3K03A

Crystal structure of cng mimicking nak mutant, nak-dtpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k03A00
3WG7C 5KUKA 2X6AA 4PA4A 2R9RB 3BEHA 3SYAA 4X88A 3ASOC 2HVKC 1R3IC 4X89A 4X8AA 4G28B 2WLLA 3LDDA 4J9ZB 3FB6C 2HG5C 1K4DC 4MVRA 5CBGA 3UM7A 3F5WC 2X6BA 4RAIA 3OUSA 2AHYA 5EK0A 3OGCC 3SYQA 4F4LA 2WLNA 4GX0A 1V54C 4GX5A 3LNMB 3TETA 4BW5A 3ASNC 4MVZA 4PA3A 4GX2A 3E8HA 5E1AC 4MVQA 2WLLB 3FB8C 2NLJC 4WFFA 3RBZA 3E8FA 3VOUA 4PDLA 2A79B 4DXWA 2WLKA 4XDJA 4XDLA 1ZWIC 2Y69C 4MTGA 3SPHA 3T4ZA 3K0DA 4R8CA 4CBCA 4H33A 4P9OA 5B3SC 4JTDB 3OR7C 3SYOA 4UUJC 3ABLC 2ATKC 2WLJA 2IH3C 1OCCC 2EIJC 2P7TC 4RUEA 4PA6A 3RW0A 3T1CA 3SPCA 3UKMA 3R65A 1OCOC 2JK5C 4MW8A 3TCUA 2ITDC 4PA7A 3T4DA 1G4YB 3FB7C 3IGAC 3SJQC 3SPIA 3K08A 3K03A 3LDCA 3RVYA 1QLEC 2IH1C 4LBEC 2ITCC 2YEVA 2ZD9A 5EBMC 3AG4C 2EIMC 4MVUA 4J9YB 4WFGA 1XL6A 3ABKC 1XL4A 3AG1C 4MVMA 4MTFA 4WFEA 3OR6C 2X6CA 2DYSC 3OUFA 1R3LC 3HPLC 4JTCB 5B1AC 3JYCA 3AG2C 5J9PC 4R6ZA 3F7YC 3ABMC 4MSWC 4MVOA 4OXSA 5EC2C 3SYPA 3T2MA 4G27B 2BOBC 2Q69A 2ZXWC 3EFFK 4QE9A 1K4CC 3RVZA 1P7BA 2BOCC 4PDVA 3K04A 2A9HA 3E86A 2DWDC 2WLIB 4P30A 4ZBMA 4R7CA 4P9PA 4QE7A 3STLC 4LP8A 4PDRA 1ORQC 1S5HC 3PJSK 4MTOA 2A0LA 3AG3C 3KG2A 4MVSA 3FB5C 2OCCC 3F7VC 4EKWA 5B1BC 2HJFC 5KUMA 5CBFA 3E89A 1R3JC 2EINC 2Q6AA 3E8GA 4P2ZA 3SYCA 2EILC 3E8BA 1J95A 4MW3A 5BZBA 4HYOA 4JTAB 5CBHA 1KKDA 1OCZC 4MS2A 5EBLC 2DYRC 4KFMA 3STZC 1M56C 2Q67A 2K1EA 1OCRC 4PA9A 1BL8A 4WFHA 5EBWC 2DWEC 2WLHA 2HFEC 3K06A 2W0FC 4GX1A 3X2QC 4XDKA 3ZRSA 5IY5C 3GB7C 1M57C 2HVJC 1JVMA 3K0GA 3LDEA 4TWKA 2Q68A 4I9WA 2QKSA 4H37A 1LNQA 2AHZA 2EIKC 2QTOA 1R3KC 3E83A 4RO2A 2KB1A 3SPGA 4RUFA 2WLMA 5EC1C 4HZ3A 4R50A 4LCUC 2H8PC 4PDMA 3SPJA 3LUTB 3ZJZA 3IFXA 4QNHB 2WLIA 1V55C
chains in the Genus database with same CATH superfamily
4OPAA 5CA0A 1IX9A 4NR1A 3JCUZ 5CA3A 4NTXA 1GM7A 2UXXA 2XAJA 5E79Z 5JWPA 1PV0A 4UV9A 3CB2A 4LH7A 1BMFG 2B1GA 5IJ9B 1S0VA 4I55B 4GKJB 2Q4PA 3CC7V 3ICXA 2YEVB 1M56B 5LYJA 4N21A 5IYZA 2LW1A 4JI8O 2YIAA 1SQQH 5H2FZ 4LFCB 1IURA 3ZBHA 3N2GB 4B7KA 3ETGA 3RVYA 4JAAA 2OT5A 3AG1C 1GM8A 5J9PC 1ZL8B 4ZI7B 3BVOA 4E4EA 1YTFD 5FNVB 1VARA 1VF6A 2Q5ZA 1BE3H 1MABG 1VQNV 1XNQO 4L87A 2UXBB 1NTKH 1KD1W 3CCSV 4PJ0Z 3JD4A 1K33A 1QCEA 2BTOA 2LW7A 4J41A 4Q20A 3U0ZA 3CMEV 3STZC 4JPRA 5GW7A 5IYCO 1YJWV 3P3PA 2ZQMA 1RSOA 5JVDA 2EZPA 2PTMA 5LP6B 2E5LB 1XMOO 4FM2A 2EILB 3WG7C 2XAFA 3GWOA 2ZE8A 1Y66A 3C3TA 2XOKG 4DV5B 3BHPA 2XASA 3APQA 3HKDA 1KMIZ 2Y0IA 4FPPA 1VQ7V 1QHTA 3GVMA 3RGBA 2WA4A 1SZXA 2CAZC 2HHHB 3QF7A 1WA8B 3ZMZA 2ZE7A 1KQSU 1GK9A 2WLKA 3CXHF 1JA8A 2A3QA 1QLNA 3MHHC 4O4HA 4KHPO 4JI4O 3CRAA 1KECA 4DR5B 1Z5VA 4BW9A 1G8MA 3L74H 1MZEA 4JI7O 4LFBO 1SF9A 4I5SA 4WBNA 1Z5WA 4LR3A 4JV5O 2YICA 3ABKC 4OX9O 4UXNA 4J7JA 2DYSC 3H1KH 2CDYA 2E3CA 3ZRXA 1WB7A 2W6JG 1JPXA 2F95B 3I55V 1GN6A 3AK3A 1JQ0A 2GTSA 1XNRO 1Q3EA 4P30A 2HJDA 5ITZB 1JFFA 2Q73A 4JI4B 5JQGA 1R6TA 3E8BA 4O2BB 1K5SA 3RYHA 4JYBA 5LXTB 3HKDB 3MAQA 1YXBA 3CPWU 3NR7A 1BT8A 4JZGA 2HFEC 2YSUB 2WPDG 3K3WA 4XDKA 4NKGB 5LMUO 1XOUA 3JARA 3B8NA 1B3QA 3BPZA 4J7ZA 4RO2A 5B3SB 1QVGU 2Y69B 1TUBB 5GTIZ 4I55A 2WLIA 3FD9A 5KUKA 3BFRA 2UUCB 5LGUA 4X64O 3JD1A 1WNSA 2R9RB 3BEHA 3ASOC 2Q9LA 3VQVA 2ZR3A 4O2AA 1CXZB 1RPRA 2HG5C 4DV0O 3CEIA 4O4IA 4TV8A 1XEQA 1KC8W 1PD3A 1SC5B 3L73H 1GM9A 4WFFA 4D7SA 4DV0B 2JIZG 4DR3B 2QWNB 1EN4A 3IC7A 5GONA 5H5NA 1A32A 4JTDB 3OR7C 1Q6UA 1RPOA 5LA6A 1JFFB 4X64B 1OZ0A 2UXCB 3CWBH 1P7GA 1IBMO 1VF5B 3SPCA 4MW8A 2VQFB 4UVAA 3K03A 4WF9V 1NH2D 2ITCC 1F4MA 4WFEA 4CH5A 2RNBA 2P90A 3JYCA 4H44B 2MW2B 4YJ3A 3ZN0A 4JI1B 1N34O 1DTOA 2EJ7A 4DV2B 2A9HA 2L6LA 4DR1O 1Q6HA 2KKWA 3FX7A 2DW4A 4ZBMA 1RSOB 4QJFB 5H6QA 4HNAA 2UXNA 3J81N 4EKWA 5KUMA 5CBFA 4IT5A 1OCOB 1TVKB 4K8XA 1VF7A 3ZHQA 2QDOA 2Z5UA 4QPKA 3RFRA 2ZDIC 1PP9H 5FL7G 3C90A 2GHYA 2KQXA 4ZKIA 1N32O 1BQ0A 2XT9A 3S3XA 1COWG 4DRXB 1W0JG 4HBNA 3UT5A 1URFA 5H9CA 3K59A 1NS1A 3BCCH 4XBFA 2JJ1G 5KA6A 5KHHA 1DLBA 1Q43A 5F2VO 3LSQA 4B3TB 3CHXA 2N05A 4RUFA 2WLMA 4DO2A 4YY3B 3QO5A 3SPJA 3OEEG 2IJIA 1VP7A 3JAKB 1FXVA 1RM1C 3D36A 5LOVB 4U3FH 3A0RA 4LF9B 4JI6O 4B08A 5K1PA 2GBOA 3FB6C 4MVRA 4KL1A 4TV9A 3AG4B 3CXCU 1AILA 3SYQA 3TK1A 3UCSC 4NYKA 4X1YA 4JI7B 3E8HA 4LFBB 3DGEA 1VQ8V 4NXMO 5EZYB 4PELA 1Q82W 2JDIG 3D36C 1M57B 1FPOA 1EN5A 3SYOA 5FPOA 2JS3A 3THOA 5EIBD 4W4KA 1OJHA 3QNEA 1JJ2U 4FIPC 2ITDC 3FKSG 1WJZA 3D3QA 2DYRB 1XMOB 1TUEB 3E22B 2CTRA 2ZM6B 4OPHA 2IU0A 3CX5F 1FFXA 3UT5B 1H2LA 3G6EV 2BOBC 3OD4A 4ASUG 3ETDA 4PV1B 4A5UB 1AR4A 1OV9A 2WSSG 2EULA 4MTOA 5BY1A 3B09A 3JAKA 4IYIA 2V4DA 3Q4HA 1AI7A 1Q6IA 5LP6C 4DR2O 3T1HB 1L0NH 2IW5A 5JCOA 1HDJA 4JASA 2DWEC 3K06A 4JI0B 4X66O 4KP4A 1N8RW 3LDEA 4X1YB 2ZE5A 1FXKA 3F5TA 2QTOA 5CN0A 3E83A 2PGGA 4B3MO 1HNWO 2UUBB 3IFXA 4LF7B 2IU3A 1GKFA 2Q0AA 1US6A 4IIJA 3W7SA 2WAMA 4CS2A 2YI8A 5LGTA 1H2GA 3AG2B 2WLLA 2ZR2A 1FKAO 1JJOA 3DC5A 2RCVA 5JJJB 2V1DA 4RQFA 3VQYA 4LF4O 2FKXA 1IZ3A 3E8FA 1IBMB 5BXZA 4MTGA 2Y69C 4CBCA 4JI8B 3E2EA 5L3FA 2QGNA 2ATKC 1Q81W 2WLJA 4PA6A 4O4JA 2P4VA 1IXBA 4TOIA 1NVPB 1NTMH 1KP2A 1HNXO 2AGAA 5L3CA 3F7YC 4KUMA 3TXQA 2DQ0A 2GV9A 1AROP 5B1BB 1F4NA 3K04A 4AI8A 1HNXB 4LF5B 1YHQV 1SETA 1B04A 4D6TH 4LF4B 1MZFA 4R7CA 4P9PA 4X65B 4TUYB 1JOYA 2JJ2G 2OTJV 4UCVA 1EFRG 3A0BZ 4FJCC 3SYCA 1NT2B 1J95A 1SA0A 5TISZ 4K3AA 3ABLB 1KKDA 4KFMA 4J7KA 2Q7GA 3PN1A 1HNZB 1M56C 1AR5A 5LMNB 2WLHA 1NJIW 2VQEO 1YITV 1NZ6A 4DUZB 4K0KB 3P32A 3OMNB 1I0HA 4O2BA 3M99B 3LSSA 5FLXN 3OTOO 2P67A 2Y4UA 1DGSA 1YDXA 3HKCA 3JASB 1R3KC 2KB1A 1OCZB 4HZ3A 1L8DA 3CJHB 4X1KB 4X1IB 5KMGA 2QM8A 2X7RB 3EXAA 2HVKC 4O4JB 4JI5B 3B8MA 3B77A 4G28B 2JGDB 1TAEA 1TUBA 1N33B 3T1YO 4B3SO 3UM7A 4RAIA 2AHYA 5KHIA 2CTPA 4I50B 2JRIA 4E2LA 4DK0A 2NLJC 3M7MX 2FB5A 4YIPA 4NXNO 3DXRB 3L70H 3K5MA 3ZHSA 4I0XA 3T1HO 5JVDB 4EEQA 3RYCB 2W6IG 1K97A 5IYBO 4OX9B 2DYSB 3A2FA 2IJKA 4CS4A 3T4DA 2RN9A 4NB5A 2PI5A 4FLUA 1Y4MA 3CD6V 5JH7B 2OYQA 1QBZA 4WFGA 1XUQA 5B1AC 2RDCA 2HKOA 3ZHRA 4OXSA 1FFTB 4U3JA 3EFFK 3RN4A 3WB1A 3ASNB 1D2DA 2LJ2A 1KU9A 2DWDC 2ODMA 4GCZA 4JV5B 3OMIB 3STLC 3CCMV 4UV8A 2XNDG 2BCCH 3PJSK 1SS3A 3N2KA 1GN4A 5LHGA 2GSMB 2O57A 3JSLA 4P2ZA 2VS0A 3KCXA 3L9DA 3OEHG 3I5DA 4DR5O 4AILC 1K73W 3JALB 1BHAA 3K5OA 4JZ2A 5EBWC 2JS5A 3GB7C 4AQYB 4RWUA 4JYYA 5K1XA 1FJGO 1JVMA 4B3RB 3EVKA 4GYCB 2EX3A 3W7XA 1GMGA 1S77D 4H37A 3K9SA 5IY5B 3SPGA 2RQ6A 5DECA 3RYIA 2UUCO 4JI6B 3G71V 1N0JA 4CC6A 1F23A 3M8AA 4IHJA 3LUTB 1HNWB 1V55C 3RYFB 2JGUA 1AJNA 3SYAA 2JEUA 1R3IC 1AI6A 4WFBV 3TJTA 1ZL8A 3ABKB 2OIGA 3RWRD 2P6JA 1VQ6V 4FFBA 3QG5A 4NXNB 1THZA 4PA3A 4K35A 4JI0O 3K5NA 1K34A 3ZMTA 1BGYH 1FS0G 3OMAB 1JMKC 5JJEB 4PI0A 3SJAC 1BZKA 4UVBA 4NTYA 1FYJA 3OW2U 1YJNV 2UU9B 1XQ8A 5KHKA 2BE3A 1YTFB 1XL6A 3FYEB 4MVMA 3OR6C 2Q8VA 1CEZA 3FFQA 3ABMC 2CGNA 2KG7A 3DC6A 1IBLB 2EBOA 4DUZO 1YZBA 4H0LB 1ORQC 3RYIB 1QVFU 2VRZA 2UUAO 1K8AW 5B1BC 2BTQA 5CBHA 5LA6B 1K7DA 4DR4B 1FJGB 1AI4A 3HKEB 4PA9A 3G6BA 3X2QC 2W0FC 4YXWG 5CB4A 1RP3B 4CH4A 1IVSA 2QTSA 2W0XA 3JD2A 2OCHA 4FLYA 4DW0A 2H8PC 2OWOA 5IYZB 1AP6A 1HW7A 1AVMA 2CTWA 5A2QN 5KHJA 4WBNB 4LF8B 3ZMSA 1FD9A 4X8AA 1ZLZA 3RYCA 3VBBA 5A9GA 3OUSA 1BS3A 2VWJA 4FLXA 1YIJV 4ZI7A 4HAMA 5E1AC 1M90W 2WLLB 4RQEA 2XAHA 2ZCEA 1Q86W 4DXWA 1CP9A 5J2UA 5FPRA 1EZJA 1QR8A 5JQGB 3K0DA 1KYOF 5B3SC 4U3JB 2DMXA 5C8YA 4DV4B 3ABLC 3JAWB 5KX5B 4BAYA 3H1JH 5LXTA 5J2TB 2NNUA 1R6KA 2QWRB 3H01A 1I5YA 2FYUH 2V7QG 2EIMC 3AG7A 4MTFA 5IWAO 4Z1MG 5HFLA 1S3JA 5CMUA 1S5JA 2CGOA 4ICGA 4DR7O 1P7BA 4AHCA 3E86A 3OFNG 4UB6Z 3ZEDA 2YXHA 3I56V 2AZ2A 3BA8A 5B1AB 2JEXA 4PDRA 2UXCO 5D5QA 1KUQA 5L3BA 1QU7A 3E89A 4DR2B 2EINC 1O9HA 5EIBC 4J10A 4FM1A 1L1FA 1OCZC 3J80N 4JI3O 3H9VA 1EM1A 3JATB 1AB3A 1VQ5V 3ETEA 3CRMA 3CSXA 3JSNA 1L0LH 2HVJC 2YIBA 4LC1A 1MG1A 5KA5A 4FK5C 1AI5A 4DV5O 1KBHA 5J2UB 3ABTA 4CS3A 1HP8A 3B2EE 1S5LZ 1I08A 2R72A 1WAZA 1SKVA 2X6AA 1X4TA 3HKCB 1MOFA 3JASA 1Q8IA 2CK3G 1P4RA 1EZVH 1MSWD 4GT1A 3Q4HB 2ZE6A 5EK0A 1M9NA 3O65A 1ZUQA 3MDSA 3T4ZA 4R8CA 4H33A 4P9OA 3JCZA 1NKDA 4DR4O 2EZOA 4MT8A 5C93A 4JI5O 2UUBO 3J7AU 1G4YB 1H2NA 4LNUA 5LGNA 3SPIA 1J5EO 1NTZH 5EBMC 4I0XB 1U96A 4CH3A 3JATA 4IYHA 3TXSA 1PNLA 2LO1A 1SERA 1R1BA 5L3EA 5EC2C 3SYPA 3W7UA 1ROPA 4FFKA 4PDVA 1IXMA 3ZRWA 4LF7O 1D5AA 2PYJA 5IDJA 5BMVB 1P49A 1I94O 2EILC 3JD0A 1XHXA 2Q7EA 2B9ZA 3L71H 2GUZA 4CH6A 4UFZA 3W7WA 2Q67A 4ZIBA 1NR1A 2YXYA 2XAGA 2YDEA 4NVPA 4EB6A 1H2SB 4TUYA 3G67A 4DR1B 1OCCB 3P3NA 3QO8A 1GH6A 2XUMA 1AJQA 2F93B 1QNMA 2Z0AA 5JJNB 4R50A 3OAAG 4X9QA 3ZHVA 3JAMN 1AR1B 1AP5A 1B06A 3QO7A 1FFXB 1XREA 3JAWA 1Y76B 5CBGA 3QVNA 2ZM6O 1VQ9V 3CCRV 2ETNA 3ML0A 4DV6B 4ZHQB 3BA9A 1NI8A 1W2BU 3ZRWB 4ABMA 4PDLA 5B1OA 3SPHA 1KKCA 1XILA 4FFBB 1M4UA 4UUJC 4FZ0A 1XNQB 2EIJC 3RW0A 5IJ9A 4GZRB 1XNRB 3X2QB 3SJQC 3K08A 3MHSC 2JVDA 2YEVA 3OTFA 1OCRB 4DW1A 1WN7A 3QTCA 4EFEA 1XMQB 1HR0B 5IWAB 4DR7B 2HR3A 4J42A 4G27B 4LF9O 4TQFA 1VF6C 2BOCC 1V54B 2CTQA 2WWWA 1HNZO 1K5QA 4LP8A 3BABA 1H38A 3CS5A 3AG3C 2CE4A 1YSCA 3DXRA 5BR8O 2MK3A 2Y0PA 3N2GA 3T1YB 3UO3A 4I4TA 5BZBA 2NR5A 2QM4A 4JI2B 3KCYA 2LP7A 1VMGA 1BL8A 4F4LA 4GX1A 5IY5C 3S3WA 1FXHA 1Y6XA 3NXSA 3HKBA 3H1IH 2BTQB 4GLXA 4DV2O 1H2KA 3OGIB 3GWKC 2HLDG 5HFMA 1H2MA 4LWSB 4B3SB 1S76D 4GKKO 4LCUC 1Q7YW 3TGUH 1IBKB 2E5LO 1J5EB 3K79A 5D5PA 4EFBA 4X89A 2DQ3A 2C2AA 1I5XA 2QKCA 4JAUA 4UCOA 2IM9A 2VQFO 4C7UA 4JYCA 3ZX6A 2EJRA 1EN6A 2EIMB 5LHHA 3A0HZ 4O4LA 5LP6A 1W0KG 2XTAA 3L75H 1WP8A 3T1CA 1NVPD 1Y74A 1OCOC 2JK5C 3SR2C 5LL6Y 3FB7C 3IGAC 1N4CA 4O4HB 2QWPB 3JD3A 3WU2Z 3K5LA 2ZINA 2E76B 2P06A 3K9AA 2YC0A 1SQVH 3KKYA 3OUFA 5J2TA 1G1XB 3AG2C 1UJWB 3K57A 3T2MA 2ZXWC 2ZT9B 3RVZA 5IJ0B 1N36B 4LF6O 4D7TA 4DV1O 2DN9A 3CCVV 4X1KA 3OT7A 3CCLV 2HP8A 1PNKA 1S5HC 1NH2B 1V55B 4JGSA 3U11A 3MD0A 4JI3B 3E8GA 4JI2O 1RM1B 4MW3A 4DR6O 5LMUB 3LNNA 1SESA 3EHBB 5JCOC 2UXBO 4WFHA 2EIKB 1MSDA 1O9GA 2YUAA 4B3MB 3DTUB 1SQBH 4I9WA 2R70A 3W7TA 3CCEV 2AHZA 1PM9A 1FXKC 1XMQO 5LHIA 5B66Z 1U97A 3UO2A 5JH7A 2F4VB 2OCCB 3HR0A 2K9PA 5KLVH 2A06H 2IBZH 1K4DC 1YVWA 2X6BA 3WB2A 2Q0OC 4YJ2B 1F7YA 4GX0A 4KHPB 1DF4A 3ABMB 5IYDO 1NR7A 2LFSA 2PF4E 5DN6G 4TT3G 3HKEA 3SJCC 1MNGA 3O9OA 2H94A 3B4SA 2A79B 4BIZA 2UXDO 4F6RA 1YI2V 4I7ZB 2QSAA 3ZIAG 1PKXA 3JALA 1E79G 4NXMB 2LGQA 4PA7A 1JX9A 4LF8O 1BQZA 2AW9A 5GONB 1VQOV 3AG4C 2OIEA 5KAIZ 2E75B 3H1LH 3CRQA 4FLVA 3HPLC 1Z2GA 3CC2V 4GKKB 1LUVA 5DEDA 2Q69A 4FMTA 5CA1B 1N32B 4IGGA 2FTKA 4BR6A 1HWYA 2CUGA 3F7VC 2HJFC 3WG7B 4WCEV 1DK1A 4J11A 2ZDIA 3E35A 4JAVA 3U10A 3IC9A 2LQTA 1NU1H 2IJJA 4MS2A 4X62B 2DYRC 2X0LA 1BSMA 1OCRC 4LFAO 3A8TA 2Z3YA 2LFRA 4YJ3B 4JI1O 4YIOA 2QR4A 1N34B 3FAVB 3BY6A 2G38A 4X20A 4UCTA 3CCJV 1XI1A 2QKSA 1LNQA 4DRXA 4F6RB 2EIJB 4HNAB 2JGDA 4UCSA 3OM3B 1QR9A 2PY5A 4DV3B 2QM7A 4QIWF 2P22C 4I50A 4X88A 4L8JA 1TA8A 1N0NA 2RJZA 1XHZA 4JF3A 1K9MW 4YY3O 3LDDA 4J9ZB 4ZOLB 1PNMA 4DR6B 4DV4O 3IAYA 1KB9F 2YXLA 2XAQA 1V54C 1UFIA 4FM0A 4TSFG 3ASNC 3OTOB 1M5IA 1FAFA 1ZTEA 2IJHA 2LGWA 2KSDA 3APOA 2VWKA 4WFAV 3AEIA 3JARB 4W4LA 1GO3F 4GKJO 5DM6V 2Y48A 5CB4B 1IBLO 5GTHZ 3ZMUA 4U7NA 3ABUA 2R9IA 4FLTA 4BIOA 4DV1B 4JYAB 3D8CA 1GRJA 1YF2A 4O2AB 2R9AA 3CCQV 4R6ZA 3CMAV 1N36O 3FAVA 3N27A 4MSWC 4LH6A 3N2KB 4O4IB 4TV8B 2QWQB 2QWOB 1OHHG 4AQYO 2UU9O 2Q7HA 1E1RG 1XBLA 2ZXWB 3KG2A 2ARHA 2ZNJA 1R3JC 4U7OA 4QGPA 2PZSA 2NN4A 3ZHUA 2YS8A 4UCUA 4DR3O 4LNUB 1PL0A 5KAFZ 3SGIA 1SRYA 2M7WA 2GTAA 1M57C 3AK1A 3K0GA 5B1NA 4IHJB 4TWKA 1VIBA 1CPYA 5BMVA 2EIKC 1F51A 4YJ2A 1R73A 2P4KA 2YIBD 2GUZB 2B1IA 1PL4A 4OGQB 4UVCA 4G2KA 1IDSA 4PA4A 1YJ9V 5L3GA 4B3TO 4LFCO 3FYIB 1WPBA 3BRCA 3KZIZ 2F66C 3TETA 4IIJB 1GN3A 4BW5A 1EBOA 4MVZA 4PI2A 4MVQA 3FB8C 4GUNA 1WLEA 3VOUA 4EB6B 1ZWIC 2ZIMA 2RMKB 1W59A 1QLEB 3CE2A 1Y76A 4RUEA 5B5EZ 1OCCC 1Q90D 3G80A 1D5NA 5FNVA 3LDCA 4FLWA 2ZD9A 2F43G 4DV6O 4MTXA 3SJBC 3RT3C 1JCHA 4FVMA 4JTCB 2ILMA 3G4SV 4MVOA 1E1QG 2DOSA 3AG3B 5KHGA 2UXDB 4DUYB 2P5OA 2WLIB 4PD4F 3VQWA 1PPJH 4X20B 4ZHQA 4K0KO 1VQPV 1X59A 2VQEB 3CRCA 2A0LA 1GN2A 2OCCC 4KXRA 5IJ0A 3VQXA 2Q6AA 4DYLA 1S72V 4CZZA 1UPGA 3ZHTA 4HYOA 3UQ8A 2ZNIA 2K1EA 1VQMV 1B6QA 4QPJA 4H13B 3B40A 3K58A 3DSQA 1VQKV 3IJ4A 1SA0B 4LF5O 4DUYO 2Q68A 1I94B 2QJ1A 2ZIOA 4PHZA 2HEPA 3R66A 1NQTA 2F1MA 1LR1A 3ETQA 3ZJZA 4QNHB 2QA4V 2GDSA 5KX5A 1VEWA 2BSKB 2N74A 1ZAUA 1SQXH 4FZ1A 3CP1A 1WA8A 1Y67A 3F5WC 4I4TB 4NTWA 1P84F 3OGCC 2WLNA 2H3OA 4LWSA 1I7FA 2AXTZ 5C8YB 1TGOA 4TQDA 3ZCCA 4GX2A 4LFAB 3HKBB 2A7WA 4BWAA 5EYPA 2D3OW 4XDJA 1TVKA 5CA0B 3CJHA 1FXKB 1N33O 3ZN1A 1YEWA 2QEXV 3LSUA 3AG1B 3ZMVA 2P7TC 2PI4A 3UKMA 3R65A 3TCUA 1H8EG 1GTOA 1QQCA 3H1HH 1Q5OA 3C3SA 4Q6GA 2FL4A 4J9YB 1XDCA 1XL4A 1SZTA 4LF6B 2ADQB 2F23A 1R3LC 4JYAO 1LUWA 1KP3A 1K4CC 3RYHB 1Y74B 2PUSA 2N04A 4MVSA 4N23A 3FB5C 4FLZA 1M93A 3ASOB 1GAXA 4JTAB 4BIUA 5CA1A 5EBLC 1NBMG 4UCRA 5IE9A 3D3IA 5H6RA 1IBKO 3WFVA 1ENVA 4I9QA 1VQ4V 1JR9A 2QKAA 2YIDA 2FMLA 5EYPB 5LBQA 3WB0A 5EC1C 1M1KW 4DV3O 4Z2WA 4DK1A 5EZYA 4B7EA 1MA1A 2D2CB 1K3EA 5IT9N 2E74B 5BR8B 4J80A 1R6NA 4DV7O 1G6UA 1WB8A 3LNMB 4GX5A 3CCUV 4X66B 1VQLV 2CH7B 2OTLV 2ZKOA 2XHBA 4ZOLA 3RBZA 1K92A 3CRRA 2L35A 3E22A 2YI9A 1SQGA 4YHHB 4XDLA 5AG2A 3CYOA 1HR0O 2PYLA 2AZ0A 3RYFA 2IH3C 4YHHO 4K8ZA 1T5EA 1QLEC 2IH1C 4LBEC 4X1IA 5KMGB 4MVUA 3OE7G 2X6CA 1RFYA 5L3DA 3P30A 3HB3B 2DE0X 4QE9A 4Z1VA 3ZRVA 4B3RO 1MMMA 4QE7A 2HHHO 5LYJB 2M6YA 3SDLA 1DF5A 1YCIA 1WPXA 4DV7B 4X62O 3ZS8C 2WA3A 1BCCH 3CC4V 1AJPA 1SQFA 2Y4TA 3ZRSA 2BSKA 1H8HG 4IL6Z 2ADPA 2QE7G 5LMNO 2B5UA 4F6EA 1ZSPA 4O4LB 5ITZA 1ZX3A 3L72H 1WP7A 2CH7A 2KG7B 5LOVA 2F4VO 1SQPH 3AK2A 3BAAA 2UUAB 4CC5A 2DJVA 1BHBA 4UB8Z 4TV9B 4PDMA 4X65O 2EINB 1V9PA
chains in the Genus database with same CATH topology
2IU3A 2QM7A 4QIWF 2X6AA 1GKFA 3W7SA 4X88A 1MOFA 2WAMA 5LGTA 1H2GA 3AG2B 2CK3G 4JF3A 1K9MW 2WLLA 5CA3A 3LDDA 1P4RA 4J9ZB 1PNMA 1GM7A 2UXXA 2XAJA 1MSWD 4GT1A 2ZR2A 2XAQA 5EK0A 1M9NA 2V1DA 1V54C 4UV9A 4TSFG 3ASNC 1BMFG 4RQFA 2B1GA 2IJHA 1S0VA 3E8FA 4WFAV 4MTGA 2Y69C 4CBCA 3CC7V 3T4ZA 4R8CA 4H33A 4P9OA 3E2EA 2YEVB 1M56B 3JCZA 1NKDA 3AEIA 4N21A 5L3FA 2EZOA 1GO3F 2ATKC 1Q81W 4MT8A 2WLJA 5C93A 4PA6A 5DM6V 2Y48A 1G4YB 5LGNA 3SPIA 3ZMUA 4U7NA 3ABUA 3ETGA 3RVYA 5EBMC 2R9IA 1NVPB 2OT5A 3AG1C 1PNLA 1KP2A 5L3CA 1GM8A 3CCQV 5J9PC 1SERA 4R6ZA 3F7YC 4KUMA 4MSWC 5L3EA 3CMAV 5EC2C 2DQ0A 3SYPA 1AROP 3W7UA 1YTFD 1ROPA 5B1BB 1F4NA 4PDVA 3K04A 1IXMA 3ZRWA 1YHQV 1SETA 4R7CA 4P9PA 1MABG 1OHHG 1E1RG 1JOYA 1VQNV 2JJ2G 4L87A 2OTJV 5IDJA 2ZXWB 3KG2A 1EFRG 4FJCC 1KD1W 3CCSV 1R3JC 4U7OA 3SYCA 3JD4A 1K33A 1QCEA 2EILC 1J95A 3JD0A 4Q20A 3CMEV 3ABLB 1KKDA 4KFMA 3STZC 4JPRA 1M56C 5GW7A 2Q67A 3W7WA 2WLHA 5IYCO 1NJIW 1YITV 1YJWV 1NR1A 1PL0A 2XAGA 2ZQMA 1SRYA 3P32A 2M7WA 1M57C 3OMNB 3K0GA 3M99B 3LSSA 5B1NA 4TWKA 2P67A 1OCCB 1CPYA 3QO8A 2EIKC 1F51A 1AJQA 1R3KC 2EZPA 1R73A 2KB1A 1OCZB 4HZ3A 4R50A 3OAAG 2B1IA 4UVCA 1AR1B 2EILB 3WG7C 4G2KA 2XAFA 2QM8A 2X7RB 3GWOA 4PA4A 1Y66A 2HVKC 2XOKG 5L3GA 3QO7A 1YJ9V 3FYIB 2XASA 3B8MA 3B77A 4G28B 4FPPA 1VQ7V 5CBGA 3UM7A 1VQ9V 3CCRV 4RAIA 2AHYA 3ML0A 3TETA 4BW5A 1EBOA 4MVZA 4E2LA 4MVQA 3FB8C 2NLJC 3ZMZA 1KQSU 1WLEA 3VOUA 1W2BU 3ZRWB 1GK9A 4PDLA 2WLKA 5B1OA 1ZWIC 3SPHA 1QLNA 3MHHC 1QLEB 1KECA 4UUJC 4RUEA 1OCCC 2EIJC 2W6IG 3RW0A 1G8MA 1K97A 5IYBO 2DYSB 2IJKA 3T4DA 3X2QB 3SJQC 2PI5A 3K08A 1Y4MA 3LDCA 4I5SA 3CD6V 3MHSC 2YEVA 2ZD9A 2F43G 1QBZA 4WFGA 3ABKC 1OCRB 4MTXA 4UXNA 1JCHA 2DYSC 4JTCB 5B1AC 3ZRXA 2W6JG 1JPXA 2HR3A 2HKOA 1E1QG 4MVOA 4OXSA 3I55V 3G4SV 1FFTB 4G27B 3EFFK 3AG3B 3ASNB 2BOCC 1V54B 1JQ0A 2DWDC 2WLIB 2WWWA 4P30A 4GCZA 1K5QA 3OMIB 3STLC 3CCMV 4LP8A 4UV8A 2XNDG 1VQPV 1H38A 3PJSK 2A0LA 3AG3C 1YSCA 2OCCC 5LHGA 2GSMB 2MK3A 2Q6AA 4P2ZA 1S72V 4CZZA 3E8BA 3OEHG 1K5SA 5BZBA 4HYOA 1K73W 4JYBA 2LP7A 1BHAA 3CPWU 2K1EA 1BL8A 5EBWC 4F4LA 1VQMV 4GX1A 2HFEC 1B6QA 2WPDG 2YSUB 3K3WA 4QPJA 4XDKA 5IY5C 3GB7C 1FXHA 3NXSA 1VQKV 1JVMA 2Q68A 3W7XA 1GMGA 1S77D 4H37A 2HLDG 3B8NA 5HFMA 5IY5B 1S76D 4RO2A 5B3SB 1QVGU 3SPGA 1NQTA 2Y69B 3G71V 4LCUC 1Q7YW 1F23A 3LUTB 3ZJZA 4QNHB 2WLIA 2QA4V 1V55C 5KUKA 5LGUA 1AJNA 3JD1A 3SYAA 2R9RB 3BEHA 3K79A 2JEUA 3ASOC 1R3IC 1AI6A 4X89A 2DQ3A 2C2AA 2ZR3A 3CP1A 4WFBV 1RPRA 1I5XA 2HG5C 3ABKB 4JAUA 3F5WC 2P6JA 3OGCC 2WLNA 1VQ6V 1KC8W 1PD3A 1THZA 3ZCCA 4PA3A 1K34A 1GM9A 4GX2A 4JYCA 2EJRA 4WFFA 2EIMB 3ZMTA 2JIZG 5LHHA 1FS0G 3OMAB 2D3OW 3IC7A 4XDJA 4JTDB 3OR7C 4UVBA 3OW2U 1FXKB 1RPOA 1YJNV 3ZN1A 2QEXV 1W0KG 1OZ0A 3AG1B 3ZMVA 2P7TC 3T1CA 1NVPD 2PI4A 3SPCA 3UKMA 3R65A 1OCOC 2JK5C 4MW8A 3TCUA 1H8EG 3FB7C 3IGAC 1GTOA 4UVAA 3K03A 3JD3A 4WF9V 1NH2D 2ITCC 1YTFB 4J9YB 3K9AA 1F4MA 1XL6A 1XL4A 3FYEB 4MVMA 4WFEA 1SZTA 3OR6C 1CEZA 3OUFA 1R3LC 2P90A 3JYCA 3AG2C 3ZN0A 3ABMC 1UJWB 3T2MA 1KP3A 2ZXWC 3RVZA 1K4CC 1DTOA 2A9HA 2EBOA 3CCVV 2DW4A 4ZBMA 3CCLV 4QJFB 1PNKA 5H6QA 1ORQC 1S5HC 1QVFU 1NH2B 2UXNA 4MVSA 4N23A 3FB5C 1V55B 4JGSA 4EKWA 3MD0A 5B1BC 5KUMA 3ASOB 5CBFA 1OCOB 3E8GA 2Z5UA 4QPKA 1RM1B 4MW3A 2ZDIC 4JTAB 5CBHA 4BIUA 1K7DA 5EBLC 5FL7G 2GHYA 4ZKIA 1NBMG 1AI4A 1SESA 3EHBB 1COWG 4PA9A 4WFHA 2EIKB 3X2QC 2W0FC 4YXWG 1W0JG 3D3IA 5H6RA 3WFVA 3DTUB 5H9CA 1ENVA 4I9WA 4XBFA 2JJ1G 5KA6A 3W7TA 1DLBA 2AHZA 3CCEV 1VQ4V 3JD2A 1FXKC 3LSQA 5LHIA 5LBQA 4RUFA 2WLMA 5EC1C 1M1KW 4DO2A 3QO5A 2H8PC 3SPJA 3OEEG 2IJIA 1FXVA 1RM1C 3D36A 3ZMSA 3A0RA 2OCCB 4X8AA 1K3EA 3FB6C 1K4DC 4MVRA 3VBBA 2X6BA 3AG4B 3CXCU 1R6NA 3OUSA 3SYQA 4GX0A 1DF4A 3ABMB 3LNMB 4GX5A 3TK1A 5IYDO 3CCUV 1VQLV 1NR7A 2LFSA 5DN6G 4TT3G 1YIJV 4HAMA 3E8HA 2OTLV 3DGEA 5E1AC 1M90W 1VQ8V 2WLLB 4RQEA 2XAHA 1K92A 3RBZA 4PELA 1Q86W 2H94A 2A79B 4DXWA 4BIZA 1Q82W 1CP9A 4XDLA 1YI2V 2JDIG 1EZJA 1QR8A 1M57B 3K0DA 5B3SC 3SYOA 3CYOA 3ZIAG 1PKXA 3ABLC 3QNEA 4BAYA 1E79G 2IH3C 2NNUA 1R6KA 1JJ2U 4FIPC 2ITDC 4PA7A 1JX9A 3FKSG 3H01A 1I5YA 1QLEC 2IH1C 4LBEC 1VQOV 3AG4C 2V7QG 2DYRB 2EIMC 4MVUA 3OE7G 1TUEB 4MTFA 4Z1MG 2X6CA 5L3DA 2IU0A 3P30A 3HPLC 3CC2V 3HB3B 5HFLA 1S3JA 5CMUA 3G6EV 2BOBC 2Q69A 4QE9A 4FMTA 3ZRVA 1P7BA 3E86A 3OFNG 4ASUG 3ETDA 3I56V 4QE7A 5B1AB 2JEXA 4PDRA 2FTKA 1DF5A 2WSSG 4MTOA 1HWYA 1WPXA 3F7VC 2HJFC 3WG7B 4WCEV 5L3BA 3E89A 2EINC 2ZDIA 3E35A 4JAVA 1L1FA 1AI7A 3CC4V 1OCZC 2IJJA 1AJPA 4MS2A 2DYRC 2X0LA 2IW5A 1OCRC 1VQ5V 3ETEA 4JASA 3ZRSA 2DWEC 3K06A 1H8HG 2Z3YA 2LFRA 2QE7G 4KP4A 2B5UA 1N8RW 2HVJC 3BY6A 4LC1A 3LDEA 3CCJV 1MG1A 5KA5A 4FK5C 2QKSA 1LNQA 1FXKA 1AI5A 2QTOA 5CN0A 3E83A 1K8AW 2EIJB 3ABTA 1BHBA 4PDMA 2EINB 3IFXA 3OM3B 1QR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG7 C;  5KUK A;  2X6A A;  4PA4 A;  2R9R B;  3BEH A;  3SYA A;  4X88 A;  3ASO C;  2HVK C;  1R3I C;  4X89 A;  4X8A A;  4G28 B;  2WLL A;  3LDD A;  4J9Z B;  3FB6 C;  2HG5 C;  1K4D C;  4MVR A;  5CBG A;  3UM7 A;  3F5W C;  2X6B A;  4RAI A;  3OUS A;  2AHY A;  5EK0 A;  3OGC C;  3SYQ A;  4F4L A;  2WLN A;  4GX0 A;  1V54 C;  4GX5 A;  3LNM B;  3TET A;  4BW5 A;  3ASN C;  4MVZ A;  4PA3 A;  4GX2 A;  3E8H A;  5E1A C;  4MVQ A;  2WLL B;  3FB8 C;  2NLJ C;  4WFF A;  3RBZ A;  3E8F A;  3VOU A;  4PDL A;  2A79 B;  4DXW A;  2WLK A;  4XDJ A;  4XDL A;  1ZWI C;  2Y69 C;  4MTG A;  3SPH A;  3T4Z A;  3K0D A;  4R8C A;  4CBC A;  4H33 A;  4P9O A;  5B3S C;  4JTD B;  3OR7 C;  3SYO A;  4UUJ C;  3ABL C;  2ATK C;  2WLJ A;  2IH3 C;  1OCC C;  2EIJ C;  2P7T C;  4RUE A;  4PA6 A;  3RW0 A;  3T1C A;  3SPC A;  3UKM A;  3R65 A;  1OCO C;  2JK5 C;  4MW8 A;  3TCU A;  2ITD C;  4PA7 A;  3T4D A;  1G4Y B;  3FB7 C;  3IGA C;  3SJQ C;  3SPI A;  3K08 A;  3K03 A;  3LDC A;  3RVY A;  1QLE C;  2IH1 C;  4LBE C;  2ITC C;  2YEV A;  2ZD9 A;  5EBM C;  3AG4 C;  2EIM C;  4MVU A;  4J9Y B;  4WFG A;  1XL6 A;  3ABK C;  1XL4 A;  3AG1 C;  4MVM A;  4MTF A;  4WFE A;  3OR6 C;  2X6C A;  2DYS C;  3OUF A;  1R3L C;  3HPL C;  4JTC B;  5B1A C;  3JYC A;  3AG2 C;  5J9P C;  4R6Z A;  3F7Y C;  3ABM C;  4MSW C;  4MVO A;  4OXS A;  5EC2 C;  3SYP A;  3T2M A;  4G27 B;  2BOB C;  2Q69 A;  2ZXW C;  3EFF K;  4QE9 A;  1K4C C;  3RVZ A;  1P7B A;  2BOC C;  4PDV A;  3K04 A;  2A9H A;  3E86 A;  2DWD C;  2WLI B;  4P30 A;  4ZBM A;  4R7C A;  4P9P A;  4QE7 A;  3STL C;  4LP8 A;  4PDR A;  1ORQ C;  1S5H C;  3PJS K;  4MTO A;  2A0L A;  3AG3 C;  3KG2 A;  4MVS A;  3FB5 C;  2OCC C;  3F7V C;  4EKW A;  5B1B C;  2HJF C;  5KUM A;  5CBF A;  3E89 A;  1R3J C;  2EIN C;  2Q6A A;  3E8G A;  4P2Z A;  3SYC A;  2EIL C;  3E8B A;  1J95 A;  4MW3 A;  5BZB A;  4HYO A;  4JTA B;  5CBH A;  1KKD A;  1OCZ C;  4MS2 A;  5EBL C;  2DYR C;  4KFM A;  3STZ C;  1M56 C;  2Q67 A;  2K1E A;  1OCR C;  4PA9 A;  1BL8 A;  4WFH A;  5EBW C;  2DWE C;  2WLH A;  2HFE C;  3K06 A;  2W0F C;  4GX1 A;  3X2Q C;  4XDK A;  3ZRS A;  5IY5 C;  3GB7 C;  1M57 C;  2HVJ C;  1JVM A;  3K0G A;  3LDE A;  4TWK A;  2Q68 A;  4I9W A;  2QKS A;  4H37 A;  1LNQ A;  2AHZ A;  2EIK C;  2QTO A;  1R3K C;  3E83 A;  4RO2 A;  2KB1 A;  3SPG A;  4RUF A;  2WLM A;  5EC1 C;  4HZ3 A;  4R50 A;  4LCU C;  2H8P C;  4PDM A;  3SPJ A;  3LUT B;  3ZJZ A;  3IFX A;  4QNH B;  2WLI A;  1V55 C; 
#chains in the Genus database with same CATH topology
 4OPA A;  5CA0 A;  1IX9 A;  4NR1 A;  3JCU Z;  5CA3 A;  4NTX A;  1GM7 A;  2UXX A;  2XAJ A;  5E79 Z;  5JWP A;  1PV0 A;  4UV9 A;  3CB2 A;  4LH7 A;  1BMF G;  2B1G A;  5IJ9 B;  1S0V A;  4I55 B;  4GKJ B;  2Q4P A;  3CC7 V;  3ICX A;  2YEV B;  1M56 B;  5LYJ A;  4N21 A;  5IYZ A;  2LW1 A;  4JI8 O;  2YIA A;  1SQQ H;  5H2F Z;  4LFC B;  1IUR A;  3ZBH A;  3N2G B;  4B7K A;  3ETG A;  3RVY A;  4JAA A;  2OT5 A;  3AG1 C;  1GM8 A;  5J9P C;  1ZL8 B;  4ZI7 B;  3BVO A;  4E4E A;  1YTF D;  5FNV B;  1VAR A;  1VF6 A;  2Q5Z A;  1BE3 H;  1MAB G;  1VQN V;  1XNQ O;  4L87 A;  2UXB B;  1NTK H;  1KD1 W;  3CCS V;  4PJ0 Z;  3JD4 A;  1K33 A;  1QCE A;  2BTO A;  2LW7 A;  4J41 A;  4Q20 A;  3U0Z A;  3CME V;  3STZ C;  4JPR A;  5GW7 A;  5IYC O;  1YJW V;  3P3P A;  2ZQM A;  1RSO A;  5JVD A;  2EZP A;  2PTM A;  5LP6 B;  2E5L B;  1XMO O;  4FM2 A;  2EIL B;  3WG7 C;  2XAF A;  3GWO A;  2ZE8 A;  1Y66 A;  3C3T A;  2XOK G;  4DV5 B;  3BHP A;  2XAS A;  3APQ A;  3HKD A;  1KMI Z;  2Y0I A;  4FPP A;  1VQ7 V;  1QHT A;  3GVM A;  3RGB A;  2WA4 A;  1SZX A;  2CAZ C;  2HHH B;  3QF7 A;  1WA8 B;  3ZMZ A;  2ZE7 A;  1KQS U;  1GK9 A;  2WLK A;  3CXH F;  1JA8 A;  2A3Q A;  1QLN A;  3MHH C;  4O4H A;  4KHP O;  4JI4 O;  3CRA A;  1KEC A;  4DR5 B;  1Z5V A;  4BW9 A;  1G8M A;  3L74 H;  1MZE A;  4JI7 O;  4LFB O;  1SF9 A;  4I5S A;  4WBN A;  1Z5W A;  4LR3 A;  4JV5 O;  2YIC A;  3ABK C;  4OX9 O;  4UXN A;  4J7J A;  2DYS C;  3H1K H;  2CDY A;  2E3C A;  3ZRX A;  1WB7 A;  2W6J G;  1JPX A;  2F95 B;  3I55 V;  1GN6 A;  3AK3 A;  1JQ0 A;  2GTS A;  1XNR O;  1Q3E A;  4P30 A;  2HJD A;  5ITZ B;  1JFF A;  2Q73 A;  4JI4 B;  5JQG A;  1R6T A;  3E8B A;  4O2B B;  1K5S A;  3RYH A;  4JYB A;  5LXT B;  3HKD B;  3MAQ A;  1YXB A;  3CPW U;  3NR7 A;  1BT8 A;  4JZG A;  2HFE C;  2YSU B;  2WPD G;  3K3W A;  4XDK A;  4NKG B;  5LMU O;  1XOU A;  3JAR A;  3B8N A;  1B3Q A;  3BPZ A;  4J7Z A;  4RO2 A;  5B3S B;  1QVG U;  2Y69 B;  1TUB B;  5GTI Z;  4I55 A;  2WLI A;  3FD9 A;  5KUK A;  3BFR A;  2UUC B;  5LGU A;  4X64 O;  3JD1 A;  1WNS A;  2R9R B;  3BEH A;  3ASO C;  2Q9L A;  3VQV A;  2ZR3 A;  4O2A A;  1CXZ B;  1RPR A;  2HG5 C;  4DV0 O;  3CEI A;  4O4I A;  4TV8 A;  1XEQ A;  1KC8 W;  1PD3 A;  1SC5 B;  3L73 H;  1GM9 A;  4WFF A;  4D7S A;  4DV0 B;  2JIZ G;  4DR3 B;  2QWN B;  1EN4 A;  3IC7 A;  5GON A;  5H5N A;  1A32 A;  4JTD B;  3OR7 C;  1Q6U A;  1RPO A;  5LA6 A;  1JFF B;  4X64 B;  1OZ0 A;  2UXC B;  3CWB H;  1P7G A;  1IBM O;  1VF5 B;  3SPC A;  4MW8 A;  2VQF B;  4UVA A;  3K03 A;  4WF9 V;  1NH2 D;  2ITC C;  1F4M A;  4WFE A;  4CH5 A;  2RNB A;  2P90 A;  3JYC A;  4H44 B;  2MW2 B;  4YJ3 A;  3ZN0 A;  4JI1 B;  1N34 O;  1DTO A;  2EJ7 A;  4DV2 B;  2A9H A;  2L6L A;  4DR1 O;  1Q6H A;  2KKW A;  3FX7 A;  2DW4 A;  4ZBM A;  1RSO B;  4QJF B;  5H6Q A;  4HNA A;  2UXN A;  3J81 N;  4EKW A;  5KUM A;  5CBF A;  4IT5 A;  1OCO B;  1TVK B;  4K8X A;  1VF7 A;  3ZHQ A;  2QDO A;  2Z5U A;  4QPK A;  3RFR A;  2ZDI C;  1PP9 H;  5FL7 G;  3C90 A;  2GHY A;  2KQX A;  4ZKI A;  1N32 O;  1BQ0 A;  2XT9 A;  3S3X A;  1COW G;  4DRX B;  1W0J G;  4HBN A;  3UT5 A;  1URF A;  5H9C A;  3K59 A;  1NS1 A;  3BCC H;  4XBF A;  2JJ1 G;  5KA6 A;  5KHH A;  1DLB A;  1Q43 A;  5F2V O;  3LSQ A;  4B3T B;  3CHX A;  2N05 A;  4RUF A;  2WLM A;  4DO2 A;  4YY3 B;  3QO5 A;  3SPJ A;  3OEE G;  2IJI A;  1VP7 A;  3JAK B;  1FXV A;  1RM1 C;  3D36 A;  5LOV B;  4U3F H;  3A0R A;  4LF9 B;  4JI6 O;  4B08 A;  5K1P A;  2GBO A;  3FB6 C;  4MVR A;  4KL1 A;  4TV9 A;  3AG4 B;  3CXC U;  1AIL A;  3SYQ A;  3TK1 A;  3UCS C;  4NYK A;  4X1Y A;  4JI7 B;  3E8H A;  4LFB B;  3DGE A;  1VQ8 V;  4NXM O;  5EZY B;  4PEL A;  1Q82 W;  2JDI G;  3D36 C;  1M57 B;  1FPO A;  1EN5 A;  3SYO A;  5FPO A;  2JS3 A;  3THO A;  5EIB D;  4W4K A;  1OJH A;  3QNE A;  1JJ2 U;  4FIP C;  2ITD C;  3FKS G;  1WJZ A;  3D3Q A;  2DYR B;  1XMO B;  1TUE B;  3E22 B;  2CTR A;  2ZM6 B;  4OPH A;  2IU0 A;  3CX5 F;  1FFX A;  3UT5 B;  1H2L A;  3G6E V;  2BOB C;  3OD4 A;  4ASU G;  3ETD A;  4PV1 B;  4A5U B;  1AR4 A;  1OV9 A;  2WSS G;  2EUL A;  4MTO A;  5BY1 A;  3B09 A;  3JAK A;  4IYI A;  2V4D A;  3Q4H A;  1AI7 A;  1Q6I A;  5LP6 C;  4DR2 O;  3T1H B;  1L0N H;  2IW5 A;  5JCO A;  1HDJ A;  4JAS A;  2DWE C;  3K06 A;  4JI0 B;  4X66 O;  4KP4 A;  1N8R W;  3LDE A;  4X1Y B;  2ZE5 A;  1FXK A;  3F5T A;  2QTO A;  5CN0 A;  3E83 A;  2PGG A;  4B3M O;  1HNW O;  2UUB B;  3IFX A;  4LF7 B;  2IU3 A;  1GKF A;  2Q0A A;  1US6 A;  4IIJ A;  3W7S A;  2WAM A;  4CS2 A;  2YI8 A;  5LGT A;  1H2G A;  3AG2 B;  2WLL A;  2ZR2 A;  1FKA O;  1JJO A;  3DC5 A;  2RCV A;  5JJJ B;  2V1D A;  4RQF A;  3VQY A;  4LF4 O;  2FKX A;  1IZ3 A;  3E8F A;  1IBM B;  5BXZ A;  4MTG A;  2Y69 C;  4CBC A;  4JI8 B;  3E2E A;  5L3F A;  2QGN A;  2ATK C;  1Q81 W;  2WLJ A;  4PA6 A;  4O4J A;  2P4V A;  1IXB A;  4TOI A;  1NVP B;  1NTM H;  1KP2 A;  1HNX O;  2AGA A;  5L3C A;  3F7Y C;  4KUM A;  3TXQ A;  2DQ0 A;  2GV9 A;  1ARO P;  5B1B B;  1F4N A;  3K04 A;  4AI8 A;  1HNX B;  4LF5 B;  1YHQ V;  1SET A;  1B04 A;  4D6T H;  4LF4 B;  1MZF A;  4R7C A;  4P9P A;  4X65 B;  4TUY B;  1JOY A;  2JJ2 G;  2OTJ V;  4UCV A;  1EFR G;  3A0B Z;  4FJC C;  3SYC A;  1NT2 B;  1J95 A;  1SA0 A;  5TIS Z;  4K3A A;  3ABL B;  1KKD A;  4KFM A;  4J7K A;  2Q7G A;  3PN1 A;  1HNZ B;  1M56 C;  1AR5 A;  5LMN B;  2WLH A;  1NJI W;  2VQE O;  1YIT V;  1NZ6 A;  4DUZ B;  4K0K B;  3P32 A;  3OMN B;  1I0H A;  4O2B A;  3M99 B;  3LSS A;  5FLX N;  3OTO O;  2P67 A;  2Y4U A;  1DGS A;  1YDX A;  3HKC A;  3JAS B;  1R3K C;  2KB1 A;  1OCZ B;  4HZ3 A;  1L8D A;  3CJH B;  4X1K B;  4X1I B;  5KMG A;  2QM8 A;  2X7R B;  3EXA A;  2HVK C;  4O4J B;  4JI5 B;  3B8M A;  3B77 A;  4G28 B;  2JGD B;  1TAE A;  1TUB A;  1N33 B;  3T1Y O;  4B3S O;  3UM7 A;  4RAI A;  2AHY A;  5KHI A;  2CTP A;  4I50 B;  2JRI A;  4E2L A;  4DK0 A;  2NLJ C;  3M7M X;  2FB5 A;  4YIP A;  4NXN O;  3DXR B;  3L70 H;  3K5M A;  3ZHS A;  4I0X A;  3T1H O;  5JVD B;  4EEQ A;  3RYC B;  2W6I G;  1K97 A;  5IYB O;  4OX9 B;  2DYS B;  3A2F A;  2IJK A;  4CS4 A;  3T4D A;  2RN9 A;  4NB5 A;  2PI5 A;  4FLU A;  1Y4M A;  3CD6 V;  5JH7 B;  2OYQ A;  1QBZ A;  4WFG A;  1XUQ A;  5B1A C;  2RDC A;  2HKO A;  3ZHR A;  4OXS A;  1FFT B;  4U3J A;  3EFF K;  3RN4 A;  3WB1 A;  3ASN B;  1D2D A;  2LJ2 A;  1KU9 A;  2DWD C;  2ODM A;  4GCZ A;  4JV5 B;  3OMI B;  3STL C;  3CCM V;  4UV8 A;  2XND G;  2BCC H;  3PJS K;  1SS3 A;  3N2K A;  1GN4 A;  5LHG A;  2GSM B;  2O57 A;  3JSL A;  4P2Z A;  2VS0 A;  3KCX A;  3L9D A;  3OEH G;  3I5D A;  4DR5 O;  4AIL C;  1K73 W;  3JAL B;  1BHA A;  3K5O A;  4JZ2 A;  5EBW C;  2JS5 A;  3GB7 C;  4AQY B;  4RWU A;  4JYY A;  5K1X A;  1FJG O;  1JVM A;  4B3R B;  3EVK A;  4GYC B;  2EX3 A;  3W7X A;  1GMG A;  1S77 D;  4H37 A;  3K9S A;  5IY5 B;  3SPG A;  2RQ6 A;  5DEC A;  3RYI A;  2UUC O;  4JI6 B;  3G71 V;  1N0J A;  4CC6 A;  1F23 A;  3M8A A;  4IHJ A;  3LUT B;  1HNW B;  1V55 C;  3RYF B;  2JGU A;  1AJN A;  3SYA A;  2JEU A;  1R3I C;  1AI6 A;  4WFB V;  3TJT A;  1ZL8 A;  3ABK B;  2OIG A;  3RWR D;  2P6J A;  1VQ6 V;  4FFB A;  3QG5 A;  4NXN B;  1THZ A;  4PA3 A;  4K35 A;  4JI0 O;  3K5N A;  1K34 A;  3ZMT A;  1BGY H;  1FS0 G;  3OMA B;  1JMK C;  5JJE B;  4PI0 A;  3SJA C;  1BZK A;  4UVB A;  4NTY A;  1FYJ A;  3OW2 U;  1YJN V;  2UU9 B;  1XQ8 A;  5KHK A;  2BE3 A;  1YTF B;  1XL6 A;  3FYE B;  4MVM A;  3OR6 C;  2Q8V A;  1CEZ A;  3FFQ A;  3ABM C;  2CGN A;  2KG7 A;  3DC6 A;  1IBL B;  2EBO A;  4DUZ O;  1YZB A;  4H0L B;  1ORQ C;  3RYI B;  1QVF U;  2VRZ A;  2UUA O;  1K8A W;  5B1B C;  2BTQ A;  5CBH A;  5LA6 B;  1K7D A;  4DR4 B;  1FJG B;  1AI4 A;  3HKE B;  4PA9 A;  3G6B A;  3X2Q C;  2W0F C;  4YXW G;  5CB4 A;  1RP3 B;  4CH4 A;  1IVS A;  2QTS A;  2W0X A;  3JD2 A;  2OCH A;  4FLY A;  4DW0 A;  2H8P C;  2OWO A;  5IYZ B;  1AP6 A;  1HW7 A;  1AVM A;  2CTW A;  5A2Q N;  5KHJ A;  4WBN B;  4LF8 B;  3ZMS A;  1FD9 A;  4X8A A;  1ZLZ A;  3RYC A;  3VBB A;  5A9G A;  3OUS A;  1BS3 A;  2VWJ A;  4FLX A;  1YIJ V;  4ZI7 A;  4HAM A;  5E1A C;  1M90 W;  2WLL B;  4RQE A;  2XAH A;  2ZCE A;  1Q86 W;  4DXW A;  1CP9 A;  5J2U A;  5FPR A;  1EZJ A;  1QR8 A;  5JQG B;  3K0D A;  1KYO F;  5B3S C;  4U3J B;  2DMX A;  5C8Y A;  4DV4 B;  3ABL C;  3JAW B;  5KX5 B;  4BAY A;  3H1J H;  5LXT A;  5J2T B;  2NNU A;  1R6K A;  2QWR B;  3H01 A;  1I5Y A;  2FYU H;  2V7Q G;  2EIM C;  3AG7 A;  4MTF A;  5IWA O;  4Z1M G;  5HFL A;  1S3J A;  5CMU A;  1S5J A;  2CGO A;  4ICG A;  4DR7 O;  1P7B A;  4AHC A;  3E86 A;  3OFN G;  4UB6 Z;  3ZED A;  2YXH A;  3I56 V;  2AZ2 A;  3BA8 A;  5B1A B;  2JEX A;  4PDR A;  2UXC O;  5D5Q A;  1KUQ A;  5L3B A;  1QU7 A;  3E89 A;  4DR2 B;  2EIN C;  1O9H A;  5EIB C;  4J10 A;  4FM1 A;  1L1F A;  1OCZ C;  3J80 N;  4JI3 O;  3H9V A;  1EM1 A;  3JAT B;  1AB3 A;  1VQ5 V;  3ETE A;  3CRM A;  3CSX A;  3JSN A;  1L0L H;  2HVJ C;  2YIB A;  4LC1 A;  1MG1 A;  5KA5 A;  4FK5 C;  1AI5 A;  4DV5 O;  1KBH A;  5J2U B;  3ABT A;  4CS3 A;  1HP8 A;  3B2E E;  1S5L Z;  1I08 A;  2R72 A;  1WAZ A;  1SKV A;  2X6A A;  1X4T A;  3HKC B;  1MOF A;  3JAS A;  1Q8I A;  2CK3 G;  1P4R A;  1EZV H;  1MSW D;  4GT1 A;  3Q4H B;  2ZE6 A;  5EK0 A;  1M9N A;  3O65 A;  1ZUQ A;  3MDS A;  3T4Z A;  4R8C A;  4H33 A;  4P9O A;  3JCZ A;  1NKD A;  4DR4 O;  2EZO A;  4MT8 A;  5C93 A;  4JI5 O;  2UUB O;  3J7A U;  1G4Y B;  1H2N A;  4LNU A;  5LGN A;  3SPI A;  1J5E O;  1NTZ H;  5EBM C;  4I0X B;  1U96 A;  4CH3 A;  3JAT A;  4IYH A;  3TXS A;  1PNL A;  2LO1 A;  1SER A;  1R1B A;  5L3E A;  5EC2 C;  3SYP A;  3W7U A;  1ROP A;  4FFK A;  4PDV A;  1IXM A;  3ZRW A;  4LF7 O;  1D5A A;  2PYJ A;  5IDJ A;  5BMV B;  1P49 A;  1I94 O;  2EIL C;  3JD0 A;  1XHX A;  2Q7E A;  2B9Z A;  3L71 H;  2GUZ A;  4CH6 A;  4UFZ A;  3W7W A;  2Q67 A;  4ZIB A;  1NR1 A;  2YXY A;  2XAG A;  2YDE A;  4NVP A;  4EB6 A;  1H2S B;  4TUY A;  3G67 A;  4DR1 B;  1OCC B;  3P3N A;  3QO8 A;  1GH6 A;  2XUM A;  1AJQ A;  2F93 B;  1QNM A;  2Z0A A;  5JJN B;  4R50 A;  3OAA G;  4X9Q A;  3ZHV A;  3JAM N;  1AR1 B;  1AP5 A;  1B06 A;  3QO7 A;  1FFX B;  1XRE A;  3JAW A;  1Y76 B;  5CBG A;  3QVN A;  2ZM6 O;  1VQ9 V;  3CCR V;  2ETN A;  3ML0 A;  4DV6 B;  4ZHQ B;  3BA9 A;  1NI8 A;  1W2B U;  3ZRW B;  4ABM A;  4PDL A;  5B1O A;  3SPH A;  1KKC A;  1XIL A;  4FFB B;  1M4U A;  4UUJ C;  4FZ0 A;  1XNQ B;  2EIJ C;  3RW0 A;  5IJ9 A;  4GZR B;  1XNR B;  3X2Q B;  3SJQ C;  3K08 A;  3MHS C;  2JVD A;  2YEV A;  3OTF A;  1OCR B;  4DW1 A;  1WN7 A;  3QTC A;  4EFE A;  1XMQ B;  1HR0 B;  5IWA B;  4DR7 B;  2HR3 A;  4J42 A;  4G27 B;  4LF9 O;  4TQF A;  1VF6 C;  2BOC C;  1V54 B;  2CTQ A;  2WWW A;  1HNZ O;  1K5Q A;  4LP8 A;  3BAB A;  1H38 A;  3CS5 A;  3AG3 C;  2CE4 A;  1YSC A;  3DXR A;  5BR8 O;  2MK3 A;  2Y0P A;  3N2G A;  3T1Y B;  3UO3 A;  4I4T A;  5BZB A;  2NR5 A;  2QM4 A;  4JI2 B;  3KCY A;  2LP7 A;  1VMG A;  1BL8 A;  4F4L A;  4GX1 A;  5IY5 C;  3S3W A;  1FXH A;  1Y6X A;  3NXS A;  3HKB A;  3H1I H;  2BTQ B;  4GLX A;  4DV2 O;  1H2K A;  3OGI B;  3GWK C;  2HLD G;  5HFM A;  1H2M A;  4LWS B;  4B3S B;  1S76 D;  4GKK O;  4LCU C;  1Q7Y W;  3TGU H;  1IBK B;  2E5L O;  1J5E B;  3K79 A;  5D5P A;  4EFB A;  4X89 A;  2DQ3 A;  2C2A A;  1I5X A;  2QKC A;  4JAU A;  4UCO A;  2IM9 A;  2VQF O;  4C7U A;  4JYC A;  3ZX6 A;  2EJR A;  1EN6 A;  2EIM B;  5LHH A;  3A0H Z;  4O4L A;  5LP6 A;  1W0K G;  2XTA A;  3L75 H;  1WP8 A;  3T1C A;  1NVP D;  1Y74 A;  1OCO C;  2JK5 C;  3SR2 C;  5LL6 Y;  3FB7 C;  3IGA C;  1N4C A;  4O4H B;  2QWP B;  3JD3 A;  3WU2 Z;  3K5L A;  2ZIN A;  2E76 B;  2P06 A;  3K9A A;  2YC0 A;  1SQV H;  3KKY A;  3OUF A;  5J2T A;  1G1X B;  3AG2 C;  1UJW B;  3K57 A;  3T2M A;  2ZXW C;  2ZT9 B;  3RVZ A;  5IJ0 B;  1N36 B;  4LF6 O;  4D7T A;  4DV1 O;  2DN9 A;  3CCV V;  4X1K A;  3OT7 A;  3CCL V;  2HP8 A;  1PNK A;  1S5H C;  1NH2 B;  1V55 B;  4JGS A;  3U11 A;  3MD0 A;  4JI3 B;  3E8G A;  4JI2 O;  1RM1 B;  4MW3 A;  4DR6 O;  5LMU B;  3LNN A;  1SES A;  3EHB B;  5JCO C;  2UXB O;  4WFH A;  2EIK B;  1MSD A;  1O9G A;  2YUA A;  4B3M B;  3DTU B;  1SQB H;  4I9W A;  2R70 A;  3W7T A;  3CCE V;  2AHZ A;  1PM9 A;  1FXK C;  1XMQ O;  5LHI A;  5B66 Z;  1U97 A;  3UO2 A;  5JH7 A;  2F4V B;  2OCC B;  3HR0 A;  2K9P A;  5KLV H;  2A06 H;  2IBZ H;  1K4D C;  1YVW A;  2X6B A;  3WB2 A;  2Q0O C;  4YJ2 B;  1F7Y A;  4GX0 A;  4KHP B;  1DF4 A;  3ABM B;  5IYD O;  1NR7 A;  2LFS A;  2PF4 E;  5DN6 G;  4TT3 G;  3HKE A;  3SJC C;  1MNG A;  3O9O A;  2H94 A;  3B4S A;  2A79 B;  4BIZ A;  2UXD O;  4F6R A;  1YI2 V;  4I7Z B;  2QSA A;  3ZIA G;  1PKX A;  3JAL A;  1E79 G;  4NXM B;  2LGQ A;  4PA7 A;  1JX9 A;  4LF8 O;  1BQZ A;  2AW9 A;  5GON B;  1VQO V;  3AG4 C;  2OIE A;  5KAI Z;  2E75 B;  3H1L H;  3CRQ A;  4FLV A;  3HPL C;  1Z2G A;  3CC2 V;  4GKK B;  1LUV A;  5DED A;  2Q69 A;  4FMT A;  5CA1 B;  1N32 B;  4IGG A;  2FTK A;  4BR6 A;  1HWY A;  2CUG A;  3F7V C;  2HJF C;  3WG7 B;  4WCE V;  1DK1 A;  4J11 A;  2ZDI A;  3E35 A;  4JAV A;  3U10 A;  3IC9 A;  2LQT A;  1NU1 H;  2IJJ A;  4MS2 A;  4X62 B;  2DYR C;  2X0L A;  1BSM A;  1OCR C;  4LFA O;  3A8T A;  2Z3Y A;  2LFR A;  4YJ3 B;  4JI1 O;  4YIO A;  2QR4 A;  1N34 B;  3FAV B;  3BY6 A;  2G38 A;  4X20 A;  4UCT A;  3CCJ V;  1XI1 A;  2QKS A;  1LNQ A;  4DRX A;  4F6R B;  2EIJ B;  4HNA B;  2JGD A;  4UCS A;  3OM3 B;  1QR9 A;  2PY5 A;  4DV3 B;  2QM7 A;  4QIW F;  2P22 C;  4I50 A;  4X88 A;  4L8J A;  1TA8 A;  1N0N A;  2RJZ A;  1XHZ A;  4JF3 A;  1K9M W;  4YY3 O;  3LDD A;  4J9Z B;  4ZOL B;  1PNM A;  4DR6 B;  4DV4 O;  3IAY A;  1KB9 F;  2YXL A;  2XAQ A;  1V54 C;  1UFI A;  4FM0 A;  4TSF G;  3ASN C;  3OTO B;  1M5I A;  1FAF A;  1ZTE A;  2IJH A;  2LGW A;  2KSD A;  3APO A;  2VWK A;  4WFA V;  3AEI A;  3JAR B;  4W4L A;  1GO3 F;  4GKJ O;  5DM6 V;  2Y48 A;  5CB4 B;  1IBL O;  5GTH Z;  3ZMU A;  4U7N A;  3ABU A;  2R9I A;  4FLT A;  4BIO A;  4DV1 B;  4JYA B;  3D8C A;  1GRJ A;  1YF2 A;  4O2A B;  2R9A A;  3CCQ V;  4R6Z A;  3CMA V;  1N36 O;  3FAV A;  3N27 A;  4MSW C;  4LH6 A;  3N2K B;  4O4I B;  4TV8 B;  2QWQ B;  2QWO B;  1OHH G;  4AQY O;  2UU9 O;  2Q7H A;  1E1R G;  1XBL A;  2ZXW B;  3KG2 A;  2ARH A;  2ZNJ A;  1R3J C;  4U7O A;  4QGP A;  2PZS A;  2NN4 A;  3ZHU A;  2YS8 A;  4UCU A;  4DR3 O;  4LNU B;  1PL0 A;  5KAF Z;  3SGI A;  1SRY A;  2M7W A;  2GTA A;  1M57 C;  3AK1 A;  3K0G A;  5B1N A;  4IHJ B;  4TWK A;  1VIB A;  1CPY A;  5BMV A;  2EIK C;  1F51 A;  4YJ2 A;  1R73 A;  2P4K A;  2YIB D;  2GUZ B;  2B1I A;  1PL4 A;  4OGQ B;  4UVC A;  4G2K A;  1IDS A;  4PA4 A;  1YJ9 V;  5L3G A;  4B3T O;  4LFC O;  3FYI B;  1WPB A;  3BRC A;  3KZI Z;  2F66 C;  3TET A;  4IIJ B;  1GN3 A;  4BW5 A;  1EBO A;  4MVZ A;  4PI2 A;  4MVQ A;  3FB8 C;  4GUN A;  1WLE A;  3VOU A;  4EB6 B;  1ZWI C;  2ZIM A;  2RMK B;  1W59 A;  1QLE B;  3CE2 A;  1Y76 A;  4RUE A;  5B5E Z;  1OCC C;  1Q90 D;  3G80 A;  1D5N A;  5FNV A;  3LDC A;  4FLW A;  2ZD9 A;  2F43 G;  4DV6 O;  4MTX A;  3SJB C;  3RT3 C;  1JCH A;  4FVM A;  4JTC B;  2ILM A;  3G4S V;  4MVO A;  1E1Q G;  2DOS A;  3AG3 B;  5KHG A;  2UXD B;  4DUY B;  2P5O A;  2WLI B;  4PD4 F;  3VQW A;  1PPJ H;  4X20 B;  4ZHQ A;  4K0K O;  1VQP V;  1X59 A;  2VQE B;  3CRC A;  2A0L A;  1GN2 A;  2OCC C;  4KXR A;  5IJ0 A;  3VQX A;  2Q6A A;  4DYL A;  1S72 V;  4CZZ A;  1UPG A;  3ZHT A;  4HYO A;  3UQ8 A;  2ZNI A;  2K1E A;  1VQM V;  1B6Q A;  4QPJ A;  4H13 B;  3B40 A;  3K58 A;  3DSQ A;  1VQK V;  3IJ4 A;  1SA0 B;  4LF5 O;  4DUY O;  2Q68 A;  1I94 B;  2QJ1 A;  2ZIO A;  4PHZ A;  2HEP A;  3R66 A;  1NQT A;  2F1M A;  1LR1 A;  3ETQ A;  3ZJZ A;  4QNH B;  2QA4 V;  2GDS A;  5KX5 A;  1VEW A;  2BSK B;  2N74 A;  1ZAU A;  1SQX H;  4FZ1 A;  3CP1 A;  1WA8 A;  1Y67 A;  3F5W C;  4I4T B;  4NTW A;  1P84 F;  3OGC C;  2WLN A;  2H3O A;  4LWS A;  1I7F A;  2AXT Z;  5C8Y B;  1TGO A;  4TQD A;  3ZCC A;  4GX2 A;  4LFA B;  3HKB B;  2A7W A;  4BWA A;  5EYP A;  2D3O W;  4XDJ A;  1TVK A;  5CA0 B;  3CJH A;  1FXK B;  1N33 O;  3ZN1 A;  1YEW A;  2QEX V;  3LSU A;  3AG1 B;  3ZMV A;  2P7T C;  2PI4 A;  3UKM A;  3R65 A;  3TCU A;  1H8E G;  1GTO A;  1QQC A;  3H1H H;  1Q5O A;  3C3S A;  4Q6G A;  2FL4 A;  4J9Y B;  1XDC A;  1XL4 A;  1SZT A;  4LF6 B;  2ADQ B;  2F23 A;  1R3L C;  4JYA O;  1LUW A;  1KP3 A;  1K4C C;  3RYH B;  1Y74 B;  2PUS A;  2N04 A;  4MVS A;  4N23 A;  3FB5 C;  4FLZ A;  1M93 A;  3ASO B;  1GAX A;  4JTA B;  4BIU A;  5CA1 A;  5EBL C;  1NBM G;  4UCR A;  5IE9 A;  3D3I A;  5H6R A;  1IBK O;  3WFV A;  1ENV A;  4I9Q A;  1VQ4 V;  1JR9 A;  2QKA A;  2YID A;  2FML A;  5EYP B;  5LBQ A;  3WB0 A;  5EC1 C;  1M1K W;  4DV3 O;  4Z2W A;  4DK1 A;  5EZY A;  4B7E A;  1MA1 A;  2D2C B;  1K3E A;  5IT9 N;  2E74 B;  5BR8 B;  4J80 A;  1R6N A;  4DV7 O;  1G6U A;  1WB8 A;  3LNM B;  4GX5 A;  3CCU V;  4X66 B;  1VQL V;  2CH7 B;  2OTL V;  2ZKO A;  2XHB A;  4ZOL A;  3RBZ A;  1K92 A;  3CRR A;  2L35 A;  3E22 A;  2YI9 A;  1SQG A;  4YHH B;  4XDL A;  5AG2 A;  3CYO A;  1HR0 O;  2PYL A;  2AZ0 A;  3RYF A;  2IH3 C;  4YHH O;  4K8Z A;  1T5E A;  1QLE C;  2IH1 C;  4LBE C;  4X1I A;  5KMG B;  4MVU A;  3OE7 G;  2X6C A;  1RFY A;  5L3D A;  3P30 A;  3HB3 B;  2DE0 X;  4QE9 A;  4Z1V A;  3ZRV A;  4B3R O;  1MMM A;  4QE7 A;  2HHH O;  5LYJ B;  2M6Y A;  3SDL A;  1DF5 A;  1YCI A;  1WPX A;  4DV7 B;  4X62 O;  3ZS8 C;  2WA3 A;  1BCC H;  3CC4 V;  1AJP A;  1SQF A;  2Y4T A;  3ZRS A;  2BSK A;  1H8H G;  4IL6 Z;  2ADP A;  2QE7 G;  5LMN O;  2B5U A;  4F6E A;  1ZSP A;  4O4L B;  5ITZ A;  1ZX3 A;  3L72 H;  1WP7 A;  2CH7 A;  2KG7 B;  5LOV A;  2F4V O;  1SQP H;  3AK2 A;  3BAA A;  2UUA B;  4CC5 A;  2DJV A;  1BHB A;  4UB8 Z;  4TV9 B;  4PDM A;  4X65 O;  2EIN B;  1V9P A; 
#chains in the Genus database with same CATH homology
 2IU3 A;  2QM7 A;  4QIW F;  2X6A A;  1GKF A;  3W7S A;  4X88 A;  1MOF A;  2WAM A;  5LGT A;  1H2G A;  3AG2 B;  2CK3 G;  4JF3 A;  1K9M W;  2WLL A;  5CA3 A;  3LDD A;  1P4R A;  4J9Z B;  1PNM A;  1GM7 A;  2UXX A;  2XAJ A;  1MSW D;  4GT1 A;  2ZR2 A;  2XAQ A;  5EK0 A;  1M9N A;  2V1D A;  1V54 C;  4UV9 A;  4TSF G;  3ASN C;  1BMF G;  4RQF A;  2B1G A;  2IJH A;  1S0V A;  3E8F A;  4WFA V;  4MTG A;  2Y69 C;  4CBC A;  3CC7 V;  3T4Z A;  4R8C A;  4H33 A;  4P9O A;  3E2E A;  2YEV B;  1M56 B;  3JCZ A;  1NKD A;  3AEI A;  4N21 A;  5L3F A;  2EZO A;  1GO3 F;  2ATK C;  1Q81 W;  4MT8 A;  2WLJ A;  5C93 A;  4PA6 A;  5DM6 V;  2Y48 A;  1G4Y B;  5LGN A;  3SPI A;  3ZMU A;  4U7N A;  3ABU A;  3ETG A;  3RVY A;  5EBM C;  2R9I A;  1NVP B;  2OT5 A;  3AG1 C;  1PNL A;  1KP2 A;  5L3C A;  1GM8 A;  3CCQ V;  5J9P C;  1SER A;  4R6Z A;  3F7Y C;  4KUM A;  4MSW C;  5L3E A;  3CMA V;  5EC2 C;  2DQ0 A;  3SYP A;  1ARO P;  3W7U A;  1YTF D;  1ROP A;  5B1B B;  1F4N A;  4PDV A;  3K04 A;  1IXM A;  3ZRW A;  1YHQ V;  1SET A;  4R7C A;  4P9P A;  1MAB G;  1OHH G;  1E1R G;  1JOY A;  1VQN V;  2JJ2 G;  4L87 A;  2OTJ V;  5IDJ A;  2ZXW B;  3KG2 A;  1EFR G;  4FJC C;  1KD1 W;  3CCS V;  1R3J C;  4U7O A;  3SYC A;  3JD4 A;  1K33 A;  1QCE A;  2EIL C;  1J95 A;  3JD0 A;  4Q20 A;  3CME V;  3ABL B;  1KKD A;  4KFM A;  3STZ C;  4JPR A;  1M56 C;  5GW7 A;  2Q67 A;  3W7W A;  2WLH A;  5IYC O;  1NJI W;  1YIT V;  1YJW V;  1NR1 A;  1PL0 A;  2XAG A;  2ZQM A;  1SRY A;  3P32 A;  2M7W A;  1M57 C;  3OMN B;  3K0G A;  3M99 B;  3LSS A;  5B1N A;  4TWK A;  2P67 A;  1OCC B;  1CPY A;  3QO8 A;  2EIK C;  1F51 A;  1AJQ A;  1R3K C;  2EZP A;  1R73 A;  2KB1 A;  1OCZ B;  4HZ3 A;  4R50 A;  3OAA G;  2B1I A;  4UVC A;  1AR1 B;  2EIL B;  3WG7 C;  4G2K A;  2XAF A;  2QM8 A;  2X7R B;  3GWO A;  4PA4 A;  1Y66 A;  2HVK C;  2XOK G;  5L3G A;  3QO7 A;  1YJ9 V;  3FYI B;  2XAS A;  3B8M A;  3B77 A;  4G28 B;  4FPP A;  1VQ7 V;  5CBG A;  3UM7 A;  1VQ9 V;  3CCR V;  4RAI A;  2AHY A;  3ML0 A;  3TET A;  4BW5 A;  1EBO A;  4MVZ A;  4E2L A;  4MVQ A;  3FB8 C;  2NLJ C;  3ZMZ A;  1KQS U;  1WLE A;  3VOU A;  1W2B U;  3ZRW B;  1GK9 A;  4PDL A;  2WLK A;  5B1O A;  1ZWI C;  3SPH A;  1QLN A;  3MHH C;  1QLE B;  1KEC A;  4UUJ C;  4RUE A;  1OCC C;  2EIJ C;  2W6I G;  3RW0 A;  1G8M A;  1K97 A;  5IYB O;  2DYS B;  2IJK A;  3T4D A;  3X2Q B;  3SJQ C;  2PI5 A;  3K08 A;  1Y4M A;  3LDC A;  4I5S A;  3CD6 V;  3MHS C;  2YEV A;  2ZD9 A;  2F43 G;  1QBZ A;  4WFG A;  3ABK C;  1OCR B;  4MTX A;  4UXN A;  1JCH A;  2DYS C;  4JTC B;  5B1A C;  3ZRX A;  2W6J G;  1JPX A;  2HR3 A;  2HKO A;  1E1Q G;  4MVO A;  4OXS A;  3I55 V;  3G4S V;  1FFT B;  4G27 B;  3EFF K;  3AG3 B;  3ASN B;  2BOC C;  1V54 B;  1JQ0 A;  2DWD C;  2WLI B;  2WWW A;  4P30 A;  4GCZ A;  1K5Q A;  3OMI B;  3STL C;  3CCM V;  4LP8 A;  4UV8 A;  2XND G;  1VQP V;  1H38 A;  3PJS K;  2A0L A;  3AG3 C;  1YSC A;  2OCC C;  5LHG A;  2GSM B;  2MK3 A;  2Q6A A;  4P2Z A;  1S72 V;  4CZZ A;  3E8B A;  3OEH G;  1K5S A;  5BZB A;  4HYO A;  1K73 W;  4JYB A;  2LP7 A;  1BHA A;  3CPW U;  2K1E A;  1BL8 A;  5EBW C;  4F4L A;  1VQM V;  4GX1 A;  2HFE C;  1B6Q A;  2WPD G;  2YSU B;  3K3W A;  4QPJ A;  4XDK A;  5IY5 C;  3GB7 C;  1FXH A;  3NXS A;  1VQK V;  1JVM A;  2Q68 A;  3W7X A;  1GMG A;  1S77 D;  4H37 A;  2HLD G;  3B8N A;  5HFM A;  5IY5 B;  1S76 D;  4RO2 A;  5B3S B;  1QVG U;  3SPG A;  1NQT A;  2Y69 B;  3G71 V;  4LCU C;  1Q7Y W;  1F23 A;  3LUT B;  3ZJZ A;  4QNH B;  2WLI A;  2QA4 V;  1V55 C;  5KUK A;  5LGU A;  1AJN A;  3JD1 A;  3SYA A;  2R9R B;  3BEH A;  3K79 A;  2JEU A;  3ASO C;  1R3I C;  1AI6 A;  4X89 A;  2DQ3 A;  2C2A A;  2ZR3 A;  3CP1 A;  4WFB V;  1RPR A;  1I5X A;  2HG5 C;  3ABK B;  4JAU A;  3F5W C;  2P6J A;  3OGC C;  2WLN A;  1VQ6 V;  1KC8 W;  1PD3 A;  1THZ A;  3ZCC A;  4PA3 A;  1K34 A;  1GM9 A;  4GX2 A;  4JYC A;  2EJR A;  4WFF A;  2EIM B;  3ZMT A;  2JIZ G;  5LHH A;  1FS0 G;  3OMA B;  2D3O W;  3IC7 A;  4XDJ A;  4JTD B;  3OR7 C;  4UVB A;  3OW2 U;  1FXK B;  1RPO A;  1YJN V;  3ZN1 A;  2QEX V;  1W0K G;  1OZ0 A;  3AG1 B;  3ZMV A;  2P7T C;  3T1C A;  1NVP D;  2PI4 A;  3SPC A;  3UKM A;  3R65 A;  1OCO C;  2JK5 C;  4MW8 A;  3TCU A;  1H8E G;  3FB7 C;  3IGA C;  1GTO A;  4UVA A;  3K03 A;  3JD3 A;  4WF9 V;  1NH2 D;  2ITC C;  1YTF B;  4J9Y B;  3K9A A;  1F4M A;  1XL6 A;  1XL4 A;  3FYE B;  4MVM A;  4WFE A;  1SZT A;  3OR6 C;  1CEZ A;  3OUF A;  1R3L C;  2P90 A;  3JYC A;  3AG2 C;  3ZN0 A;  3ABM C;  1UJW B;  3T2M A;  1KP3 A;  2ZXW C;  3RVZ A;  1K4C C;  1DTO A;  2A9H A;  2EBO A;  3CCV V;  2DW4 A;  4ZBM A;  3CCL V;  4QJF B;  1PNK A;  5H6Q A;  1ORQ C;  1S5H C;  1QVF U;  1NH2 B;  2UXN A;  4MVS A;  4N23 A;  3FB5 C;  1V55 B;  4JGS A;  4EKW A;  3MD0 A;  5B1B C;  5KUM A;  3ASO B;  5CBF A;  1OCO B;  3E8G A;  2Z5U A;  4QPK A;  1RM1 B;  4MW3 A;  2ZDI C;  4JTA B;  5CBH A;  4BIU A;  1K7D A;  5EBL C;  5FL7 G;  2GHY A;  4ZKI A;  1NBM G;  1AI4 A;  1SES A;  3EHB B;  1COW G;  4PA9 A;  4WFH A;  2EIK B;  3X2Q C;  2W0F C;  4YXW G;  1W0J G;  3D3I A;  5H6R A;  3WFV A;  3DTU B;  5H9C A;  1ENV A;  4I9W A;  4XBF A;  2JJ1 G;  5KA6 A;  3W7T A;  1DLB A;  2AHZ A;  3CCE V;  1VQ4 V;  3JD2 A;  1FXK C;  3LSQ A;  5LHI A;  5LBQ A;  4RUF A;  2WLM A;  5EC1 C;  1M1K W;  4DO2 A;  3QO5 A;  2H8P C;  3SPJ A;  3OEE G;  2IJI A;  1FXV A;  1RM1 C;  3D36 A;  3ZMS A;  3A0R A;  2OCC B;  4X8A A;  1K3E A;  3FB6 C;  1K4D C;  4MVR A;  3VBB A;  2X6B A;  3AG4 B;  3CXC U;  1R6N A;  3OUS A;  3SYQ A;  4GX0 A;  1DF4 A;  3ABM B;  3LNM B;  4GX5 A;  3TK1 A;  5IYD O;  3CCU V;  1VQL V;  1NR7 A;  2LFS A;  5DN6 G;  4TT3 G;  1YIJ V;  4HAM A;  3E8H A;  2OTL V;  3DGE A;  5E1A C;  1M90 W;  1VQ8 V;  2WLL B;  4RQE A;  2XAH A;  1K92 A;  3RBZ A;  4PEL A;  1Q86 W;  2H94 A;  2A79 B;  4DXW A;  4BIZ A;  1Q82 W;  1CP9 A;  4XDL A;  1YI2 V;  2JDI G;  1EZJ A;  1QR8 A;  1M57 B;  3K0D A;  5B3S C;  3SYO A;  3CYO A;  3ZIA G;  1PKX A;  3ABL C;  3QNE A;  4BAY A;  1E79 G;  2IH3 C;  2NNU A;  1R6K A;  1JJ2 U;  4FIP C;  2ITD C;  4PA7 A;  1JX9 A;  3FKS G;  3H01 A;  1I5Y A;  1QLE C;  2IH1 C;  4LBE C;  1VQO V;  3AG4 C;  2V7Q G;  2DYR B;  2EIM C;  4MVU A;  3OE7 G;  1TUE B;  4MTF A;  4Z1M G;  2X6C A;  5L3D A;  2IU0 A;  3P30 A;  3HPL C;  3CC2 V;  3HB3 B;  5HFL A;  1S3J A;  5CMU A;  3G6E V;  2BOB C;  2Q69 A;  4QE9 A;  4FMT A;  3ZRV A;  1P7B A;  3E86 A;  3OFN G;  4ASU G;  3ETD A;  3I56 V;  4QE7 A;  5B1A B;  2JEX A;  4PDR A;  2FTK A;  1DF5 A;  2WSS G;  4MTO A;  1HWY A;  1WPX A;  3F7V C;  2HJF C;  3WG7 B;  4WCE V;  5L3B A;  3E89 A;  2EIN C;  2ZDI A;  3E35 A;  4JAV A;  1L1F A;  1AI7 A;  3CC4 V;  1OCZ C;  2IJJ A;  1AJP A;  4MS2 A;  2DYR C;  2X0L A;  2IW5 A;  1OCR C;  1VQ5 V;  3ETE A;  4JAS A;  3ZRS A;  2DWE C;  3K06 A;  1H8H G;  2Z3Y A;  2LFR A;  2QE7 G;  4KP4 A;  2B5U A;  1N8R W;  2HVJ C;  3BY6 A;  4LC1 A;  3LDE A;  3CCJ V;  1MG1 A;  5KA5 A;  4FK5 C;  2QKS A;  1LNQ A;  1FXK A;  1AI5 A;  2QTO A;  5CN0 A;  3E83 A;  1K8A W;  2EIJ B;  3ABT A;  1BHB A;  4PDM A;  2EIN B;  3IFX A;  3OM3 B;  1QR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...