3JZ7A

Crystal structure of the extracellular domains of coxsackie & adenovirus receptor from mouse (mcar)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
209
structure length
209
Chain Sequence
PEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus and adenovirus receptor homolog
publication title The coxsackievirus-adenovirus receptor reveals complex homophilic and heterophilic interactions on neural cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 42
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2009-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jz7A02
1GGCH 1IEBB 4GRLA 3FOMA 5DUMH 2V2WB 2PO6B 1BVZA 1R5WA 1SY6H 5J6HA 5BXFA 4X9HA 1CVSC 3TH4T 1YN6A 3RPIA 2DJSA 3OF6A 1LO3H 4BSVA 4O2EB 3ARRA 5IBLC 3PV7A 4R7NB 2VN4A 5F96H 3PQYD 4XPAL 2ZCHH 5FECB 4Y4HA 4YDKL 3C8KA 1JRHL 2HWZL 4P46B 5EU7E 5DYOB 2EE2A 3B8YA 2GITA 2A73A 2EE6A 5DMIH 1NCTA 3BJ91 1VDGA 2MCPH 4XCCH 5IBUG 1YYMH 2YD8A 3QWRD 3IDNA 2B1HL 4QTHA 1BD2D 3FZUC 4KUCF 2VNCA 3B9AA 1TMCB 3K4ZA 1KJ2H 2I9TB 4K07A 1N64H 2IPKA 2IBBA 4G9FA 3GJFK 3QXDB 4U1JA 4Z76B 5A3ID 2CRZA 1FVDB 4PFEA 4XXCC 1S5IH 5SX4H 1QPPA 3D9AH 4PJFA 1F3JA 3GRWA 3CAFA 3T77B 5B39B 4MB4A 5I74B 5DC9B 2IAMA 3CJJA 4HS3A 4OZHA 3G5YB 4FFYH 3SKJH 3G6DH 3P9LA 5E8DL 2VDQH 4L8BB 4MDJB 2E8YA 4O9HL 3DXAA 1YQ2A 4ZO7A 3LEXB 4MQ7A 3MJ8A 3R4DA 3BIKB 4Z7WB 3KYOA 2HT3C 1KBGL 4GBXD 4X7SL 4LCCA 4YX2H 3KPSA 5DD6A 2FBOJ 3MV9A 1GJIA 4W6YB 3AVEA 3V6BR 1KJMA 3GIVB 3OHXB 4K8RD 2A1WL 1XIWC 1SVZA 2NR6D 3OB0K 4PRIA 5B8CC 5J3HD 5DTFB 5JIIA 5T1MB 4YFLI 2EXWD 1BZ7A 4Y5VA 2IEPA 3QXAA 1S7UA 4EOWL 4F57L 2RJMA 4JQVC 4XNZC 5DD1L 2HFEB 2BSSA 4GSDL 1IEAB 2HN7A 3GMOA 5IVZB 1U8HB 1ZHNB 3VWKA 1OTSC 4KKBC 2CK0L 3BPNB 3SGKA 3BVNB 4G8GE 4NQDA 2UV3A 2VITA 4MJ6A 1VSCA 4JFXB 1MUJA 4OGXL 2J8OA 1AR1D 4C59B 3NABL 1RD6A 5F1KC 5ANMA 3PWPD 3UTZA 3UP1A 4YO0B 2Z8VC 2DBLL 5C86A 2ED9A 3JV5A 5GPRA 4DOHB 2EXYC 2OCFD 5E00B 1KB9J 4HKBA 4K55A 3GJEA 4PB9L 2NYYD 3BHBB 3DUSB 2CXGA 5AZ2L 3SJVE 3QT2A 2ILLA 3EJZC 4TSBL 2QSCL 3H0TA 3BP5A 1PQZB 1IGFL 4H25A 1FAIH 1YDPA 4HIEA 1IT9L 4BH7B 4W68A 1II4E 2NY5H 1DDHA 1AGCB 1DQJB 4PLOB 2P24A 3AREA 3UCRA 4Z7WF 1XH3B 1QFWH 3OX8A 3IU4L 3BE1L 1V5JA 5IIEA 2AJVH 2X1WL 1HINH 2CLZA 3FT4B 4NHCL 4DCQA 2VXVH 5F7EH 1MJ7H 2CSPA 3V6ZB 2VLJD 1MQ8A 1I1YA 2YN3A 3O3UN 3HAEA 1KFAH 4A2LA 4M1GH 4YBLC 2R1WB 1FNGB 3IFPA 4ZUWA 1NGPL 4LHUD 3NIFE 5DT1L 4AIZA 1K3IA 1JNHB 2PTTB 1MHHA 5C0CA 2VDOH 4PJXE 4IMLB 2CUIA 1K8IB 3B83A 4YH6A 5ALBL 3WL9B 5KZCD 1GYAA 3HR5B 2BVQB 5BQ7A 2E6QA 2B5IB 2V2XA 1JTTA 2BNQB 4XBEL 3RIFK 3IJHB 5TFSL 4S1QH 1P9MC 3C6SA 1OY3B 4GQPH 4LPUA 4RNRA 4MAYC 5ENWB 4BZ2L 3O4LB 1NEZG 4HQQL 4LGSB 3ZYOA 3C2AL 5I1GL 3B9KD 2AV1B 5FKPB 1DE4B 5GRJH 3QAZC 1SJHA 1F2XK 2X9YA 4WIQA 2VL4A 3BZ4B 1BAFL 5J11B 4MGXA 4NQVA 1QVOA 4LLWB 4R3SA 5D1XC 3WHXB 1L7IL 5C9JA 3GSNL 1CXKA 1Z0MA 2O5XH 4H88H 5A2IH 5EU3B 3KLHC 4NIKB 1KCSH 1EEZA 4WI2A 1ES0A 1V7MH 5ITFB 1U8NA 4K3JL 1RU9H 2CJUH 3C6LD 3ARGB 1W72A 4DEPC 2DWEA 3RNKA 4P23B 5BS0D 5B38G 4IMKC 5TQ2L 1WCQA 5IOPA 1Z6JT 4OTXH 2J4WH 5JW4M 2WBWB 3UDWA 5EIQA 2X4PA 4WFGE 4XCEB 3ARDD 4ENEC 5TGBA 5EA0H 4S11A 4JFDE 4M62H 2NY0D 3NPSC 5I30H 1CDHA 4TUOA 5IROA 2PCPB 1F58L 3IGAA 4JN1L 4LLMA 5FOBA 4Z7QE 4M6MH 1VCAA 2R2HB 2AXFB 5CCKH 2DRUA 3QUZC 4PUBL 4U1SB 3SE4A 3DECA 3OPZL 2Q8AH 3DVNB 1AGEB 4XMPL 1C16B 1M71A 1OAKH 3SDCC 4IRJA 3KPRE 3DV6B 3Q2CA 4QY8B 4QHMA 4WCYL 4WUUB 4CADA 4JHZA 4R4FH 3G6JB 4NYLB 3KR3H 5I1IL 2YPLB 3NCYS 3TYGH 4ZUSA 5GSRB 4L3EA 3QDGE 4XPGH 5IB1B 4O5LH 4KQ4L 1A6VH 2Z93A 1CR9H 1WC7B 5E24E 3QEHB 4QRPA 1A1MA 1YA5A 1DBJH 1IC5H 3S3SA 3ULVH 1RZFH 4ZXBA 5F9OL 1RJLB 2V17H 2IH1A 4JB9L 1AE6H 1XZ0A 4Z18A 4QGYA 3ULVC 3QEQE 2OI9C 3F7VB 2FYYB 4HAFA 5F3HB 1KEGH 1C08A 3C5JB 1IC7H 1PX4A 1T1XA 4J7RA 4LPCA 4E41A 5JPNA 1H3PL 5IMOB 1KCKA 4P5MB 1KT2A 3QIBA 4IRSC 1JZ5A 5KOVC 3TT1L 3VGDA 1EX0A 4JO4H 4HKXB 3BYYA 1G6RB 4R8WH 1QLRB 3AS2A 1CGSL 3UTSB 1U3ZA 1W2KT 4OCWL 4B53A 1VKXA 2NY6B 4FZ8H 4L5FH 5JMRA 4KK6C 1CGUA 1YEJL 3OR6B 4OQTA 3VFVB 4C55A 4JRXA 3QEUA 1XR9A 5IF0A 2AKRA 3TCLB 2MJWA 1Q0XL 5AD0B 2LAAA 3ARWA 5IW1A 4P46D 4UTAH 3NH7L 4PD4K 1RAMA 4JFPA 5D93C 1GZQB 3C60A 3KYNA 2F53A 2UVEA 2ZP0T 4OV6F 3WFEH 4DAGH 4NKDA 4F33A 3NIDE 4L4VA 1U41A 3GKWH 3ARZA 5JW3L 3G6JF 4OF3A 4NC1C 2DQTL 4OGYH 2AVGA 2UY7A 3T3PE 2C3VA 15C8L 1PKOA 1AGDA 3ZTNH 5A2KH 3S37H 1BF2A 1JHTA 3T3ME 4OAWA 4LVOC 6FABL 3T1WA 3VXOB 1NFIA 4Q9QH 2AQ3A 3AS3A 1MIML 1U93A 4CKVX 2K7PA 4N90E 4CMHB 3O6KL 2IPTL 4N0YL 1LE9A 1I1AB 4K94L 1U8OB 4OKVA 4P4KB 1DLFL 5IVNA 5D8JL 4J8RB 3T1FA 4KHTL 3BT2L 3RWFA 3QHFH 5C0JB 5IW6B 5DRWB 1N59A 5BO1L 2DQCH 1PY9A 4JKWA 5IEHA 4PRDA 2IC2A 4G9FE 2Y23A 1S3KL 4YGVA 3IU3B 5DVKA 2AXGB 2DMBA 2XN9B 1JWUA 4RAUA 3VFSB 4EBQL 3KHOA 1G9EA 4JDZB 3E0GA 5GGTH 2EKSA 5GRVL 1I8IB 4XC3L 4Y1AB 4NPYB 4GW5B 3DLQR 4PJFE 3INUH 3IFOA 1Z0NA 3H9HB 4OZHE 1NANH 4GAJL 3EYQD 1OP3H 4MMZC 5CWSA 5IBUB 3ILQC 3HPJA 3ULUH 4BQ8A 1JK8B 3VFUA 4D0CA 3AM8A 4Q6IB 3DXAE 1GC1C 1T2QH 4HAGA 3LS5L 3ULUC 4KGLA 4WEBL 1LK3L 2QEJA 2ATPB 3KPSE 3K8LA 3SCMB 3QUMH 3LV3B 5F1NA 3DX7B 4XI5D 1SYVA 5JZ7D 4M7LT 4PJEA 4MA1B 1F6AA 2PXYB 4P2RE 1PZ5A 1PJ9A 3L3GB 5D7JD 1I7ZB 3SDDD 4E0RA 3BW9B 4QRQB 1PX3A 4PRIE 3GBNH 2VDML 4TVPL 3EFDL 4NRXA 2O5YL 3RTQB 2ADGA 5D1QB 4IOSD 1QZ1A 4M6OL 3GSQA 3O3AA 3SDXE 1T83C 3SQBA 4EUPB 5T1DL 1JPFB 2VDNL 4OFVA 5D9SB 4WHTA 2FB4H 5CZXC 4Q9RH 3UYPA 1QO3B 4JANA 3QQ4B 2CKBL 4LKCA 3V4VH 4J4PD 1S7QA 2IQ9L 4NQDE 4LARL 4OF6A 3CXHK 5H8DA 3L5HA 5KSBA 1K8DB 1OT1A 5FM8A 1NGXB 5CEZH 3RVWC 2FL5A 3N1FC 3QDHA 2R29L 2YUVA 4IEFB 4MB5A 2BNRA 3PDOB 4NKMA 5ANME 5L0QC 3RWDA 4HWEH 2VR5A 2ATKA 3FQTA 1JCKA 5JUEL 4MNHA 3IDIA 4OIIL 4GT7A 5ESAA 4LBEB 3CDGA 12E8H 4PRPB 3MZTA 3OAZH 2GJZB 4NN6C 3O45A 4LCYA 4QXTA 4F37F 4F80A 1D5XA 1FYTA 4DKDC 2VL5A 5KSUB 3NCCB 4OCRH 4POUB 4K3DL 5HYFA 4K3EL 4GW4B 1XCQA 3TIEA 3UBXA 3X11A 4JZJC 1R3LA 4PJ8A 1HQRA 3MRFA 2EKJA 1AKJD 2AK4D 3MJ9L 1QRKA 2CD0A 1MSPA 5FYJU 1LEIB 1QLEH 1G9MC 4U1MA 4QCIA 2QKIB 2EH7L 1K9TA 3P30H 5CUSH 1NJ9B 3MRMB 3O4LD 3FFDB 2HFFA 1CFVL 3QUXC 1C12B 1GGCL 5C0CE 1FJ1B 2VQ1B 5DUML 1N5AA 2JELH 3SGEH 1FC2D 1G7IB 2VZTA 2GJ6D 4NBZB 1TCRA 3DX9B 4S10A 2YXMA 2RR3A 1SY6L 3A6BH 2EC9U 2R2EB 3BMWA 1PG7X 4C56A 4KVCH 1UQSA 3CSYA 1FNEB 5A16B 2YEZA 3QDMA 5CS7A 3B2UC 4POZC 1LO3L 3BPLC 2UZXB 3G5ZA 5FDYA 3ARGD 4MMXC 2ZCHL 5E7BA 1TTGA 1S7VA 2FDBP 1LEGB 2A2QT 5DMIL 4WO4A 3EGSA 2FR4B 5I2IA 2MCPL 4XCCL 3QG6B 2P8PB 3O6FC 3L3JA 2BK8A 3AB0C 3CPLB 2ZNXA 1YY9C 3VXSA 2JK5A 8CGTA 1FNLA 1FRGH 1KJ2L 4LSDA 4M7ZC 3FRUA 4JPIB 1N64L 3VFPB 4P9HL 3MV8D 3NCFB 1HYSC 3QXWA 4XGZB 4FFWD 3PL6B 5E1AB 2EO1A 2YMXH 4HH9A 3UX9B 3IVKA 2VDRH 1S5IL 2OMNA 3GMNA 4KTEH 3D9AL 1T21B 4WUUD 3R8BB 2WBKA 4QRRB 4PS4H 4FFYL 4JCLA 3SKJL 5M94B 3G6DL 4R7DA 2VDQL 1MHCB 4EN3B 4PGBA 3OKNA 3MBXH 1PSKH 4YLQT 4XVUD 2IAND 4HUMB 1P53A 1C5DA 3JTSA 3OKLA 2P49B 3BD4A 3Q1SH 3DGCR 4YX2L 1MCHA 1SEBA 3UJTH 2VLME 5DSCA 3U30B 1ZT1B 1WAAF 2YPKB 4RGMC 4LOUD 1NC2B 5B38B 4CVWA 3SDAA 1YNKL 5DEGA 4OSUH 3F12A 5E5RB 3H3PH 1U2CA 1JGUH 1TVBA 1PGRB 3OSKA 4HT1H 1A6AA 3IKKA 4LKXA 4I0PA 3VE0B 4M8QA 4XCNA 1DVFD 2FJGA 3V5DA 2ZOKA 2VAAB 4KJWC 4JGUA 1ACZA 1FNSH 5DHVB 4QRPE 1SMOA 1SYSB 3DX8B 4I13B 1ITBB 1U36A 1HHIB 5BZWA 1MVUB 2XNAA 2NY6D 3FRPG 4R97C 4HLJA 4G8IB 3OKKA 4MD0B 3NCJH 5DUBB 3V4PH 1PEZA 1HXYB 4P99A 2H9GA 5HJ3B 4E41E 3TN0C 3KJ6L 3BGAA 3VH8B 1DLHA 3QXTA 3I6KB 4L3AA 3QQNA 3HG1A 5I75B 1YN7B 4IJ3B 1FO0B 2YUWA 4JVWA 4MS8D 4UDTA 4X80H 3S4SA 1UJ3C 1FAIL 1JUFB 2ADIA 3W9EA 2OZ4A 2A0LC 2NY5L 5AWNH 3BDYH 4JO3H 2FLRT 4JRXE 4X6DA 3TT3H 3LRSB 3PWVA 4FMFA 2YD1A 1QFWL 4M3KB 3BN9D 3GSNB 3I6GB 2AJVL 1HINL 1Q8MA 1Q94A 4FFVD 2VXVL 3MXVH 5F7EL 2J1KA 5I66B 3NFNB 2F53E 4I2XE 1MJ7L 5F1OB 5KVDH 5IB3B 2WQ8A 43CAB 3WLWC 4N1EA 1KFAL 3ZE0F 4M1GL 4L4VE 4KPHH 1N7MH 1WCBB 3LKOA 1TJIL 4PV9B 5HVHB 3QISA 2VDOL 1WTLA 4S1RL 4YJZL 3MPCA 3Q5OA 4XVJH 2CLRA 3KWWA 1MIEL 4TULH 5C0FB 2PTVA 3QH3A 1CXEA 4AEEA 1RIUH 4S1QL 5EC1B 2JCCB 3PWUA 1U92B 5TH2A 1H8OA 1W8NA 1BOGB 2FO4A 2PYFB 4I5BA 3QNXA 3WO3B 4KGJA 3LD8C 1U8LA 3EYOB 4Z78A 3UJIH 4PYHA 5GRJL 1FLRH 5ESQB 2XKNA 2VZVA 5IP4A 4KI5C 1QBLH 3HRPA 4LSSH 5ICYB 3KAAA 5ABDE 2RQ8A 5L2KB 4NN5B 5D2LA 5IK3A 2A9MH 2CDEA 4J3VA 1NMBH 4UQ3A 3RZCB 1MLCA 2KUTA 1YNLH 4U1LA 4H88L 1JWMA 2H32H 2P5EB 1EZVY 1KCSL 1CLYH 4TNVF 1VFAB 5C3LD 1T7VA 1V7ML 1RUQH 3RJDA 1UH3A 2X1QA 3NACL 1RU9L 3LN5B 4U49A 2CJUL 3R1GL 5C6WH 2YD7A 4ZQKA 5E6IA 4NO0B 2OYPA 4L9LB 4OTXL 2J4WL 4UV4H 4RRPA 3LZFH 3ROOA 5BW7A 4PJEE 4JHAH 4M48H 4NP4H 2W07A 5DO2D 3HPLB 4FTVB 5EA0L 2B0SH 4M62L 4P57A 5I30L 3BQUA 4KJPD 3VFWA 2JJTA 4M6ML 5E2UH 3DURB 3ZE2F 4AMKH 3WNLA 3ARFC 4U7MA 1IC1A 4ZD3H 1YNTB 3N9GH 4Y4FA 2Q8AL 1XR8A 1OAKL 3T65A 3L95B 4OCSH 2AI0H 3WIFA 1U95B 1AR2A 3GB7A 5IJVA 5D7KD 2AJUH 5GS2D 4OD1L 4R4FL 4P5TB 2ZUVA 2CLVB 4WNQB 4MSWB 5DK3A 3SY0A 3TYGL 5K9KB 3EOYG 3MRPA 5KSBE 3IKCA 2EIEA 3QZWG 3CVHH 5C08E 2JCCF 4XPGL 4O5LL 1YMHA 1A6VL 3G5VB 1U8JA 1CR9L 4LDEB 2BNRE 1T0NA 1XF4A 2GY5A 3FCTB 1DBJL 1IC5L 4OZ4B 4Y16C 3EDJA 1J8KA 2V17L 3GMPA 1HH6B 5FOJA 2A6KB 1AE6L 5BZDB 4JPWH 3CDYA 5JOEA 1C5BL 4ZAKB 2E9IA 2KPNA 2CO6B 2VE6A 1FFQA 3DVGB 4AEHH 1KEGL 1IJ9A 3ZDYF 1IC7L 4HKZA 1BQHG 3MNWA 4PV8A 4NCDA 5CEXA 2IPUG 2PYED 1ZVYA 3C09C 3RGVD 2Q3ZA 4ZODA 5JR1H 3LKPB 4RAVA 5I73C 2NQCA 4YFEA 3TBTA 4RGNE 1GH7A 2NX5D 4JO4L 4R8WL 3BP6B 3QDAA 4J3UA 1B9ZA 4RWYH 5J8OA 5KSAB 1AXSB 3RWHA 3PQYA 4L5FL 4I4WB 3GSVA 4L3CB 2R56H 3KXFB 5E5MB 5J6GB 5C07B 4ODVL 3QHZH 4XCFH 3QUZA 4F3FB 4UTAL 5IMLA 3QA3A 2Y9RT 5CP3A 1CICC 3TZVB 2VLKD 1NBYA 2E6PA 3N06B 4F37K 3WFEL 4EVNA 3TBYB 2P8LA 1J7VR 1SBBA 2VZ3A 4I77H 4DAGL 1T66C 1KIQA 4NO3B 4Y4KB 2DLGA 3GKWL 4BFGA 5E8EB 4C56E 5ADOH 3EKCA 3QDME 4OGYL 5D7IA 2NTSP 2WBJB 3ES6B 4B50A 5HYEA 1DL7L 5H37G 3S37L 1NDMB 4PR5B 4G9DB 3KG5A 3FQWB 4HWBH 5E08H 4Q9QL 4JKMA 3LSOA 4WFHD 5BCAA 4WV1B 3LKNA 4OLYH 3BH9B 2NZ9C 4R0LC 2Y4SA 5DD3H 3U79A 2W9DH 4B5EA 3QHFL 3VXSE 4TOYH 1EAPB 1N6VA 2DQCL 5GXBB 4NM4H 4GRWB 2Q86B 2ZUUA 3TO4D 3L3HB 4HZLA 2CKBB 3EO1A 1X5GA 3ET9F 1KULA 2DYPD 3O2DH 1CT8B 5CGMA 3KPPA 3KPNA 4Y19A 5GGTL 1NMCB 5K9JH 5F89B 3WFHB 4J3OC 5JHDB 1QHOA 3MLTA 4KDVA 2D7MA 4JFQB 4NQCA 1YMMB 3INUL 4AQ1B 3WBDA 3ULUL 3EAKA 5FHBH 4M7JH 2DQUL 3TO2B 1MH5B 2XIDA 2GT9B 1T2QL 1JP5A 1JGDA 3GO1H 2R23A 4NRZA 4QXGH 4M4PA 2A6JA 3QUML 4TUJB 3AS0A 1H15B 4QYOB 1D9KD 4P3DB 4N5EC 1A2YB 5DEFA 4U7SA 3GBNL 2DQIH 3V5HB 4KZEH 1EMTH 1OGAB 3GRWL 3QI9A 3EDDA 3DPBA 4XBPA 3RKPA 2NXYC 1UWEH 3MV01 3DVFA 2AEQH 2APVA 5C0GB 1SHMA 4M7LH 1U58B 4JFFB 1P2CA 3VRIB 1GHFH 2FB4L 4Q9RL 1Z9SA 2BMKB 1D6VH 3V4VL 1G7LB 5DZNA 4WGVB 4DFHA 3MJ6A 4Y2DB 5HVFB 2D31A 5IB4B 2BY3A 5C3TA 3K8MA 3VWJA 5EC2B 4QO1A 4PY8J 4WW1A 3L3DA 1H0DA 3ABZA 2A77H 4LLQB 4GRWF 5EBLB 1K4DB 3TFKD 2I5YH 4HWEL 1UXSA 1V7NH 4CNIA 3HG1E 4JDTH 1J0IA 3KLDA 5BRZA 4LHUA 3P77B 5DLMH 4MXVF 3CLEH 12E8L 2W0KA 1Q9OA 1IAKA 2H2SC 2H3NB 3KPMB 1NCCH 2JIXD 1FCCA 3ARBD 5KTEH 4X5XA 4NHUB 2ZUYA 1UZ8B 4OCRL 4X6DE 2CH8A 4G42B 3MRRA 1FL5B 1FBIH 1N3NB 4GH7B 1WF5A 1KJ2B 3WKNA 5IV2A 4RZCB 3EYUH 2QSVA 2F19H 5HBBA 1F3DJ 2E6JA 4IOFC 3W11C 3P30L 5CUSL 1GCFA 4Q74A 3VFMA 4F7CA 3LHPH 4IIQB 4JM2D 4LGRB 3W9DB 1G1CA 5TDOB 1UWXH 4XNXH 3OR7A 4KK5C 3C87A 4Z7VB 5I71B 2JELL 2FSEA 5EZOH 4Y5YA 4KKAD 2IADB 2L7JA 1NDGB 1WQVT 2AJ3A 1QPXA 2NY2C 4YHNA 2JE8A 3EHBD 2E5EA 5HDQH 3A6BL 3HI1A 1KPUB 5DK2B 1WIOA 2IALB 4KVCL 3N0PB 3L7FB 3KJ4B 3ROLB 2X70A 5J13C 3Q6FA 5B8CB 1P1ZA 2R1YB 4QT5B 1YJDH 4X7DC 1MCKA 1DSFH 4XB8A 5IFAH 4KU1A 4BFEA 2W60B 3RL1B 1RY7B 4GO6B 3S9DB 3SO5A 1U8MB 1YJDC 5ACMA 5D2LE 1MAMH 4FTVD 3O3DB 1LVEA 2VAJA 4S2SA 2FECL 3B5HA 2DTSA 1DQLH 4AH2B 2OP4H 2G2RB 4YXLH 1FRGL 1MFEH 2ARJB 3O9WA 3HZYB 3TNMB 5DMKB 2KDGA 3STZA 5HHOD 4KROB 1NKRA 5DQJA 2FEEI 2VDRL 4WWKB 4HV8B 4KTEL 3LY6A 3PGCB 1ZGLP 4V2BA 2OTWB 5HYSA 4YDJB 4LLDB 3K0WA 4PS4L 4BFIB 2P8MA 2Q76A 2DLEA 4UU9A 2ICEA 3MBXL 1PSKL 5TF1L 4CUCA 5EO0B 4KXZI 2Q1EA 2A6DA 3HNTH 3U36A 5CJQH 1FG2A 3Q1SL 3VFNA 4Z5RB 5HGAA 3UJTL 1AD0B 1IRAY 4HUUA 5MEND 3NZ8A 4TNVK 4Z7VF 2Q87A 4MNQA 4YHPB 4OSUL 3TGXA 4F7MA 4ZAKD 1CDBA 3H3PL 1JGUL 3QWOA 4X6EB 2C1PA 3DIFA 1J05B 1VGKB 1R5IB 4G6ML 2DLIA 3QULA 4ZTPH 2DMCA 2OX5A 1INQB 1YEKH 4NNXB 4MNGA 4OGZA 1KPRA 5KOMC 5BVJB 1FNSL 3VG9C 3CLFH 4QRTB 1H5BC 3P9MB 1CDCA 2X1OA 3HAEG 4XCYB 1FZMB 1MJUH 2IBGA 5KSAD 2R4RH 1WT5A 1INDH 2NY3C 5GRYA 3NCJL 3FT3B 2I27N 2YKLH 4LMQE 3LQZB 25C8H 2YPVL 3VD4A 1IM3B 2XV6B 3VXRD 1K3ZA 1NC4B 3SPVA 3TF7C 4FQLH 3QIWB 4WI9A 1I7UA 4LP4A 5I15L 1KG0A 3QZWB 1HKFA 1XF3B 5FFLA 3TZVD 4UQ2A 3SN6N 4F7EA 4AL8H 2PN5A 3VXNA 4YDVB 2W9LA 4X80L 4XP5H 2OK0H 1KCRH 2GFBA 3HZMB 4QHLB 2NW3A 1M7DB 1NL0H 3PQYE 1AC6A 2YK1H 2Y7QB 4G7YH 5AWNL 1A7RH 4ZOCA 3BDYL 4JO3L 3REWB 4ELMA 3TT3L 5T3XE 2HTKD 1U3HC 2O61A 1G7JB 4PJXB 5T1LB 1OAZL 1C8PA 3DSFL 1BQHB 4JFOA 1JMZA 5FYKU 3QQ9C 3GGWA 5IQ9A 1UGNA 2BSTB 2HP4A 1CDJA 1A6TA 4XT1C 4PTUA 5E2VH 4G3YH 5LGHH 3TLRA 3VGEA 5GS1B 4U6XA 5KVDL 4PJBA 3WIHH 1R3HB 1J18A 4HLZG 3PWJB 4MD5B 1KPVA 4NZUH 4PRHD 2Q8BH 5CFHA 1Q9LA 4KPHL 4W4OA 3P73B 3RI5F 1KIRB 1CE1H 4WI5A 1L6ZA 1X5FA 5D7IE 2GSGB 3PHSA 1T7ZA 2ZCLH 4O02H 1RK0B 3ECBA 3MNZA 1WFNA 4XVJL 1BQUA 5IB5B 2ZUSA 4TULL 3PNWB 2EDTA 2C7UB 3T0AA 4LSRL 2YN5A 2WLZA 3PGFH 1RIUL 4O51A 3FTGB 4JR9H 1XF2A 4WW2B 3L9RA 2AP2A 4G6AD 3TA3D 1HI6A 1IGYA 3TN0A 1MCJA 3UJIL 5CBAB 4OF8A 5D7JA 1FLRL 4PJGA 1AP2B 5CLTA 5D72H 1QBLL 1MCFA 4LSSL 1DANU 1S9YB 2HTLD 3PHQA 5HSFA 4Y19E 5F7DB 2H2PD 5JXEC 1X3DA 2A9ML 1UJ3A 1NMBL 4KWUA 4Y5XB 2D0FA 4NQCE 4JFDB 5EU5B 4F7TB 3QUYA 3K81A 3C5ZB 1CLYL 1D6EB 4PRNB 3SKMA 3P0YH 2VUOA 1IM9B 1RUQL 3AY4C 2Z8SA 1A21A 1Y6NR 3TYFB 1TJGH 2ZOLA 1OQOA 4OFYD 4J3XA 4PJCA 1JYWA 5FV1L 3ARPA 3D18A 4LGPB 4PD4J 3KPOA 4LAJH 4LSVH 3WXVL 1XGPB 4PJXF 4YUEH 3NBNA 4K8RH 3LZFL 3MCLH 5DJYA 2ADJA 1ZA3A 4JHAL 4M48L 4NP4L 3VD9A 5IJKA 2P5WA 2B0SL 4HUXA 4YQXH 2CIKA 2QQKL 1OLZA 4K8RC 3V8OA 1QEWB 1TITA 2KZ1B 4NC1E 4XBGB 4UAOB 5E2UL 4WI4A 5J3HC 1HSBA 5IGXH 4AMKL 1TENA 5IHZB 3E6HB 2DJ4A 3RA7H 4OD2A 4ZD3L 3UTTB 4RFNC 1PW3A 4JFHD 1SMAA 4OCSL 5DFWH 2AI0L 5C09B 3HE7B 2RBLA 3MRKA 3QEQB 2AJUL 4KDWA 3U2SA 2HJFA 5FM5M 1KB5H 5GRVK 5JDSA 4HK0A 4D0BB 2C3XA 1PY4A 3CVHL 3VFTB 4NQUA 4WW2F 4X6CB 1ZSDB 4KMQA 1G9NH 3BISA 1WLHA 1AKJA 4KK9C 1AR1C 2X4TB 3U9PH 3RL2A 2G60H 3WUZA 2YR3A 2DM4A 1G9NC 1DEEB 5T5NG 1E0OB 2WWMC 5E9DB 5DJ2A 4JPWL 4LSUH 5BRZE 1A6UH 5E8OB 2I9LA 4L9DA 2NYYC 3S96B 4AEHL 3WN5B 2AJSH 2AJZA 1S7RA 3FONB 4ELKA 5JR1L 2GJ6A 1NUDA 3MRIB 4X99B 1B4JH 1CFSB 3MXWH 4NOFA 5TF0A 4EI5C 5TDNB 1FORH 3FOMB 4GRLB 5DJDA 4GW1B 3FB8A 4PRAB 4RWYL 1MCDA 3ILPA 1T6VN 4ONGH 1R5WB 2HT4D 5FUZH 5HHPA 1OGTA 5BXFB 2R56L 3DV4A 4N8CH 5LGJB 1EVTC 3RPIB 1OM3H 2AABH 4OUUB 1FZOB 3QHZL 4XCFL 2NCMA 2VYRE 5KSVA 4Y4HB 2VXTH 3C8KB 2NY1B 2BVUA 3I2CH 4RMWA 3AXLA 1U3JA 3IDNB 4QTHB 4CGTA 2BXZA 3MV8A 4I77L 3U1SH 3CXHJ 3QUMB 4MJ5A 2ZUXA 2IPKB 2BSRA 3GSOA 4XWOD 4OKDA 4HMEA 2ARWA 2EZ0D 3RY6C 1MY5A 5HTSA 4Y16A 4X6CF 1A14H 2J7LA 2DQGH 4U1JB 4U31A 4HWBL 5E08L 5LKNA 1MHPH 2NPLX 5F9DC 4PJFB 4KRLB 4XP1H 3S3JA 4WJ5A 4OLYL 1JZ7A 4JFYA 2PF6A 5DD3L 4AY0A 1KXVC 3DBXB 2W9DL 2X09A 3MC0A 2VZOA 4TOYL 3G9AB 5DR5H 4MQ7B 5D1ZC 3MJ8B 3P11H 4PJ5B 1AQKH 4FQCH 1RPQA 3KYOB 4YGAB 5EBMA 2I07B 4FZEH 1L6XA 3KPSB 3V0VB 4X9BA 5DD6B 3MV9B 1Z3GH 3IFNL 3B8SA 5K9JL 2F58H 2ZKHH 3C6LC 4LFHG 4G8GD 5GS0D 3U4EB 3BGMA 5AUMA 4XAWH 5ICXB 3ZT7A 4PB0L 5KVMC 5KW9H 1T20B 3QIUD 1AO7B 5FHBL 4P0DA 4M7JL 1BZ7B 2AXJA 3NIDF 4Y5VB 2YD6A 3E8UH 3ARDC 3QXAB 1IKNA 3GO1L 1OW0C 2IH3B 2NY0C 3DMMC 3GMRA 4QXGL 5GGVY 4YC2C 4XPFL 2BSSB 4G6JH 1RJZA 1UEMA 2HN7B 3GMOB 3SJVD 2GTWA 4WUKH 3T3MF 4JKPH 4RFEA 3IRPX 1DUZB 3V4UH 1BGXH 3S88L 2XY2A 3H9ZA 5D2NA 4JZJB 4ALAL 1G7HA 1ZS8A 2DI7A 4MNQE 4MJ6B 3MQIA 2DQIL 3EUUA 4OJFH 4KZEL 1EMTL 4QHNA 1CK0H 5DFTA 1NC4D 4B0MM 1M05A 4W4NA 2E7MA 4OV5A 3UBXG 2D7NA 5I1JH 2RFXB 5ANMB 3UTZB 1UVQA 1UWEL 3MCG1 4LK4A 2AEQL 4M7LL 4YR6B 4MNGE 5FYJE 4ODWA 1NGYB 4HKBB 3GJEB 1GHFL 2AERT 3MBEB 1D6VL 3O4OC 4R0LA 4ZOAA 3RVTD 4JREC 4PJFF 1N8ZA 1ORSB 2SEBB 3CFKB 1LD9A 1YDPB 3WLBA 3T4AA 1EO8H 4MCYA 2GUOA 4R96A 4LNVA 5C0IB 1H9VA 5T1LD 5DRNB 5C71A 3FO1A 4X7TA 3REVB 4NBXB 2P47B 3D3VA 4DUWA 1DQDH 4L8CA 5F8QC 2I5YL 1CGVA 1DJSA 1V7NL 3QXVA 2CLZB 4JDTL 4DCQB 4I48A 4M9PA 3HI5H 5DLML 4HK3J 2PO6C 1EIBA 3QFJE 3CLEL 2DF3A 2FZ3A 3SBWA 1I1YB 5BOZG 3F7RA 1DBKL 1NCCL 3VRLF 3IFPB 1EZVX 1N2RA 1G7PA 3NTCH 1EXUA 4AIZB 3GSWA 2BXYA 4BSJA 4LCWD 5D70H 1MHHB 2P48B 4LAQH 3DHJA 2K9UA 2R0LH 4P46C 3EYUL 1K85A 4FQHB 1X4ZA 3FQXA 5GGQH 3C6SB 4PJBE 4JRYB 2ZSVA 3LHPL 3DROA 3MUZ1 4ZUTA 4LLUA 4CVUA 2O26U 1Z9MA 3RUGB 4XNXL 2MKLC 4ZPTB 5HGDA 4OCLC 1JPTH 5IW3A 3U0WH 1NMAH 5EZOL 4WFGD 3X3GH 5HHNB 4JZOA 1NCAH 2GTZB 1QVOB 5M7QA 4R3SB 4JFDD 5HDQL 4J1UA 5I1CH 3RY4A 4A6YA 2FEDC 3KLAB 1YEDA 1IM9D 5I74C 4R2GD 1ES0B 1RZJH 1A0QH 1U8NB 3EYFA 1F11A 1YJDL 2DWEB 3RNKB 1F4AA 1WWWX 1DSFL 2Z35B 5IFAL 1RZJC 3KPRD 5SWSA 1BEYH 5F7YC 3OXSA 3VMPA 2Z8WC 2DQFB 4MD4A 4NUJA 3H9SA 3RI5K 3VXMA 5CHNA 4L4TD 4HGWA 4H1LA 1I9JH 1DQLL 1NBZA 2YA0A 2OP4L 4YXLL 3QDGD 1P4IH 4I3SH 1MFEL 5DXWA 4MDIA 4XPBH 3IGAB 5ID1A 4FN0A 1TTUA 2NY7H 1BJ8A 1O5DT 3JXAA 4Y2OA 3RP1A 1OOAA 4PJCE 5AAMA 3BX7C 4PLJD 4GAYA 5I6XB 1BJ1H 4IRJB 2Q6WA 3HE7D 5EO9A 3TVMD 3VGHA 1SEQH 3QEQD 4QHMB 4XI5C 5BJTA 5B4MD 1A6WH 5F71A 2P5WE 3BPNC 2PW2B 4AJ0A 2E7LC 1OHQA 5CSZA 2ADFL 1ORQA 2BCKA 2CDGA 3HNTL 4L3EB 5CJQL 4HDIA 1FL6A 4RMTA 2LE9A 1H8SA 1I7TA 5HY9A 2EDKA 3BFOA 3RUGF 1QR1A 3S4SG 2AGJL 2WLYA 1CD9B 4CVXB 1QSFB 4AEIH 5J4MA 4N9OB 4K2UH 2MKWA 2PYEA 3O2WH 2JB5H 3RGVA 2HT2D 3WEXB 3OJ2C 5J7CC 3ZE1F 2GIYA 4E41B 1T1XB 5JPNB 4IRZH 3HE6B 4J4PC 4ZTPL 4HUWA 4XHJC 5T5FH 1RFDH 1KT2B 4HIIA 1YEKL 3X13A 2JF1A 3RWGA 2IPUK 3WUWA 4KI5E 4WDIB 1JNJA 2BZDA 1SJEB 3CLFL 4BQ6A 3H7BA 4K3HA 1OAXL 3RVXC 1JV5B 2Y5TA 1LO5B 1FPTH 3EOAA 5JOPD 1MJUL 5TE6H 2Q7YA 2R4RL 4P2QE 4EQ3A 5L8JB 4XZUA 3RWJA 1VKXB 3DYMA 1INDL 1FH5H 4Z77B 3T09A 5CJXC 2YKLL 5LBSH 4JFEA 2XICA 3WD5H 25C8L 4JRXB 3QEUB 1XR9B 5IF0B 2AKRB 1B6UA 1PG7W 4FQLL 1QFPA 2VLKA 5FO8A 4BK5A 3VXUB 4N90D 4JFPB 5DC4B 1X4YA 4NRYA 4AL8L 3GJFA 4ERSH 1UM4L 2F53B 1A9BB 3T0EA 2OK0L 1KCRL 3BJLA 4BUHA 4PGCB 1P4LB 3D39A 3CDFA 5D5MA 1NEZA 4F33B 4L4VB 1NL0L 2B5IC 3JVGA 2YK1L 4G7YL 4G9FD 1A7RL 1ZA6A 2C3VB 1YEIH 3RVUD 1E28A 2WIMA 1AGDB 3MYJA 2KBGA 1JHTB 4OAWB 2H32B 1T4KB 1NFIB 2W1NA 3ZDZE 5F3BA 1DANT 1U93B 4NT6A 4LNRA 1EGJA 1RMFH 4JJ5B 5E2VL 2IAMD 4G3YL 5LGHL 3O41A 2LU7A 3NFSH 1LE9B 5F1IA 1IAIM 3WIHL 3TO4A 3F8UB 4OKVB 3MV8E 1QYGL 3DXAD 3LAFA 4HS8H 3ZO0A 4NZUL 2C4FU 2Q8BL 3JBG7 2O93L 5EFIA 4YE4H 3WE6A 3QEGH 1Y0LA 4WEMB 5IEHB 1CE1L 4ODHH 4NDMA 3KPSD 4PRDB 4X8JA 4YHIB 4RRPG 1RZIA 4O02L 4YAQB 2ZCLL 4YGVB 4M7KL 1C1EL 1JWUB 4G43B 5FK9A 4M61B 1EEUA 1W8OA 3ARGC 4P2RD 2EKSB 3GBMH 4P23C 2Z31A 3OGCA 5GS3A 4MJIA 2L0DA 4PRID 3PGFL 1YY8A 5BV7H 1S7WA 4JR9L 3QCTH 1NQBA 3VFUB 4D0CB 1RIHH 4GRMA 5DJZA 4X4XB 3HC0A 3MOAH 2JB6A 3PGDA 5D72L 5M95B 4CMMA 4L4JA 4FS0A 4NKOA 5F1NB 3VWKD 3U6RB 1SYVB 4C83B 2JJWA 4PJEB 43C9A 2B1AH 4HIHB 5F72S 2ORBL 4HUNB 4HUVA 3I3BA 1VGEH 4JN2B 3CVHB 1PZ5B 2J6EA 1LO4H 3MO1A 4M1DH 4NQDD 1SQ2N 1BWMA 3ISWA 2YC1A 5GGUA 2DIBA 3GEWB 3BPCA 1HKLH 3P0YL 3B9DA 5C6TH 1J0KA 4NRXB 5EO1A 3VXTB 4HCRA 5T5NF 2ADGB 1TJGL 4C54A 4X4ZA 3L5WB 4KK8C 3FN9A 3GSQB 4NNPH 4LSVL 4WU5B 4WHTB 4HMCA 3QCUH 4YUEL 4K8RL 4XRCA 3MCLL 4LQ1A 2OBGA 4JANB 3CMOH 4AQOA 1S7QB 4K9EH 4YQXL 2IJ0C 1J8HE 1T1ZA 4PGDB 1MCNA 5KSBB 1AIFA 1ND0B 2FL5B 2DLTA 4U2ZA 3PXJA 4FRWA 3ARED 4ONFH 4OGAD 32C2A 4ZPVA 5CGTA 5IGXL 4NKMB 3AUVA 5FB8A 4J2XA 3RA7L 1JNNH 1OP9A 2X1PA 1TQCB 5GRUH 3UPRB 2ATKB 3FQTB 1UB5A 4NCC1 2ZJSH 4XNQB 4ZUVA 2JIXA 1MJ8H 2Y1VA 4MNHB 5FV2A 1IL1A 1F6FB 4JO2H 3O3EB 3NOIA 2CUHA 2EEDA 3BZFA 4ORZC 3CDGB 4G8EA 4RBPH 3RBGA 3L1OH 2XXMB 1FN4A 3MRBA 4JQXC 3O45B 4LCYB 4MA3A 1HH9A 2ICES 3GM0A 2NY6C 1FYTB 3CZFA 2VL5B 4PLNC 1D7FA 1G9NL 5C0CD 1BOYA 2XQYK 4JKKA 1OP3K 4YEFA 3P4MB 3UBXB 3TIEB 3U9PL 3LKRA 3X11B 3D3VE 2G60L 5JXEA 1HQRB 4CN4A 3BD3A 3L5JA 2XOTA 1D3CA 2HJLA 3JV6B 4LSUL 4PJEF 5L9DH 3SGJA 3ZKQD 4JM2A 4KJYA 1RZ8A 3S8WA 1I9EA 4U1MB 4QCIB 4WHYH 4XX1E 2EIDA 3AY4A 4MS8C 4UTBL 2AJSL 1EEQA 1X9QA 3UYRL 4E42A 1BPVA 4XNMA 1IAMA 1B4JL 3MXWL 1MOEA 4X6FB 1FORL 3OAYH 1N5AB 3B3IA 2E9JA 4KUZH 1PG7L 4ONGL 1NAMA 1VHPA 1TFHA 5FUZL 4CMHC 5F8RC 2W9EH 4FQIH 3CSYB 1JMXA 1OM3L 3QDMB 2AABL 1KCLA 4P4KC 3ZKND 5KSBF 1MFAH 4UT6L 3IB4A 4DGVH 4ORGA 2VXTL 4FXKA 3WFDH 1XCTA 2FO1A 3I2CL 1I8MA 2VXUH 3QDJB 2VN7A 4N8VG 4WO4B 4YPGA 1ED3A 3EGSB 4MWFA 4DGIH 5I2IB 4HGMA 4PPTA 3HUJB 4PRBB 5JW5A 3L3JB 1FG9C 1E6JL 2G5RA 3C9NB 3PABB 3WSQH 3U1SL 4BA8A 1A3LL 3BSZH 5JO5B 1CS6A 1KN4H 2VLMD 2M8XA 1ZANH 2BVEA 3MREA 3GM8A 2X9XA 3IDXH 5HI4D 1WUNT 4Q6IC 1A14L 1PYWA 1WZMA 2DQGL 2W65A 3OAZK 3QRGH 5H94A 3IVKB 1RUMH 5CIPA 4A2MA 1MHPL 2X40A 2NW2A 4XP1L 3NCEB 5SWSE 4HMDA 4LPXA 4KV5F 3SCMC 4S0SD 5DMYA 5I16A 3K2MC 4R7DB 4M6NH 4U3XA 3BXNA 3H9SE 4MA1C 3VXME 3KLSA 1QRNA 4PGBB 4R4BA 2PXYC 1UWGH 3OKNB 1DQQA 5DQ9B 3U0PB 5DR5L 5EB9A 3IDYC 3P11L 3JTSB 1WZKA 3OKLB 4FQCL 1A5FL 4LRIC 4ISVB 5IMMA 4FZEL 4NKQB 1SEBB 5GSVA 2B4CC 5HXMA 4MLSA 1Z3GL 2DBJA 4QRPD 3RTQC 1VFBA 1DUYA 3TBWA 4EI5A 5D1QC 2EYSA 4ZXBD 3FN3A 1H3GA 1T3FA 2F58L 2ZKHL 1GVIA 2GSIA 2ENSA 4GXUM 3W81A 3SDAB 5KW9L 4NO2B 5GGSY 1EFXA 2VR9A 2DM2A 1WZLA 2ZG3A 2F54B 1TVBB 3WJJA 4AM0B 2X42A 3IDJA 4E41D 4JCMA 4LKXB 4M02A 3E8UL 3I02A 1J1XH 1HHJA 4I0PB 5DO2C 3T8XA 3U82B 3F62A 1FVCB 3QIBD 2FJGB 3ZKXB 2ZOKB 3KDMA 5SWQA 4G6JL 5DHXB 3QR2A 5DVLA 3OJMB 4WUKL 3DI3B 4JKPL 2F74B 1JGVH 4HF5H 3P4OA 3V4UL 5HDOA 1BGXL 5CMAA 2EDRA 5EOCH 2XNAB 2R9HD 5GS2H 1NLBH 3OKKB 4LEXH 3HUJF 2HRPH 2PYEE 4OJFL 4ESKA 4JRXD 1CK0L 5IVXA 1HSAA 1A3QA 2H9GB 4PY7A 5I1JL 1P5VA 5I1HH 4NWTH 1EEYA 2DQDH 1S78C 3UAJC 1JFQH 3NIGF 1BFTA 1ZWIA 3MRNA 3NZHH 3EJYC 3C60D 2F53D 2P7TA 1ZHKA 4N5UA 4HG4K 4LQFH 4UDTB 2WWKT 3S4SB 5GIRB 3DUUA 4Q7DA 1M7XA 4N0FA 4L4VD 4L29A 5D1ZA 1EO8L 4JFEE 5HHQA 3PWVB 4M8VA 1LDPH 2BOBA 1DQDL 3TBVA 4ONHA 1VACA 3KPQA 4W6XB 1GSMA 1Q94B 4JJHA 5ECJE 4DTGH 5DGQA 3HI5L 1MCRA 5JHLH 1NGWA 1J1OH 3T0EE 1GOHA 3D39E 4LEOA 5D5ME 3NCMA 3U9UB 3VCLA 2BDNH 1FCGA 1DN0A 3T08A 3DMMA 4XC1H 3LKOB 3NTCL 1IAOB 4MVBC 5D70L 5FYLE 4KTDH 4LAQL 1BJMA 3MMEA 5HHME 3KWWB 4WI3A 1RZ7H 4FQJH 2QQNH 3QH3B 4ZFZA 4EOWH 4NQTA 5DJ8A 1CFQA 4EXKA 4ZFFA 5GGQL 4X5WB 5ERWA 1S9VA 5TH2B 2FO4B 1XGRB 2X7LA 5T3ZE 2GK2A 1E4XI 2W0FA 1NFDA 2GQHA 2YHGA 2K7QA 1CQYA 4ODBD 5HYSG 5FUCE 4JY6A 2XKNB 5KN5A 1JPTL 3U0WL 1NMAL 3LKSB 4PYGA 3MROB 2XPGA 1RHHA 3OJDA 1NCAL 5IK3B 4DZ8A 2XT1B 1I8LC 3PL6C 2V9TA 4X9GA 4PBWD 2CDEB 1IBGH 5AG9A 4MJIE 1BX2A 1JWMB 4ZDHA 5GZND 5KVFH 1PKQA 5KG9B 1PBYA 1RZJL 2AEIT 4EN3C 1ZKAA 5AZ2H 2CDFA 4ZQKB 5E6IB 1NCUA 3T2NH 1IGFH 2DKMA 1LQSR 2ED7A 3MGTA 1IT9H 4OLUH 3U30C 1HYRC 2V2WA 2PO6A 5I8EA 5JDJA 4BJLA 1I9JL 1KJ3H 1QP1A 3GSRB 4P57B 1P4IL 5C08D 4I3SL 3BQUB 3BE1H 3RZWA 3MNVB 4XPBL 3VFWB 5I1KH 3O8XD 3IXAB 2BNRD 3K46A 4NHCH 2NY7L 3ZHKA 4HXAH 5DHVH 1MY7A 5KAQG 5FECA 4Y4FB 5CGYD 3I3EA 1VERA 3JWDH 1VEOA 1NGPH 1SEQL 5EU4A 4P9MH 3WMSA 3GB7B 1HXMB 1A6WL 4M5ZL 3V6OC 3JWDC 4Y0GA 3SY0B 1OTUD 3R8QA 5SWZB 1NFKA 1P6FA 3MRPB 3IKCB 2J6EH 1T0PB 2I9TA 1U8JB 1WBXA 4UBDD 4RGND 1T0NB 5E8NB 1XF4B 2FATH 3MR9A 3VXPB 3QXDA 4HCRH 4CN1A 4PJ8D 3KNBB 4MQXD 1PVHA 3GMPB 1FO0H 4AEIL 5C0ND 1AGBA 5HGHA 2XTJB 5I75C 3O2WL 4IJ3C 2JB5L 4KDTC 4PJ9B 1W0WA 4R4ND 1QD0A 3G5YA 2VE6B 5FYKE 4MDJA 4FG6D 3MNWB 4PV8B 4IRZL 3LEXA 4M6AA 2Y5EA 1RFDL 5T5FL 5CEXB 3QNZB 4Z7WA 3GSNH 4RAVB 4XH2B 4OT1H 1OPGH 3BWUC 4XNYL 4ZS6D 3OHXA 3HNVH 1FPTL 5TE6L 5IBTL 4WTXA 1WEJH 2WUBL 4C56D 3RWHB 1FH5L 3PQYB 3GSVB 4ZS7H 5LBSL 5TQ2H 3QDMD 1UCBH 4YHZL 3WD5L 3MUHL 2BFVH 2G5BA 4HEPG 5EZLA 2C4FT 1OT2A 1F13A 4UOW1 2GCYB 2HVKB 3JV0A 2B7DT 3TC9A 2DQHH 4OFKA 2V5YA 1BD2B 2YRPA 3EZJB 3QA3B 1GPOH 2QTEA 5HVHC 4BKLB 4ERSL 4QTIH 5HI3D 1U8HA 1NBYB 2E9BA 4HJJH 3O2VL 3CUPB 3VXSD 2VO5A 2DKUA 1KIQB 4PUBH 3BVNA 4FQXD 3BRFA 5DJ0A 4HX1A 3UTQA 1NBVH 5D7IB 2JLLA 1YEIL 5F9WB 3NN8B 1OF2A 5KJRH 2RIKA 1RMFL 5E00A 3CFEA 3BHBA 3DUSA 4OIAA 4GBXB 4NN5C 5LQBH 3B5TA 5ESVA 4TTGA 3HC4H 3RZCC 1PQZA 1U0QA 2FRGP 4YE4L 3MZGB 4U3HA 3QEGL 4OB5L 4ODHL 1CDYA 1NAMH 2FJHA 4XPTH 1DQJA 3EO1B 3T0DA 4QOKA 3KPPB 1BZQK 5JA8B 3KPNB 3GBML 4P49A 1T22A 4KJQD 5BOPA 1CVRA 3MLTB 1YPZB 4L9LC 4NQCB 3EFFA 1V3MA 2ED8A 5BV7L 2X4QA 3QCTL 3V6ZA 1QRNE 3GZKA 5IBLD 1RIHL 1WFTA 1KEML 1F00I 5HD8C 4CU6A 1MCSA 1N0XH 2R1WA 1FNGA 3MOAL 4POYA 5I0DA 1JGDB 1FSKC 2R23B 2UYLB 1BQSA 2A6JB 4HS6B 1E6OH 3ORJA 4IMLA 3A6CH 4JDVB 3FZUD 4Z95H 3WL9A 1VGEL 3AGVA 4M1DL 1LO4L 1QNZL 5I1LA 2YBRB 3ARSA 2BVQA 3CU7A 5DEFB 2FX9H 3AMKA 1I4FA 3BP4B 2BNQA 1YYLH 1HKLL 3ALWA 5C6TL 4G6KH 3QI9B 5JQ6H 2E7HA 2QV2A 4XBPB 4P5TC 2XA3A 2JJSA 4BUGA 4N0UB 2DTMH 4JG0H 1LEKB 3O6LH 4NNPL 3H42H 5D7IF 3HG1D 1DE4A 4DFIA 1T1YA 3VU2A 3QCUL 4PJHB 4FXGB 5JW3H 1QUNA 3CMOL 5J56B 1IGMH 1NEUA 2D31B 3BYTA 4K9EL 4LLWA 4PJIB 2HT3D 3VWJB 1U91A 2V7NA 2FIKA 1MIMH 4ZAKC 4ONFL 5IVXE 1F3RB 1T1WA 4EKXA 1Z5LA 1JNNL 3WHE1 5D8JH 3FAWA 5GRUL 3PJSB 1UXSB 5EUKA 4U6HA 1FE8H 4KC3B 4ZO9A 2ZJSL 2D7OA 4JO2L 4YZFE 5BRZB 3EO9H 2OJEB 4LHUB 3L1OL 3BEWB 1YPZF 3VXQA 4LCWA 4AK1A 1I7RB 1IAKB 3E3QC 2CRIA 4ZYKB 3HZKA 4X5XB 5KSAC 3Q6GH 1NH6A 2IG2H 5KZCB 2VZ1A 4PGZA 3L5IA 4KMLB 5GGRB 5GHWH 2X4NB 3MUJA 3MRRB 4KKBD 2AXFA 3MGOA 3MV7A 3L6FB 4U1SA 4LLYA 5TE7H 5IV2B 2ZNWA 5DZOA 1C16A 3EDKA 5EOTB 5L9DL 3DWTA 1JGEB 3TZVC 3B9KB 2Z0BA 4HC1A 1EH9A 1KIPB 4LIQH 4NYLA 4KXZH 3VFMB 1CN4A 3BEVB 4Y4KC 3VG0L 4ZTOL 4TTDC 5IB1A 3OR7B 4Q6YA 1S7XB 1IE5A 1JF5A 2WBJC 1AGFB 5HI5D 3MJ7A 4Y5YB 4TVPH 5AZEL 4P5KA 1FV1A 1ADQA 1W0VB 4KUZL 1RJLA 3HI1B 4LMQI 3C6LB 4WV1C 2W9EL 3P4NA 4FQIL 1XGQB 5BS0B 2FWOA 4WU7A 3B2VH 4DK3A 2X70B 3F7VA 4GRWH 5JOFB 2FYYA 3Q6FB 4U33A 5F3HA 3O11B 4PJIF 1MFAL 1NFDE 2FGWH 2ZUWA 4P5MA 1ZLVK 3D87B 4L4TA 3WFDL 5C2BH 5F97E 3U48A 5E2JA 4YNYA 2VXUL 3OMZA 4DGIL 2APWA 1G6RA 2BX5A 3CFBB 4U6TA 4YFLF 3LRHA 5FM4A 2RB8A 5CJBA 4S2SB 1NMCC 2LVCA 4MA7H 1CGYA 3WSQL 1Q9WA 3BSZL 4ZO6A 2MCG1 1U8KA 1KN4L 1PKQE 3TJEL 1HHHB 1S7SB 3FO0H 1UG9A 4U6YB 3OR6A 1ZANL 3VFVA 1G7MA 3STZB 3IDXL 3RHWK 3TCLA 3QRGL 1RUML 5DGRA 4WI7A 3TH3T 4X0KB 5SV3A 5HYSB 4JHBA 2NMSA 3RX8A 4LLAA 5SX5H 4M6NL 1W0YT 3G04A 5C70A 4K3DH 1UWGL 2ICEB 2H2PC 4CL7A 5DRXB 4JREB 2A6DB 4TNWF 3U36B 2AV7B 4ZO8A 1FG2B 1OP5H 5HGAB 4A6YL 4HUUB 4BSWA 3NZ8B 5D1XD 4DZBA 3CGTA 3UTPE 3VXOA 1KIUA 3KLHD 4Y7MA 1UWXK 2H41A 5J0BA 3LN4B 1I1AA 1U8OA 3DIFB 4P4KA 1WFOA 1S8DA 4XXDB 1H3TA 4LSTH 4Y2DC 2R4SH 1NUNB 1IAII 1J1XL 1BHGA 4OBRA 3RU8H 5F7MC 5C0JA 5DRWA 3QULB 3MGAA 5FDWA 1VEPA 4MNGB 1KPRB 2BVPA 5T33H 4CAGA 2NY4D 2VUYA 3ARXA 1G0XA 2XN9A 1MFBH 4XX1G 3HMWL 1JGVL 4HF5L 4ENED 5EOCL 1G84A 4Y1AA 1QTYT 4GW5A 5DJ6B 1X5KA 1NLBL 5GISL 4LEXL 5TQ0H 2HRPL 3OG4B 4OFPA 3H9HA 2IMMA 5T3XD 1OSZA 3RWCA 1JK8A 3QUZD 4NWTL 5I1HL 3DRTA 2DQDL 4OCNC 1I7UB 4J6RH 1JFQL 1KG0B 4Z7WE 3TIDA 1MRDH 3S3PA 3NZHL 3BO8A 2BY2A 4UQ2B 2ATPA 4ZMAT 1HWGB 1TTFA 1Y18B 3VXNB 5JIHA 3FMGH 4LQFL 4P9HH 2GFBB 2PXYA 1RJCA 2NW3B 2VLLA 4HWZA 1L9MA 4PJAA 4QRSA 5K59E 4GKZA 4QRQA 4PLKC 3ZHLA 3WS6C 4MQTB 4P9HC 4QRUA 4QHKJ 4ELMB 3QQ3A 1MCIA 5DMGD 3PDGA 2O61B 1LDPL 4MZ3A 4V1DD 3CXDH 4JFOB 4IIQC 3GGWB 4EUPA 1CXLA 5D9SA 2YD9A 5FF6A 5C0AD 3SE8H 4DTGL 3ULVD 5MEQB 5D7SH 5I71C 1MPAL 5JHLL 4GUPA 1H3VA 1QO3A 1J1OL 1J0HA 2OMBA 4ZNEE 1CFNA 1KPVB 2BDNL 1Q9LB 5EBWA 5I1AB 3PP3H 1K8DA 3CK0H 3S34H 5DS8A 2HT4C 4P2RA 4XC1L 1CG9A 1J10A 3MUGA 3KJ4C 1CU4H 3QPXH 1YNKH 5I17A 4KTDL 1B3JA 3ECBB 1GGIH 1KTKE 4ODXA 3MNZB 4Y19D 5FCUH 3V0WL 3A67H 4JHWL 1RZ7L 4FQJL 4M1CC 2QQNL 4H1LG 4NQCD 4DOHE 1O0VA 3SDXA 4ZNCD 4B7LA 1GAFH 4O51B 5KAQF 2OTUA 1XF2B 4YDIH 1IQWH 5MHSE 1HI6B 5JNYB 4PRPA 1IGYB 4IOIA 4TRPH 5KVEH 1EVUA 4LPWA 2GJZA 5D7JB 4PJGB 3SDDB 1CYGA 5KSUA 3OKYA 1U9KA 3MLVL 5EU6D 4XWOC 1T7WA 2X9WA 3LRGA 1LE5A 4QOKE 3PHQB 4KROC 2IF7A 3CH8A 1CZ8L 4WWKC 1IBGL 3GHEH 4GQ9H 4W70A 3KJ6H 3QUYB 5KVFL 4PJDB 3QRFM 3QI9D 3SKMB 4Q2ZB 5FM5O 2QKIA 3RRQA 3D1MC 3D85A 3FFDA 4LCUA 2ZOLB 3SOBH 5L8LB 3T2NL 4PJCB 4ELMF 1A7PH 2ZWLT 3D18B 2DJUA 4RSVA 5MEPA 4NQXA 4NZTL 4OLUL 2VQ1A 5DJYB 3LB6D 4HWNA 2YWYA 2ADJB 5TJWK 2P5WB 4HUXB 1KJ3L 3DX9A 3RDTA 3VWJD 2MTPA 2NY5C 3C8DA 5I0ZA 2BNQE 2X6MA 3SE3A 3WUWG 5I1KL 1FNEA 2DL2A 1HSBB 4HXAL 5E95B 2XQBH 4RMRA 2IQAB 2R2BB 3JWDL 2DQJL 5DVNA 3BKCL 5BRZD 4P9ML 4M9OA 3ILQD 5D6DC 1TJIH 3MRKB 3U2SB 3QG6A 1FFPB 4S1RH 2HJFB 4LU5H 3CPLA 5GJSH 4HK0B 3WNMA 5EG6C 1MIEH 2J6EL 3I84A 1QQDA 3QUKB 4KAQH 3NVQA 3QPQD 3VFPA 1AKJB 2AK4B 2FATL 3JTTA 3B9EA 3OKMA 4HCRL 3RL2B 3F5WB 3V95A 4PJGF 3PL6A 5E1AA 3DO7A 3QIWC 1FO0L 4U1HA 4LDLB 1QBBA 5DJXB 5DJ2B 5ILTH 1LNUA 3GMMA 3NCYP 5INDA 1T21A 2WP3T 1KCVH 2I9LB 4QRRA 3KYAA 3ZL4H 1MQKH 2VWEC 4LCWE 1MHCA 3ULSA 5L7XH 2AJZB 1S7RB 4PJDF 4ELKB 4CU8A 4EIGB 2PNDA 1UCTA 3IF1B 4WI6A 2GJ6B 4DKAA 1QFOA 4JZNA 5CZXD 4OT1L 4NQED 1OPGL 4U1IB 1A47A 3FB8B 4PJCF 4X9IA 3MV7E 1U8PA 2EDHA 3HNVL 3NACH 4H26B 1KUMA 3GHBH 1WEJL 1ZVHA 3R1GH 5CJ5A 3RVWD 5HHPB 1OGTB 3DYPA 2AAVA 4P48A 3DV4B 4ZS7L 1UCBL 3V8CA 5GS1C 2BFVL 1YEGH 5D7LD 3RWEA 1A22B 5CEZD 4LCIH 2YPLE 4NQSA 4H5SB 1D5IH 4OI9A 1KENH 2DQHL 3DARA 5KS9A 3EO0A 4D3CH 2UZIH 4DVRH 5CKAA 4RMVA 1CTOA 2ZPKH 2HFTA 1UKQA 2QHRH 2VABA 4JE4B 5BV7B 1GPOL 3AXLB 4QTIL 3WDIA 1SYSA 3DX8A 4HJJL 1R3IH 3BAEH 5F21B 1B0GB 3MV8B 1HHIA 4HJGA 1QG3A 1A02N 2KH2B 1NBVL 4MD0A 3O9WD 1IGTB 2BSRB 5DUBA 3HLAA 4LF3A 4WW2C 1JWSB 5J1TC 2J8UB 4OD1H 3K2UL 5KJRL 2X4RA 4L4TE 2YD2A 5H37H 3I6KA 4OCXH 2OTPA 2IANB 4WJ5B 2BRQA 1INEH 1YN7A 1A1OA 4KDTA 5F7HA 4CDHA 4JRWA 4UIKH 4Z7NE 5C8JA 5LQBL 1T04A 1CL7I 1HZHL 3VJ6A 4Y5XC 3HC4L 1ADQH 4PJ7A 3U46A 1FZKA 5IQ7H 5DI8A 3C5ZC 1MWAH 1NAML 3OTTA 5EBMB 2ZSWB 2CRMA 4XPTL 1UA6H 3S35H 3LRSA 4GKNA 4XP6H 1C5BH 3UPAA 1BWWA 3L7EA 4G6FB 3I6GA 4MNQD 4DKFH 5AUMB 3S5LA 3DRQA 3UROR 1DVFB 1L0QA 3B2UD 4POZD 5IB2A 1G6VK 4QNPF 3S6CA 5IB3A 1MHEA 1FL3A 2UWEA 2YWZA 4Q0XH 3A6OA 1N0XL 5FYJD 2YSSA 3W2DH 3GMRB 4I0KA 5DDHB 4WFFE 2ICWJ 4P3CH 1RJZB 2EC8A 5AYUH 4UAOC 4OZGA 3HMXH 1E6OL 2GTWB 3V79C 3A6CL 3O6FD 2AJXH 4Z95L 3IJYA 1MI5A 1YY9D 2VISB 1MNUH 4ODVH 5JORA 5D2NB 3N85L 2OQJA 2FX9L 1RZGA 4AEFA 1YUHA 1YYLL 3HE7C 4G6KL 1C5CH 2BERA 5JQ6L 2BRRH 1M05B 1U92A 5IWLA 5DURD 1BOGA 4I2XA 2DTML 1UVQB 4JG0L 1YEHH 2Q3AA 3O6LL 3IS1X 3HTLX 3EYOA 3H42L 4ODWB 5JOPE 2J8UF 5ICYA 4ETQA 2XN9E 4CW1A 3QFJD 4TNWK 5L2KA 1JYNA 1IGML 1N8ZB 5FGBA 1DL7H 4Y1AE 5ID0A 3RBSA 1D5ZA 1SJVA 1RJYB 2P5EA 4HIJB 1KC5H 4J3WA 3V6FA 3WNPA 4R96B 4MCYB 2GUOB 2KQNA 3BKJH 1JYVA 5J9PB 4LLVA 3OJVC 1CCZA 3WN5C 4KRNA 4X7TB 3LN5A 1AHWA 4L8CB 2V7HA 5C0DA 4F9LA 2L4OA 1FE8L 3FQUA 5GZOD 3AC0A 4I48B 3EO9L 1B0RB 4GRLC 2FZ3B 3VRJA 4P2OA 3DI2B 4PJAE 3H3KA 5CD3B 4D8PB 1V8HA 1N2RB 3Q6GL 4KJWD 1G7PB 2IG2L 3EZ8A 4F9PA 1EXUB 4BZ1L 5GHWL 3IAGC 1BLNB 2FEEL 1TPXB 4NFDA 3VA6A 2DQUH 4Y4HC 5TE7L 2W38A 2NY1C 1I75A 2DWDA 3VFRB 3BPOB 4IBLT 1U95A 1YECL 1BQLH 4S1DC 2UUDH 1BZ9A 4LIQL 2ZSVB 4P5TA 2CLVA 1NCNA 3TN0D 2VKXA 3DROB 5I9QB 1WWBX 4ODSH 4ZUTB 1KLGB 4LLUB 4BM7A 5FKAA 1JF1B 3GMLB 3IDYB 3UMTA 5HGDB 4APQA 3G5VA 3STBA 4NCC2 4CRPA 4WVRA 1PEWA 3FCTA 3RVUC 3GRWH 1AD9A 3QO1A 3OAUH 2WINB 1LILA 5ACLA 1TVHB 3HI6L 3DETC 3QUYD 2XFXB 4J1UB 3JWOH 4A6YB 3AU1B 1ZT7B 5BZDA 1LK2B 2IAMC 3B2VL 1DEDA 5LWYH 4PRPE 4K7PY 3EYFB 1U42A 1A9EA 1F11B 2FGWL 4PP2B 5HDBF 3VGBA 3ZTJG 5C2BL 5EN2A 1N26A 3LKPA 4F2MA 4NGHH 4NBYB 2M2DA 5C08A 3OXSB 4I9WE 4HG4J 1A7QH 3BP6A 3O8XA 4MD4B 3WLWD 4OLWH 2P5WD 3VXMB 4MA7L 3MRJA 2RHEA 4UOW0 4H1LB 3NPZB 5CBEA 1DBBH 1MEXH 3T2PA 4I4WA 4OZFA 1IGIH 3FO0L 5E5MA 5D4QA 5C07A 5ID1B 4HW6A 4Y5VC 3L3KA 3B9VA 2R15A 3MRCA 2GEEA 2X44D 4F3FA 1KV3A 2ERJB 4HFWB 2Q6WB 5EBGA 4P2YA 5EH1A 2C1OB 3U0TA 1JE6A 4ZSOA 3VD3A 5BVPH 2J8HA 1ORQB 2PTUA 2CDGB 1I85A 5K33A 4RWHA 5E8EA 3P4LA 1FL6B 1WBYB 5KVGH 4KI5D 3BP7A 4D0DB 1TZIA 4D2NA 1I7TB 2WBJA 3TPKA 3LH2H 1QR1B 4G9DA 3FL7A 4X4YB 3FQWA 2MMXA 3LEVH 4P2QD 1V3LA 5ACZB 2XY1A 4N0CC 4YFDB 5F44A 4JLRB 5DEZA 1X5YA 2PYEB 5J1AA 4GG6B 3RGVB 3HS0B 3MBEC 1T7YA 3WO4B 4QWWD 1CI5A 1X5ZA 4GLRI 1RUKH 4LSTL 1M6OA 2R4SL 2NX5B 3F6IA 4UMGA 4O2CB 3RU8L 4ZFOA 4H0IA 1EAPA 4HUWB 1HDMA 3BN3B 4HBCL 3X13B 4BH8B 1TIUA 3RWGB 3BWAB 2Q86A 4N1HB 4X4MA 5T33L 2CKBA 1RURH 2XZQH 5IMKA 1MFBL 4OGAC 3H7BB 3K4DA 1OQXA 2FX8H 1J88A 2HVJB 2FNBA 3EOAB 5F89A 3WFHA 2AS5M 5MEOA 2IFFH 1ZHLA 4XZUB 3RWJB 4U1KA 3HAEH 5TQ0L 3EIFA 3AS1A 3EDFA 4QRRE 3DHMA 4X6BA 4K7FB 2M26A 4RA0C 3QJHB 1PDKA 2WAHA 3LQMA 2XWTA 4J12A 2VLKB 1YQVH 4J6RL 2GT9A 3MCKA 3CC5B 1MRDL 3Q48A 4MXQC 2APXA 3QWQB 4FQXA 5DVOA 4NRYB 4YK4C 4TUJA 3EOBB 3FMGL 4AIXA 2B2XH 1MFDH 4P3DA 2EIZA 2QADB 4UB0H 1NEZB 1CBVH 3X14B 2A74B 2BVOA 2A6IA 5HHVH 5E99H 2J88H 3ZE0E 4IDJH 3V5HA 2XZZA 4MX7A 3CX2A 3V0AC 3V5KB 1RUAH 1OGAA 1E28B 3MYJB 3HHRB 4Y16D 3L5XH 3CXDL 2EDOA 4CBPA 5GGVH 5KS9E 4PP1C 5HHMB 3MJ9A 1A6ZA 3FB5A 5TF1H 1KTLA 4LNRB 1S5HA 3SE8L 1G7QB 3UYOD 5D7SL 5F1IB 3NGBB 2BMKA 3TO4B 1G7LA 3OKDA 4EEEA 4Y2DA 1BFOB 1K4CB 2DYPB 1CLOH 5IB4A 3WHE0 3WE6B 5CZVL 4F8TA 4GG6F 1BVKA 1N0LA 3CK0L 3S34L 4HLZH 4YIQA 3WS3A 5T1KA 5K9OA 1W72H 3QPXL 3L3OB 1CU4L 4X8JB 3DO3A 2JKXA 4HEME 3VW3H 1GGIL 5FK9B 3P40A 1UXWA 2XRAH 2C3WA 1AQDB 5EUOA 4LLQA 1I8KA 5FCUL 4G6FD 5HPMB 4X98B 4MCZB 3A67L 4MJ2A 1SY6A 5EBLA 4G6MH 1K4DA 5J1SC 3DGGA 4YHMH 3OGCB 4MJIB 1GAFL 3UDWC 2QHLA 1YY8B 3VI4E 3M45A 4ZOBA 3U7YH 2VXQL 4YDIL 5GQBA 1IQWL 4UUJA 5JLZA 4Y8AA 5DFVC 4TRPL 5KVEL 4PJ7E 4GRMB 1D9KB 4XP9L 4NHUA 5TE4H 2JB6B 1UZ8A 2WIIA 3PHOB 4CMMB 4PGEA 3FHQA 4QGTA 5KANG 1J5OH 43C9B 2YPVH 1A3RH 1T66D 3P2TA 1J8HD 3MO1B 3GHEL 4GQ9L 5I6XC 5I15H 2YC1B 1MCPH 4IRJC 4XXCA 5GGUB 3BPCB 1TJHH 1ZT4A 1MCQA 5EO1B 4I8DA 1BF8A 4YDLC 1WICA 3BZDA 1JTOA 2UWEE 4UZGA 2X4OB 1NKOA 4HPYH 3SOBL 3NCBB 3ZE2E 4HWUA 1OD9A 1A7PL 5TDOA 2AW2A 4OZGE 4XRCB 4Z7VA 4NJAH 4PTTA 5GS0L 3Q5TA 1A4JA 1MI5E 2V5SA 3IAPA 3GMQA 4KKNA 1OAZH 3OXRB 1QBMH 1T1ZB 3DSFH 3X17A 5E7FA 1AIFB 3UZVB 1XIWA 4DWHA 5B8CA 2XQBL 3D3VD 2BY0A 3T2OA 2R1YA 3HE6C 4URTB 3UEZA 3WDJA 3QIBC 1J0ZA 2Y6SD 4ZUVB 2JIXB 4JQVA 2W60A 1T5XA 3ARBB 1U8MA 3BZFB 4G8EB 5L2KE 5E8PA 1FN4B 4LU5L 5GJSL 3OGOE 2VLRD 4OQTH 5IVOA 2X41A 3IFLH 4AH2A 1HH9B 2R9HC 2P5EE 4O2FB 4Z7OF 4I1NB 4KAQL 5DHYA 5DQDH 4LSRH 4ZUUA 2Z4QB 3HZYA 4LSQH 3TNMA 5GGSA 4N5ED 3ZYZA 4WWKA 4HV8A 2HJLB 2OTWA 5LCVH 1DQMH 5ILTL 4JM2B 4RQQB 3S7GA 1KCVL 2BVYA 3ZL4L 3WXWL 3TJHC 4KJYB 1RZ8B 5EPMB 2DOCA 4BFIA 1MQKL 1VPOH 3LPFA 5L7XL 4HH8A 5DUPH 5FA3B 3KGRA 2W91A 5HGBB 4XNMB 1A1NA 1RZKH 3PWNB 4LPVA 4Z5RA 5EOQH 4JKLA 2H26B 1EHLH 1AD0A 1GOGA 1KXTB 4YHLH 4K23H 1RZKC 2VB5A 4NNYB 4NM8L 3ZKMD 1QLFB 3GHBL 5H2BB 1NAMB 5GGRY 1WSST 5IFJA 1YEGL 4QXUL 1OB1A 2R0KH 3WXVH 1QOKA 4F7PA 5IESH 3RFZC 5TDPA 3S36X 1QSZA 4X6EA 4LCIL 4EIZC 1J05A 4GXVH 1D5IL 1KENL 3PDDA 2OXHA 4ORGB 4D3CL 2UZIL 4FXKB 4DVRL 1MRFH 4U2YA 1XCTB 2ZPKL 1MCEA 2QHRL 2QQKH 5INCA 4BK4A 3RPKA 1I8MB 1B6DA 5SWSD 1FSKB 1HWHB 3WNOA 1WWCA 4DK6A 1ED3B 4MWFB 2X4SA 5D6DA 1R3JB 3H9SD 4QRTA 3VXMD 1R3IL 2VDLH 3BAEL 5FO9A 4I3GA 2H2SD 2HAZA 4XCYA 5HHOB 2VZSA 2IBZY 1CFTA 4DUVA 2BSED 3NFPB 2VERN 4JQIH 4RBPK 3MREB 4XWGH 1P9MA 5FO7A 3RIFF 3AM8C 3MRGA 4MAYA 1KACB 2W65B 4PY8I 3FB6B 3W5NA 2BJMH 3BGFC 1XF3A 2NW2B 4OLZH 4OCXL 5I16B 1JN6A 3F7YA 1INEL 4IOFD 3W11D 3SKOA 4UIKL 1XGTA 3BXNB 4YDVA 2CO7B 3AFLA 4R4BB 3E3QE 4QHLA 1DQQB 4JM2F 4U6VH 1ADQL 5IQ7L 3HZVB 4MYWB 5FAAA 1M7DA 5MENB 5D1XA 1MWAL 2Y7QA 1NSNH 5IMMB 4KK5D 1UA6L 2IFGA 5GSVB 3S35L 2MHAA 5C07E 1ZAGA 4M00A 2BVTA 3OKEB 3TBWB 5DSCB 1VFBB 1DUYB 4J3SA 4XP6L 3BKMH 3EJJX 4IM8A 4JY4A 2NY2D 1RIVH 2GSIB 1UKTA 4AT6A 4S1SH 3FFCA 4DKFL 4JAMB 4DVBB 4ODTH 1EFXB 1AXTL 4IMKA 1BFVH 2WUCH 3D25B 3OAYK 3IXTA 4ZSOE 3IDJB 4KRPD 3I02B 1P7HL 1HHJB 3T8XB 3HR6A 1U8QB 4Q0XL 2ZG2A 3W2DL 3KDMB 3NA4A 1VA9A 1KIRA 1HILB 5IM7A 2DICA 4P3CL 2EH8H 2D7QA 5AYUL 3DUHA 3HMXL 2UY6A 4GMTH 2AJXL 1AH1A 1QFUH 1MNUL 4GKOA 3VXRB 5CMAB 2GJJA 1TQCC 3PNWA 5E4EB 1T5WA 1T7XA 2C7UA 4JFED 3FTGA 1C5CL 3SDCA 2BRRL 1WIPA 4DJMA 5IVXB 4EDXB 4WW2A 2JJUA 1HSAB 1XEDA 1FFNA 3OG6B 1YEHL 1EEYB 1CGXA 5EDXA 5CBAA 1GXEA 1ZWIB 4X4ME 1AP2A 5DJCA 1NGQH 1HIMH 2BHZA 4F15B 4WRLA 1ZHKB 3D6GA 2WK2A 3T0ED 2HA1A 3D39D 2QADD 5JHDE 4L29B 5E2WH 4RX4D 1EBPA 1YMME 4V1DA 1NCBH 4TPRH 4OZIB 4F7TA 1KC5L 4UNTA 4CDGC 1D6EA 5FGCE 5FYLD 3BKJL 5C0AA 4R4NC 3O3BA 4UIMB 4CJ1A 5HHMD 4CVZB 1TETH 3TBVB 4L8SB 1VACB 3BH8A 3KPQB 4HIXH 4PRHB 1KXQE 4IRSA 3BRGC 4GS7B 2G9HB 3IETA 1NGWB 4ZS6C 3T04D 5A40E 2OSLA 5T3ZD 4LEOB 3IFNH 4H8WH 2F9BT 1DN0B 4DUXA 3GUTA 3MSPA 4OI7A 1OGAE 1YZZA 4PB0H 5CD5C 4N8VA 5E6YA 3KS0H 1K5NB 1K2DA 3VDBA 3OB8A 4YBQD 3MMEB 5MP6H 3V7MA 3ZLQC 2Z31D 3TV3H 3D0VB 3TA3B 4MJID 2NY3D 4Z7UB 2F5AH 3JZ7A 4WO4C 4ZFFB 1BQLL 4XPFH 5ERWB 1S9VB 5HI3C 2ZZUT 2X7LB 4JFZH 5EU6A 1X4XA 5F70A 2W0FB 1NFDB 4ODSL 1FHGA 2EIBA 2IGFH 4TSCH 3S88H 5IVXF 4ALAH 4C4KT 5KN5B 2MOVA 4UNVA 3D2UA 2X4TA 3OJDB 5EUOE 2YOCA 5D6CA 2HJKB 3OAUL 2VIRA 4X7EC 1DEEA 4AIOA 4NJ9H 5IEKA 1BX2B 3JWOL 4ZDHB 5E9DA 4HGKC 1EJ6A 1X44A 1VADA 4NSKA 3TH2T 2HLFD 3CIQA 5LWYL 3MFFB 4UILH 1UB6A 3LKQB 4OZIF 4PREA 1EFQA 4ETYA 2V2TB 2CDFB 3QQ9D 3EYVB 1DBMH 1UZ6E 1JZ8A 2M1KA 3M1BA 3VMNA 1L7TH 4PG9A 3MGTB 1ZLVH 2IMNA 4X99A 2RCSH 4NGHL 1S9KC 4MZ2A 5TDNA 4GW1A 5CKGA 1A7QL 4N68A 5C0RH 4G80A 4OLWL 5I8EB 4PRAA 2R8SH 2HH0H 4KJQC 2AQ1A 1DBBL 1LP9A 1MEXL 3SDAC 1A4KB 2XWJB 1J87A 4N1CA 1IGIL 3VI3E 5LGJA 2FLBT 2JTDA 4OUUA 5GGTA 1FZOA 1ZVSB 1AJ7H 4I0PC 2ESVD 3ETBF 2EC9T 3ZKXC 1DBKH 5I1DA 8FABA 4Z7VE 5EU4B 1IC4H 1Q38A 3BZEA 1D5BA 2ZUQB 5FYKD 1HHKB 1UH2A 4I18B 2OL3A 3QBTB 4Z7UF 5BVPL 1AY1L 1KLUA 4MJ4A 5F6HJ 3BKYL 5C0EB 3QUMA 1A64A 5L6YH 5KVGL 3W39B 1WBXB 5I8CB 1QBAA 1I3VA 5DD5H 1NFDF 5ETUB 2V5RA 3MR9B 2DDQH 5JXED 3LH2L 2ITDB 2APFA 1TNMA 3LEVL 1HHGB 2C26A 3SKUD 2DI8A 1AGBB 3M17A 2ICWA 1T83A 5HGHB 5F7LB 3GSXB 1L0YA 1ACYH 1U8IB 5MERA 3PV6A 4U05A 1W0WB 2Y06H 2OZ4H 2NLJA 1RUKL 4Z8FH 3DBXA 4NQEA 1M7IB 3F58H 2APBA 3OL2A 3RWIA 1YEEH 4EUPG 4PJ5A 1T6WA 1PLGH 4NZDA 2I07A 5JA9A 3RVVC 3V0VA 3FKUS 2R0WH 1RURL 2XZQL 4AG4L 5DK0A 2ICCA 2FX8L 3RKDC 5D7LA 2NNAB 4FQQA 2I26N 3KYMA 2IFFL 3U4EA 5ICXA 1NLDL 3FN0H 1T20A 4J23A 4RFOH 3ZDXF 3QO0B 1AO7A 2G5BB 1CLZH 5EZLB 5D96B 4U3CA 1K6QH 2WZPD 4G5ZL 4GMSL 1CD8A 4HK3N 3N1GC 1YQVL 1WITA 5EZJA 2G75A 2IH3A 4LVEA 4L8DA 2Y72A 2GY7B 1FZJA 3GSUA 4RMSA 1CF8H 1JHLH 2AJYH 3MRDA 4HULB 2B2XL 4DW2H 1MFDL 3K7UA 1DUZA 4TVSa 4X7FC 5IFHH 3QNYA 4RAHA 4UB0L 1CBVL 5FEBA 4JZJA 3FQNA 1S9XB 5HHVL 5E99L 4U1NB 2J88L 3I75A 5DJ0B 4HX1B 3UTQB 1UEYA 4IDJL 1KSRA 4HJ0C 1P7KA 5JXAL 1BBJB 1RUAL 4KK9D 4TYUA 3H6JA 5H35B 1XFPA 3L5XL 2RFXA 5A2FA 5E5UB 5MI0B 4FP8H 5GGVL 1OF2B 2D0GA 3E2HB 3TCXA 2WWMD 4YR6A 4OUOA 1NGYA 5F6IB 3QUXA 4HZAA 2ADFH 4KKLC 1I3RA 3CFEB 3MBEA 1QRND 3I6LD 5HI5C 5ESVB 1FYHB 3CD4A 2XWBA 5DF0A 1CLOL 1ORSA 1QSEA 2DL9A 2SEBA 3CFKA 5IHBA 2AGJH 3QJFA 3FJTA 2FJHB 1TQBB 1W72L 3FO9A 4G8GB 4M93B 4EI5D 5C0IA 3VW3L 4OI8A 3QIUB 3HFML 5I1EH 2L7UA 1UM6H 5DRNA 2XRAL 4QOKB 3JV4B 3REVA 1T22B 5E6IC 2I60H 4K71C 4YHML 2H6PA 1EFXD 3EFFB 2X10A 5BW7C 2X4QB 3U7YL 4FHBD 2VWEE 5K59F 3TM6A 2GK0B 3SJVB 1OAXH 3I50H 3O6FA 2VZUA 1DN2A 5TE4L 3BQUC 3JUYA 5F7KC 2EEBA 2JJTC 3G08A 2Z91B 1J5OL 3B6SA 2DLFL 1A3RL 1UACH 5I1LB 1YEFH 4Y4FC 2N7AA 3FFCE 1MCPL 1T0MB 1I4FB 1TJHL 4FQHA 1E27A 2CIIA 3RIAF 5CP7B 4JRYA 1ZEAH 1UM4H 1X7QA 4FMKA 1A6PA 3QFJA 4HPYL 1FLTX 3SGDI 3RUGA 1BIIB 1P7QD 4ZPTA 1T1YB 3VGGA 4NJAL 5ITBH 4DQOH 5HHNA 2GTZA 5CEYA 1G1YA 1QBML 2GI7A 5D1ZD 2XTJC 1U91B 2GAZA 2V7NB 2FIKB 3ARVA 3KLAA 1UM5H 3KVQA 4PJ9C 1UYWL 1T1WB 4QF1A 1MREH 1Z5LB 5CILH 3VFOA 1QYGH 1BM3L 2Z35A 3MOBH 5EUKB 4U6HB 2GW5A 3DOSA 1OARH 2NY4C 1R6VA 3FB7A 2B8OT 2DQFA 3VXQB 4LCWB 3IYLW 4M7KH 1C1EH 2WMPA 2HMID 4OQTL 3IFLL 4V1DE 5T3XH 5L88H 1XGYH 3DMMD 3HZKB 1RSFA 1FNAA 2A83A 5EORH 4OD3H 5DQDL 5C0AE 4LSQL 3ULVE 2OXGA 3RY5A 1SBSL 4K7PX 3KYKH 5CP3H 3MGOB 3MV7B 1J11A 1UH4A 4LLYB 4UT7H 1QHPA 4KUCD 2EYRA 5LCVL 1DQML 5KANI 2XZAH 5JPMA 1VPOL 3FT2A 1V3KA 2PW2A 5DUPL 5C0BD 1HOCA 2ZUTA 2ORBH 3VH8G 3AAZB 2PETA 5EZIH 1RZKL 5A3IC 3R0MA 4U1GB 5EOQL 2E3VA 1EHLL 1GZPA 3MJ7B 5F9WC 5DMGC 4YHLL 4IS6B 1KNOA 4K23L 4P5KB 1FV1B 4R2GB 1EHAA 1R0AH 4CVXA 1QSFA 3UTTE 1MWAB 3NIFF 2QSTA 1OD7A 2CGRH 3FO2B 3P4NB 1MVFA 5C09E 2R0KL 2FWOB 4WU7B 5IESL 2E27H 3K4AA 1IAIH 2NXZB 3KPRB 4GBXC 3WEXA 3IS0X 4GXVL 5EU6E 2VQTA 3HE6A 4YWGH 3D69A 4L1DA 4L4TB 1MRFL 1BVLA 1QFHA 4X6CE 3S5LG 3TBSA 4YNYB 5J89A 4WDIA 4EI6B 3QDGB 4FNLH 2PO6D 1SJEA 2NR6C 4NOBA 2VDLL 9CGTA 1SVCP 1JV5A 1LO5A 2QR0A 2FH8A 1SM3H 2EXWC 2H8PB 1Q9WB 5E9DE 1U8KB 4DGYH 1HEZA 4Z77A 4HD9A 4JQIL 1BFSA 1G7MB 3TVMB 4XWGL 1E4WH 1JZ2A 3CSPA 2BP3A 4RIRA 5DJAB 4U0QB 3UTPD 2FGZA 2BJML 3VXUA 4KQ3H 4OLZL 4L1HA 2HG5A 3B4NA 3ARUA 1KGCE 1TZHB 3RNQA 1A9BA 3G04B 4GJTB 4XMLH 4P59H 4PGCA 1JIBA 1P4LA 1PFCA 3U7AA 2X2YA 3PUCA 4U6VL 3Q3GA 1LP9E 4JEGB 1Z2KA 3E1F1 2WW8A 1NSNL 4P2QA 2H1PH 2BOCB 3QI9C 5IKCA 5A2LH 3BKML 3IDGA 3LS4H 4BSWB 1RIVL 4UTBH 4DZBB 2MQCA 2H32A 1T4KA 4S1SL 3MLXH 1JYXA 2FEDD 4ODTL 3UYRH 4U0RB 2OJZH 4HHAA 3ULUE 4JJ5A 4Z7QF 1BFVL 2WUCL 3TP4A 4B41A 2PR4H 3LB6C 3OKOA 2GHWB 1S8DB 2NTFA 2HKHH 5FDWB 3VWJC 1PG7H 2VDPH 2BVPB 3BIAX 2EH8L 5J6HB 4YHIA 5E70A 4YAQA 2EDLA 1YN6B 1P5UA 2D3VA 4GMTL 4G43A 1GGBH 4M61A 2X89A 1QFUL