3K03A

Crystal structure of cng mimicking nak mutant, nak-dtpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k03A00
4PA6A 5IY5C 2WLHA 1K4DC 4PDVA 2A0LA 2WLIA 4P2ZA 2X6AA 4G27B 5J9PC 2HVKC 3T4DA 1KKDA 3GB7C 4MVRA 4MSWC 3T1CA 4P30A 3LUTB 3K03A 1ZWIC 3SPCA 4JTDB 2ITCC 3RVYA 2IH3C 2WLIB 4MVUA 4X8AA 4MTFA 4MW3A 1XL6A 5B1BC 2QKSA 5EK0A 3E8FA 4MTGA 2DWEC 1OCCC 3E8BA 4RAIA 3SJQC 3SPGA 3F7VC 3HPLC 5B3SC 4KFMA 4R8CA 2IH1C 3RW0A 4DXWA 3EFFK 3AG4C 2DWDC 2X6CA 3SYAA 3ASOC 3ASNC 4EKWA 3UKMA 2WLNA 5EBMC 2HG5C 2JK5C 4LP8A 4H37A 5CBHA 3K08A 2A79B 4P9PA 1JVMA 4WFGA 4RUFA 3ABLC 3OGCC 4PA9A 3TCUA 3UM7A 4TWKA 4MTOA 4GX0A 5EBLC 2A9HA 3SPJA 3T2MA 3FB7C 4QNHB 2ZD9A 3LNMB 2Q6AA 5KUMA 4MVZA 3F5WC 3E8GA 3LDEA 4P9OA 1V54C 3KG2A 4PA4A 4BW5A 3AG1C 4X89A 2Q67A 1R3KC 1J95A 3ABMC 4GX2A 5EC1C 4G28B 2BOBC 4CBCA 2WLLB 2K1EA 3SYCA 4R7CA 3E86A 3STZC 2WLJA 3WG7C 1M56C 3T4ZA 4GX5A 3OR6C 3TETA 2X6BA 3X2QC 2R9RB 4R50A 4OXSA 1R3IC 3RVZA 3OUFA 2Y69C 3FB6C 3ABKC 3ZJZA 4JTCB 1R3JC 3R65A 3SPIA 2EIMC 4ZBMA 4XDJA 2YEVA 3RBZA 2EIKC 2EILC 3SYPA 3SYQA 2ATKC 4F4LA 3SPHA 4RUEA 1XL4A 3STLC 2WLMA 2EIJC 4MVSA 2AHYA 5KUKA 5B1AC 4XDLA 4MVMA 5E1AC 1BL8A 2Q68A 4WFHA 3SYOA 4MVQA 2HFEC 1M57C 3IFXA 3OR7C 3PJSK 4WFEA 1P7BA 4MW8A 3ZRSA 4LBEC 1OCZC 1OCOC 1QLEC 3K04A 3OUSA 4HYOA 4QE7A 1ORQC 3K0DA 3LDDA 4MVOA 4LCUC 4WFFA 3BEHA 3K06A 3IGAC 5EC2C 4I9WA 2AHZA 3E8HA 5EBWC 3AG2C 2ZXWC 3FB8C 4X88A 2OCCC 3F7YC 2H8PC 1S5HC 2Q69A 2EINC 2HVJC 2WLKA 4HZ3A 4JTAB 4MS2A 4QE9A 2WLLA 4XDKA 5CBFA 3JYCA 2DYSC 1R3LC 1K4CC 3K0GA 1LNQA 3FB5C 5CBGA 2ITDC 4RO2A 2QTOA 4UUJC 2W0FC 4J9ZB 4J9YB 2HJFC 3AG3C 2BOCC 5BZBA 4PDLA 4PA7A 4PDRA 4H33A 4GX1A 1G4YB 1OCRC 3E89A 4R6ZA 3E83A 1V55C 3VOUA 4PDMA 2DYRC 2P7TC 2NLJC 4PA3A 2KB1A 3LDCA
chains in the Genus database with same CATH superfamily
1YJNV 3BABA 2IJHA 1M56B 2N74A 3MHHC 2HVKC 3LUTB 3K03A 3WFVA 3RFRA 1S5LZ 1N4CA 4DV5O 4NKGB 5KHIA 1IBLO 4RAIA 1GKFA 1SQFA 4LFBO 4G2KA 3ZMZA 4LWSA 1GM7A 3ZN0A 4EKWA 1J5EB 1TGOA 2QWQB 1COWG 3ABMB 1GRJA 3FD9A 2UUBB 1XHZA 1NBMG 4D7SA 3RN4A 2R9IA 2R72A 1TUEB 2LO1A 2Z0AA 2WLLB 1ZX3A 3M99B 5IYCO 3T4ZA 1N34B 4U7NA 1IX9A 1WP8A 3W7SA 3J7AU 5LMUO 3G80A 3CMAV 1OZ0A 4JTCB 1KKCA 2EULA 3G6EV 1YCIA 3HKCA 1ROPA 4LR3A 1NR1A 3SYPA 3K9AA 1MOFA 4BIZA 4OX9O 4X20A 5KHKA 5JJEB 1H2GA 4O4JA 4LFCB 4GYCB 2X7RB 5KLVH 1P7BA 1MA1A 1NTZH 5B66Z 2LP7A 2QEXV 1IBKO 1YIJV 4I0XA 5H5NA 1YDXA 1AILA 2NR5A 4HZ3A 5LP6A 1IDSA 4B3SB 1HW7A 3K0GA 5J2UA 2PYLA 1OCZB 2QWNB 5GTIZ 2Q0AA 4IIJB 4FLUA 5EYPA 1H2NA 5GONA 2UUCO 4LF7B 3GB7C 4OPHA 2CGNA 3SPCA 2QE7G 1I0HA 2ZIOA 1KC8W 1VQ7V 1I7FA 1SQPH 3E8BA 3L9DA 4FFBA 1SRYA 4HNAA 1D5NA 3CCMV 1US6A 1KUQA 4TUYA 5EBMC 1P49A 1VF7A 2A79B 4X1KA 2OIGA 1DK1A 4O2BB 3TCUA 4IHJB 2WWWA 5JQGB 5B1AB 2XHBA 4E4EA 2CTQA 4LH6A 3T2MA 3SJBC 4JI6B 3ABTA 2DW4A 3FYEB 5IY5B 2P06A 4BW5A 3AG1C 2QTSA 4BIUA 1NU1H 1WN7A 4B3SO 4DV4B 1N0NA 5K1PA 4DR1O 2CAZC 2A3QA 1SERA 4NR1A 5B5EZ 5KHHA 2UXCB 3K5LA 4FLTA 2EJRA 2GUZA 3OMAB 3CB2A 3RBZA 3VQXA 2DQ3A 3A2FA 5CA0B 1D2DA 1FJGB 3CC2V 3B8MA 1OJHA 4YIOA 1Q7YW 3B09A 1Q90D 5LMUB 4ZHQA 4JF3A 2KQXA 4MW8A 3U10A 4AI8A 4NYKA 5JJJB 3T1HO 3JARA 2PUSA 3K06A 4YJ2A 2OCCC 3OFNG 4X20B 2XAHA 4GT1A 5L3EA 5KHJA 3ZHSA 1WB7A 2W0FC 1AROP 4LFCO 1JR9A 4X62B 1T5EA 4WBNA 1VQ8V 1XMQO 2ZINA 1F51A 1YZBA 3JALA 2OTLV 2KB1A 5J2TA 3HKEA 2GDSA 2JGDB 4OPAA 4DV1B 2HP8A 1XL6A 1SESA 4MTGA 2UXCO 5TISZ 3F7VC 4LF4B 1MZEA 4EFBA 2E76B 2HG5C 5D5PA 3T1YB 5FNVB 1Y76A 2LGQA 4PI2A 4H44B 2PYJA 3QVNA 2Q9LA 5EBLC 3RYFB 1QVFU 2Y48A 1YTFB 1E79G 3LDEA 2IJJA 5H6QA 1K9MW 1WA8A 4CBCA 1ZLZA 3SYCA 5DM6V 5DEDA 2B1IA 2YI9A 4W4KA 2PF4E 2Q73A 4YJ3A 3GVMA 3FFQA 1H8HG 3FB6C 3D3IA 4I5SA 4XDJA 3HKBA 3I55V 4OX9B 4U3JB 1Q8IA 2PY5A 3G6BA 2WLMA 2XAFA 1GN3A 4DV7B 1AJQA 5E1AC 1WPBA 1WP7A 4MVQA 4DV6B 4JGSA 1HNWO 4KHPO 2EIKB 1XMOO 3Q4HA 1FXHA 1OCCB 3RYHB 3W7UA 5LGUA 1N33O 1JOYA 2H8PC 3T1YO 2WLLA 1M57B 4DV6O 3KCYA 1BQ0A 1K4CC 1LNQA 3SR2C 3OT7A 3ZCCA 3TGUH 3FYIB 1BS3A 3JALB 3CX5F 2RNBA 2ZT9B 3ABKB 2R70A 3HB3B 1YITV 1VF6A 1Y4MA 1K4DC 2KKWA 2JIZG 1AI5A 3ZRVA 3AK2A 4DR6B 4H13B 3OTOO 5LMNO 1TVKB 1BCCH 4DR2O 3SJQC 3DTUB 5L3GA 4X62O 3HPLC 4KFMA 1MMMA 3JD1A 4JYCA 3RW0A 3C3TA 3JD4A 4I0XB 1AJPA 3ASOC 1WNSA 3UKMA 2AGAA 2JK5C 4DR6O 1LUWA 2A06H 3DXRB 5CA1B 1N36B 2YUAA 3AEIA 3B77A 2PI4A 4DV1O 3ZRXA 4CS2A 3EVKA 1HNZB 1HNXO 3CS5A 1B06A 3E8GA 1J5EO 5CB4B 3KG2A 3RYCA 1J95A 2JVDA 3E86A 2EJ7A 5IYBO 3SDLA 5L3DA 1EFRG 3AG1B 3X2QC 4LNUB 4UB8Z 1GMGA 4K8XA 3ABKC 3JASA 1OCOB 3SYQA 4LH7A 4LF5B 2HJDA 1Q43A 5C8YA 1PPJH 2XUMA 4MVMA 1AI4A 4KXRA 3N27A 1CEZA 2XNDG 5EYPB 3RYHA 4WFEA 1QLEC 1B04A 3LSSA 1AVMA 1S72V 3L70H 4UXNA 3OM3B 4BWAA 3APOA 2W0XA 4GKKO 3CXHF 2CTPA 2BOCC 1VQ9V 1IVSA 5LHIA 1QBZA 4IHJA 1BGYH 5JQGA 3CCLV 3CEIA 1RPRA 2JJ2G 1L0NH 3ZMTA 3X2QB 3JCZA 4DUYO 2XASA 5IYZA 4LF9B 2F43G 3E8FA 1S0VA 1H2MA 3O9OA 4LFAO 4FLVA 1VARA 2ZQMA 3Q4HB 3OTFA 2YXLA 3DC5A 2LFSA 4UVBA 2VRZA 1K5SA 5LP6C 2HHHB 1PV0A 4P9PA 1BHAA 2QWRB 5LMNB 3UT5B 2EX3A 3LNMB 3IAYA 3CD6V 3M8AA 3DSQA 5A9GA 4JI2O 1KB9F 1V54C 4CS3A 2K1EA 3DXRA 3JAKB 3RVZA 3NR7A 4J7KA 2VQFB 3RYIB 1XDCA 3TJTA 4RUEA 3B8NA 3STLC 1V9PA 1NVPB 2MK3A 1Q3EA 4JI8O 3BA9A 2XTAA 1AJNA 4IT5A 4JYBA 1AR4A 5CA1A 2BTQB 3QG5A 2ZNIA 1OCOC 2YIBD 4O4IA 2L35A 4PD4F 2BTQA 2Y0PA 3ZHUA 5LYJB 3KZIZ 4L87A 3ETDA 3GWOA 1FFXA 5C8YB 2EZOA 1SS3A 3JYCA 4UV9A 2QR4A 1U96A 2RN9A 2JS5A 3P3NA 2BSKB 4JAUA 5FPRA 4OGQB 4DV5B 4CH5A 2Y0IA 4I50A 2GTSA 1BHBA 1LUVA 2BSKA 4TOIA 4JZ2A 4AQYB 2CTRA 3K5NA 2GTAA 2CTWA 2LW1A 4BAYA 4EB6A 3BCCH 2QDOA 2EBOA 4UVCA 2MW2B 5EIBC 3AG4C 3AG7A 4QPJA 2AXTZ 4LP8A 1S5JA 3BPZA 5GTHZ 3OGCC 2JS3A 1K3EA 1BMFG 3BFRA 5L3FA 5LGTA 4O2AA 2XT9A 5ITZA 3CCVV 4Z1MG 2ZM6O 3I5DA 2Q67A 3ABMC 1JJOA 2DYRB 1Y74A 4PI0A 4D7TA 1WLEA 3S3WA 4DR4B 2IU0A 3WB0A 4JI7B 3C90A 4ZI7B 3FAVB 3CSXA 3KKYA 3R66A 3W7XA 1V54B 3R65A 5CB4A 4WCEV 1I94O 2ATKC 2CUGA 3SPHA 4NTYA 4W4LA 1KP2A 3ZMUA 1YJWV 2P67A 4DR3O 2FTKA 4ICGA 2CH7A 4I55A 5LYJA 5J2TB 2VQEO 2LQTA 1EBOA 2XAQA 4X65O 3LDDA 3J80N 1FXKC 3H01A 2ADQB 1FXKA 3F7YC 2P4VA 1DF4A 1FPOA 4J80A 4WF9V 1OHHG 3E22B 2WAMA 2FYUH 3JD2A 1QCEA 4JYAB 4RO2A 3ZMVA 2HJFC 4DK0A 2NN4A 1N32O 2UXBB 4GCZA 4DUZB 5KAFZ 4DW1A 1SETA 1QHTA 1XHXA 4FFBB 4AILC 2DYRC 3JAMN 2NNUA 1GH6A 4EFEA 3M7MX 2N05A 4KL1A 2QKSA 3ABLB 3JCUZ 4FFKA 5KHGA 1ZAUA 5D5QA 2VS0A 4PHZA 3UO2A 3OMIB 4O4HB 1JVMA 3ZHRA 2N04A 3UM7A 5CA3A 2ZDIA 1YEWA 4F6RA 4FK5C 2ZR3A 2ZD9A 5LHHA 5KUMA 1NH2D 1S76D 1MABG 1YTFD 1HNXB 5CMUA 1VP7A 1O9HA 1XQ8A 5JWPA 4YY3B 3THOA 3ZIAG 1R3KC 3FAVA 4JI3B 2RQ6A 1PD3A 3CHXA 2RDCA 4GX5A 1XNQB 1K7DA 1GN2A 1SQVH 2P6JA 3QF7A 3CRAA 2CE4A 4X1IB 2HLDG 1N33B 1Z5VA 1ZL8B 2AHYA 1JCHA 1UFIA 1M5IA 1PNKA 2DE0X 5HFMA 4WFFA 2IJKA 2Q0OC 4CC6A 3L74H 1N0JA 1QU7A 3OW2U 1NTMH 1Z2GA 2AHZA 3E8HA 1H38A 2WPDG 4DYLA 2ETNA 2Q69A 2EINC 4JTAB 4MS2A 5LHGA 4NTWA 5LP6B 1IURA 2JGDA 1E1RG 1Q6HA 1PP9H 4PA7A 3CRCA 1XNRB 1F23A 4PDRA 4GKJO 1DF5A 1AR5A 3A0HZ 4IL6Z 5JCOC 2JEUA 1PM9A 3E22A 4P30A 5FPOA 3RYCB 4UV8A 4MTFA 3HKBB 2F23A 5LL6Y 2ZXWB 1K97A 4JI1O 4DR5O 2DJVA 4R8CA 4ZKIA 4O4IB 2DWDC 1F4MA 1EN5A 1Z5WA 4H37A 3K08A 5C93A 5KA5A 4FLXA 1GM8A 1CPYA 1DGSA 5JCOA 1SQXH 3ZRWB 4B3TB 4MVZA 2JRIA 5IJ0B 4LF8O 1SKVA 4X9QA 4AQYO 1JFFA 3BA8A 3HKDB 3JATA 3G71V 2Q7EA 3ETQA 4J7ZA 2R9RB 3K59A 1MG1A 5CN0A 2UXDB 2Y69C 2ZDIC 5H9CA 1VQOV 4LF6O 5K1XA 3K57A 4I4TB 2PI5A 1ENVA 1RFYA 5JH7A 3RWRD 4NXNO 4X64B 3AG3B 4TT3G 4ZHQB 1YHQV 5KX5B 3B2EE 4LF5O 2ZR2A 3CCSV 1AI7A 2AW9A 4NXNB 1SC5B 4TV8B 3WG7B 2HEPA 2BCCH 1KECA 1NKDA 4NXMB 1VF5B 2PGGA 3MDSA 1F4NA 3K5MA 1OCRC 3VOUA 3F5TA 3SJCC 4WBNB 1I94B 1XMQB 4J10A 2ADPA 4Z1VA 2X6AA 4O4LB 1P4RA 2UXXA 4MW3A 4X1YA 2GUZB 1QR9A 3RYFA 5B3SC 1TVKA 4FJCC 4CS4A 4ZI7A 2YS8A 1MSWD 4ABMA 3W7WA 1K8AW 5IWAB 1ZTEA 1XI1A 2V4DA 1KMIZ 2Q6AA 5LXTB 2VQFO 1XUQA 2YEVB 5FLXN 4K0KO 1VIBA 5EC1C 1G8MA 4G28B 1E1QG 2BOBC 3WB2A 2ZM6B 1Q6UA 5B1OA 2GHYA 1LR1A 3WG7C 3OAAG 4R50A 3FKSG 1VQ4V 4B3TO 1VF6C 1W2BU 1RP3B 4BW9A 2YICA 5JH7B 1YXBA 2X0LA 2ZE8A 1YVWA 1SZTA 4DV0B 3JSLA 1BL8A 1HWYA 5BY1A 3A8TA 4DR2B 4LBEC 3TK1A 4N23A 1H2SB 4LF6B 1XILA 2OTJV 4B3MB 3BAAA 5LA6B 1B3QA 3JD3A 2HVJC 1R73A 2F4VO 1FD9A 5CBGA 1EZVH 4RWUA 3ZS8C 2ITDC 4PJ0Z 3AG3C 3ICXA 1XNRO 5BR8O 1RSOB 4H33A 4B3RB 1MSDA 2OCCB 1G1XB 2A7WA 3E83A 3VQVA 1NI8A 2RMKB 2QGNA 1L1FA 4CH4A 1VQKV 2ZE6A 2F4VB 2CK3G 3CP1A 4YJ3B 4X1YB 2YI8A 2A0LA 2QKCA 2WLIA 3CRRA 4P2ZA 4PDVA 4JZGA 4MSWC 4MVUA 2LW7A 3RYIA 4FLWA 1DTOA 5IYZB 4DR7B 4GZRB 4CH3A 3EFFK 4RQFA 2LGWA 3BRCA 4JI2B 4JAVA 4C7UA 3CC7V 4RUFA 2YSUB 4KUMA 3B4SA 4DV4O 4DR7O 1CXZB 5BMVB 1QLNA 1VQPV 1NVPD 1FYJA 4Z2WA 4DV7O 1YSCA 2EILB 1ZSPA 5F2VO 4RQEA 2P5OA 2WLJA 3TETA 2EIJB 4I9QA 3CE2A 2H3OA 3CRMA 2AZ0A 1AP5A 2VWJA 2ODMA 1R3JC 1R6NA 4E2LA 4ZBMA 1HP8A 2OT5A 3G67A 2YEVA 3DC6A 1GN4A 4JI3O 3ZX6A 2RJZA 1PNLA 3VBBA 2V1DA 3CCUV 3SYOA 1KBHA 5JVDB 2IM9A 4LF9O 4QJFB 3CJHA 3ZRSA 3CCQV 2ZKOA 4DRXB 1Q86W 1VQ6V 4LCUC 3BEHA 2OIEA 1JPXA 4Q6GA 1P84F 3FB8C 2QM4A 3AG4B 2DQ0A 2FMLA 4DV2B 3L75H 1XREA 4O2AB 2H94A 4PDLA 3E35A 3KCXA 3DGEA 2JDIG 4R6ZA 4PA6A 5IY5C 2WLHA 1HDJA 4PELA 1NZ6A 4G27B 1GM9A 1ZWIC 4IYIA 5IJ0A 4BIOA 2ILMA 2BTOA 2M7WA 1WJZA 1HR0B 1OCCC 1N8RW 3MD0A 4DXWA 4DUZO 2WLNA 5IWAO 4WFAV 2IU3A 2ZE5A 4WFGA 1Y74B 1K73W 2QKAA 3H1HH 4UVAA 4TV8A 1SQGA 1H2KA 3FB7C 1IBMO 3D3QA 2QJ1A 1FXKB 1AI6A 1X4TA 3ZEDA 3UT5A 1M9NA 2V7QG 3STZC 1TA8A 1NS1A 2DMXA 1R1BA 3OR6C 1URFA 4UCTA 4X66B 4DW0A 1EN6A 2Z3YA 3JAWB 3SGIA 1EM1A 3BY6A 1TAEA 3SPIA 3EXAA 4NTXA 3ZN1A 1EZJA 4LFBB 2O57A 3ETGA 1XL4A 1X59A 2CDYA 5KUKA 4GKKB 3QO5A 4MTXA 5IJ9A 2LJ2A 2WA4A 1H2LA 3D36A 2DYSB 4CH6A 4CZZA 1FAFA 3ZHTA 1S3JA 1GAXA 2E5LO 4HYOA 3G4SV 4LF4O 2PZSA 1JX9A 4J11A 1BQZA 3TXSA 3H9VA 2WSSG 2WLKA 1W59A 4QE9A 5LGNA 1FFXB 2FB5A 5E79Z 2QA4V 3W7TA 2QM8A 4B3RO 5BZBA 2EINB 5GONB 1S77D 3E89A 1GK9A 2W6IG 2YDEA 2FKXA 1DLBA 4LF7O 1U97A 4BR6A 3BVOA 4IYHA 4X66O 4DV2O 1YF2A 2ITCC 4ZIBA 2IH3C 4X1IA 2DN9A 3H1LH 2IJIA 5EK0A 3SPGA 1K5QA 4YXWG 5IYDO 3OE7G 4D6TH 4JV5O 3OGIB 3ASNC 1A32A 2UU9B 3GWKC 3OTOB 1UPGA 4PA9A 4MTOA 3LSQA 3LNNA 3A0RA 4I4TA 1XNQO 1Q81W 4QPKA 4P9OA 3U11A 4X89A 2Q7GA 1GN6A 4TQFA 2UUCB 2GSMB 4DR1B 1M56C 4YJ2B 3ML0A 4DR4O 1K34A 1N32B 3OUFA 2XAGA 3S3XA 1IBMB 1MZFA 3RT3C 4FM1A 5EZYA 4MVSA 4Q20A 3N2GB 4JI0B 1WPXA 4K8ZA 3P3PA 2LFRA 4DV0O 3PN1A 2G38A 3HKEB 3PJSK 1B6QA 3HKCB 4JI4O 3OUSA 3K0DA 4MVOA 2DOSA 4DV3O 4X65B 4I9WA 2Q4PA 5J2UB 1S5HC 4XDKA 4B3MO 1I5XA 5CBFA 3JSNA 3FB5C 2W6JG 5IT9N 1Q6IA 2QTOA 4J9ZB 4J9YB 2HR3A 3O65A 4KHPB 4DV3B 4DRXA 4N21A 3NXSA 5B1BB 5KA6A 2NLJC 1IXBA 1JJ2U 3N2KB 1KD1W 1FJGO 4U3FH 3VQYA 4MVRA 5BXZA 3CCEV 1R6KA 2BE3A 1WA8B 4FIPC 1M4UA 1XBLA 4HNAB 2F66C 4UCUA 2DWEC 2QWPB 4YHHO 4LNUA 1K92A 2GBOA 2UUAO 4X1KB 4H0LB 5CBHA 2CH7B 1JFFB 1NJIW 1W0JG 4HBNA 2L6LA 4I50B 2A9HA 2KG7A 1NTKH 5GW7A 1F7YA 5KX5A 4FZ1A 3F5WC 1IBLB 2UXDO 4JI6O 5AG2A 2KG7B 5FL7G 3J81N 3TXQA 1VEWA 1PL4A 4IGGA 1JQ0A 1WAZA 3P32A 4OXSA 1RPOA 5EZYB 1YJ9V 2Y4UA 1D5AA 3CYOA 1NH2B 1R6TA 3CCJV 1FXVA 1WB8A 2EIJC 4F6RB 4O4LA 5B1AC 4XDLA 2FL4A 4B7EA 4JAAA 2Q68A 1KU9A 5L3BA 3QNEA 5KAIZ 3EHBB 2ZNJA 2JJ1G 4TQDA 2E3CA 4QE7A 5EC2C 4X88A 3ASNB 4ZOLA 1THZA 2HHHO 4J42A 2E75B 2QWOB 3N2GA 3IC7A 1R3LC 4ZOLB 4J7JA 3UO3A 3JARB 3JAWA 2XAJA 2Q7HA 1V55C 2F93B 2QSAA 4PA3A 4GKJB 3LDCA 2CGOA 1EN4A 4I55B 1KKDA 2B1GA 2F95B 2OCHA 3OEEG 3RVYA 5CA0A 1L8DA 4X8AA 3ASOB 1JA8A 4UFZA 2C2AA 4QIWF 1OCRB 3CPWU 1PL0A 3HR0A 1M90W 1FKAO 4B7KA 4YY3O 3WU2Z 3SYAA 2UXNA 5H6RA 4AHCA 3BHPA 2F1MA 3ABUA 4TV9B 3N2KA 1YI2V 2D2CB 3ABLC 3FX7A 1HR0O 4FM0A 2YXYA 4FZ0A 3A0BZ 1O9GA 2K9PA 4KP4A 4JASA 1QVGU 4LFAB 5LXTA 4GX2A 3QO7A 1SQQH 2P90A 1Y76B 5FNVA 4R7CA 4GLXA 5DECA 2YC0A 4CC5A 4EEQA 1NQTA 2X6BA 4LWSB 3JATB 1R3IC 4TUYB 5LOVB 3U0ZA 5A2QN 1VMGA 1SF9A 4U3JA 1SQBH 2EZPA 4FPPA 1V55B 2Q8VA 1Y66A 1KYOF 1CP9A 1TUBB 4JI7O 1H8EG 2PTMA 5LA6A 1N36O 2VWKA 3AG2B 3IFXA 3H1IH 1NT2B 3JASB 3AK3A 1IBKB 1HNWB 3K04A 1AB3A 1PKXA 4DO2A 5EBWC 3AG2C 2ZXWC 4U7OA 3OMNB 1AR1B 4FVMA 2VQEB 4NB5A 5BR8B 4UUJC 4YIPA 1ZL8A 3QO8A 1Y67A 1FFTB 1G6UA 2ZIMA 5B1NA 4NXMO 2HKOA 3K9SA 1UJWB 1G4YB 1K33A 4JYYA 5HFLA 4WFBV 2P7TC 3HKDA 1XOUA 4JPRA 3CRQA 3E2EA 5J9PC 4DUYB 1XEQA 3UQ8A 1NR7A 3MAQA 2JEXA 3OEHG 4JTDB 3CMEV 2OWOA 2WLIB 3H1KH 2WA3A 4K3AA 2B5UA 3I56V 1KP3A 4YHHB 2OYQA 4K35A 3C3SA 4LF8B 3ZBHA 3K3WA 2X6CA 1KQSU 2Z5UA 4JV5B 2M6YA 3CXCU 5B3SB 3IJ4A 4O4JB 4TSFG 4TWKA 4GX0A 1JMKC 3SPJA 2YIDA 2YIAA 1M93A 2UU9O 4PA4A 1SZXA 3QTCA 1RM1C 1L0LH 4K0KB 1OV9A 2QM7A 4TV9A 1Q5OA 2EIMB 1MNGA 2KSDA 4JYAO 1VQ5V 3SJAC 5IE9A 1W0KG 4UCRA 3IC9A 3ZJZA 2EIMC 4DK1A 1QLEB 2ZCEA 4F4LA 2EILC 1BSMA 3T1HB 1P7GA 4JI8B 3ZRWA 2R9AA 3LSUA 5KMGB 2GV9A 5LBQA 1M1KW 4GUNA 3UCSC 2RCVA 3K58A 4FLZA 4JI4B 1ORQC 5L3CA 5JVDA 3CWBH 3IGAC 3ZHVA 4LC1A 3L73H 2IBZH 1GTOA 3ETEA 5H2FZ 4O2BA 3JD0A 2Y69B 2P22C 3AK1A 2E74B 1QQCA 2P4KA 1SA0A 4FM2A 5LOVA 2JGUA 4GX1A 1BE3H 3CCRV 2YIBA 2B9ZA 1RSOA 5IDJA 3ZHQA 4PDMA 4HAMA 4L8JA 1SA0B 4F6EA 4EB6B 1TUBA 3T4DA 1GO3F 3T1CA 4J41A 1FS0G 3K79A 4X64O 1HNZO 5B1BC 1ZUQA 2UXBO 4QGPA 1QNMA 1Y6XA 2IH1C 1QR8A 3CC4V 4JI5O 2UUAB 1I5YA 1VQLV 4PV1B 4JI1B 4DR5B 3H1JH 4QNHB 4UB6Z 1Q82W 2ARHA 3L71H 4JI5B 3RGBA 5BMVA 1VQMV 3B40A 3JAKA 4JI0O 3OD4A 3K5OA 1I08A 4A5UB 3D8CA 2YXHA 4UCOA 5IJ9B 3WB1A 3ZMSA 1BT8A 4IIJA 3APQA 4I7ZB 3CJHB 2D3OW 5ITZB 4ASUG 1XMOB 4UCVA 2EIKC 2E5LB 5EIBD 4DR3B 1IZ3A 2XOKG 4MT8A 2Q5ZA 1IXMA 1VQNV 4WFHA 4NVPA 2UUBO 4O4HA 2HFEC 1M57C 3L72H 3OR7C 3MHSC 4UCSA 1OCZC 5DN6G 3VQWA 1BZKA 4B08A 3P30A 5JJNB 2IW5A 5KMGA 2DYSC 4XBFA 1N34O 2Y4TA 4FLYA 4FMTA 1PNMA 3D36C 2AZ2A 1AP6A 2ZE7A 1RM1B
chains in the Genus database with same CATH topology
1YJNV 1JJ2U 2IJHA 2JJ2G 1M56B 3ZMTA 2X6AA 3MHHC 1KD1W 2HVKC 4MVRA 3X2QB 3CCEV 3LUTB 3K03A 3JCZA 1R6KA 1P4RA 2XASA 4FIPC 3WFVA 2UXXA 4MW3A 2F43G 1QR9A 3E8FA 1S0VA 2DWEC 4RAIA 1GKFA 5B3SC 2ZQMA 4FJCC 4G2KA 2LFSA 4UVBA 1K92A 3ZMZA 4EKWA 1GM7A 3ZN0A 1K5SA 1COWG 3ABMB 1MSWD 5CBHA 3W7WA 4P9PA 1K8AW 1NJIW 1W0JG 1BHAA 2A9HA 1NBMG 5GW7A 3LNMB 3CD6V 2Q6AA 3F5WC 2R9IA 2YEVB 1V54C 5FL7G 1TUEB 5EC1C 1G8MA 4G28B 1E1QG 2BOBC 2WLLB 3M99B 2K1EA 5B1OA 2GHYA 5IYCO 3WG7C 1JQ0A 3OAAG 3P32A 3T4ZA 4U7NA 3W7SA 4R50A 4OXSA 3RVZA 3FKSG 3CMAV 1RPOA 1VQ4V 1OZ0A 1YJ9V 4JTCB 3G6EV 1W2BU 1ROPA 3CYOA 1NR1A 1NH2B 3CCJV 3SYPA 1FXVA 4RUEA 3B8NA 3K9AA 1MOFA 2EIJC 2X0LA 3STLC 4BIZA 1SZTA 1NVPB 2MK3A 5B1AC 4XDLA 1H2GA 1BL8A 1AJNA 2Q68A 4JYBA 1HWYA 5L3BA 3QNEA 2X7RB 3EHBB 1P7BA 2JJ1G 4LBEC 1OCOC 2LP7A 3TK1A 4QE7A 2QEXV 4N23A 1YIJV 5EC2C 2OTJV 4L87A 4X88A 3ASNB 3ETDA 1THZA 3GWOA 3JD3A 4HZ3A 2HVJC 1R73A 2EZOA 3JYCA 3IC7A 1R3LC 3K0GA 4UV9A 5CBGA 2ITDC 1OCZB 3AG3C 4JAUA 4H33A 2XAJA 2OCCB 3E83A 1V55C 1BHBA 1L1FA 1VQKV 4PA3A 3CP1A 2CK3G 3LDCA 4PDVA 2A0LA 2WLIA 4P2ZA 1KKDA 2B1GA 3GB7C 4MSWC 4BAYA 3OEEG 3SPCA 3RVYA 2QE7G 4MVUA 4X8AA 3ASOB 1KC8W 2C2AA 4QIWF 1OCRB 3CPWU 1VQ7V 1PL0A 3E8BA 1M90W 1DTOA 2EBOA 4UVCA 1SRYA 3CCMV 3EFFK 4RQFA 3AG4C 3SYAA 2UXNA 5H6RA 4QPJA 3ABUA 5EBMC 4LP8A 4JAVA 1YI2V 2A79B 3CC7V 4RUFA 3ABLC 3OGCC 3TCUA 2YSUB 2WWWA 4KUMA 5B1AB 3T2MA 1K3EA 1BMFG 3ABTA 5L3FA 2DW4A 4KP4A 5LGTA 1QLNA 1VQPV 3FYEB 4JASA 1NVPD 5IY5B 1QVGU 4BW5A 3AG1C 3CCVV 4Z1MG 2Q67A 3ABMC 4GX2A 3QO7A 2DYRB 1YSCA 2EILB 2P90A 4RQEA 4BIUA 4R7CA 1WLEA 2WLJA 2IU0A 1NQTA 3TETA 2EIJB 2X6BA 1R3IC 1SERA 3W7XA 1R3JC 1V54B 3R65A 1R6NA 4E2LA 4FPPA 2EZPA 4WCEV 4ZBMA 1V55B 2EJRA 2OT5A 3OMAB 2YEVA 3RBZA 2ATKC 1Y66A 3SPHA 2DQ3A 1KP2A 3ZMUA 1CP9A 1YJWV 1H8EG 2P67A 3CC2V 2FTKA 1PNLA 3B8MA 3VBBA 2V1DA 3CCUV 1Q7YW 3AG2B 3SYOA 3IFXA 4JF3A 4QJFB 4MW8A 1EBOA 3ZRSA 3CCQV 3K04A 2XAQA 1Q86W 3LDDA 1PKXA 1FXKC 3H01A 4LCUC 3BEHA 3K06A 1VQ6V 4DO2A 1JPXA 5EBWC 3AG2C 2ZXWC 1FXKA 3FB8C 4U7OA 3F7YC 2OCCC 3OFNG 3OMNB 1DF4A 3AG4B 1AR1B 2XAHA 2DQ0A 4GT1A 1OHHG 4WF9V 2WAMA 5L3EA 3JD2A 1QCEA 4RO2A 3ZMVA 4UUJC 2W0FC 2HJFC 1AROP 3QO8A 1FFTB 2H94A 4PDLA 3E35A 5B1NA 3DGEA 2HKOA 4GCZA 1UJWB 1G4YB 1VQ8V 1K33A 2JDIG 4R6ZA 1SETA 5HFLA 2DYRC 1F51A 2P7TC 4WFBV 2NNUA 2OTLV 2KB1A 4PA6A 5IY5C 2WLHA 4JPRA 4PELA 3E2EA 5J9PC 4G27B 1GM9A 1ZWIC 1NR7A 3CMEV 2JEXA 3OEHG 4JTDB 2WLIB 1XL6A 1SESA 2B5UA 2QKSA 3ABLB 2M7WA 4MTGA 1OCCC 3I56V 1KP3A 1N8RW 3MD0A 3F7VC 3K3WA 4DXWA 2X6CA 1KQSU 2Z5UA 3CXCU 2WLNA 2HG5C 4WFAV 5B3SB 2IU3A 3OMIB 1JVMA 4TSFG 4WFGA 1K73W 4UVAA 3UM7A 5CA3A 2ZDIA 4TWKA 4FK5C 4GX0A 5EBLC 2ZR3A 3SPJA 3FB7C 1QVFU 2ZD9A 5LHHA 5KUMA 1NH2D 1FXKB 2Y48A 1AI6A 1E79G 1YTFB 1S76D 1MABG 1YTFD 3LDEA 5CMUA 4PA4A 2IJJA 5H6QA 1K9MW 1RM1C 3ZIAG 1R3KC 1M9NA 4CBCA 2QM7A 3SYCA 2V7QG 3STZC 5DM6V 1PD3A 2B1IA 2EIMB 4GX5A 3OR6C 1VQ5V 1K7DA 2Z3YA 1W0KG 2P6JA 1H8HG 3FB6C 3D3IA 3ZJZA 3BY6A 3SPIA 2EIMC 4I5SA 4XDJA 1QLEB 2HLDG 3ZN1A 4F4LA 1EZJA 3I55V 2EILC 3ETGA 1XL4A 3ZRWA 2WLMA 2XAFA 2AHYA 1AJQA 5KUKA 1JCHA 3QO5A 4MTXA 5E1AC 5LBQA 3D36A 2DYSB 4MVQA 4JGSA 4CZZA 1PNKA 1M1KW 2EIKB 1S3JA 5HFMA 4WFFA 4HYOA 3G4SV 1ORQC 2IJKA 5L3CA 3IGAC 1FXHA 1JX9A 3OW2U 1OCCB 2AHZA 3E8HA 3W7UA 5LGUA 4LC1A 1JOYA 1H38A 2WPDG 1GTOA 3ETEA 2H8PC 2WSSG 2Q69A 2EINC 2WLKA 4JTAB 4QE9A 4MS2A 2WLLA 1M57B 5LHGA 5LGNA 1K4CC 1LNQA 3JD0A 2Y69B 2QA4V 3ZCCA 3W7TA 3FYIB 1E1RG 2QM8A 5BZBA 2EINB 4PA7A 1F23A 4PDRA 3ABKB 4GX1A 3CCRV 3HB3B 1S77D 3E89A 1GK9A 2W6IG 5IDJA 1YITV 4PDMA 4HAMA 1DF5A 1DLBA 1Y4MA 1K4DC 2JEUA 2JIZG 3T4DA 1GO3F 3T1CA 1AI5A 4P30A 3ZRVA 2ITCC 1FS0G 2IH3C 3K79A 4UV8A 4MTFA 5B1BC 2IJIA 2ZXWB 5EK0A 3SPGA 1K97A 3SJQC 3DTUB 5L3GA 1K5QA 4YXWG 3HPLC 4KFMA 4R8CA 3OE7G 3JD1A 4JYCA 4ZKIA 2IH1C 3RW0A 5IYDO 3JD4A 2DWDC 1AJPA 1F4MA 3ASOC 3ASNC 1QR8A 3UKMA 3CC4V 2JK5C 4H37A 3K08A 5C93A 1I5YA 5KA5A 1VQLV 1GM8A 1CPYA 4PA9A 3AEIA 3B77A 2PI4A 4MTOA 3ZRWB 3LSQA 3ZRXA 4QNHB 3A0RA 4MVZA 1Q81W 3E8GA 1Q82W 4QPKA 4P9OA 3KG2A 1VQMV 4X89A 1J95A 2GSMB 3E86A 5IYBO 1M56C 5L3DA 1EFRG 3G71V 3AG1B 3ML0A 3X2QC 1K34A 2R9RB 3ZMSA 1MG1A 3OUFA 1GMGA 5CN0A 2Y69C 2ZDIC 3ABKC 2XAGA 5H9CA 2D3OW 4ASUG 1VQOV 1OCOB 3SYQA 2EIKC 2XOKG 4MVSA 4MT8A 4Q20A 2PI5A 1ENVA 1IXMA 1WPXA 4MVMA 1VQNV 1AI4A 2LFRA 4WFHA 1CEZA 2XNDG 2HFEC 1M57C 3OR7C 3PJSK 1B6QA 4WFEA 3MHSC 1OCZC 1QLEC 3AG3B 3OUSA 4TT3G 3LSSA 5DN6G 3K0DA 4MVOA 1S72V 4UXNA 1YHQV 3OM3B 4I9WA 3P30A 1S5HC 4XDKA 2ZR2A 3CCSV 1AI7A 2IW5A 1I5XA 5CBFA 2DYSC 4XBFA 3WG7B 3FB5C 2W6JG 1KECA 2QTOA 4J9ZB 4J9YB 1NKDA 2HR3A 4FMTA 1PNMA 2BOCC 1VQ9V 1F4NA 1OCRC 4N21A 5LHIA 3NXSA 5B1BB 1QBZA 3VOUA 5KA6A 3CCLV 1RM1B 2NLJC 1RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA6 A;  5IY5 C;  2WLH A;  1K4D C;  4PDV A;  2A0L A;  2WLI A;  4P2Z A;  2X6A A;  4G27 B;  5J9P C;  2HVK C;  3T4D A;  1KKD A;  3GB7 C;  4MVR A;  4MSW C;  3T1C A;  4P30 A;  3LUT B;  3K03 A;  1ZWI C;  3SPC A;  4JTD B;  2ITC C;  3RVY A;  2IH3 C;  2WLI B;  4MVU A;  4X8A A;  4MTF A;  4MW3 A;  1XL6 A;  5B1B C;  2QKS A;  5EK0 A;  3E8F A;  4MTG A;  2DWE C;  1OCC C;  3E8B A;  4RAI A;  3SJQ C;  3SPG A;  3F7V C;  3HPL C;  5B3S C;  4KFM A;  4R8C A;  2IH1 C;  3RW0 A;  4DXW A;  3EFF K;  3AG4 C;  2DWD C;  2X6C A;  3SYA A;  3ASO C;  3ASN C;  4EKW A;  3UKM A;  2WLN A;  5EBM C;  2HG5 C;  2JK5 C;  4LP8 A;  4H37 A;  5CBH A;  3K08 A;  2A79 B;  4P9P A;  1JVM A;  4WFG A;  4RUF A;  3ABL C;  3OGC C;  4PA9 A;  3TCU A;  3UM7 A;  4TWK A;  4MTO A;  4GX0 A;  5EBL C;  2A9H A;  3SPJ A;  3T2M A;  3FB7 C;  4QNH B;  2ZD9 A;  3LNM B;  2Q6A A;  5KUM A;  4MVZ A;  3F5W C;  3E8G A;  3LDE A;  4P9O A;  1V54 C;  3KG2 A;  4PA4 A;  4BW5 A;  3AG1 C;  4X89 A;  2Q67 A;  1R3K C;  1J95 A;  3ABM C;  4GX2 A;  5EC1 C;  4G28 B;  2BOB C;  4CBC A;  2WLL B;  2K1E A;  3SYC A;  4R7C A;  3E86 A;  3STZ C;  2WLJ A;  3WG7 C;  1M56 C;  3T4Z A;  4GX5 A;  3OR6 C;  3TET A;  2X6B A;  3X2Q C;  2R9R B;  4R50 A;  4OXS A;  1R3I C;  3RVZ A;  3OUF A;  2Y69 C;  3FB6 C;  3ABK C;  3ZJZ A;  4JTC B;  1R3J C;  3R65 A;  3SPI A;  2EIM C;  4ZBM A;  4XDJ A;  2YEV A;  3RBZ A;  2EIK C;  2EIL C;  3SYP A;  3SYQ A;  2ATK C;  4F4L A;  3SPH A;  4RUE A;  1XL4 A;  3STL C;  2WLM A;  2EIJ C;  4MVS A;  2AHY A;  5KUK A;  5B1A C;  4XDL A;  4MVM A;  5E1A C;  1BL8 A;  2Q68 A;  4WFH A;  3SYO A;  4MVQ A;  2HFE C;  1M57 C;  3IFX A;  3OR7 C;  3PJS K;  4WFE A;  1P7B A;  4MW8 A;  3ZRS A;  4LBE C;  1OCZ C;  1OCO C;  1QLE C;  3K04 A;  3OUS A;  4HYO A;  4QE7 A;  1ORQ C;  3K0D A;  3LDD A;  4MVO A;  4LCU C;  4WFF A;  3BEH A;  3K06 A;  3IGA C;  5EC2 C;  4I9W A;  2AHZ A;  3E8H A;  5EBW C;  3AG2 C;  2ZXW C;  3FB8 C;  4X88 A;  2OCC C;  3F7Y C;  2H8P C;  1S5H C;  2Q69 A;  2EIN C;  2HVJ C;  2WLK A;  4HZ3 A;  4JTA B;  4MS2 A;  4QE9 A;  2WLL A;  4XDK A;  5CBF A;  3JYC A;  2DYS C;  1R3L C;  1K4C C;  3K0G A;  1LNQ A;  3FB5 C;  5CBG A;  2ITD C;  4RO2 A;  2QTO A;  4UUJ C;  2W0F C;  4J9Z B;  4J9Y B;  2HJF C;  3AG3 C;  2BOC C;  5BZB A;  4PDL A;  4PA7 A;  4PDR A;  4H33 A;  4GX1 A;  1G4Y B;  1OCR C;  3E89 A;  4R6Z A;  3E83 A;  1V55 C;  3VOU A;  4PDM A;  2DYR C;  2P7T C;  2NLJ C;  4PA3 A;  2KB1 A;  3LDC A; 
#chains in the Genus database with same CATH topology
 1YJN V;  3BAB A;  2IJH A;  1M56 B;  2N74 A;  3MHH C;  2HVK C;  3LUT B;  3K03 A;  3WFV A;  3RFR A;  1S5L Z;  1N4C A;  4DV5 O;  4NKG B;  5KHI A;  1IBL O;  4RAI A;  1GKF A;  1SQF A;  4LFB O;  4G2K A;  3ZMZ A;  4LWS A;  1GM7 A;  3ZN0 A;  4EKW A;  1J5E B;  1TGO A;  2QWQ B;  1COW G;  3ABM B;  1GRJ A;  3FD9 A;  2UUB B;  1XHZ A;  1NBM G;  4D7S A;  3RN4 A;  2R9I A;  2R72 A;  1TUE B;  2LO1 A;  2Z0A A;  2WLL B;  1ZX3 A;  3M99 B;  5IYC O;  3T4Z A;  1N34 B;  4U7N A;  1IX9 A;  1WP8 A;  3W7S A;  3J7A U;  5LMU O;  3G80 A;  3CMA V;  1OZ0 A;  4JTC B;  1KKC A;  2EUL A;  3G6E V;  1YCI A;  3HKC A;  1ROP A;  4LR3 A;  1NR1 A;  3SYP A;  3K9A A;  1MOF A;  4BIZ A;  4OX9 O;  4X20 A;  5KHK A;  5JJE B;  1H2G A;  4O4J A;  4LFC B;  4GYC B;  2X7R B;  5KLV H;  1P7B A;  1MA1 A;  1NTZ H;  5B66 Z;  2LP7 A;  2QEX V;  1IBK O;  1YIJ V;  4I0X A;  5H5N A;  1YDX A;  1AIL A;  2NR5 A;  4HZ3 A;  5LP6 A;  1IDS A;  4B3S B;  1HW7 A;  3K0G A;  5J2U A;  2PYL A;  1OCZ B;  2QWN B;  5GTI Z;  2Q0A A;  4IIJ B;  4FLU A;  5EYP A;  1H2N A;  5GON A;  2UUC O;  4LF7 B;  3GB7 C;  4OPH A;  2CGN A;  3SPC A;  2QE7 G;  1I0H A;  2ZIO A;  1KC8 W;  1VQ7 V;  1I7F A;  1SQP H;  3E8B A;  3L9D A;  4FFB A;  1SRY A;  4HNA A;  1D5N A;  3CCM V;  1US6 A;  1KUQ A;  4TUY A;  5EBM C;  1P49 A;  1VF7 A;  2A79 B;  4X1K A;  2OIG A;  1DK1 A;  4O2B B;  3TCU A;  4IHJ B;  2WWW A;  5JQG B;  5B1A B;  2XHB A;  4E4E A;  2CTQ A;  4LH6 A;  3T2M A;  3SJB C;  4JI6 B;  3ABT A;  2DW4 A;  3FYE B;  5IY5 B;  2P06 A;  4BW5 A;  3AG1 C;  2QTS A;  4BIU A;  1NU1 H;  1WN7 A;  4B3S O;  4DV4 B;  1N0N A;  5K1P A;  4DR1 O;  2CAZ C;  2A3Q A;  1SER A;  4NR1 A;  5B5E Z;  5KHH A;  2UXC B;  3K5L A;  4FLT A;  2EJR A;  2GUZ A;  3OMA B;  3CB2 A;  3RBZ A;  3VQX A;  2DQ3 A;  3A2F A;  5CA0 B;  1D2D A;  1FJG B;  3CC2 V;  3B8M A;  1OJH A;  4YIO A;  1Q7Y W;  3B09 A;  1Q90 D;  5LMU B;  4ZHQ A;  4JF3 A;  2KQX A;  4MW8 A;  3U10 A;  4AI8 A;  4NYK A;  5JJJ B;  3T1H O;  3JAR A;  2PUS A;  3K06 A;  4YJ2 A;  2OCC C;  3OFN G;  4X20 B;  2XAH A;  4GT1 A;  5L3E A;  5KHJ A;  3ZHS A;  1WB7 A;  2W0F C;  1ARO P;  4LFC O;  1JR9 A;  4X62 B;  1T5E A;  4WBN A;  1VQ8 V;  1XMQ O;  2ZIN A;  1F51 A;  1YZB A;  3JAL A;  2OTL V;  2KB1 A;  5J2T A;  3HKE A;  2GDS A;  2JGD B;  4OPA A;  4DV1 B;  2HP8 A;  1XL6 A;  1SES A;  4MTG A;  2UXC O;  5TIS Z;  3F7V C;  4LF4 B;  1MZE A;  4EFB A;  2E76 B;  2HG5 C;  5D5P A;  3T1Y B;  5FNV B;  1Y76 A;  2LGQ A;  4PI2 A;  4H44 B;  2PYJ A;  3QVN A;  2Q9L A;  5EBL C;  3RYF B;  1QVF U;  2Y48 A;  1YTF B;  1E79 G;  3LDE A;  2IJJ A;  5H6Q A;  1K9M W;  1WA8 A;  4CBC A;  1ZLZ A;  3SYC A;  5DM6 V;  5DED A;  2B1I A;  2YI9 A;  4W4K A;  2PF4 E;  2Q73 A;  4YJ3 A;  3GVM A;  3FFQ A;  1H8H G;  3FB6 C;  3D3I A;  4I5S A;  4XDJ A;  3HKB A;  3I55 V;  4OX9 B;  4U3J B;  1Q8I A;  2PY5 A;  3G6B A;  2WLM A;  2XAF A;  1GN3 A;  4DV7 B;  1AJQ A;  5E1A C;  1WPB A;  1WP7 A;  4MVQ A;  4DV6 B;  4JGS A;  1HNW O;  4KHP O;  2EIK B;  1XMO O;  3Q4H A;  1FXH A;  1OCC B;  3RYH B;  3W7U A;  5LGU A;  1N33 O;  1JOY A;  2H8P C;  3T1Y O;  2WLL A;  1M57 B;  4DV6 O;  3KCY A;  1BQ0 A;  1K4C C;  1LNQ A;  3SR2 C;  3OT7 A;  3ZCC A;  3TGU H;  3FYI B;  1BS3 A;  3JAL B;  3CX5 F;  2RNB A;  2ZT9 B;  3ABK B;  2R70 A;  3HB3 B;  1YIT V;  1VF6 A;  1Y4M A;  1K4D C;  2KKW A;  2JIZ G;  1AI5 A;  3ZRV A;  3AK2 A;  4DR6 B;  4H13 B;  3OTO O;  5LMN O;  1TVK B;  1BCC H;  4DR2 O;  3SJQ C;  3DTU B;  5L3G A;  4X62 O;  3HPL C;  4KFM A;  1MMM A;  3JD1 A;  4JYC A;  3RW0 A;  3C3T A;  3JD4 A;  4I0X B;  1AJP A;  3ASO C;  1WNS A;  3UKM A;  2AGA A;  2JK5 C;  4DR6 O;  1LUW A;  2A06 H;  3DXR B;  5CA1 B;  1N36 B;  2YUA A;  3AEI A;  3B77 A;  2PI4 A;  4DV1 O;  3ZRX A;  4CS2 A;  3EVK A;  1HNZ B;  1HNX O;  3CS5 A;  1B06 A;  3E8G A;  1J5E O;  5CB4 B;  3KG2 A;  3RYC A;  1J95 A;  2JVD A;  3E86 A;  2EJ7 A;  5IYB O;  3SDL A;  5L3D A;  1EFR G;  3AG1 B;  3X2Q C;  4LNU B;  4UB8 Z;  1GMG A;  4K8X A;  3ABK C;  3JAS A;  1OCO B;  3SYQ A;  4LH7 A;  4LF5 B;  2HJD A;  1Q43 A;  5C8Y A;  1PPJ H;  2XUM A;  4MVM A;  1AI4 A;  4KXR A;  3N27 A;  1CEZ A;  2XND G;  5EYP B;  3RYH A;  4WFE A;  1QLE C;  1B04 A;  3LSS A;  1AVM A;  1S72 V;  3L70 H;  4UXN A;  3OM3 B;  4BWA A;  3APO A;  2W0X A;  4GKK O;  3CXH F;  2CTP A;  2BOC C;  1VQ9 V;  1IVS A;  5LHI A;  1QBZ A;  4IHJ A;  1BGY H;  5JQG A;  3CCL V;  3CEI A;  1RPR A;  2JJ2 G;  1L0N H;  3ZMT A;  3X2Q B;  3JCZ A;  4DUY O;  2XAS A;  5IYZ A;  4LF9 B;  2F43 G;  3E8F A;  1S0V A;  1H2M A;  3O9O A;  4LFA O;  4FLV A;  1VAR A;  2ZQM A;  3Q4H B;  3OTF A;  2YXL A;  3DC5 A;  2LFS A;  4UVB A;  2VRZ A;  1K5S A;  5LP6 C;  2HHH B;  1PV0 A;  4P9P A;  1BHA A;  2QWR B;  5LMN B;  3UT5 B;  2EX3 A;  3LNM B;  3IAY A;  3CD6 V;  3M8A A;  3DSQ A;  5A9G A;  4JI2 O;  1KB9 F;  1V54 C;  4CS3 A;  2K1E A;  3DXR A;  3JAK B;  3RVZ A;  3NR7 A;  4J7K A;  2VQF B;  3RYI B;  1XDC A;  3TJT A;  4RUE A;  3B8N A;  3STL C;  1V9P A;  1NVP B;  2MK3 A;  1Q3E A;  4JI8 O;  3BA9 A;  2XTA A;  1AJN A;  4IT5 A;  4JYB A;  1AR4 A;  5CA1 A;  2BTQ B;  3QG5 A;  2ZNI A;  1OCO C;  2YIB D;  4O4I A;  2L35 A;  4PD4 F;  2BTQ A;  2Y0P A;  3ZHU A;  5LYJ B;  3KZI Z;  4L87 A;  3ETD A;  3GWO A;  1FFX A;  5C8Y B;  2EZO A;  1SS3 A;  3JYC A;  4UV9 A;  2QR4 A;  1U96 A;  2RN9 A;  2JS5 A;  3P3N A;  2BSK B;  4JAU A;  5FPR A;  4OGQ B;  4DV5 B;  4CH5 A;  2Y0I A;  4I50 A;  2GTS A;  1BHB A;  1LUV A;  2BSK A;  4TOI A;  4JZ2 A;  4AQY B;  2CTR A;  3K5N A;  2GTA A;  2CTW A;  2LW1 A;  4BAY A;  4EB6 A;  3BCC H;  2QDO A;  2EBO A;  4UVC A;  2MW2 B;  5EIB C;  3AG4 C;  3AG7 A;  4QPJ A;  2AXT Z;  4LP8 A;  1S5J A;  3BPZ A;  5GTH Z;  3OGC C;  2JS3 A;  1K3E A;  1BMF G;  3BFR A;  5L3F A;  5LGT A;  4O2A A;  2XT9 A;  5ITZ A;  3CCV V;  4Z1M G;  2ZM6 O;  3I5D A;  2Q67 A;  3ABM C;  1JJO A;  2DYR B;  1Y74 A;  4PI0 A;  4D7T A;  1WLE A;  3S3W A;  4DR4 B;  2IU0 A;  3WB0 A;  4JI7 B;  3C90 A;  4ZI7 B;  3FAV B;  3CSX A;  3KKY A;  3R66 A;  3W7X A;  1V54 B;  3R65 A;  5CB4 A;  4WCE V;  1I94 O;  2ATK C;  2CUG A;  3SPH A;  4NTY A;  4W4L A;  1KP2 A;  3ZMU A;  1YJW V;  2P67 A;  4DR3 O;  2FTK A;  4ICG A;  2CH7 A;  4I55 A;  5LYJ A;  5J2T B;  2VQE O;  2LQT A;  1EBO A;  2XAQ A;  4X65 O;  3LDD A;  3J80 N;  1FXK C;  3H01 A;  2ADQ B;  1FXK A;  3F7Y C;  2P4V A;  1DF4 A;  1FPO A;  4J80 A;  4WF9 V;  1OHH G;  3E22 B;  2WAM A;  2FYU H;  3JD2 A;  1QCE A;  4JYA B;  4RO2 A;  3ZMV A;  2HJF C;  4DK0 A;  2NN4 A;  1N32 O;  2UXB B;  4GCZ A;  4DUZ B;  5KAF Z;  4DW1 A;  1SET A;  1QHT A;  1XHX A;  4FFB B;  4AIL C;  2DYR C;  3JAM N;  2NNU A;  1GH6 A;  4EFE A;  3M7M X;  2N05 A;  4KL1 A;  2QKS A;  3ABL B;  3JCU Z;  4FFK A;  5KHG A;  1ZAU A;  5D5Q A;  2VS0 A;  4PHZ A;  3UO2 A;  3OMI B;  4O4H B;  1JVM A;  3ZHR A;  2N04 A;  3UM7 A;  5CA3 A;  2ZDI A;  1YEW A;  4F6R A;  4FK5 C;  2ZR3 A;  2ZD9 A;  5LHH A;  5KUM A;  1NH2 D;  1S76 D;  1MAB G;  1YTF D;  1HNX B;  5CMU A;  1VP7 A;  1O9H A;  1XQ8 A;  5JWP A;  4YY3 B;  3THO A;  3ZIA G;  1R3K C;  3FAV A;  4JI3 B;  2RQ6 A;  1PD3 A;  3CHX A;  2RDC A;  4GX5 A;  1XNQ B;  1K7D A;  1GN2 A;  1SQV H;  2P6J A;  3QF7 A;  3CRA A;  2CE4 A;  4X1I B;  2HLD G;  1N33 B;  1Z5V A;  1ZL8 B;  2AHY A;  1JCH A;  1UFI A;  1M5I A;  1PNK A;  2DE0 X;  5HFM A;  4WFF A;  2IJK A;  2Q0O C;  4CC6 A;  3L74 H;  1N0J A;  1QU7 A;  3OW2 U;  1NTM H;  1Z2G A;  2AHZ A;  3E8H A;  1H38 A;  2WPD G;  4DYL A;  2ETN A;  2Q69 A;  2EIN C;  4JTA B;  4MS2 A;  5LHG A;  4NTW A;  5LP6 B;  1IUR A;  2JGD A;  1E1R G;  1Q6H A;  1PP9 H;  4PA7 A;  3CRC A;  1XNR B;  1F23 A;  4PDR A;  4GKJ O;  1DF5 A;  1AR5 A;  3A0H Z;  4IL6 Z;  5JCO C;  2JEU A;  1PM9 A;  3E22 A;  4P30 A;  5FPO A;  3RYC B;  4UV8 A;  4MTF A;  3HKB B;  2F23 A;  5LL6 Y;  2ZXW B;  1K97 A;  4JI1 O;  4DR5 O;  2DJV A;  4R8C A;  4ZKI A;  4O4I B;  2DWD C;  1F4M A;  1EN5 A;  1Z5W A;  4H37 A;  3K08 A;  5C93 A;  5KA5 A;  4FLX A;  1GM8 A;  1CPY A;  1DGS A;  5JCO A;  1SQX H;  3ZRW B;  4B3T B;  4MVZ A;  2JRI A;  5IJ0 B;  4LF8 O;  1SKV A;  4X9Q A;  4AQY O;  1JFF A;  3BA8 A;  3HKD B;  3JAT A;  3G71 V;  2Q7E A;  3ETQ A;  4J7Z A;  2R9R B;  3K59 A;  1MG1 A;  5CN0 A;  2UXD B;  2Y69 C;  2ZDI C;  5H9C A;  1VQO V;  4LF6 O;  5K1X A;  3K57 A;  4I4T B;  2PI5 A;  1ENV A;  1RFY A;  5JH7 A;  3RWR D;  4NXN O;  4X64 B;  3AG3 B;  4TT3 G;  4ZHQ B;  1YHQ V;  5KX5 B;  3B2E E;  4LF5 O;  2ZR2 A;  3CCS V;  1AI7 A;  2AW9 A;  4NXN B;  1SC5 B;  4TV8 B;  3WG7 B;  2HEP A;  2BCC H;  1KEC A;  1NKD A;  4NXM B;  1VF5 B;  2PGG A;  3MDS A;  1F4N A;  3K5M A;  1OCR C;  3VOU A;  3F5T A;  3SJC C;  4WBN B;  1I94 B;  1XMQ B;  4J10 A;  2ADP A;  4Z1V A;  2X6A A;  4O4L B;  1P4R A;  2UXX A;  4MW3 A;  4X1Y A;  2GUZ B;  1QR9 A;  3RYF A;  5B3S C;  1TVK A;  4FJC C;  4CS4 A;  4ZI7 A;  2YS8 A;  1MSW D;  4ABM A;  3W7W A;  1K8A W;  5IWA B;  1ZTE A;  1XI1 A;  2V4D A;  1KMI Z;  2Q6A A;  5LXT B;  2VQF O;  1XUQ A;  2YEV B;  5FLX N;  4K0K O;  1VIB A;  5EC1 C;  1G8M A;  4G28 B;  1E1Q G;  2BOB C;  3WB2 A;  2ZM6 B;  1Q6U A;  5B1O A;  2GHY A;  1LR1 A;  3WG7 C;  3OAA G;  4R50 A;  3FKS G;  1VQ4 V;  4B3T O;  1VF6 C;  1W2B U;  1RP3 B;  4BW9 A;  2YIC A;  5JH7 B;  1YXB A;  2X0L A;  2ZE8 A;  1YVW A;  1SZT A;  4DV0 B;  3JSL A;  1BL8 A;  1HWY A;  5BY1 A;  3A8T A;  4DR2 B;  4LBE C;  3TK1 A;  4N23 A;  1H2S B;  4LF6 B;  1XIL A;  2OTJ V;  4B3M B;  3BAA A;  5LA6 B;  1B3Q A;  3JD3 A;  2HVJ C;  1R73 A;  2F4V O;  1FD9 A;  5CBG A;  1EZV H;  4RWU A;  3ZS8 C;  2ITD C;  4PJ0 Z;  3AG3 C;  3ICX A;  1XNR O;  5BR8 O;  1RSO B;  4H33 A;  4B3R B;  1MSD A;  2OCC B;  1G1X B;  2A7W A;  3E83 A;  3VQV A;  1NI8 A;  2RMK B;  2QGN A;  1L1F A;  4CH4 A;  1VQK V;  2ZE6 A;  2F4V B;  2CK3 G;  3CP1 A;  4YJ3 B;  4X1Y B;  2YI8 A;  2A0L A;  2QKC A;  2WLI A;  3CRR A;  4P2Z A;  4PDV A;  4JZG A;  4MSW C;  4MVU A;  2LW7 A;  3RYI A;  4FLW A;  1DTO A;  5IYZ B;  4DR7 B;  4GZR B;  4CH3 A;  3EFF K;  4RQF A;  2LGW A;  3BRC A;  4JI2 B;  4JAV A;  4C7U A;  3CC7 V;  4RUF A;  2YSU B;  4KUM A;  3B4S A;  4DV4 O;  4DR7 O;  1CXZ B;  5BMV B;  1QLN A;  1VQP V;  1NVP D;  1FYJ A;  4Z2W A;  4DV7 O;  1YSC A;  2EIL B;  1ZSP A;  5F2V O;  4RQE A;  2P5O A;  2WLJ A;  3TET A;  2EIJ B;  4I9Q A;  3CE2 A;  2H3O A;  3CRM A;  2AZ0 A;  1AP5 A;  2VWJ A;  2ODM A;  1R3J C;  1R6N A;  4E2L A;  4ZBM A;  1HP8 A;  2OT5 A;  3G67 A;  2YEV A;  3DC6 A;  1GN4 A;  4JI3 O;  3ZX6 A;  2RJZ A;  1PNL A;  3VBB A;  2V1D A;  3CCU V;  3SYO A;  1KBH A;  5JVD B;  2IM9 A;  4LF9 O;  4QJF B;  3CJH A;  3ZRS A;  3CCQ V;  2ZKO A;  4DRX B;  1Q86 W;  1VQ6 V;  4LCU C;  3BEH A;  2OIE A;  1JPX A;  4Q6G A;  1P84 F;  3FB8 C;  2QM4 A;  3AG4 B;  2DQ0 A;  2FML A;  4DV2 B;  3L75 H;  1XRE A;  4O2A B;  2H94 A;  4PDL A;  3E35 A;  3KCX A;  3DGE A;  2JDI G;  4R6Z A;  4PA6 A;  5IY5 C;  2WLH A;  1HDJ A;  4PEL A;  1NZ6 A;  4G27 B;  1GM9 A;  1ZWI C;  4IYI A;  5IJ0 A;  4BIO A;  2ILM A;  2BTO A;  2M7W A;  1WJZ A;  1HR0 B;  1OCC C;  1N8R W;  3MD0 A;  4DXW A;  4DUZ O;  2WLN A;  5IWA O;  4WFA V;  2IU3 A;  2ZE5 A;  4WFG A;  1Y74 B;  1K73 W;  2QKA A;  3H1H H;  4UVA A;  4TV8 A;  1SQG A;  1H2K A;  3FB7 C;  1IBM O;  3D3Q A;  2QJ1 A;  1FXK B;  1AI6 A;  1X4T A;  3ZED A;  3UT5 A;  1M9N A;  2V7Q G;  3STZ C;  1TA8 A;  1NS1 A;  2DMX A;  1R1B A;  3OR6 C;  1URF A;  4UCT A;  4X66 B;  4DW0 A;  1EN6 A;  2Z3Y A;  3JAW B;  3SGI A;  1EM1 A;  3BY6 A;  1TAE A;  3SPI A;  3EXA A;  4NTX A;  3ZN1 A;  1EZJ A;  4LFB B;  2O57 A;  3ETG A;  1XL4 A;  1X59 A;  2CDY A;  5KUK A;  4GKK B;  3QO5 A;  4MTX A;  5IJ9 A;  2LJ2 A;  2WA4 A;  1H2L A;  3D36 A;  2DYS B;  4CH6 A;  4CZZ A;  1FAF A;  3ZHT A;  1S3J A;  1GAX A;  2E5L O;  4HYO A;  3G4S V;  4LF4 O;  2PZS A;  1JX9 A;  4J11 A;  1BQZ A;  3TXS A;  3H9V A;  2WSS G;  2WLK A;  1W59 A;  4QE9 A;  5LGN A;  1FFX B;  2FB5 A;  5E79 Z;  2QA4 V;  3W7T A;  2QM8 A;  4B3R O;  5BZB A;  2EIN B;  5GON B;  1S77 D;  3E89 A;  1GK9 A;  2W6I G;  2YDE A;  2FKX A;  1DLB A;  4LF7 O;  1U97 A;  4BR6 A;  3BVO A;  4IYH A;  4X66 O;  4DV2 O;  1YF2 A;  2ITC C;  4ZIB A;  2IH3 C;  4X1I A;  2DN9 A;  3H1L H;  2IJI A;  5EK0 A;  3SPG A;  1K5Q A;  4YXW G;  5IYD O;  3OE7 G;  4D6T H;  4JV5 O;  3OGI B;  3ASN C;  1A32 A;  2UU9 B;  3GWK C;  3OTO B;  1UPG A;  4PA9 A;  4MTO A;  3LSQ A;  3LNN A;  3A0R A;  4I4T A;  1XNQ O;  1Q81 W;  4QPK A;  4P9O A;  3U11 A;  4X89 A;  2Q7G A;  1GN6 A;  4TQF A;  2UUC B;  2GSM B;  4DR1 B;  1M56 C;  4YJ2 B;  3ML0 A;  4DR4 O;  1K34 A;  1N32 B;  3OUF A;  2XAG A;  3S3X A;  1IBM B;  1MZF A;  3RT3 C;  4FM1 A;  5EZY A;  4MVS A;  4Q20 A;  3N2G B;  4JI0 B;  1WPX A;  4K8Z A;  3P3P A;  2LFR A;  4DV0 O;  3PN1 A;  2G38 A;  3HKE B;  3PJS K;  1B6Q A;  3HKC B;  4JI4 O;  3OUS A;  3K0D A;  4MVO A;  2DOS A;  4DV3 O;  4X65 B;  4I9W A;  2Q4P A;  5J2U B;  1S5H C;  4XDK A;  4B3M O;  1I5X A;  5CBF A;  3JSN A;  3FB5 C;  2W6J G;  5IT9 N;  1Q6I A;  2QTO A;  4J9Z B;  4J9Y B;  2HR3 A;  3O65 A;  4KHP B;  4DV3 B;  4DRX A;  4N21 A;  3NXS A;  5B1B B;  5KA6 A;  2NLJ C;  1IXB A;  1JJ2 U;  3N2K B;  1KD1 W;  1FJG O;  4U3F H;  3VQY A;  4MVR A;  5BXZ A;  3CCE V;  1R6K A;  2BE3 A;  1WA8 B;  4FIP C;  1M4U A;  1XBL A;  4HNA B;  2F66 C;  4UCU A;  2DWE C;  2QWP B;  4YHH O;  4LNU A;  1K92 A;  2GBO A;  2UUA O;  4X1K B;  4H0L B;  5CBH A;  2CH7 B;  1JFF B;  1NJI W;  1W0J G;  4HBN A;  2L6L A;  4I50 B;  2A9H A;  2KG7 A;  1NTK H;  5GW7 A;  1F7Y A;  5KX5 A;  4FZ1 A;  3F5W C;  1IBL B;  2UXD O;  4JI6 O;  5AG2 A;  2KG7 B;  5FL7 G;  3J81 N;  3TXQ A;  1VEW A;  1PL4 A;  4IGG A;  1JQ0 A;  1WAZ A;  3P32 A;  4OXS A;  1RPO A;  5EZY B;  1YJ9 V;  2Y4U A;  1D5A A;  3CYO A;  1NH2 B;  1R6T A;  3CCJ V;  1FXV A;  1WB8 A;  2EIJ C;  4F6R B;  4O4L A;  5B1A C;  4XDL A;  2FL4 A;  4B7E A;  4JAA A;  2Q68 A;  1KU9 A;  5L3B A;  3QNE A;  5KAI Z;  3EHB B;  2ZNJ A;  2JJ1 G;  4TQD A;  2E3C A;  4QE7 A;  5EC2 C;  4X88 A;  3ASN B;  4ZOL A;  1THZ A;  2HHH O;  4J42 A;  2E75 B;  2QWO B;  3N2G A;  3IC7 A;  1R3L C;  4ZOL B;  4J7J A;  3UO3 A;  3JAR B;  3JAW A;  2XAJ A;  2Q7H A;  1V55 C;  2F93 B;  2QSA A;  4PA3 A;  4GKJ B;  3LDC A;  2CGO A;  1EN4 A;  4I55 B;  1KKD A;  2B1G A;  2F95 B;  2OCH A;  3OEE G;  3RVY A;  5CA0 A;  1L8D A;  4X8A A;  3ASO B;  1JA8 A;  4UFZ A;  2C2A A;  4QIW F;  1OCR B;  3CPW U;  1PL0 A;  3HR0 A;  1M90 W;  1FKA O;  4B7K A;  4YY3 O;  3WU2 Z;  3SYA A;  2UXN A;  5H6R A;  4AHC A;  3BHP A;  2F1M A;  3ABU A;  4TV9 B;  3N2K A;  1YI2 V;  2D2C B;  3ABL C;  3FX7 A;  1HR0 O;  4FM0 A;  2YXY A;  4FZ0 A;  3A0B Z;  1O9G A;  2K9P A;  4KP4 A;  4JAS A;  1QVG U;  4LFA B;  5LXT A;  4GX2 A;  3QO7 A;  1SQQ H;  2P90 A;  1Y76 B;  5FNV A;  4R7C A;  4GLX A;  5DEC A;  2YC0 A;  4CC5 A;  4EEQ A;  1NQT A;  2X6B A;  4LWS B;  3JAT B;  1R3I C;  4TUY B;  5LOV B;  3U0Z A;  5A2Q N;  1VMG A;  1SF9 A;  4U3J A;  1SQB H;  2EZP A;  4FPP A;  1V55 B;  2Q8V A;  1Y66 A;  1KYO F;  1CP9 A;  1TUB B;  4JI7 O;  1H8E G;  2PTM A;  5LA6 A;  1N36 O;  2VWK A;  3AG2 B;  3IFX A;  3H1I H;  1NT2 B;  3JAS B;  3AK3 A;  1IBK B;  1HNW B;  3K04 A;  1AB3 A;  1PKX A;  4DO2 A;  5EBW C;  3AG2 C;  2ZXW C;  4U7O A;  3OMN B;  1AR1 B;  4FVM A;  2VQE B;  4NB5 A;  5BR8 B;  4UUJ C;  4YIP A;  1ZL8 A;  3QO8 A;  1Y67 A;  1FFT B;  1G6U A;  2ZIM A;  5B1N A;  4NXM O;  2HKO A;  3K9S A;  1UJW B;  1G4Y B;  1K33 A;  4JYY A;  5HFL A;  4WFB V;  2P7T C;  3HKD A;  1XOU A;  4JPR A;  3CRQ A;  3E2E A;  5J9P C;  4DUY B;  1XEQ A;  3UQ8 A;  1NR7 A;  3MAQ A;  2JEX A;  3OEH G;  4JTD B;  3CME V;  2OWO A;  2WLI B;  3H1K H;  2WA3 A;  4K3A A;  2B5U A;  3I56 V;  1KP3 A;  4YHH B;  2OYQ A;  4K35 A;  3C3S A;  4LF8 B;  3ZBH A;  3K3W A;  2X6C A;  1KQS U;  2Z5U A;  4JV5 B;  2M6Y A;  3CXC U;  5B3S B;  3IJ4 A;  4O4J B;  4TSF G;  4TWK A;  4GX0 A;  1JMK C;  3SPJ A;  2YID A;  2YIA A;  1M93 A;  2UU9 O;  4PA4 A;  1SZX A;  3QTC A;  1RM1 C;  1L0L H;  4K0K B;  1OV9 A;  2QM7 A;  4TV9 A;  1Q5O A;  2EIM B;  1MNG A;  2KSD A;  4JYA O;  1VQ5 V;  3SJA C;  5IE9 A;  1W0K G;  4UCR A;  3IC9 A;  3ZJZ A;  2EIM C;  4DK1 A;  1QLE B;  2ZCE A;  4F4L A;  2EIL C;  1BSM A;  3T1H B;  1P7G A;  4JI8 B;  3ZRW A;  2R9A A;  3LSU A;  5KMG B;  2GV9 A;  5LBQ A;  1M1K W;  4GUN A;  3UCS C;  2RCV A;  3K58 A;  4FLZ A;  4JI4 B;  1ORQ C;  5L3C A;  5JVD A;  3CWB H;  3IGA C;  3ZHV A;  4LC1 A;  3L73 H;  2IBZ H;  1GTO A;  3ETE A;  5H2F Z;  4O2B A;  3JD0 A;  2Y69 B;  2P22 C;  3AK1 A;  2E74 B;  1QQC A;  2P4K A;  1SA0 A;  4FM2 A;  5LOV A;  2JGU A;  4GX1 A;  1BE3 H;  3CCR V;  2YIB A;  2B9Z A;  1RSO A;  5IDJ A;  3ZHQ A;  4PDM A;  4HAM A;  4L8J A;  1SA0 B;  4F6E A;  4EB6 B;  1TUB A;  3T4D A;  1GO3 F;  3T1C A;  4J41 A;  1FS0 G;  3K79 A;  4X64 O;  1HNZ O;  5B1B C;  1ZUQ A;  2UXB O;  4QGP A;  1QNM A;  1Y6X A;  2IH1 C;  1QR8 A;  3CC4 V;  4JI5 O;  2UUA B;  1I5Y A;  1VQL V;  4PV1 B;  4JI1 B;  4DR5 B;  3H1J H;  4QNH B;  4UB6 Z;  1Q82 W;  2ARH A;  3L71 H;  4JI5 B;  3RGB A;  5BMV A;  1VQM V;  3B40 A;  3JAK A;  4JI0 O;  3OD4 A;  3K5O A;  1I08 A;  4A5U B;  3D8C A;  2YXH A;  4UCO A;  5IJ9 B;  3WB1 A;  3ZMS A;  1BT8 A;  4IIJ A;  3APQ A;  4I7Z B;  3CJH B;  2D3O W;  5ITZ B;  4ASU G;  1XMO B;  4UCV A;  2EIK C;  2E5L B;  5EIB D;  4DR3 B;  1IZ3 A;  2XOK G;  4MT8 A;  2Q5Z A;  1IXM A;  1VQN V;  4WFH A;  4NVP A;  2UUB O;  4O4H A;  2HFE C;  1M57 C;  3L72 H;  3OR7 C;  3MHS C;  4UCS A;  1OCZ C;  5DN6 G;  3VQW A;  1BZK A;  4B08 A;  3P30 A;  5JJN B;  2IW5 A;  5KMG A;  2DYS C;  4XBF A;  1N34 O;  2Y4T A;  4FLY A;  4FMT A;  1PNM A;  3D36 C;  2AZ2 A;  1AP6 A;  2ZE7 A;  1RM1 B; 
#chains in the Genus database with same CATH homology
 1YJN V;  1JJ2 U;  2IJH A;  2JJ2 G;  1M56 B;  3ZMT A;  2X6A A;  3MHH C;  1KD1 W;  2HVK C;  4MVR A;  3X2Q B;  3CCE V;  3LUT B;  3K03 A;  3JCZ A;  1R6K A;  1P4R A;  2XAS A;  4FIP C;  3WFV A;  2UXX A;  4MW3 A;  2F43 G;  1QR9 A;  3E8F A;  1S0V A;  2DWE C;  4RAI A;  1GKF A;  5B3S C;  2ZQM A;  4FJC C;  4G2K A;  2LFS A;  4UVB A;  1K92 A;  3ZMZ A;  4EKW A;  1GM7 A;  3ZN0 A;  1K5S A;  1COW G;  3ABM B;  1MSW D;  5CBH A;  3W7W A;  4P9P A;  1K8A W;  1NJI W;  1W0J G;  1BHA A;  2A9H A;  1NBM G;  5GW7 A;  3LNM B;  3CD6 V;  2Q6A A;  3F5W C;  2R9I A;  2YEV B;  1V54 C;  5FL7 G;  1TUE B;  5EC1 C;  1G8M A;  4G28 B;  1E1Q G;  2BOB C;  2WLL B;  3M99 B;  2K1E A;  5B1O A;  2GHY A;  5IYC O;  3WG7 C;  1JQ0 A;  3OAA G;  3P32 A;  3T4Z A;  4U7N A;  3W7S A;  4R50 A;  4OXS A;  3RVZ A;  3FKS G;  3CMA V;  1RPO A;  1VQ4 V;  1OZ0 A;  1YJ9 V;  4JTC B;  3G6E V;  1W2B U;  1ROP A;  3CYO A;  1NR1 A;  1NH2 B;  3CCJ V;  3SYP A;  1FXV A;  4RUE A;  3B8N A;  3K9A A;  1MOF A;  2EIJ C;  2X0L A;  3STL C;  4BIZ A;  1SZT A;  1NVP B;  2MK3 A;  5B1A C;  4XDL A;  1H2G A;  1BL8 A;  1AJN A;  2Q68 A;  4JYB A;  1HWY A;  5L3B A;  3QNE A;  2X7R B;  3EHB B;  1P7B A;  2JJ1 G;  4LBE C;  1OCO C;  2LP7 A;  3TK1 A;  4QE7 A;  2QEX V;  4N23 A;  1YIJ V;  5EC2 C;  2OTJ V;  4L87 A;  4X88 A;  3ASN B;  3ETD A;  1THZ A;  3GWO A;  3JD3 A;  4HZ3 A;  2HVJ C;  1R73 A;  2EZO A;  3JYC A;  3IC7 A;  1R3L C;  3K0G A;  4UV9 A;  5CBG A;  2ITD C;  1OCZ B;  3AG3 C;  4JAU A;  4H33 A;  2XAJ A;  2OCC B;  3E83 A;  1V55 C;  1BHB A;  1L1F A;  1VQK V;  4PA3 A;  3CP1 A;  2CK3 G;  3LDC A;  4PDV A;  2A0L A;  2WLI A;  4P2Z A;  1KKD A;  2B1G A;  3GB7 C;  4MSW C;  4BAY A;  3OEE G;  3SPC A;  3RVY A;  2QE7 G;  4MVU A;  4X8A A;  3ASO B;  1KC8 W;  2C2A A;  4QIW F;  1OCR B;  3CPW U;  1VQ7 V;  1PL0 A;  3E8B A;  1M90 W;  1DTO A;  2EBO A;  4UVC A;  1SRY A;  3CCM V;  3EFF K;  4RQF A;  3AG4 C;  3SYA A;  2UXN A;  5H6R A;  4QPJ A;  3ABU A;  5EBM C;  4LP8 A;  4JAV A;  1YI2 V;  2A79 B;  3CC7 V;  4RUF A;  3ABL C;  3OGC C;  3TCU A;  2YSU B;  2WWW A;  4KUM A;  5B1A B;  3T2M A;  1K3E A;  1BMF G;  3ABT A;  5L3F A;  2DW4 A;  4KP4 A;  5LGT A;  1QLN A;  1VQP V;  3FYE B;  4JAS A;  1NVP D;  5IY5 B;  1QVG U;  4BW5 A;  3AG1 C;  3CCV V;  4Z1M G;  2Q67 A;  3ABM C;  4GX2 A;  3QO7 A;  2DYR B;  1YSC A;  2EIL B;  2P90 A;  4RQE A;  4BIU A;  4R7C A;  1WLE A;  2WLJ A;  2IU0 A;  1NQT A;  3TET A;  2EIJ B;  2X6B A;  1R3I C;  1SER A;  3W7X A;  1R3J C;  1V54 B;  3R65 A;  1R6N A;  4E2L A;  4FPP A;  2EZP A;  4WCE V;  4ZBM A;  1V55 B;  2EJR A;  2OT5 A;  3OMA B;  2YEV A;  3RBZ A;  2ATK C;  1Y66 A;  3SPH A;  2DQ3 A;  1KP2 A;  3ZMU A;  1CP9 A;  1YJW V;  1H8E G;  2P67 A;  3CC2 V;  2FTK A;  1PNL A;  3B8M A;  3VBB A;  2V1D A;  3CCU V;  1Q7Y W;  3AG2 B;  3SYO A;  3IFX A;  4JF3 A;  4QJF B;  4MW8 A;  1EBO A;  3ZRS A;  3CCQ V;  3K04 A;  2XAQ A;  1Q86 W;  3LDD A;  1PKX A;  1FXK C;  3H01 A;  4LCU C;  3BEH A;  3K06 A;  1VQ6 V;  4DO2 A;  1JPX A;  5EBW C;  3AG2 C;  2ZXW C;  1FXK A;  3FB8 C;  4U7O A;  3F7Y C;  2OCC C;  3OFN G;  3OMN B;  1DF4 A;  3AG4 B;  1AR1 B;  2XAH A;  2DQ0 A;  4GT1 A;  1OHH G;  4WF9 V;  2WAM A;  5L3E A;  3JD2 A;  1QCE A;  4RO2 A;  3ZMV A;  4UUJ C;  2W0F C;  2HJF C;  1ARO P;  3QO8 A;  1FFT B;  2H94 A;  4PDL A;  3E35 A;  5B1N A;  3DGE A;  2HKO A;  4GCZ A;  1UJW B;  1G4Y B;  1VQ8 V;  1K33 A;  2JDI G;  4R6Z A;  1SET A;  5HFL A;  2DYR C;  1F51 A;  2P7T C;  4WFB V;  2NNU A;  2OTL V;  2KB1 A;  4PA6 A;  5IY5 C;  2WLH A;  4JPR A;  4PEL A;  3E2E A;  5J9P C;  4G27 B;  1GM9 A;  1ZWI C;  1NR7 A;  3CME V;  2JEX A;  3OEH G;  4JTD B;  2WLI B;  1XL6 A;  1SES A;  2B5U A;  2QKS A;  3ABL B;  2M7W A;  4MTG A;  1OCC C;  3I56 V;  1KP3 A;  1N8R W;  3MD0 A;  3F7V C;  3K3W A;  4DXW A;  2X6C A;  1KQS U;  2Z5U A;  3CXC U;  2WLN A;  2HG5 C;  4WFA V;  5B3S B;  2IU3 A;  3OMI B;  1JVM A;  4TSF G;  4WFG A;  1K73 W;  4UVA A;  3UM7 A;  5CA3 A;  2ZDI A;  4TWK A;  4FK5 C;  4GX0 A;  5EBL C;  2ZR3 A;  3SPJ A;  3FB7 C;  1QVF U;  2ZD9 A;  5LHH A;  5KUM A;  1NH2 D;  1FXK B;  2Y48 A;  1AI6 A;  1E79 G;  1YTF B;  1S76 D;  1MAB G;  1YTF D;  3LDE A;  5CMU A;  4PA4 A;  2IJJ A;  5H6Q A;  1K9M W;  1RM1 C;  3ZIA G;  1R3K C;  1M9N A;  4CBC A;  2QM7 A;  3SYC A;  2V7Q G;  3STZ C;  5DM6 V;  1PD3 A;  2B1I A;  2EIM B;  4GX5 A;  3OR6 C;  1VQ5 V;  1K7D A;  2Z3Y A;  1W0K G;  2P6J A;  1H8H G;  3FB6 C;  3D3I A;  3ZJZ A;  3BY6 A;  3SPI A;  2EIM C;  4I5S A;  4XDJ A;  1QLE B;  2HLD G;  3ZN1 A;  4F4L A;  1EZJ A;  3I55 V;  2EIL C;  3ETG A;  1XL4 A;  3ZRW A;  2WLM A;  2XAF A;  2AHY A;  1AJQ A;  5KUK A;  1JCH A;  3QO5 A;  4MTX A;  5E1A C;  5LBQ A;  3D36 A;  2DYS B;  4MVQ A;  4JGS A;  4CZZ A;  1PNK A;  1M1K W;  2EIK B;  1S3J A;  5HFM A;  4WFF A;  4HYO A;  3G4S V;  1ORQ C;  2IJK A;  5L3C A;  3IGA C;  1FXH A;  1JX9 A;  3OW2 U;  1OCC B;  2AHZ A;  3E8H A;  3W7U A;  5LGU A;  4LC1 A;  1JOY A;  1H38 A;  2WPD G;  1GTO A;  3ETE A;  2H8P C;  2WSS G;  2Q69 A;  2EIN C;  2WLK A;  4JTA B;  4QE9 A;  4MS2 A;  2WLL A;  1M57 B;  5LHG A;  5LGN A;  1K4C C;  1LNQ A;  3JD0 A;  2Y69 B;  2QA4 V;  3ZCC A;  3W7T A;  3FYI B;  1E1R G;  2QM8 A;  5BZB A;  2EIN B;  4PA7 A;  1F23 A;  4PDR A;  3ABK B;  4GX1 A;  3CCR V;  3HB3 B;  1S77 D;  3E89 A;  1GK9 A;  2W6I G;  5IDJ A;  1YIT V;  4PDM A;  4HAM A;  1DF5 A;  1DLB A;  1Y4M A;  1K4D C;  2JEU A;  2JIZ G;  3T4D A;  1GO3 F;  3T1C A;  1AI5 A;  4P30 A;  3ZRV A;  2ITC C;  1FS0 G;  2IH3 C;  3K79 A;  4UV8 A;  4MTF A;  5B1B C;  2IJI A;  2ZXW B;  5EK0 A;  3SPG A;  1K97 A;  3SJQ C;  3DTU B;  5L3G A;  1K5Q A;  4YXW G;  3HPL C;  4KFM A;  4R8C A;  3OE7 G;  3JD1 A;  4JYC A;  4ZKI A;  2IH1 C;  3RW0 A;  5IYD O;  3JD4 A;  2DWD C;  1AJP A;  1F4M A;  3ASO C;  3ASN C;  1QR8 A;  3UKM A;  3CC4 V;  2JK5 C;  4H37 A;  3K08 A;  5C93 A;  1I5Y A;  5KA5 A;  1VQL V;  1GM8 A;  1CPY A;  4PA9 A;  3AEI A;  3B77 A;  2PI4 A;  4MTO A;  3ZRW B;  3LSQ A;  3ZRX A;  4QNH B;  3A0R A;  4MVZ A;  1Q81 W;  3E8G A;  1Q82 W;  4QPK A;  4P9O A;  3KG2 A;  1VQM V;  4X89 A;  1J95 A;  2GSM B;  3E86 A;  5IYB O;  1M56 C;  5L3D A;  1EFR G;  3G71 V;  3AG1 B;  3ML0 A;  3X2Q C;  1K34 A;  2R9R B;  3ZMS A;  1MG1 A;  3OUF A;  1GMG A;  5CN0 A;  2Y69 C;  2ZDI C;  3ABK C;  2XAG A;  5H9C A;  2D3O W;  4ASU G;  1VQO V;  1OCO B;  3SYQ A;  2EIK C;  2XOK G;  4MVS A;  4MT8 A;  4Q20 A;  2PI5 A;  1ENV A;  1IXM A;  1WPX A;  4MVM A;  1VQN V;  1AI4 A;  2LFR A;  4WFH A;  1CEZ A;  2XND G;  2HFE C;  1M57 C;  3OR7 C;  3PJS K;  1B6Q A;  4WFE A;  3MHS C;  1OCZ C;  1QLE C;  3AG3 B;  3OUS A;  4TT3 G;  3LSS A;  5DN6 G;  3K0D A;  4MVO A;  1S72 V;  4UXN A;  1YHQ V;  3OM3 B;  4I9W A;  3P30 A;  1S5H C;  4XDK A;  2ZR2 A;  3CCS V;  1AI7 A;  2IW5 A;  1I5X A;  5CBF A;  2DYS C;  4XBF A;  3WG7 B;  3FB5 C;  2W6J G;  1KEC A;  2QTO A;  4J9Z B;  4J9Y B;  1NKD A;  2HR3 A;  4FMT A;  1PNM A;  2BOC C;  1VQ9 V;  1F4N A;  1OCR C;  4N21 A;  5LHI A;  3NXS A;  5B1B B;  1QBZ A;  3VOU A;  5KA6 A;  3CCL V;  1RM1 B;  2NLJ C;  1RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...