3QP3A 4PJ9B 3UJIH 3UYOD 1TMCB 4X5WB 3EZ8A 3I85A 1H5BC 4Q7DA 4MX7A 2DM3A 3VD7A 1YMMA 1EIBA 4QRRD 4HIJB 4X7EC 4O02H 3UJIL 1BJMA 4JJ5B 2DF3A 5ALCH 3MRDA 5D7IE 2EDHA 2APTA 3OKLA 1QFWM 3ARGA 4I0PA 1J11A 4WW2C 3P4NB 4JDVA 4K9EH 5I1IH 2BNQA 4FQ1H 4N9GB 5EUOE 2X4QA 5HDBF 1U8NB 2ADGB 4PRHE 4WO4A 4NQCA 4X8JB 1KN4H 3O3BA 3IDJA 1S9VB 1CD9B 4G8EB 5ALCL 2EDOA 4RDQF 1QA9A 3QAZB 1AO7D 3HFML 3MV7B 5FOBA 1YNKH 3MUHL 3RDTC 4K9EL 5I1IL 4V1DD 3DVNA 3RY5A 3LEXB 5MHSD 3C5SA 5D70L 3NIGE 3MUJA 2X1WL 4OD3H 3VWKA 4M3JA 1ZGLA 1DN0B 2R2EA 3RUGF 4MD0B 4MQ7B 25C8H 1U42A 4FXLA 5IJVA 1N4XH 3C6LA 3ET9F 1GAFH 4NT6B 2FATH 1KELH 1EFXA 4WNQB 2HN7B 4LCWB 4NYLA 3RDTD 4D9LL 3RPKA 2FX8L 2VLJA 5J13C 1BM3H 4B7LA 1DQLL 1A6WH 4MD4A 5DQ9A 4UTBL 2WBJC 1T2QH 4WFGD 3NPZB 5DVNA 1G7LB 4KFZC 1KELL 3HS0B 1YN6B 4ZDHB 1EMTL 1KNOA 4JQXC 2I9TB 1OD9A 2A9NH 3MV7E 3ZKXB 5E95B 5DEFA 3SY0B 5M95B 1A6WL 4AIZB 3HZYB 4RFNC 3D25B 4GXUM 5HHQB 4DEPC 4QRUB 5DFWH 3U4BH 2DKSA 3BZ4A 4RDQG 4OBRA 1F45A 4MD5B 2XIDA 1AIFB 2B4CC 1EBAA 2CDGA 5CP3H 3HB3D 2A9NL 5C70A 5TJWK 3P30H 5EOCJ 2Y5TA 4HKXA 5F1NB 4BELD 3O6LH 4FQQA 4NZTL 1XF1A 3LRSB 1J18A 3BZEA 3QDGE 3VFTA 4P2CG 3QEQE 4EZMA 1JGUH 1BZ7A 2ZCKL 1TZIA 3CZFB 4U1KA 1C8PA 3PWPA 4LSVL 2E8YA 1JF6A 2OBGA 5T3ZD 2GKIA 4FQXB 1U6AH 4JM2A 3ARVA 3MCKB 3P30L 2OQJB 5E7FA 4CN6A 3HLAB 4WWKB 1INDH 5D1ZD 3MRKB 2JB5L 5CLWA 3O6LL 4OLYH 3BKJL 3VXSD 5B38A 1JWMB 2VXUL 3DRQA 3BWUC 5ITFA 3DROB 1K5NB 3ESUF 4J4PD 2C1OA 1JGUL 3CK0L 3DWTA 3FFDA 2YD8A 3HE7C 3QUZC 4W81A 3EBAA 4W68A 4P23A 1ZGLP 1U6AL 1T5XA 4LRNL 4M9OA 5AZ2H 3MLXH 1AGCA 1N6QH 2W1NA 3VFRA 2HTLD 3TT3L 3RTQA 4ZO8A 4U6HA 1QRNB 3MLWH 4OB5H 3U6RB 4S1QH 4CNIB 4W6WB 4F7MA 1X5YA 5C71A 5IQ7H 5SWZB 3ZDYF 3JVGC 2OZ4L 2GAZA 3WIFA 3SGDI 4Y19A 5EZOH 1WWCA 1WZ1L 3HE7D 3PABA 4QTHB 3BH8B 1JZ6A 2MNUA 5T3XE 4OB5L 4BFGA 4KK5C 2F8OA 4JFZH 1XGUA 4GAFB 1NC4A 3UTSB 2J8UA 5ENWB 4DOHB 1QQDA 1MY7A 3TM6A 5KJRL 3SDCB 5DEGB 2NY7H 1R3LB 5EZOL 3I3BA 1JF1A 1LO5A 5EO1A 4WCYL 4XWGH 3BE1L 1I9RL 4M02A 3PL6C 1ACZA 5E4EB 1F4WH 4JFZL 5HYJA 2FX7H 4YXLL 1B4JL 2X9YA 1JMZA 4ZOEA 3MOBL 1NCAL 3WFDH 5IM7B 4KK5D 1KCUH 3MRNA 3QEHB 2A74A 5IFJA 2NY7L 5D5MF 3UMTA 3SGEI 5KS9A 4A6YB 4M1GL 2JJSC 4U05A 1KJVB 2XA3A 1UJ3B 3CCHA 2P5EB 2BDNH 3KVQA 3GMOA 1F4WL 4BK5A 4G9DB 2FX7L 3HE6A 1CWVA 2HLFC 4XMLH 4PJAB 3QXTA 1YJDH 3OB0H 3WFDL 1Q9KA 3V4PH 2YN3A 1IAMA 1KCUL 4I3GA 4O4YH 4PJEE 4DJMA 5CAYB 5F1OB 2CKBA 3EYOB 3KLDA 1X7QA 2QQKL 3KXFE 4NO3B 2FJHA 3UTSE 5ICZA 3NA4A 4DOHE 1ZHBB 1D5BB 4TQEL 2BDNL 3L3HA 2ESVB 1RHHB 5GIRB 2XN9D 3ZDZE 4JZJB 1LO3L 4NN7B 4O4YL 2KQMA 1BEYH 1BQSA 5C07D 2EYSA 1C5DB 1E4XH 3IU3B 2Y23A 2J6EH 1MWAA 3TBSB 3MFFA 1HHHB 5ESAA 2CMRH 4R8WH 4I48B 1CLZH 4MAUH 4CU8A 4JRXD 5LJYH 1KLGB 3MJ9A 3RVXC 5TE7H 2V7HA 1BEYL 4MA1B 1H3XA 1DQMH 4HLJA 1BBJA 3GSUB 4C54A 5FO7B 2D7TH 4PJAE 4R8WL 1EGJH 5IESL 1CLZL 4HWBH 4MAUL 3QZWG 5EBLA 5L2JA 4Y4KB 3VW3L 3BRDA 3GI9H 4HLZG 4P5TC 4JFEA 5A16A 5TE7L 3TVMD 2VLME 5I73B 2DQGL 3RY6A 4Y16C 2CO7B 2ESVE 2VZVA 1FE8H 3QCVL 2D7TL 1ONQA 4HULB 1I7ZB 2EDNA 2OI9C 5FCUH 3O3EB 4PJXE 5HVFB 4Y4HC 4M1DL 5I71B 3NH7H 2EO1A 3U79A 1KPUB 1PJ9A 1G7QB 1CLCA 1T5WB 2E5EA 3KPMA 4K3EH 3GMQB 4OQTH 5DJDA 3EO0A 1I8IB 3MRMA 3RBGA 1C16A 4U33A 3TIEB 3B9AA 4NP4H 1WLHA 3GIVB 2IAND 3WFEH 2NLJB 3H3PH 4JKWA 5IBUG 2HWZL 5DRZB 2DL2A 4KK6C 5BW7C 5EC1A 5FUCE 2BX5A 3QDJE 2IQAA 4K3EL 2GCYB 2HFEA 3IDIB 4IRSB 4FG6C 1XGRB 4Y4HD 3ARBA 4OCYL 3WJLA 4NP4L 2P8MA 3WE6A 1HKLL 1YEDB 3WFEL 2Y4SA 3INUL 5EZJA 3MJ6A 3T0EC 1NJ9B 2FIKA 1S7XB 3FCTB 3AS0A 1RUQH 1S5IH 1OAXL 3D0LA 4PTTA 4MNQA 2ARJA 4DUWA 3FN9A 5D2NC 1ITCA 5DT1H 3VXMA 5D72H 1NMAL 2PYEA 5F7DB 3OXRA 1MFAH 4YXHH 3EOBA 3O45B 2Y6SC 2NYYD 1BHGA 1RUQL 4I3SH 2FECI 1UACH 4MS8C 1YUHA 3D0VB 3ILQD 1F3RB 3SGJA 1ORQA 3AXLA 5DT1L 2CJUH 1P7QA 1IAOB 2UWEF 1MFAL 4OM0H 5J3HD 3OJ2C 8FABA 2ADJA 4I9WE 4G6FD 5JW4N 4QHKJ 2NY3B 7CGTA 5DJCA 2M26A 5EOTB 3OHXA 3HRZB 4I3SL 4OCSL 1FNGB 4Q9BA 5IMOA 4MA3A 1I1FB 4L3CB 4N0CC 3DMMA 2EH7H 2CJUL 2JJVA 4LPVA 3KJ4C 3S37H 3LKPA 4LSPH 3LKSA 5IWLA 2AK4B 1JPGA 3TNNB 4U1GC 1OTTC 3DTXA 3C5ZB 3NA9H 4IDLA 5E8NA 2Q6WB 1CLYH 4L4VD 1IGFH 4ZS7H 3NFPA 6FABH 2YC1A 3QDMB 4Z7VA 3MLTB 1N5AB 2YD3A 3SGKA 4Z7QE 4YHPB 3GMPA 3NN8B 5HD8C 3E6HA 3H9SD 4XAWL 4XNYH 2EH7L 2LTQB 1MCOL 5HGDA 3S37L 4LSPL 3RVTC 3MV8D 2DDQH 1KB5A 3RGVA 4JHZA 2DYPB 3U48A 2BC4A 5JORA 1GHFL 2MPAH 1MAML 3QQ9D 6FABL 1CIDA 3RL1A 1G7MB 4MJ6B 5E1AA 1VFAB 4GXVL 1MHCB 2VDNH 3MROA 2H8PA 4MDIB 2EDKA 1RZ8A 4XNYL 4LHUA 3IDGB 2GTZB 3OAYK 5DQJB 2V7NA 2PO6B 5FYJD 3P4OA 5ADPH 2PCPA 2JJWA 4H8WC 5E94B 4E42B 4AMKL 2MPAL 1T0MA 5IBTH 2HJKB 5L9DL 3BKCH 4AH2A 1G6RB 5TF1H 3RVTD 4ONHB 3JV4A 1GPOL 1F90H 1U8IB 1B88A 4UV4H 5TQ2L 3U82B 1TCMA 5I8KH 1TVHB 4L29B 2VQUA 4PJDA 5K9QG 3SE9H 2R8SH 1BD2A 3QDME 3ZKNC 5ADPL 3AY4C 1UGNA 4LPTA 4CMHB 1Q0YL 1C5BH 4HJ0D 5IBTL 3BKCL 3CSYA 3IYLW 3VH8A 1F90L 3VFGL 1Q9WB 4UV4L 4GRLA 2V5MA 5SWSB 4WGWB 2WIMA 3W5NA 3SE9L 2R8SL 1EHXA 1IT9H 4U6XB 4WU5B 4HUUB 1FAIL 1RIHH 4HUVA 1LDSA 4HJGA 3D6GA 5CD5D 4WFED 5E7BA 3V7MA 2RBLA 4G43B 3G5YB 5FV2A 1FH5H 4CDHA 1P1ZB 1BVLB 5EORH 5L2KA 2MQ0A 3D18A 1CD8A 3P0VH 4MHHI 3T3MF 1RMFH 2VITA 2F54B 1J8HA 3FQXB 1D3CA 4M93B 4LNRB 3BDBA 1RIHL 1HXMB 1KTLA 3HNTL 5M94B 5KSAC 1G7PB 1DBKH 5JHDB 4GH7B 3MACH 2P8PB 2UYLB 3NCBB 1P4BH 5MEQA 1LGVA 4L8DA 4F7TA 4M5ZH 3HI1A 3MNZA 3JV0A 3OKOB 1QR4A 3J7HA 3S5LG 1RMFL 4NUJA 4UQ2B 1P7HL 2XTJE 1T89C 4EI5D 3MGOB 2ZUYA 1DBKL 1OSZA 3VA2C 3VGDA 2HKFH 1QD0A 4C56E 1BFOB 2YPKB 1P4BL 5EO0A 5KSAD 1VFOA 4HHAB 4R0LC 1A3RL 4PD4J 3OKMB 3U0TB 1OOAA 2WK2A 1QYGH 2EE9A 4KDTC 1I9EA 5AZEH 4RGMB 2DWEA 5BRZB 4WW2B 3T2NH 1NH6A 2LQRA 4JRYD 5C9KA 5CJOH 4PJBF 3FB5A 4P46C 5HYSB 4F9LA 3UP1A 2HKFL 1T20A 5BV7H 1BJ1H 4QRRE 4XRCB 3TYFA 3R0NA 2PXYD 2BOCB 2M1KA 5ACZB 4OZ4A 1LEIA 3SQOH 5CEYA 2ERJC 5JHDE 4LKCA 2BHZA 1QYGL 1QSFD 4P9HH 5IVXA 4N9OB 5T1DH 1VCAA 5B3NA 1UEYA 4I0KA 3T2NL 5JW4R 3VG9C 3UO1H 4M7ZC 4ZD3H 5DJZA 2EC8A 2V2WA 4XI5C 1YEIH 2NTSP 5BV7L 1VGKA 3ARZA 3TYGH 1YEJL 4XP9L 3CIQA 3TCXA 1ZT4A 3DARA 4P3CH 2C3GA 1I7TA 1NDGA 1SVZA 5D6DA 1JUFA 4X9GA 4L8BB 3ZYZA 5T1DL 5BOPA 1Q72H 1GZPA 4PUBH 5ITBL 2AXHA 3UO1L 3JBG7 5KN5A 5TGBA 3EHBC 2BVTA 3UDWC 1YEIL 4JR9L 4RGOH 1RFDL 3TYGL 5MHSE 1F2QA 4NNYB 5J13B 4Y5VA 3LCYA 2X4NB 3ZE2E 3QNYB 1JJUA 4YIQA 2WBJB 2DLTA 4Y5XA 1GGBH 3KPTA 4JEGB 1Q72L 4PRPA 5J11C 4YGVA 3OQ3B 4PUBL 2R15A 2Z91A 3UTPD 5TE6H 5C09A 3P9MA 3WDIA 2V17H 3QIWC 5IHZA 1FL6A 1PEWA 1R3JA 1SHMA 2FEDC 3DI3B 4U6YB 4B5EA 2SEBB 4MWFB 1RY7B 3EUUA 3OL2A 1FC1A 5F3HA 3FB6A 4LCUB 5CEZE 3KHQA 3FQRB 5B38G 4RFNB 3TNMB 4HFWA 5EWIH 2D0GA 4PTUA 4L3ED 5DD1H 2OZ4A 3GMNB 1OT2A 5D7SH 3BMWA 3QIBB 3F12A 1VACA 3VXNA 4LPUA 3JUZA 2IALA 2JB6B 1PSKH 3BXNB 3V6BR 1OF2B 2WWKO 5K9KA 4BM7A 1NFIA 4H88H 3VFVB 2LE9A 5EWIL 4YPJA 4Z7WB 3ULVF 5DD1L 4JY4A 5D7SL 2D0HA 3GMMB 5AYUL 2OL3B 3JV6B 2BVPA 5EUKB 4QHMB 3WJJC 1PSKL 4PBXA 1R5VB 1I8KA 4KUCD 1N7MH 3FFCA 1HHJA 4FQ2H 1GVIA 1PZUB 3BT2H 4H88L 4IS6A 1BGXL 5MENB 2EDWA 3GM8A 3G5XB 2BVOA 4DN4L 3KPSB 1HHKB 3FT4B 1XF5A 4L4TD 4K8RL 3QUZB 5JA8B 4H1LB 2X41A 1T2XA 1TFHA 4XMKL 3MBED 4RFOL 1N7ML 3LD8B 2VSCA 4FQ2L 5T3ZE 3BT2L 3BDYH 3IU4H 1DN2A 4TOYL 2DQJL 2YR3A 5FA3B 1WBYA 3QG7H 3VXSE 4LDEB 2XICA 2R2BB 3BIKB 5JO5A 5GGTL 2HFFB 5EU4B 5KVEL 4Z7WE 1BZ9A 3M07A 3NVQA 1TCRA 4PY8J 1A8JH 4YFDB 5EFIA 3F62A 4C83B 2ITDA 1XCQB 3C9NA 4LSTL 3IU4L 1JPFB 5DTFB 1FL3A 3NPSC 2XWJA 5KSVA 4PY7B 2FGWH 1GH7A 2B8OT 2BMKA 3MLVH 1AI1L 3BP6A 4JO2H 1L0QA 3LV3B 4LBEA 4PGCA 2ZG2A 3TBTB 4E5XA 4NFDA 5IMMB 4UB0H 5T3ZH 3KPSE 4H26B 5F9JB 3K3QA 3PL6B 5J1AA 2FGWL 3FQTB 5SWQB 1G7JA 1A3QA 4NQTA 3MJ7B 1T66D 1K2DA 3K8LA 4WTZA 2VDML 4GLRI 2XA8L 3CFDB 1G9MH 1HHIA 3OWEA 2N1KA 4M7KH 1W0WA 1N26A 5ABDE 4U0RC 1J1PH 3MREA 4HKBB 5DC4B 4UB0L 1PX4A 3REWA 4XCEA 3LOWA 3HRPA 4RMRA 2R0ZL 2G9HB 2FO4A 1LP9F 3GO1H 2NW2B 1Y18A 4XB8A 5I19H 5ALBH 2IADA 5HI4D 4E41D 2NQCA 2G75B 3PWUB 4OZGF 5B21A 3CD4A 4QRSA 3WDJA 4M7KL 4PJIA 3VA6A 3OAUH 3WLWD 1ZHNA 4PLKC 4HUWB 4IDJH 4XNXH 4Q9CA 4LLYB 3V7AE 2EIZB 1LQSR 3VFPB 3VXQA 2NY4C 3WUWB 2F5BL 4PGJA 1BF2A 1CK0H 3SCMD 1OD7A 4HZLB 4P4KA 5D2LA 4ZNEE 1UM4H 3MGTB 1QRKA 1HYSD 1E4JA 3WFBL 4CMMA 5C0JB 3HC4H 4QRPD 4QKXB 1EO8H 4TUOA 3LPFA 4DKFL 4JVPA 2BXYA 4XCCH 3HNSH 1DUYA 4LMQI 3GMLB 4IDJL 1H0DB 1IM9B 1MRFH 5IHLB 3PWNA 3ARWA 1DUZA 4LSRH 4F7CB 2EEAA 1DFBH 2G2RA 1UM4L 1AGDB 1XIWC 2XN9E 4J3OC 4ZO9A 2F53B 4BKLA 3HC4L 4PJHE 2YEZB 2FWOA 4JB9H 4P2QA 3WNLA 3T8XB 4HMDA 5HDOA 1S7RA 3OJDA 3RKDD 2BOBA 5C07E 4HPYH 1AE6L 3V95A 4M4PA 1CGWA 1T7VA 1NGZA 1MRFL 5C0FB 1VKXA 3VMOA 4LSRL 1ZAGA 3WV0A 2FX9H 1DFBL 3GHEH 4JRXE 1YY8A 1M7DA 3OAYH 4P5TB 1UXSB 1K3ZA 3HCVA 5BMFL 2GY5A 3OPZH 4LCCA 1NAMB 5ICYB 1PKQA 4C57C 3Q0HA 4JB9L 4P9MH 4Y16B 1T03L 4HCRH 2GEEA 4H0GA 4HPYL 4MJ5A 2YD1A 2OI9B 3LKQA 5DUMH 4P57A 1QR1A 4HUXB 5ACMA 5JIHA 2BRRH 3EAKA 2X4OB 2JCCE 1A1MB 3Q48A 3GHEL 4YAQB 4QOKA 3L7EA 4X83A 4LOUC 2HLAA 4OF3A 3RQ3A 3LRHA 3B6SA 1SYSB 3QYCA 5DHYA 2GSIB 3JSSA 2IFFH 3QI9A 1O7SA 1UCBL 5DUML 1GOFA 4ZAKD 5TDNB 2F53E 3CLEH 1I7RA 2BRRL 4YDVB 3VRLE 2DRUA 1FFPB 1QEWA 1KLUA 1W0VA 3GSNL 4HDIB 4Y1AB 1YZZA 5I1KH 3N9GH 3V5KA 1NGQH 1RJYB 1T0PB 4NQEB 3WNMA 3QJFA 3L6FB 1I7UB 5JMOC 4I4WA 2O5XH 2VABB 4AEIH 4BQCA 1U3YA 3T0EB 1WAAF 5FYKD 2FH8A 1VEOA 4GBXD 4LQ1A 4QYOA 1FNEA 2FJFA 5GJSH 4RZCB 4PP1D 4JFFB 3SDAC 5KSBA 2ZZUT 1VB9A 1M7IB 3AFLA 2MSPA 5D2NB 4LARH 3ABZA 3RI5K 4M03A 4D9QE 2D7MA 5D7LB 1J9CT 4FQPA 3G5VB 4EI6B 5KBNC 4Z77A 2O5XL 3BWAB 4P5MB 3BUTA 4ZPTA 4G7VH 5GRZA 2NY2C 4Z0XA 1XF3B 4OZHA 2AEPL 4LRIC 3RWDB 4Y2DD 1PD6A 3S35L 5KSUA 4R7NB 5FIEA 1F11A 5I17B 1XGQB 3HNVH 4ZTOH 4LARL 1X5HA 4JVWA 1IQDA 3ZO0A 3IGAB 1CQYA 1JV5B 1U8OB 3ZHLA 5DWUL 4XZUB 4N8CL 5EOCH 1RIUH 4N0UB 1YEFL 5HI5D 2PW1A 4WHYG 1TTGA 1I1YB 4L8CA 4K94L 1R3HB 4LHUG 3W0WD 1A6UH 4PJ7E 3FQWB 2GK0B 3B9VA 4ZTOL 5E8EB 1NGXA 4DVBB 1S9XA 3VRIB 4X6EB 3T0EE 2NZ9D 2Q3ZA 2R2CA 1TJIH 1XF4B 2JJUA 2FRGP 3KJ4B 2QSVA 4JFFE 4F57H 2B1AL 5EOCL 1RIUL 4U1GB 5FGBC 1EAJA 3GSWA 1Q1JH 3VD3A 3N1PC 5D2NE 4KMLB 5FUOH 3UTQB 5E9DA 5IOPB 1KPVA 1BBDL 5D7LE 1IFHH 2H1PL 3GSVA 4NKOB 2F58H 1Z5LA 1C08B 1QUNA 1JZ3A 2VZUA 3FMGL 1BFTA 1TJIL 2PTVA 1BPVA 1D9KB 2VSDA 4JO1L 5D7IF 4OIBA 3ZYOA 4F57L 4X4YA 4NGHH 1KT2A 4TUKL 4PJ5B 1F97A 3VFSA 3V6OA 3D85A 1Q1JL 4OZFH 2C7UB 1Z9OA 3TESA 4OSUH 4KJYA 4TRPH 3UC0H 2AI0L 5HHNA 1U3HC 4L4VE 2R56L 2ZOLA 2X4RA 4X99B 1FFNB 3TH2T 2F58L 5IIEA 1UXWA 1K6QL 1RURH 3O8XC 5C0AD 1MVUA 3GM0A 4X0KB 4WV1C 1J0HA 1RZKC 3MV8E 4OSUL 4TRPL 3UC0L 3V0AC 1U8JA 4OZIE 1KTDB 4LGPB 4CJ0A 2WINA 2BCKA 5F7EL 2F5AH 1GGUA 3SDDC 4WIQA 2HH0L 2Y36H 5C0BB 1WEJL 1U3HD 1RURL 1B4RA 5D1QA 4JHAL 2Z8WC 3TT1H 1LK2A 4M6OL 2HVKB 3GSQA 4U1LB 5FYJE 5CGTA 3JWOH 1CFTB 4L1HA 2IMNA 3LKNB 5I76A 4LKXA 3O3AA 4G9FB 5B8CC 5HHMD 4XC3H 4P2OA 5F7FA 3DXAD 4RIRA 2ZOKA 1RJLB 2D7NA 2A73B 2EO9A 3BQUD 4FZ8H 3QPQD 4X7TA 3SDDD 3TT1L 2P24B 3ARXA 3QH3B 4B7IA 4LPCA 4OV5A 1T21A 3MNVA 3KYAA 3FB7A 3PGCA 3OBAA 1U2HA 2J5LC 2VQ1A 5MERA 4P5KA 3DVGA 4XC3L 5C0ND 5DUBB 4J1UB 4JN2B 4JY6A 3S96A 2YWZA 1QBAA 1IGJA 2NXYC 4R3SB 3IFOA 5DFVD 1LK3H 4GAJH 2MCG1 4P99A 2FR4B 1QHPA 5JXAH 3OGOE 3FTGA 5FYJH 3JTTB 3KYMA 3KPPA 3VWJD 1OSPH 3MRJA 4QF1B 4MMZC 4WFEE 2FLBT 1PG7L 4OCNC 4YHKH 4TULH 4HG4J 1IEBB 3K2MC 2E8ZA 2R39A 1LK3L 5I0DA 4GAJL 2VWEE 2J7LA 5JXAL 1T4KB 4PP2A 4ODVH 1QFHA 5GRJL 4FFYH 2YPLD 4Y2OA 3VXUA 2VDPH 3EOTH 3LN4B 1N59A 4TVPD 4R0LB 4TULL 4B0MM 4U2YA 1AC6A 1N8ZA 4EN3D 2P8LA 3ME0A 5C9JB 2G5BB 4HUMB 1U8PB 3IETA 3MX0A 4LCYA 3T1FA 3CC5B 1V7MH 4D2NA 3CGTA 4ODVL 3WYRA 1BQHA 1II4E 5FKAB 1FORH 4P46B 4ZTPL 4Q9RH 2PYFB 2VDPL 1MFDL 3EOTL 4YC2C 3V4VL 3F65A 3PQYB 1A7NL 3PDDA 1FSKC 1RU9H 2ERJB 5F1SA 2VOTA 4WI9A 1A7BA 5JXED 3UPRA 3PUCA 4H25A 1EUUA 3F7QA 4XP5L 1V7ML 3VG9B 4M7ZB 4Y5YA 3MUGB 4KKAD 1NCDL 2H3NA 4JN1H 4UOJA 4JRYE 3KPRD 4LPXA 2IG2L 3WHXA 1H9VA 1CFNA 3DRTB 4OCWH 5F9WC 5DD0H 3X17A 3H9HB 4MJID 2R0LL 5L0QC 1VHPA 1RU9L 1T7WA 1AO7A 4N8VA 1S7VB 3ES6A 1I8MA 2Z4QB 3GIZH 2CKNA 4ZUTB 1YN7B 1DSFL 4KZEH 3QRGL 1XAUA 3DGGA 2DB8A 4LGSB 2R29H 4PRAB 3IJSA 3V8CA 8CGTA 1ETZA 3U30C 3RZCA 3TCLA 1MSPA 3BKMH 2KL6A 1INQB 1ZS8A 1IE5A 1KBGL 1FFOA 1IZKA 5J11B 3A67H 5D96C 1A1NA 3EFFA 1T22A 1CVSC 3N1GC 3ORJA 1EXUB 3PQYE 3A6OA 5DI8A 2OXGA 3S3JA 1BQUA 3RL2A 5HYQA 4M48H 3QIWB 5D4QA 3FRUB 1BIIA 3ZL4H 3TPUB 5IHUL 3GMRB 3BKML 1MIMH 3MRQA 5E5MB 5ISZB 1HDMB 3S34H 4N5EC 3TZVD 3ZE1E 4S1DD 3MO1B 1AD9B 2XT1B 4DZ8B 1DEEB 1Z2KA 3A67L 5GZOC 1PDKA 3L3GA 3STLB 3TWCH 4QRQB 5BQ7B 5GGTA 3NIFE 1U58A 5F21B 2CIIB 3L7FB 4CVZB 2R1XB 4JFYB 4TTDD 1I4FA 2ID5A 4PJEF 4KJWC 2NX5A 1L0XA 3QFJB 4ZMAT 3DSFL 1A4KA 4J7RA 1PQZA 4LLVB 5IF0A 2FL5B 4BSVA 4MXWH 4N5ED 3HC0B 4G42B 3ALWA 2K9UA 3B9KA 1FN4B 4I2XA 2XACC 1MI5A 4KKLC 3ZDZF 4ZYKB 3WFCH 1DLFH 1EO7A 1NBYA 5KAQF 4RGND 5FV1L 3TPKA 5EN2A 3VXTA 4AENB 4NKQB 5K59E 2VH5H 2CPCA 2NY0D 3NZ8B 2QL1A 4WI7A 1G1CA 4KJWD 2FB4H 4MXWL 3G6JB 5ADOH 5C0IA 4KGLA 3QDHA 2XY2A 3L3DB 4DGIH 2X7LA 2R9HC 5D7JB 4MDJB 3ZZ1A 3NCYS 4OCXL 1DLFL 3LN5A 1X5GA 3ARFC 4CVWA 2BSSB 2AJUL 4AEHL 2VH5L 1T04A 3SO5A 1HI6A 4XB7A 2FB4L 3FT2B 3WS6C 4GW5B 1M05A 1SYVB 1I8LC 1C7TA 3QEGH 4DGIL 5EH1A 2HVJB 4NNXB 5DJYA 1Q9LB 1J0KA 3QFJE 3LSOA 5K9JL 4G8GA 2R9HD 4JDTH 4L4TE 1MCWW 1VADA 1R6VA 3IKCB 4MA7L 1QP1A 4S2SB 3TA3A 4CAGA 3NPSB 1ZEAH 4BH7B 4J3VA 3G08A 3KR3H 4URTB 5TDPB 3QEGL 3IDNB 4PJXF 1T1ZA 5F3BA 4X6FA 5IB2A 4L3AA 3QO1A 4NO0D 4QNPE 2XPGB 5INCA 5F88B 5CJQL 3BD5A 4JKMA 1ZVSA 1JZ8A 1OVZA 3O2DL 3D2UA 3O3UN 4BSWB 1JTPA 1MAKA 1WWWX 1P9MA 1L7IH 1CT8B 1IGTA 4PJ8D 5HI3D 3DHJA 4W4OA 3TEUA 3ARDD 2Q7YA 1E27A 2VRAA 1SMAA 1Q9OB 1UA6H 3TO4A 1QFUH 2OTUB 4ZUWB 5I1DA 4NZRH 5J6HB 1JNHA 5D1XC 1MIEL 2HKHL 4X6CB 4A6YL 5D7KD 5FHBH 1WF5A 4P3DA 3MRIB 3O2WH 1RV6X 1E28A 3L95A 4QGTA 2CGRL 3CXHJ 4DKAA 1VPOH 2ZJSH 1IAKA 3T0AA 3S3PA 1FG2A 3U0PB 3QNXB 4WU7B 4YH6A 3SKNA 7FABH 1X5KA 2DJSA 3GGWB 4JY5L 1CR9H 1QFUL 3JUYA 3LMJH 5DS8B 1OHQA 3R06B 3QG6A 1AR1C 4NZRL 5T33H 4JGUA 1S7SA 5FHBL 3O6FA 5ERWB 4LMQE 1BLNA 5DEZA 3VE0A 2X1PA 3EOAA 4JFDA 2NY4B 3IAPA 3QHFH 4PGEB 1AKJA 3PJSB 4F80A 4K3HA 4JPVL 4KTEL 4OLVL 4L8SA 1A6ZB 2UUDK 7FABL 4F7PB 3JWDC 3IT8D 3LMJL 5GSRA 2BSTB 4WO4C 3W39B 5HPMA 1S9WA 2GT9B 4NCDA 2F15A 4QXGL 1YMMD 1T80A 3OV6A 1YEGH 3O4LA 5F7WC 3GSNA 4KAQH 2XWTB 2D31A 3J8F7 1GGIH 3FRPA 3EGSA 2EEDA 4RMQA 1YNLL 3CFKA 4O9HH 1XIWB 1CD0A 4XP1H 2N7BA 3OKEB 1OAUH 2EDQA 2JKXA 2A6KB 2H6PB 2IWGA 3ARGD 4I0PD 5BZDB 1TJGH 4NNPH 2Q7NA 2BNQD 4WDIB 1YEGL 3U1SL 4WO4D 4KAQL 1NSNL 1D6VH 1R5WB 4NQCD 1KCVL 4JFXA 1NGYA 5EPMB 1P53A 1I3GL 5E70A 3BW9B 2DQCH 3IDYC 1OB1A 5FYLL 3WL9B 3C6LC 4D8PB 5JLZB 4L9DA 3MZTA 4NQSA 4QXTB 1G7HA 4Z7QF 1CI5A 4XP1L 1NC2B 3IJYB 5KANG 3FQUB 1DCLA 1TJGL 2ATKA 5GS1A 4KKNA 3U0WH 4F2MB 3TFKC 2OR8A 4U1NA 4W6YB 3DBXB 3IDXH 4OKVA 5IVOA 4JO4L 1IM3A 2QQNL 4UAOC 2HJLA 3VWKD 4BH8B 2FNBA 1Q0XH 3BN9C 4F3FA 4LF3B 3TLRA 3V6FB 4JGMA 3RBSA 3V79C 3VFOA 3GJFB 3O41B 1QG3A 2BFVL 4S0SD 2HP4A 2UY6A 3GJEB 5BVJA 1ES0B 2C4FU 2X1XR 1A6VL 4RWHA 3D5OF 3U0WL 1EFXD 2YD7A 4QTIH 1FO0H 2IAMA 4OKDA 3WUZA 1S8DA 2VLJD 4JPIB 1PG7W 4NRYB 1B0RB 1Q0XL 2L4OA 3TFKD 5IVZA 5E5UB 4DUVA 2AV7A 1VFUA 2DTML 4WHTB 4X6BB 3F58H 15C8L 3QIUA 4LLDA 4HZAA 1P84J 3SDYH 5B3JE 3OXSB 3HZMA 4QTIL 1FO0L 3LB6C 3SDAB 1F4AA 2IQ9H 5A2LH 1EO5A 2WW8A 3U2SA 1FZJA 4OQ1A 1QSVA 1CS6A 1EEZA 1HXYA 2Z31A 4LLAA 1FZKB 4HFUH 2VERN 2BRQA 4X98A 2NY2B 4JM2C 4HK0A 3U7WL 5DSCA 3LHPH 4GKNA 5E2VH 4XBPB 4XCNA 4M5YL 5FYKE 1EBPA 1JNNH 1WFUA 5JQ6L 3S4SB 1LNUA 3LB6D 4LEOA 2IGFH 3CPLA 5E00A 5J6GB 1NCWH 3KPLB 4OTXH 2A77H 5ILTH 5GGVY 3BEVB 3HAEA 4M8VA 4K2UL 1ZHLA 1JFQL 2VB5A 5JDSA 5DMKA 4TPRH 3LHPL 2ZNXA 5E2VL 4FABH 1YA5A 1RUMH 2CR6A 3PWPD 3MBXH 4D0BB 5CMAB 1DBML 5BJTB 4JM2D 4KDVA 1JN6B 3NABL 4F7EA 5HHPB 2IGFL 3RX8A 3C2SA 3KJ6H 5GPRA 4OTXL 3RUGB 3CVHA 3QUMB 4DCQA 4TUJB 1M71A 4TSBH 2X9WA 2XKNB 3MYZA 1YNTB 3HUJA 4TPRL 1GZQB 4FABL 4DKDC 5EIIA 3PXJA 4HG4K 2ICES 2YA0A 2VDLH 4G8IB 5FYKH 3MBXL 5JDJA 3L5WB 4P23D 1FDLL 4NPYB 5C08A 1NCNA 4UT7L 3PF2A 4AT6B 1CIUA 2HG5A 3UTTB 2Z93A 2ZKHL 3QNZB 1DR9A 3ZT5A 2DWDB 1PFCA 3RTQD 4I1NB 1ZSDA 3EYUL 4XCYB 4J8RA 1ZKAA 2CRMA 1A4JA 1OP9A 2Z92B 1QTYT 5EUOA 4YHOH 5BZWA 4NSKA 2APFA 4Y19D 2VMFA 4PRHA 4MLSA 1FYTA 4UU9A 1V3KA 1EUTA 1YY9D 1YPZE 2VLKA 2HT2C 4WI6A 3R0MA 4LCIH 4PLJC 5I8EA 2O61B 3BP7B 3O8XB 5FGSA 1GGYA 4DZBA 1NQBA 4NOFA 1TENA 1CL7I 1BQLL 1NC4D 3HPLB 1DBBL 2VO5A 4WV1B 3QUXA 1UZ8A 1G6RL 3RWJB 1XFPA 3VD5A 4PJ9A 3S35X 3KS0J 4X5WA 1X4XA 4R26L 2DI8A 4LCIL 4BFEA 2PTUA 5DZNA 4YR6B 4K23L 5HYJD 4ZS6D 5FCSH 5B4MC 4S11A 5C0AE 4HIJA 3RNKB 1W72H 5GRVK 3ULVC 2WV3A 4GMTH 5DRWB 2W07A 1WTLA 1GRWA 4JJ5A 4NC2B 1DLHB 3NMEA 5B8CB 2DQIL 1N6UA 4GG6E 5GHWH 3ZE2F 2XXMB 3P4NA 3MMEB 4LSUH 4N9GA 3HE6D 2YD4A 1U91B 4F8QA 3W9DB 1U8NA 1BIHA 1CFQB 2ADGA 4X8JA 4ISVB 2BVQB 4NRXB 2P47B 4YE4L 4NZUH 3A6BH 3FONB 2J5LB 1S9VA 1IKFH 1UENA 4G8EA 3S7GA 2AEWA 1QLFB 1FJ1B 4WRLA 3IDMB 4YEFA 5HHME 5GHWL 5A43C 3MV7A 2VDOH 2NXYB 5DMGD 2V5YA 1BQHG 3DXAE 3OAZK 5TH2B 5E99L 3LEXA 5ANMB 1RZIB 3D39B 2H2SD 4EXPX 4NZUL 3HMXL 3ROLB 1DN0A 3X11B 4MD0A 5E8OB 2WIIB 4MQ7A 2YD5A 3T4YB 1S9YB 2VDOL 2C4XA 4NT6A 1YQ2A 4PG2A 5A2FA 2OSLB 1D5MB 4H20H 4JQVC 3RY6C 4WNQA 3W2DH 2HN7A 4LCWA 1WZLA 3RHWK 1A7QL 5HGBB 3DURB 3X13B 4QO1A 4LFHD 1H3GA 2DI9A 4JANB 4UNVA 2A6DB 1XCTB 4GO6B 2DMCA 3ULUD 1WC7B 1G7LA 3HS0A 4H20L 2DICA 2HJFB 1EVUA 1S7QB 3W2DL 5M7QA 3NFSL 1YN6A 2AXJA 4JFED 4JFOB 4ZDHA 2I9TA 4Z5RB 4BZ2H 4YC2B 3SY0A 3EKCA 2YPLE 3QCTL 1MEXH 4AIZA 2EDEA 1FSKB 3HZYA 4APQB 3D25A 5HHQA 1ZLSH 4QRUA 5D5MB 1RZFH 5GZND 1T6VN 1ZVHA 4PGBB 3NCCB 4XHQA 3ARBC 4PV8B 4MD5A 4PJCE 5EULV 2YBRA 4KROB 1MLCA 2DIBA 1UVQB 4QXWA 5F9WB 2WZPD 3TV3H 4X4ME 1MEXL 1CGVA 2PXYA 4X6DE 2VXQH 1ZLSL 5F1NA 1RZFL 3LRSA 2IF7A 4EUPB 3MUZ1 3D87B 2LU4A 4ZXBC 3CZFA 4MB3A 2VZ3A 4NRZB 1BAFL 3BPOC 3ARBD 4FQXA 3U30B 4K7FB 4PB9H 3MCKA 4Y4FC 4WI3A 3TV3L 3BD3A 1PG7X 2OQJA 4NKIH 1KGCD 3HLAA 5FO9B 4WWKA 3MRKA 5IBUB 5E8DH 4MJIE 3MRLA 4TVPH 2VUOA 1QZ1A 1JWMA 4C55A 3SGJC 2AQ2A 4LGRB 3R8QA 3DROA 1K5NA 5D96B 5L88H 4MNQD 4HMCA 1EFQA 5C8JA 3VXMD 2PYED 4NKIL 2DQDL 1MHPL 2ENSA 1U3ZA 4QXUL 4HH9B 5E8DL 4OLWH 3AS1A 1UKSA 1QRNA 4YDLC 2IFGA 3U6RA 3IRPX 4CNIA 4RMVA 1MAJA 2OMBA 4LAJH 4WFFD 3P0GB 5L88L 2UUDH 2XKSA 5SWZA 1MFBH 2V9TA 5F7HA 5CGYD 1ZOXA 4MMXC 5C2UB 3WS3B 1P7QD 3EZJB 2VIRB 3MCLL 3BH8A 2WSKA 3CH8A 4X7SL 3CXHK 1CGSL 4MB5A 4MB4A 2FHCA 1U8MB 4R4NC 3SGKC 4OLXH 1Y0LB 4Q58C 3UTSA 1RJCA 3G5ZB 5ENWA 2H32H 2ZUSA 2YXMA 3SDCA 4XP6H 2N56A 4JRWA 5AYQA 2AJYH 1CICC 5DJ2B 3DMMD 4GW1B 1NUNB 5DEGA 2X05A 1R3LA 2OL3L 2E9BA 2DBJA 3O2DA 4MSWB 5JW3H 3H3KA 3PHQB 2A1WH 4HLZH 4XXCC 4FTVB 4HIEB 4YDKL 5I8OH 5CGMA 4KKBC 4DW2L 1F6AB 5E8PB 4X5XB 3T2PA 2EKJA 4IJ3C 2F74B 3VFUB 5JIIA 5JQHC 5IW3A 3S36L 2AJYL 3QEHA 5GRYA 1YC7A 4PYGA 3G6DL 3ARFB 5JW3L 4A2LA 2QSQA 4A6YA 2F8XC 1HIMH 3FO1B 1KJVA 4KMTH 4PJHF 3RGVD 1UJ3A 4KHTH 2P5EA 4XVJL 5I8OL 1IC7H 4G9DA 4PRIB 1V7NH 4UBDD 3STBA 4MNGE 2GQHA 4PJAA 1O7VA 1RQ5A 4MVBC 1HK6A 3ROOB 4KKBD 3WO4B 3VGFA 2W60B 1WJ3A 1IGCL 3EYOA 4RMTA 4NO3A 4YEEA 4KMTL 5K33A 4WEBL 1D5BA 1OARH 4PJGE 3ARSA 4GRLC 2ESVA 1CCZA 1RHHA 1V7NL 4JZJA 1SBBA 1HSAB 2GK2A 2IPKB 4U7KA 3I6LE 2JCCF 4XH2B 5DR5H 5F8RC 1TQCC 4HSQA 4FTVE 3LKRB 1GXEA 3EJJX 4LLQA 1C5DA 3G6AB 2BNRB 3IU3A 3TBSA 1BD2D 4OJFH 1HHHA 1OAKH 2HT4C 3V4UH 4I48A 1OARL 3KAAA 4JAMB 4FFWC 3JXAA 2YUXA 1KLGA 1G7IB 2NXZD 1V05A 1RUAH 4GRLD 4HS8L 5IB1B 3VRLF 4K9EC 1NAKL 5DR5L 5GGUB 2VNCA 4R4BB 4OD1H 4G3YL 5FO7A 2NY1D 5D1XB 2B0SH 4Y4KA 2D4DA 1BREA 2R69H 4P4RB 3EJZC 3GK8H 1I9IL 2ZUWA 3BGFC 4IEFB 1RUAL 4QT5B 1T3FA 2FGZA 5L2KD 5IP4A 4MXQC 4ORGB 3B3IB 4OD1L 1OAZL 3QXWA 1J8HD 4J2XA 4AQ1B 2B1HH 4Z7UF 1I7ZA 1FZMB 2B0SL 1PLGH 3O3EA 3GK8L 5FGCB 2BNRE 1X6NA 4M6NH 5EU3B 3MRDB 4OI8A 1KPUA 1G7QA 4PBVC 1T5WA 3ZKSD 3GMQA 1I8IA 3AGVA 3WIIH 4PJFE 3TIEA 1ZTXH 2W92A 3WMSA 2HRLA 3GIVA 3CFJB 2NLJA 4MXQD 4ODHH 2I25N 2AQ3A 1LEGB 4TSCL 5DRZA 2XZQL 4YK4C 1NBVL 2D2OA 1XR9B 2GCYA 3W9EB 3IDIA 2WWMC 4IRSA 1XGRA 4KI5C 5AG8A 3S5LB 3UBXB 4PJ7F 1ZTXL 2FLRT 3T2OA 2LAGB 1OGAB 2QSTA 2UZXB 1YEDA 2E7HA 3RPIB 4P2RB 3NZHL 1NGWB 1NJ9A 4ODHL 3VXRB 3W11C 1S7XA 3FCTA 4FQHB 4XPHH 5TFSH 4U7SA 1RIVL 4XPFH 5E5RB 2J4WH 2WAHA 5C0EB 3IDYB 3C6LB 4AYFA 3UROR 3MRHB 5F7DA 2BP3A 1WZMA 5FGCE 3WIHH 3SE4C 2YXFA 4JG0L 3O45A 5I1LB 1SJXA 1F3JB 4XPHL 4Y5VC 5TFSL 5CBAB 2I07B 4KK9C 1FLTX 4PV9B 4LPWA 1IC5L 1KJMB 3D0VA 3C6SB 4S1RL 3F5WB 4U0QB 1KEML 1UB5B 1IAOA 3FHAA 4S1SH 1ZK9A 3WIHL 1JRHL 4C58B 3IFNH 1EHLH 4YHLL 1CG9B 2E6QA 3MZGB 5EOTA 5HXMA 4NO5B 3HRZA 2N4IA 4YBQC 5DGRA 3STZB 4MNHB 1FNGA 4XVTH 3BP5B 3R1GH 3UJJH 1GJIA 3L3OB 1OGAE 1IKNC 1I1FA 1ZLVH 2QBWA 4L3CA 4OZIF 3VXOB 3VXRE 1S5HB 1CE1L 4KZDH 4OZFG 5E6IC 4S1SL 2AK4A 2XZAH 3TNNA 4FA8A 4PRPD 5GRVL 5J1SC 1ZWIB 5J89A 1EHLL 4HGKC 2Q6WA 5IMLB 1OTSD 5SX4I 3DECA 4ZUVB 5JTWA 3QDMA 3NGBC 3MA7B 3G9VA 4FQIL 4GS7C 3R1GL 5C09D 1FNFA 4DAGH 3MLTA 1N5AA 1A14L 4YHPA 2X4UB 3NN8A 3D3VB 1KJ2B 3BFOA 4ZSOA 2VLJE 2NY5L 2XZAL 2DYPA 1MELA 1LDPH 4HQQH 5T5NF 3P4LA 1G7MA 3KPOB 3T4AB 4MJ6A 4DAGL 1ZANL 4JLRB 1VFAA 1MHCA 4MDIA 1FAKT 4OCRH 3GZKA 4PJBB 4UTAH 3IDGA 5K9OB 2GTZA 4BFIB 4JCLA 4J3SA 4IRZH 4Y89A 5DQJA 1H3VA 2PO6A 5E6ZA 1U8QB 4N0RA 4XWOC 5E94A 4E42A 1ZA6B 3UAJC 2VDRH 1K4CB 2CIKB 2HJKA 1OP3K 1RZ7H 1G6RA 1HEZB 1JK8B 1WFTA 4ONHA 3IDUA 1U8IA 2A6IB 4XXDB 3RKPA 2QKIB 3DUSB 4PLNC 5ID1B 3DI2B 5A3IC 4MXVF 5KG9B 1TVHA 4UTAL 2DD8H 4L29A 1MVFA 1U93B 3FFCD 2LV4A 4KRPC 4IRZL 1J86A 1A47A 3E6FB 5BXFB 1W2KT 5D71H 2VDRL 3TH4T 4BSJA 1RZ7L 3D3VE 4KMQA 1EK3A 4QWWC 3SKJH 4GRWE 3P4MB 1C5CL 4FFVD 1AFVL 5SWSA 4NFBA 2DD8L 5F9DC 3WNPA 5F6HJ 2E6PA 1YJDC 4U6XA 4U2ZA 4WU5A 2QR0B 3OMZA 1EVTC 3F6LA 3B2VH 4HUUA 4YX2H 2O26U 3LH2L 4ZFFB 2C3VB 2X70B 5D71L 1EJOH 4IHOB 4PRNB 4G43A 3G5YA 1JF5A 3M1BB 1P1ZA 1BVLA 4GUPB 3SDXF 3SKJL 3TBWB 3K1DA 4H5SB 3LS5L 1A21A 5FUZH 1IL1B 2YHGA 3QA3B 4QWWD 4IMKC 2F54A 2J88H 3FQXA 2Q8AH 3MV11 4LNRA 3B2VL 4YX2L 3WHE1 1HXMA 4Q6IC 2EZ0D 2HTKD 1EJOL 3V0WH 1G7PA 5JHDA 5FK9B 3RVWD 3HMXA 4TTGA 4K3DH 2P8PA 3SJVB 2UYLA 5F97E 5F89B 1X4YA 1V5JA 4GRWH 3U7YH 5FUZL 3OKOA 5T1KB 5CLTA 3GFUA 2MQCA 2J88L 4UQ2A 5I74C 4Y19E 5L8LB 3KHOA 4NC0B 4JDZB 1SJHB 3MGOA 4EVNB 3V0WL 1MF2H 5IFHL 1CL7H 3QUYD 4ALAH 1BFOA 2YPKA 1WGOA 3PWLB 4JM4L 4HHAA 3WEXB 4M62H 3ZYIA 1QLEL 5T1LB 1ZA3B 3OKMA 1JI1A 2GSGB 3U0TA 2VLRB 4HIXH 4OI9A 4OM1H 3JV5A 5BRZA 1QKZL 4WW2A 5H37H 4QCIB 4YHNB 2UZIL 3QWRA 4AY0A 5HYSA 4LDOB 4DFIA 2CXGA 1DQDL 4XRCA 3ZSSA 2ZUUA 4M62L 2BOCA 5ACZA 3VCLB 2CDEB 4HIXL 4L1DA 4OM1L 5IV2B 3SJVE 1X5XA 3NTCL 5KS9E 1VEPA 4D0CB 4R90H 5EBWB 1AGEB 2IBBA 2OLDA 4P4KD 3O6ML 3BRGC 4O51B 4CRPA 2EXWC 5CBEB 1YC8A 3NIFF 5E6YA 5I1CH 1KIPB 4KC3B 4YBLC 4L8BA 4AM0B 2UVFA 3ISWA 3L5XL 3ULVE 5CSGA 4ERSH 2JIXB 1CXLA 2XWBB 5LCVH 4N1CA 3DV4B 4EKXA 1FP5A 1LHZA 2VLRE 4LNVA 1KCSH 2X4NA 4IRJC 3QNYA 4P2QD 5I1CL 3OJVC 2P5WB 2WBJA 4HBQA 4ODBD 3GSXB 4XPGH 3RY4A 4ERSL 1TETH 4ELMF 2HFGH 2EDTA 3EDKA 4BQ6A 1VGEH 4U6YA 4R9HA 3RIAK 2SEBA 1UZ6E 4MWFA 3MLUH 4OLZH 2XKUA 5GJTH 4LCUA 4POZC 2C3XA 3FQRA 1F00I 1H3UA 3TNMA 4XPGL 3TJEL 1IGML 3BKYH 2A38A 2KPNA 2CKBH 1KFAH 4U1JB 4KUCF 3GMNA 3I02B 3ULUE 3L5IA 3QIBA 4Z0BL 1MCRA 3RI5F 4QOKD 3N85H 4C4KO 2JB6A 1VGEL 5GS2D 1LP9B 1TTUA 1CDUA 1LVEA 3BXNA 2AS5M 3LVEA 1OF2A 3MLUL 2CLZB 1YYMH 2VZTA 4OLZL 4OZGB 3VFVA 3BKYL 1BECA 3QI9D 2ADFH 4Z7WA 3QO0B 2CKBL 1MWAH 1UEMA 1WIUA 3VFWB 3BO8B 1P2CB 5KW9L 5HHVH 2WUBH 3P11L 2Y06H 2P5WE 4ZXBB 2OL3A 3JV6A 1A02N 5EUKA 4QHMA 3BPOB 1R5VA 1GGTA 1YYML 3FQNB 3MJ9H 4Y4FB 1IMHC 3FO9B 5EG6C 4RMWA 3HPJB 2MMXA 2MHAB 5MENA 2KH2B 1OLLA 1MWAL 3KLHC 3G5XA 2WUBL 3WBDA 3KPSA 1HHKA 3ULUH 3FT4A 3CMGA 5C0CB 1M6OB 3QUZA 4H1LA 1HH6B 2D03L 4QHUB 2WBWB 3B2UD 5I18H 43C9B 2BJML 3LIZH 3K1KC 2DOCA 1KGCE 1LP9E 2PTTB 5FA3A 5GGSY 3ZHDA 2WP3O 2APWA 4N90D 4NM8H 1HNGA 5DHVB 2IBGA 4JHWH 5F7UA 2R0KH 3JVGA 5L7XL 1I1AC 2R2BA 1I9JH 3KLHD 3BIKA 2HFFA 5EU4A 1JL8A 4MJ2A 4EDWL 5I18L 1K8DA 2DQHH 1FVDB 3GRWL 1C12B 3QXUA 4C83A 2N7AA 4DVRL 4JFQA 1XCQA 1OM3L 2CUIA 1JPFA 5DTFA 1MCKA 2DLFL 2PYEE 5CUSL 4PY7A 1IQWL 2X1OA 5KANI 4YQXH 5JHLH 3CH1B 3LEVH 2QQQA 4BA8A 2VL5B 3NOIA 3LV3A 2GJ6B 4WFFE 4WI2A 1OCWL 1I9JL 4DGYH 5LGJB 1CICB 3E3QC 3U9UB 3EYQD 4XVUD 3TBTA 2KUTA 5IMMA 3WN5C 3OG6B 1ZGLM 1U36A 3ZDXF 3I2CH 4H26A 4KKCD 5F9JA 3PL6A 5SWQA 3FQTA 3KLAB 5C0CE 3AREB 2DIJA 4YQXL 5JHLL 5DO2C 3LEVL 4LHUB 5IG7B 1OP5H 3MJ7A 3CFDA 5JOEA 1KN2H 4N0YH 1Z3GL 2YOCA 4HKBA 3LKOB 5F9AC 2JJSA 3JV4B 4ENEC 2DKMA 2NY6D 5E1HB 3D85D 4ETYA 2G9HA 2NW2A 3MNWB 3BGMB 2P43B 1U9KA 2G75A 3PWUA 1KN2L 1QFPA 4Z7VE 4N0YL 4O5LH 2AJSH 4O2EB 2X44D 3C60C 3TN0C 5MEOB 4M43L 3I3DA 4HUWA 4Z78B 1QHOA 1KTKE 1T6WA 3HG1B 4LLYA 3VFPA 1WICA 3B9DA 3WUWA 2P1YA 5DZOA 3MV9B 3LY6A 2Z9TA 4HZLA 1A64A 3MGTA 2CLRB 3K4AA 5EU6B 1QBML 1JHTB 1X5FA 1EAPB 1TQCB 1WCBB 5C0JA 2AJSL 4XPTH 1MLBB 3QXAB 1AXTL 5D1QD 5DYOB 2EDDA 3GMLA 4GG8A 1H0DA 1IM9A 2VC2H 4GKZB 4PS4H 2FO1A 2J3SA 4F7CA 3FT3B 1AC0A 3I3EA 1OL0A 4IIQB 3VD4A 3VFMA 3X3GH 3T77B 4YBHA 1AGDA 2VITB 3B5TA 1IARB 2F53A 1N0LA 4LSQH 2YEZA 4P2OD 4XPTL 4LU5L 1WQVT 2Y07H 5CJXC 5KTEH 3T8XA 5BV7C 1OAYH 4PJDE 1FCCA 2EXYD 5BVPH 2VC2L 4PS4L 5C0FA 2H26B 4ELKB 1HOCB 1KB5H 3BGFB 5B3JF 2W0FB 4HS6B 1FGNH 1HQ4B 1UXSA 3KNBB 3S36X 3SQBA 3H6JA 1NAMA 5ICYA 5HDQL 3HG1E 2IH3B 4AEFA 1RZJH 4WHYH 5C86A 4Y16A 1OP3H 5KTEL 5J7CC 1OAYL 2CRZA 5BVPL 4MQTB 5EU6E 2A83B 1J7VR 4HUXA 2EH8L 2X4OA 5D7IB 1A1MA 4NM4H 2VN4A 4ODXB 4YAQA 1FGNL 2P44B 2R23B 3TO2B 2VL4A 5DJXB 1RZJL 3DX8B 2XTLA 4MA8L 3OR6B 4ONGH 3IFPB 1A6AB 5BS0B 2W59A 1SYSA 2GSIA 5HVGB 1LO2H 5TDNA 1WIPA 3OB8A 4RRPA 4YDVA 1FFPA 4NM4L 5BW7A 4YK4B 3VXUD 5BCAA 4YNYB 4HDIA 4Y1AA 1IGYB 4CUCA 1F8TL 1QBBA 5IVXB 1YEKL 5DC0A 1RJYA 4Q2ZB 4ONGL 4NQEA 32C2B 3L6FA 1I7UA 4Y5YC 2HRPH 2VABA 5DC9B 3T0EA 1LO2L 1MFEH 2VZOA 4X7FC 2QADC 4RZCA 2NR6C 1EEYB 4JFFA 1NEUA 3OKDB 5IJKC 5CIPH 1M7IA 1KSRA 5D2NA 4WGVB 4Q97A 3EO9L 3QEUB 2PW2B 3I50H 4UDTB 5D7LA 4EI6A 3G5VA 5KN5B 2HRPL 5CWSB 3BWAA 3HFMH 3DGCR 4WI4A 3E2HC 4P5MA 1G0DA 4YWGL 2W9DH 1MFEL 3PV6B 3QFDB 5AWNH 1XF3A 3RWDA 4XPAL 3NFNB 3T08A 5BS0E 5D70H 5I17A 3O0RL 1XGQA 2QADD 1CDGA 2IH1B 2NR6D 2ENYA 5DDHB 1MH5B 1S7TB 3IGAA 3I50L 1JV5A 2H41A 4JKKA 4FP8L 2FDBP 2A6JB 1U8OA 1RSFA 1YPZF 4XZUA 3DYMA 4N0UA 5IHZB 3G9AB 2W9DL 4RFEB 3F6IA 1WWAX 5AWNL 5IVXE 1R5IB 3REVB 4KI5E 1I1YA 1CDIA 1R3HA 2Q76B 3PIQB 5HHOD 3FQWA 2GK0A 3RZCD 4AQOA 3BYYA 4M9PA 5E8EA 4D9LH 4DVBA 2FX8H 3VRIA 4X6EA 5CINH 1DQLH 1XF4A 3FHQA 5E6IB 4UTBH 3BOVA 5J06A 1X5JA 3TIDB 2VTFA 1VACB 2AXFB 4HKZB 1W8NA 4UIKH 2YA2A 4YO0B 3UTQA 5IMKB 4K8RD 4ONFL 4DWHA 4GS7B 5IOPA 2HYMA 1SEQL 1P4LB 4ZO6A 4NKOA 5JMRA 3RVVD 1EMTH 1C08A 1RVFL 1WK0A 2EEBA 4XMPH 3RIFK 5I1GL 5CINL 1N64L 3O6KL 3QDGB 1NCBH 2JK5A 1D9KA 4X9FA 3QEQB 1T1XB 4GG6F 3HC3H 4PJ5A 4J3XA 4UIKL 2C7UA 2O5ZL 4GAGL 3RU8L 1FV1B 2BK8A 3HB3C 4MAYD 5SX4H 3SBWC 1QSEB 3DIFB 4X99A 1FFNA 2E6JA 5C09E 3WNNA 4UOW1 4XMPL 5GRUL 4POUB 4FMFA 1NCBL 1ACYL 3PWJB 2NX5D 3HC3L 3DNKA 5CD3B 4X0KA 3V9FA 1PKOA 4NZTH 4XAKE 2LU3A 3N1QC 4FNLH 4G6AD 3B9KD 1MI5D 2BSED 2C5DC 1K4DB 4JFPB 1KTDA 2OR7A 3B9EA 2ZCKH 4CN4A 1JYWA 5F44A 5I6XC 5D1ZC 3DETD 4LSVH 5C0BA 2DS4A 5J0BA 1ZLUK 4KRPB 1CGTA 2DQFB 1G9MC 5C6PB 4J4PC 3AY4A 2ICCA 2JB5H 2HVKA 1ORSB 3QUML 3BKJH 4U1LA 4YDIL 1CFTA 2VXUH 4FNLL 4PBWD 4UMGA 3LKNA 2ICWI 4G9FA 1EPFA 1JZ2A 3CK0H 4RMSA 1DJSA 2HTLC 3M17B 3C08L 3X3FL 4LRNH 1RJLA 3QQ3B 1MFNA 2A73A 5AUMB 1QSEE 1YDPB 5CILH 3CVIL 3TT3H 1DQQB 2P24A 3MA9L 3QH3A 3DYPA 2DI7A 1L6XA 2OZ4H 1J1XH 1ZHKB 4G8GD 5DUBA 4J1UA 4JN2A 2F19L 1WZ1H 1K3IA 2KBGA 4ORZC 3TA3D 2I26N 5CILL 1K2DB 2FR4A 4Q6IB 3JTTA 5LGHH 4MQXD 3S3SA 2HMIC 5C0RH 5I1HL 4QF1A 4PJCF 4LK4A 1J1XL 5KJRH 1U41A 5DA4A 1IEBA 5LAXB 3D2UD 4WCYH 3ZKQD 5I74B 4X6DF 3BE1H 4LP5A 4PJEB 1I9RH 3OTTA 1T4KA 1T89A 2VZSA 1AGFB 1HZHL 2MTPA 1B4JH 4YXLH 5LGHL 3KXFB 2FCBA 4F33B 3MOBH 5C0RL 1NCAH 3LN4A 4TNWK 4U1IB 3TO4D 2DLIA 4PPTA 2HMID 4U1MB 5TPWL 5CCKL 3I6GB 4M1GH 5C9JA 1A9EB 1U8PA 2EDXA 4UI2A 4KVNL 5DVMA 3CC5A 5JOPE 3MGAA 5DVOA 4RA3A 3IJHB 4HV8B 5FKAA 4P46A 2FEEL 1QBLL 2PYFA 3CFEB 3G04B 4Z6AT 1XGTB 3PQYA 4I0CC 1RI8A 2O5YL 6CGTA 3CX5K 4X4XB 2QQKH 4M8QB 3O6FD 4TQEH 4JFDD 9CGTA 3GSRB 3MUGA 3U4EB 1AKJD 1LO3H 3K7UA 3ULSB 4FZEL 1NUFA 3DRTA 4Q74A 1CYGA 3H9HA 4NWTH 1KJ3H 2YMXL 5GGSB 4NDMB 4YBLB 3WXVL 5HDLA 1S7VA 3ESVF 4PJIE 5IHBA 2Z4QA 4ZUTA 1YN7A 3O4LD 5DMIH 2EIEA 3EYFB 3UDWA 4PRAA 2JLLA 4R2GC 5I2IB 4WHCA 4OFPA 3I6KB 1JWUB 4NWTL 4LLUB 1KJ3L 4PJXB 4Y8AA 5EIVA 4S0TD 4IRJB 3LKQB 1INQA 3KLSA 2FSEB 4WUUB 4X7DC 3ZE0F 1HINH 5IESH 3IFLH 3VW3H 3SE3C 3T65B 4CL7A 4XPBH 1DVFD 3TVMC 4HUKB 1EXUA 5DMIL 43CAB 2IJ0C 3O9WB 3QIWA 2R4RH 2OK0L 4IMLB 3FRUA 3PWVB 3TPUA 3GMRA 4PGDB 2DQGH 5E5MA 3RNQB 5ISZA 1HDMA 2VXSH 5I8CB 4JO3L 4R2GD 3MO1A 1AD9A 1AXSB 3QDJB 3QXVA 4DZ8A 5FO8B 3QCVH 1DEEA 4P2QE 2EE2A 3F7YB 1HINL 3IFLL 1UC6A 4XPBL 4RA0C 3STLA 4CVXB 1INEH 4M1DH 4QRQA