3K03A

Crystal structure of cng mimicking nak mutant, nak-dtpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k03A00
1OCCC 2QTOA 2EILC 3AG3C 4PA6A 2AHYA 4MVZA 5BZBA 1R3KC 4MW3A 4DXWA 3BEHA 4LBEC 4MVSA 2KB1A 4WFHA 5CBHA 3RBZA 4MVRA 3SYQA 1R3IC 3HPLC 1ORQC 2IH3C 2WLKA 5EBWC 4QNHB 3K08A 3LUTB 4I9WA 1XL4A 4PDMA 3SYPA 3SYOA 5B1AC 4CBCA 3FB8C 4PDVA 3FB7C 4HZ3A 1JVMA 2WLNA 4R7CA 4F4LA 3WG7C 2HVKC 3T4ZA 3T2MA 3K0DA 3FB5C 3IFXA 4P2ZA 4X8AA 4GX5A 1S5HC 2WLLA 2H8PC 2HG5C 3ABMC 3R65A 3SYAA 2ITDC 2DWEC 1OCZC 2QKSA 1K4CC 3KG2A 3UKMA 4J9YB 1OCRC 5B3SC 3VOUA 3SPGA 3STZC 3T1CA 3F7YC 2EIMC 2HJFC 2AHZA 2Q69A 2Y69C 2DYSC 2ITCC 3LNMB 3RVYA 4MVQA 4ZBMA 4MW8A 3SPIA 1V54C 5EC2C 4P9PA 2ATKC 2X6CA 4KFMA 3TCUA 4R6ZA 2WLHA 5CBFA 3AG4C 3SJQC 2NLJC 4UUJC 4PA4A 2WLMA 3ABLC 3E8HA 3UM7A 3LDDA 4X88A 4GX2A 4H33A 4RUEA 2WLJA 2K1EA 2DYRC 4XDKA 2X6BA 4TWKA 1V55C 4PA3A 2OCCC 3SPCA 2BOBC 2WLIA 4P30A 1M57C 4J9ZB 2DWDC 1LNQA 5EC1C 2WLIB 3E8BA 4JTAB 5J9PC 4PDRA 4MTOA 5EBMC 1G4YB 3LDEA 4G28B 2R9RB 5EK0A 2A0LA 3SPHA 3E8GA 4XDLA 4WFGA 3FB6C 3TETA 2Q68A 3AG2C 5CBGA 3OR6C 3ABKC 2EINC 3EFFK 4H37A 5E1AC 1R3LC 4GX1A 5KUMA 3OGCC 3RW0A 3ASNC 4R8CA 3PJSK 4G27B 3IGAC 1OCOC 2A9HA 4JTCB 4R50A 4PA9A 3STLC 1KKDA 2Q6AA 2EIKC 4LCUC 2WLLB 1BL8A 3OUSA 4QE7A 1J95A 4RUFA 5EBLC 3LDCA 3SYCA 4EKWA 3JYCA 3ZRSA 4MVUA 4RO2A 4MTFA 4HYOA 3X2QC 2EIJC 1R3JC 3F7VC 1XL6A 3E89A 4PA7A 4P9OA 4WFEA 4XDJA 3E86A 4MTGA 3SPJA 3AG1C 2YEVA 3ASOC 3E8FA 2P7TC 4OXSA 4MSWC 2Q67A 5IY5C 4WFFA 2X6AA 2HFEC 3F5WC 1K4DC 3T4DA 4BW5A 1QLEC 3GB7C 2HVJC 1P7BA 1M56C 4PDLA 3K03A 2JK5C 2ZD9A 4X89A 3K0GA 3K04A 4JTDB 5KUKA 4QE9A 2IH1C 4RAIA 3E83A 1ZWIC 2A79B 2BOCC 4MS2A 2ZXWC 4GX0A 4MVOA 3RVZA 3ZJZA 3OUFA 2W0FC 5B1BC 3OR7C 3K06A 4LP8A 4MVMA
chains in the Genus database with same CATH superfamily
2ODMA 1YZBA 4PI0A 3K9AA 1N34O 1R3KC 1EZJA 4J41A 3OAAG 3W7XA 1K92A 1H2GA 1TVKA 4PI2A 5LGNA 2HHHO 2A7WA 4HZ3A 4JYBA 3BVOA 3RYHB 1QQCA 3I55V 4TV8A 4YJ3A 2BTQB 2YC0A 4DV4B 4BR6A 2ITDC 2IU3A 1MMMA 5GONB 1K33A 2HJFC 4MTXA 3LNMB 4JI7B 4NTWA 4I4TB 2ATKC 2Q73A 5LHHA 1S5JA 4N23A 4GLXA 4LH7A 1I5XA 4U7NA 2JJ1G 3ABUA 4DR4B 1WLEA 1XHZA 4RUEA 5AG2A 4O4IA 1V55C 1SS3A 4PJ0Z 5BY1A 3CHXA 1YJ9V 4IYIA 4J9ZB 2EIJB 1LNQA 1K73W 4DR2O 3K5NA 1KMIZ 3EXAA 3CWBH 4UCTA 1I5YA 3BABA 2HHHB 1YJWV 5IYCO 3JCZA 2YI8A 4WFAV 4I4TA 4EB6B 2MW2B 3CRMA 3RW0A 2EBOA 1I94B 4CH5A 1OCOC 1B04A 2XNDG 1SQGA 1ZL8A 3OFNG 4LF8B 3O9OA 1QHTA 1EM1A 1R3JC 3AEIA 4LF7B 2RDCA 4P9OA 2B5UA 1IBKB 1TVKB 1AILA 2JS3A 4DV6O 5LP6A 3GB7C 2CUGA 4NXNO 4Z1MG 3ZHTA 1K97A 2P67A 4DRXA 1SA0B 2A79B 4MVOA 2ZXWC 3MD0A 1V9PA 4NKGB 5FLXN 3WFVA 1Y74B 1B3QA 1N36O 2EILC 5CA1B 3BFRA 4BAYA 2R9AA 4MVSA 2Q5ZA 5CBHA 4KP4A 2Y0IA 3K08A 3B77A 1XL4A 4XBFA 5LXTB 4JPRA 1KYOF 2AW9A 1GKFA 3HKEA 3WG7C 4FFBA 4DR7B 3QTCA 1H2KA 3D8CA 3ZRWA 5KMGB 3KG2A 4B3TO 5FPRA 1G1XB 3HKEB 3ABKB 3C3SA 2Q69A 4CC6A 3T1YB 2B1IA 2DMXA 2ADQB 3ABLC 3ZMVA 3ETEA 4JI8B 2RJZA 2FL4A 4QPJA 1D5AA 5EC1C 4IT5A 1S0VA 1VQ6V 4OPAA 5KHIA 5LOVB 3QVNA 1EZVH 3FAVB 1R6KA 4JI6B 5LP6B 4DV2B 3TETA 1ZSPA 3SJBC 3AG2C 2DYSB 2EINC 4DV2O 5LP6C 1BGYH 2OTLV 1OV9A 5KMGA 4CS4A 1OCRB 2UXNA 5KX5B 1JQ0A 3BY6A 5EBLC 4RQFA 1GN2A 4RQEA 1R6NA 4XDJA 1NS1A 3SPJA 5L3BA 2OYQA 4WCEV 4DR1B 4JI5B 2P06A 4AQYO 1PKXA 3OMNB 1HWYA 4J7KA 2F4VO 3DGEA 4FM2A 3RVZA 4JZ2A 3OUFA 2ZM6O 1W2BU 4A5UB 3T1HB 1R3IC 2BTOA 4QNHB 2P5OA 1KKCA 4ASUG 5IYDO 4PDVA 4UFZA 2WLNA 2EINB 4JI6O 1L1FA 1MZFA 3K0DA 1QVGU 3AK1A 5F2VO 1NTKH 1SETA 4LWSA 3OD4A 3JATA 2UXDB 1NR1A 1OCZC 2QKSA 4J9YB 1OCRC 2D2CB 1N8RW 4DV4O 2IJJA 2JGDB 4E2LA 4EB6A 2F93B 4L8JA 1H2SB 3P32A 2H94A 2KG7B 4OX9B 4E4EA 4X88A 4GKKO 1Z5VA 1XOUA 1KC8W 4JGSA 5LGUA 2EZPA 4X66O 4JI0B 3C3TA 1H2NA 4GKJB 4JTAB 1O9GA 2OCHA 4UVBA 2AXTZ 4B7EA 1I0HA 5LBQA 1N32B 2ZQMA 1Y76B 2CTPA 1NH2D 3O65A 4AI8A 3TXSA 1BQZA 3TJTA 2FMLA 2LO1A 5IYZB 2XASA 4DV0B 1KUQA 3MDSA 1HNXO 2QGNA 2OCCB 3OUSA 1XNQO 1OCZB 4CH6A 1OHHG 5CA3A 4WBNA 1US6A 2Q67A 1JPXA 1QCEA 1W0KG 2HFEC 2IJKA 3RFRA 2ZKOA 4X89A 4JYAO 3H1KH 1FPOA 4DV3B 4BWAA 2BOCC 4FZ1A 3FX7A 1OCCC 1NVPD 3VQXA 4G2KA 4MVZA 4U3JA 4KHPB 3E22A 1FJGB 2KB1A 3LSQA 4TT3G 4X1KB 2H3OA 4NXNB 2F4VB 1FXHA 3D3QA 1AJQA 3FB7C 2X7RB 1QR8A 3B40A 4TQFA 5J2TB 1VQ5V 4JI4O 4I50A 2DWEC 4B3RO 3JD0A 3UKMA 5B1NA 2CDYA 3ZX6A 1JOYA 1N4CA 4UXNA 1SF9A 2L6LA 4CH4A 4NTYA 3K5MA 3EHBB 1RFYA 3SJQC 4PA4A 2OT5A 1IXMA 5CB4A 1FAFA 2W0XA 4D7TA 2ZE7A 2LGWA 2Q4PA 4LFBO 1VF7A 1Q6UA 4JI1B 5K1XA 2MK3A 4DV3O 4Z1VA 2KQXA 1SQPH 2GV9A 1K9MW 3BA9A 5ITZB 2P4KA 2A9HA 1N34B 3ZMSA 1NJIW 3G4SV 3T1YO 1THZA 2W6IG 1VF6C 2BTQA 3JD4A 4FK5C 1GH6A 3Q4HB 1NU1H 5IY5B 2BCCH 4QGPA 3F7VC 2FYUH 2JIZG 2Y0PA 1WN7A 4MSWC 1K8AW 5IY5C 4WFFA 1HNWO 5DN6G 2VQFO 3WG7B 1M56C 2JK5C 1LUVA 5L3FA 3K0GA 1WPXA 4JTDB 4DK1A 5H2FZ 4GT1A 3JASA 3FYEB 4K3AA 2DJVA 2NN4A 3OGIB 4MVMA 3I56V 1EN5A 4O4IB 3BEHA 2YXLA 3QNEA 4WFBV 2R70A 3RBZA 2ZDIA 2ETNA 4TOIA 2Q9LA 3CRAA 1MNGA 3NR7A 2XHBA 1BHBA 2JGUA 1QLEB 2UUCO 1S77D 4OX9O 2F23A 2PUSA 2E74B 1XMOO 3ZRWB 2WLLA 3JAMN 4LF7O 3L71H 2F95B 4PELA 4PV1B 2E75B 1YITV 3AG2B 2DYSC 3J7AU 5A9GA 4MW8A 3SPIA 5LA6B 1B06A 2X6CA 3OTFA 4ZHQA 3ZHRA 5CBFA 3AG4C 2X0LA 3FAVA 3B4SA 1Q7YW 3TK1A 1NBMG 1QVFU 3JAKB 5JVDA 1PM9A 3JALA 4X64O 1S72V 4AHCA 3J81N 2ZE5A 1WJZA 1G4YB 4FLZA 4JAAA 4G28B 5EK0A 2EJ7A 2P4VA 4X1YA 3E8GA 3ZHQA 4BIUA 4H37A 4BIOA 2WA4A 1I94O 3SJAC 5KUMA 4DR6B 3OW2U 1EN4A 4G27B 4TV9B 4CC5A 5L3CA 1GM8A 1IBKO 4FPPA 2QE7G 1BZKA 4N21A 4B3MB 5IDJA 1OJHA 3D36C 2X6AA 3QG5A 4I0XB 1QU7A 2YXYA 4ZIBA 4ZI7B 1NR7A 3L9DA 1IVSA 3OM3B 5B1BC 1CPYA 4DRXB 3OR7C 3CP1A 1XILA 3ETDA 4PA6A 3ZMZA 2AHYA 3QO8A 1W59A 1AI5A 3SYOA 2RN9A 4X64B 4JI3B 1FFXA 4J11A 4JAVA 1P7GA 1G8MA 4O2AB 1VP7A 3CCLV 1ZL8B 3ABMC 3VBBA 4TV9A 1N33O 3H1HH 3RYHA 4PHZA 3CXCU 5KHJA 3ZIAG 1HNZO 3QF7A 2PZSA 4X1YB 3UM7A 1P4RA 2QTSA 1RSOB 2QM7A 2XOKG 1CXZB 5JJJB 3JALB 4K8XA 3RGBA 1RPRA 3MAQA 2JS5A 2P6JA 4CS2A 5JQGA 2R9RB 3SPHA 1RM1C 5EYPB 3CCQV 5KA5A 3OR6C 3HKCB 4WBNB 3IC9A 1MOFA 2IW5A 2ZXWB 3OGCC 1B6QA 2QR4A 4UV8A 3CCUV 1BL8A 3MHSC 1GN3A 2QEXV 1GTOA 4LR3A 3LDCA 1EBOA 4DUYB 3X2QC 1XL6A 3B2EE 4PA7A 4UCRA 3AG1C 5DEDA 3ASOC 1AR5A 5IWAO 2ZR3A 1IXBA 4BW5A 5JH7B 1WPBA 3CSXA 1BSMA 2LGQA 3H1IH 2ZD9A 2WPDG 2JJ2G 5CA1A 1P49A 1WAZA 4FLVA 1KP3A 1N33B 4QE9A 5B3SB 3ASNB 4GX0A 5HFMA 2QWQB 5FNVA 1M4UA 1VQ9V 1P84F 4J7ZA 4QIWF 4EEQA 3L75H 4CBCA 2DQ3A 1F51A 3T2MA 2EIKB 3FB5C 3KCXA 2QKCA 3P3NA 2P90A 3ZHVA 1K4CC 3S3WA 1WP8A 2EZOA 1YXBA 5HFLA 3F7YC 2VWKA 1X4TA 3TCUA 4LFCO 4U7OA 4DR3B 2Q8VA 2V4DA 3BCCH 2QJ1A 2RMKB 4H33A 2DYRC 3OEEG 4DR4O 4FMTA 2WLIA 2LFSA 4F6RA 1WA8A 4YHHO 1YJNV 1AP5A 2DWDC 1QNMA 3DC5A 4PDRA 2ZCEA 3R66A 5J2UB 1XHXA 2UUAO 1JCHA 2P22C 3H01A 2IU0A 4FJCC 2EX3A 1TUBB 4GX1A 3MHHC 5D5PA 4B3RB 1Q86W 3JARB 4LF4O 4X9QA 1KD1W 1SRYA 1JA8A 4JI8O 2Q0OC 2N74A 3EVKA 3E89A 2VRZA 1Q82W 5LYJA 1L8DA 4X1KA 1QLEC 3JAWB 1UJWB 4JASA 4DV0O 2HR3A 4J42A 1AI4A 2CK3G 3ZJZA 5IJ9B 3UO2A 5LMUO 4NB5A 4DK0A 3ZRVA 1LR1A 3P3PA 4K0KO 4DV5O 4LBEC 2GUZB 2LQTA 2IH3C 4UCSA 4I55B 3CCSV 2ZE8A 1FYJA 4JI0O 1D5NA 2L35A 4R7CA 4ICGA 1BT8A 5EIBC 2N04A 1URFA 1YHQV 1PPJH 3M7MX 1PNLA 2XAJA 1N36B 4TUYA 2E76B 2YIDA 5K1PA 4UCUA 2WLJA 3UT5A 4UCVA 3QO5A 1TUEB 2HEPA 3CYOA 4P30A 1SKVA 2UXCB 1VARA 3RYIA 3VQVA 4DR5O 1OCCB 3N2KB 4WFGA 2PI5A 4JYAB 5GW7A 5E1AC 3CCRV 1EFRG 5LYJB 1A32A 2Z5UA 2YIAA 3WB2A 1SC5B 3U10A 2JRIA 3FFQA 5H5NA 4UB6Z 1VQNV 4F6EA 2YXHA 5H6QA 2GBOA 5CA0A 2ZIMA 4QE7A 1ZX3A 2IJIA 4CH3A 3FD9A 1X59A 2Q0AA 1PD3A 4MVUA 4JYCA 2W6JG 2EIJC 3QO7A 1M90W 2HP8A 3W7TA 5FL7G 1KB9F 1XDCA 2Z3YA 2GHYA 1CEZA 1PV0A 1VF6A 2XTAA 3HR0A 4FZ0A 5KUKA 2IH1C 3KKYA 4LF8O 4RAIA 1YTFD 2W0FC 4LF5B 4JF3A 1SESA 2GTSA 4W4KA 1YTFB 2DOSA 5KA6A 2CH7A 3K3WA 3H9VA 3DXRA 3SYQA 1BMFG 3HPLC 4O2BB 2CE4A 4YIPA 3CRQA 4PDMA 3T1HO 5B1AC 3W7UA 3K57A 3T4ZA 2DW4A 3IAYA 2UUBO 4X8AA 1COWG 1RPOA 4JV5B 5LHIA 1K34A 3B09A 2DQ0A 2ITCC 3AG7A 1V54C 4LF9O 2WAMA 1K5SA 5IJ0B 1AR4A 2QWOB 3ZMTA 3APOA 1MABG 2QKAA 4FLUA 4I7ZB 3N2GB 5EIBD 1PNKA 2BSKB 4ZOLA 1JR9A 2JVDA 2IM9A 3E35A 1J5EB 2XAQA 3K9SA 1NTMH 4O4LB 1ZLZA 1SERA 3ASNC 2GTAA 2HJDA 3ABLB 3STLC 3ZN0A 2Q6AA 1R73A 4LFCB 5IYZA 4TSFG 2O57A 1TA8A 1CP9A 5LMUB 3B8NA 4GKKB 4WFEA 2F43G 1RP3B 5LXTA 3K5LA 3RN4A 2F1MA 3ZHUA 1Y76A 1JFFB 3DTUB 5EZYB 2HVJC 4PDLA 4FLTA 3AG4B 1DF5A 2ILMA 2BE3A 2XT9A 1M57B 1Z2GA 5BMVB 4JAUA 4KXRA 3CJHB 1F4MA 2VQEB 4F6RB 4ZOLB 3FKSG 2M6YA 1SZTA 3L70H 2OIGA 3CC4V 1PNMA 4MW3A 4DXWA 4JI5O 1IZ3A 3ZRXA 1NTZH 1XEQA 1UPGA 1T5EA 2WLKA 4Q20A 5LGTA 3ZEDA 1GN4A 3SYPA 1V55B 4YIOA 2JGDA 2KSDA 1JVMA 2QWPB 2XUMA 1SQVH 4KUMA 3TXQA 4JV5O 1HR0O 1Y4MA 3ZN1A 2UXXA 1BQ0A 2ZM6B 1UFIA 3LNNA 4LWSB 3R65A 5FPOA 1PP9H 1Z5WA 3ABMB 1IBLB 4ZBMA 1GK9A 4KFMA 1F7YA 2CH7B 3DSQA 5J2UA 2OCCC 3RYIB 1ZAUA 4B3SB 3JSLA 2ZNJA 2ZIOA 1M57C 2Q7HA 3A0BZ 4X1IA 3WB1A 4WF9V 1U97A 3JSNA 4Z2WA 4I0XA 1FS0G 3FB6C 3HKBA 4DR1O 4FLXA 5GONA 3IGAC 3E2EA 1TAEA 2Y69B 4FLWA 3RYFA 3KCYA 4TV8B 4YJ3B 1VQKV 4RO2A 4H0LB 1I08A 3A8TA 4JI4B 3ICXA 3E86A 4FVMA 1MA1A 1E1QG 3T4DA 1K4DC 2NR5A 4O4JB 1DGSA 4FLYA 3D36A 3E22B 3K03A 1IBLO 3RT3C 3JD2A 5GTIZ 3K04A 4ZKIA 3CCEV 3OMAB 2QWNB 5IJ9A 3CMEV 5C8YB 1OCOB 1ZUQA 4C7UA 3CRRA 3T1CA 3ZRSA 1AI6A 4DW0A 5BZBA 3ETGA 4B3MO 2CTQA 4ABMA 1Q43A 1DTOA 3FYIB 4UV9A 5EBWC 4IHJA 4CS3A 3ZMUA 1WP7A 1NI8A 4FM1A 4DW1A 1BS3A 1XREA 3G71V 2YIBD 1H8EG 3THOA 4P2ZA 4I9QA 1IX9A 3G67A 4KHPO 3JARA 4HAMA 1NT2B 1Q81W 1GM9A 5BR8O 4PD4F 5L3EA 2RNBA 4UVCA 3RYCB 2EULA 4P9PA 1JJOA 3X2QB 4NR1A 4L87A 4O2BA 2NLJC 5JQGB 4XDKA 5IYBO 1VQ7V 2V1DA 1JJ2U 4PA3A 4DYLA 3SPCA 1HNWB 5C93A 4X65O 4DV1B 4UVAA 2DYRB 1WB8A 2WLIB 2PYJA 2YIBA 2XAHA 2PF4E 3BA8A 4NXMO 1H8HG 1D2DA 2N05A 1XMOB 3JD1A 1KU9A 1Q6HA 4YJ2A 2EIKC 5CMUA 1S3JA 1PL0A 4HYOA 3GVMA 3VQWA 3A0HZ 2D3OW 1YF2A 1FXVA 1TUBA 2QSAA 3HKDB 3BRCA 4LNUA 1R1BA 3DXRB 2C2AA 1ROPA 2FB5A 1YEWA 5BR8B 3OMIB 1H38A 4MS2A 1NVPB 4NYKA 4H13B 2QDOA 1BHAA 1WNSA 3CPWU 2VQEO 4GCZA 1V54B 2OTJV 3WU2Z 1EN6A 1VQLV 1VQ8V 4WFHA 1YDXA 2XAFA 2ZT9B 5JCOC 4GUNA 5KHKA 4DV1O 5A2QN 2YDEA 1L0NH 1IURA 3U0ZA 2PY5A 2YI9A 2PI4A 2PYLA 1XUQA 2H8PC 2HKOA 2UUBB 1G6UA 4YJ2B 1YVWA 3VOUA 4DR2B 4U3FH 3RVYA 3J80N 5CN0A 3HKCA 1SQQH 4UUJC 3M8AA 4RWUA 3ZBHA 1YIJV 2GUZA 2QM4A 4BIZA 1VQ4V 1FXKC 4X20B 5IT9N 4KL1A 1E79G 3CJHA 2BSKA 1QLNA 1FXKB 4BW9A 4YHHB 1HR0B 5EBMC 4DR3O 4QJFB 5IJ0A 1JFFA 1AI7A 2Y48A 3ZS8C 3K59A 3CB2A 5KAFZ 1NKDA 2WSSG 1GM7A 3S3XA 5KLVH 2ZDIC 5B1BB 3RYFB 4B08A 4LCUC 3JD3A 1NZ6A 1J95A 1XMQB 1H2LA 3JYCA 4I5SA 4MTFA 2YS8A 1AJPA 2AGAA 1FFXB 4MTGA 4TQDA 1Q3EA 4UCOA 2YEVA 5JJNB 4DUYO 3CRCA 4K35A 2AZ2A 4DR7O 3F5WC 2Z0AA 1OZ0A 3HB3B 1P7BA 2OIEA 1JX9A 2YICA 3F5TA 1WB7A 2LP7A 1N32O 3K58A 3G6EV 3E83A 4YXWG 3RWRD 4LFAB 5JWPA 3BPZA 1U96A 2QTOA 4EFBA 4J7JA 1VQMV 2QM8A 4JI2O 1NH2B 2LJ2A 2A3QA 2QWRB 1DLBA 1I7FA 3HKDA 3TGUH 2M7WA 5IE9A 1JMKC 4DV6B 3Q4HA 3H1LH 5B1AB 2KKWA 4B7KA 1GO3F 4DV7O 3SYAA 1N0NA 3P30A 4JZGA 4O2AA 4GYCB 1RM1B 3SPGA 2UXCO 5ITZA 1SQXH 1KECA 1HNZB 3AG3B 4GZRB 2ZR2A 2EILB 4LF6B 2CTRA 2CGNA 3I5DA 4X66B 4HNAA 2HLDG 4X1IB 4OGQB 1WA8B 3IC7A 4Q6GA 2Q7EA 3ASOB 4J80A 4X62B 1SZXA 1KBHA 3SJCC 4TUYB 5JH7A 2Q68A 5CBGA 2CAZC 2LFRA 3ABKC 5LA6A 4ZHQB 2FKXA 1ZTEA 1LUWA 2E3CA 4OPHA 5JJEB 1Q6IA 1Q8IA 3PJSK 5H6RA 3AK3A 4D6TH 4H44B 4PA9A 4MT8A 3SR2C 1KKDA 2LW7A 2WLLB 2EIMB 4EKWA 2RCVA 3CCMV 3VQYA 4O4LA 1VQOV 4CZZA 2UU9B 2AZ0A 2E5LO 3CMAV 3BHPA 1SQBH 3N2KA 2IJHA 2NNUA 2A06H 2G38A 3CS5A 2UXBB 1QR9A 1RSOA 3ZCCA 5BMVA 4LF5O 4LF4B 1Y66A 5JCOA 4K8ZA 4MVRA 1PL4A 2YSUB 4O4JA 3GWKC 5EZYA 4I9WA 3FB8C 4DV7B 3IFXA 1VMGA 2UUCB 2UUAB 2HG5C 4YY3B 2R9IA 1Y6XA 1GMGA 1S5LZ 5B3SC 4YY3O 3CCVV 2EIMC 1VQPV 3UQ8A 4MVQA 1AVMA 3CCJV 2ZNIA 4I55A 2WLHA 1QBZA 2FTKA 1KQSU 2WLMA 1HNXB 2K1EA 1XNQB 4TWKA 3WB0A 3JCUZ 5KHGA 3A2FA 3E8BA 4HNAB 5J9PC 5CB4B 2VQFB 4D7SA 4DR5B 1F4NA 2UXDO 4XDLA 3JAWA 4B3TB 4LNUB 1Q90D 1F23A 3W7WA 1R3LC 1XNRO 5IWAB 1MG1A 1O9HA 4B3SO 1AJNA 4R8CA 3W7SA 1VIBA 3ABTA 2K9PA 5CA0B 3SYCA 1XI1A 1R6TA 2ARHA 3N27A 2P7TC 4GKJO 5GTHZ 3H1JH 3K5OA 4J10A 4O4HB 4U3JB 5E79Z 1N0JA 1YSCA 2ZINA 1M93A 5B1OA 1XQ8A 5L3GA 4ZI7A 3K06A 1Y67A 4LFAO 4DUZB 3L72H 3IJ4A 5L3DA 2CGOA 4IIJB 5TISZ 2PTMA 1W0JG 3RYCA 1XMQO 1ENVA 5H9CA 3OTOB 5DM6V 1S5HC 2DN9A 2B1GA 3L73H 2Y4TA 1IBMB 4DR6O 4K0KB 3M99B 2IBZH 4JI7O 5LHGA 1E1RG 3NXSA 3CC2V 3APQA 2Y69C 3GWOA 5EC2C 4W4LA 4X62O 4R6ZA 1VEWA 2JDIG 1TGOA 1VF5B 3LDDA 4LH6A 5KHHA 4UB8Z 2RQ6A 4JI2B 1MZEA 4X20A 2YUAA 3N2GA 1FKAO 3CEIA 4NTXA 5B5EZ 4MTOA 3UT5B 3LDEA 3SDLA 2A0LA 2KG7A 2GDSA 2UU9O 3B8MA 2QA4V 2WA3A 5DECA 2E5LB 1XBLA 2V7QG 1K5QA 3K79A 5D5QA 3JATB 3CC7V 4RUFA 2UXBO 1IDSA 4NXMB 4FM0A 1AB3A 3BAAA 3E8FA 4OXSA 1IBMO 2DE0X 2Q7GA 3HKBB 3PN1A 3OE7G 1FJGO 5EYPA 4IIJA 5B66Z 1BCCH 1KP2A 2F66C 3KZIZ 1HDJA 3CXHF 4LC1A 3UCSC 1ZWIC 1DK1A 5LL6Y 1SA0A 4LP8A 2XAGA 3AG3C 4HBNA 2R72A 2GSMB 4O4HA 5BXZA 1GRJA 1ORQC 3ZHSA 3LUTB 3DC6A 3AG1B 3ML0A 3UO3A 4F4LA 2HVKC 4NVPA 4GX5A 1AROP 5KX5A 4DUZO 5LMNO 4DV5B 4QPKA 2VWJA 3STZC 3AK2A 2AHZA 4IGGA 1M9NA 1M56B 4JI1O 4FIPC 3U11A 3E8HA 4LF6O 4GX2A 3OTOO 1L0LH 4IYHA 4JYYA 2Y4UA 2X6BA 2PGGA 3LSUA 1MSDA 2LW1A 2BOBC 2CTWA 2EJRA 3CX5F 1FFTB 4X65B 1YCIA 1GN6A 1J5EO 1SQFA 4AILC 3CD6V 1HP8A 1DF4A 1NQTA 3G6BA 2B9ZA 1H2MA 3EFFK 2JEXA 2YEVB 2ADPA 5LMNB 1GAXA 1BE3H 2OWOA 2WWWA 3C90A 1M5IA 2JEUA 4JTCB 4R50A 3D3IA 4I50B 1Q5OA 2ZE6A 4IL6Z 5J2TA 3ETQA 2VS0A 4FFBB 3SGIA 5KAIZ 3A0RA 3LSSA 4AQYB 1AP6A 1MSWD 4EFEA 4IHJB 4DO2A 1K7DA 3OEHG 1K3EA 1FD9A 3G80A 4LFBB 3L74H 5LOVA 5FNVB 1S76D 4JI3O 1YI2V 1FXKA 4FFKA 1Y74A 1AR1B 3CE2A 3OT7A 1M1KW 1XNRB 5JVDB 5C8YA 3JASB 4LF9B 1HW7A 3JAKA
chains in the Genus database with same CATH topology
3I56V 2QTOA 1VQMV 1YTFB 2QM8A 3K9AA 1R3KC 1EZJA 5KA6A 3BEHA 1NH2B 3K3WA 3QNEA 4WFBV 3OAAG 3RBZA 1K92A 3SYQA 1BMFG 3W7XA 2ZDIA 3HPLC 1H2GA 4PDMA 1DLBA 5B1AC 5LGNA 3W7UA 1BHBA 4HZ3A 2M7WA 4JYBA 1QLEB 3I55V 3T4ZA 1S77D 2DW4A 4X8AA 5B1AB 1GO3F 1COWG 1RPOA 2WLLA 3ZRWB 3SYAA 2ITDC 3P30A 5LHIA 4PELA 1K34A 2IU3A 1RM1B 3SPGA 1K33A 2DQ0A 1YITV 2HJFC 3AG2B 4MTXA 1KECA 2DYSC 2ITCC 3LNMB 3AG3B 4MW8A 3SPIA 2ZR2A 1V54C 2ATKC 2X6CA 5LHHA 2EILB 2WAMA 1K5SA 4N23A 5CBFA 3AG4C 2X0LA 1I5XA 4U7NA 2JJ1G 3ZMTA 1Q7YW 3ABUA 1MABG 1WLEA 3TK1A 4RUEA 1NBMG 1V55C 1QVFU 1PNKA 2HLDG 1YJ9V 4J9ZB 2EIJB 1S72V 1LNQA 3IC7A 1K73W 1G4YB 3ASOB 1I5YA 4G28B 3E35A 5EK0A 1YJWV 3E8GA 2XAQA 2Q68A 5IYCO 3JCZA 5CBGA 2LFRA 3ABKC 4BIUA 4H37A 4WFAV 5KUMA 3OW2U 1SERA 3RW0A 2EBOA 3ASNC 3PJSK 4G27B 5H6RA 1OCOC 3ABLB 2XNDG 4PA9A 4MT8A 3STLC 2Q6AA 3ZN0A 1KKDA 1R73A 2WLLB 3OFNG 5L3CA 2EIMB 1GM8A 4EKWA 4TSFG 1CP9A 3CCMV 3B8NA 1R3JC 3AEIA 4FPPA 4CZZA 4P9OA 4WFEA 2QE7G 2F43G 2B5UA 1VQOV 4N21A 5IDJA 2X6AA 3CMAV 3DTUB 3GB7C 2HVJC 2IJHA 2NNUA 4PDLA 3AG4B 4Z1MG 1DF5A 1M57B 4JAUA 1K97A 1NR7A 2P67A 2A79B 4MVOA 1F4MA 2ZXWC 3MD0A 3OM3B 5B1BC 1CPYA 3FKSG 3WFVA 1QR9A 3OR7C 1SZTA 3ZCCA 2EILC 3CP1A 4PA6A 3ETDA 3CC4V 3ZMZA 2AHYA 1Y66A 1PNMA 4BAYA 4MW3A 4DXWA 4MVSA 3ZRXA 5CBHA 4KP4A 4MVRA 2YSUB 2WLKA 3QO8A 4Q20A 3K08A 1AI5A 5LGTA 4I9WA 3B77A 1XL4A 4XBFA 3SYPA 1V55B 3SYOA 4JPRA 3FB8C 1JVMA 1GKFA 3WG7C 4JAVA 4KUMA 1Y4MA 3IFXA 1G8MA 2UXXA 3ZN1A 3CCLV 2HG5C 3R65A 3ABMC 2R9IA 3ZRWA 3KG2A 3VBBA 1GMGA 5B3SC 3ABKB 3CCVV 2EIMC 1VQPV 2Q69A 3ABMB 2B1IA 4MVQA 1GK9A 4ZBMA 3CXCU 4KFMA 3CCJV 2WLHA 3ZIAG 1QBZA 2FTKA 1KQSU 2WLMA 3ABLC 3UM7A 1P4RA 3ZMVA 3ETEA 2K1EA 4TWKA 2OCCC 2QM7A 2XOKG 4QPJA 1M57C 5EC1C 4WF9V 3E8BA 1S0VA 1VQ6V 5J9PC 1RPRA 2P6JA 2R9RB 1F4NA 3SPHA 1R6KA 1FS0G 4XDLA 1RM1C 3FB6C 3TETA 3CCQV 5KA5A 3AG2C 2DYSB 3OR6C 1F23A 2EINC 3W7WA 1R3LC 1MOFA 2IW5A 1MG1A 2ZXWB 3OGCC 1AJNA 4R8CA 3W7SA 2OTLV 3ABTA 3IGAC 1B6QA 3E2EA 1OCRB 4UV8A 2UXNA 3CCUV 1BL8A 1JQ0A 3BY6A 2Y69B 3MHSC 5EBLC 2QEXV 1GTOA 4RQFA 3LDCA 3SYCA 1EBOA 1VQKV 4RO2A 4RQEA 3X2QC 1R6NA 1XL6A 4PA7A 4XDJA 3E86A 3SPJA 3AG1C 5L3BA 3ASOC 2P7TC 4WCEV 2ZR3A 1PKXA 1E1QG 3OMNB 1K4DC 3T4DA 4BW5A 1HWYA 3D36A 3K03A 2ZD9A 3JD2A 2WPDG 2JJ2G 3K04A 1YSCA 4ZKIA 1KP3A 3DGEA 3CCEV 3OMAB 4QE9A 5B3SB 3ASNB 5B1OA 3CMEV 3RVZA 4GX0A 5L3GA 1OCOB 3OUFA 5HFMA 3K06A 3T1CA 3ZRSA 1AI6A 5BZBA 3ETGA 5L3DA 1VQ9V 1W2BU 1DTOA 3FYIB 1R3IC 4UV9A 5EBWC 4QNHB 4QIWF 1W0JG 4ASUG 2DQ3A 3ZMUA 4CBCA 5IYDO 4PDVA 2WLNA 2EINB 1L1FA 3G71V 1F51A 3T2MA 1ENVA 1H8EG 2EIKB 3K0DA 3FB5C 4P2ZA 5H9CA 1QVGU 5DM6V 1S5HC 1SETA 2B1GA 2P90A 1NR1A 1OCZC 2QKSA 1K4CC 4HAMA 3M99B 4J9YB 1OCRC 5LHGA 1N8RW 2EZOA 1E1RG 3NXSA 1GM9A 5HFLA 1Q81W 3CC2V 3F7YC 2IJJA 2Y69C 3GWOA 5L3EA 4E2LA 4UVCA 5EC2C 4P9PA 3X2QB 3TCUA 4L87A 4R6ZA 4U7OA 3P32A 2NLJC 2H94A 2JDIG 3LDDA 4X88A 4H33A 4XDKA 2DYRC 5IYBO 1VQ7V 1KC8W 2V1DA 1JJ2U 3OEEG 4JGSA 4PA3A 5LGUA 3SPCA 4FMTA 5C93A 2WLIA 2EZPA 2LFSA 1YJNV 4UVAA 2DWDC 2DYRB 2WLIB 4JTAB 4PDRA 4MTOA 4UVBA 2XAHA 3LDEA 5LBQA 2A0LA 1JCHA 3H01A 2IU0A 4FJCC 2ZQMA 1NH2D 1H8HG 3B8MA 2QA4V 4GX1A 3JD1A 3MHHC 2V7QG 1K5QA 1Q86W 2XASA 3K79A 2EIKC 1KD1W 2OCCB 5CMUA 1S3JA 1SRYA 3OUSA 3CC7V 4RUFA 1PL0A 1OCZB 4HYOA 3E89A 1OHHG 5CA3A 2D3OW 1Q82W 1FXVA 3E8FA 4OXSA 2Q67A 1JPXA 1QCEA 1W0KG 2HFEC 3OE7G 1QLEC 1UJWB 2C2AA 1ROPA 2IJKA 4JASA 1KP2A 4X89A 2HR3A 1AI4A 3OMIB 4LC1A 1H38A 1ZWIC 2BOCC 4MS2A 2CK3G 3ZJZA 1NVPB 1BHAA 4LP8A 3CPWU 3ZRVA 1OCCC 2XAGA 1NVPD 3AG3C 4G2KA 4GCZA 1V54B 2OTJV 4MVZA 4LBEC 2GSMB 1VQLV 2KB1A 4WFHA 1VQ8V 3LSQA 2XAFA 1ORQC 2IH3C 3LUTB 4TT3G 1FXHA 3AG1B 3ML0A 3CCSV 1AJQA 3FB7C 2X7RB 4R7CA 1QR8A 4F4LA 2HVKC 2PI4A 4GX5A 1AROP 1VQ5V 2H8PC 2HKOA 2DWEC 3JD0A 3UKMA 5B1NA 1JOYA 4QPKA 4UXNA 3VOUA 3STZC 2AHZA 3RVYA 5CN0A 1YHQV 1M9NA 1M56B 3EHBB 1PNLA 4FIPC 2XAJA 3SJQC 4UUJC 4PA4A 2OT5A 1YIJV 3E8HA 4BIZA 4GX2A 2WLJA 1IXMA 2X6BA 1VQ4V 3QO5A 1FXKC 1TUEB 3CYOA 2BOBC 4P30A 1E79G 2EJRA 1QLNA 1FXKB 1FFTB 5EBMC 3CD6V 1DF4A 1NQTA 1OCCB 4QJFB 4WFGA 2MK3A 2PI5A 5GW7A 1AI7A 2Y48A 3EFFK 5E1AC 2JEXA 1EFRG 2YEVB 3CCRV 1K9MW 2Z5UA 1NKDA 2WSSG 1GM7A 2WWWA 1VQNV 2ZDIC 2JEUA 5B1BB 2A9HA 5H6QA 4JTCB 4R50A 3ZMSA 1NJIW 3G4SV 3D3IA 1THZA 2W6IG 4LCUC 3JD3A 4QE7A 1J95A 2IJIA 3JD4A 4FK5C 1PD3A 3JYCA 4I5SA 4MVUA 5IY5B 4MTFA 4JYCA 2W6JG 1AJPA 2EIJC 3F7VC 3A0RA 3LSSA 3QO7A 2JIZG 1M90W 4MTGA 3W7TA 2YEVA 1MSWD 4DO2A 5FL7G 4MSWC 1K8AW 2Z3YA 5IY5C 4WFFA 1K7DA 5DN6G 3F5WC 3OEHG 2GHYA 1CEZA 1OZ0A 3WG7B 1K3EA 3HB3B 1P7BA 1M56C 1JX9A 2JK5C 5L3FA 1S76D 3K0GA 2LP7A 1WPXA 4JTDB 5KUKA 3G6EV 2IH1C 1FXKA 4GT1A 1AR1B 1YI2V 4RAIA 1M1KW 3E83A 3FYEB 4YXWG 1YTFD 2W0FC 4JF3A 1SESA 4MVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC C;  2QTO A;  2EIL C;  3AG3 C;  4PA6 A;  2AHY A;  4MVZ A;  5BZB A;  1R3K C;  4MW3 A;  4DXW A;  3BEH A;  4LBE C;  4MVS A;  2KB1 A;  4WFH A;  5CBH A;  3RBZ A;  4MVR A;  3SYQ A;  1R3I C;  3HPL C;  1ORQ C;  2IH3 C;  2WLK A;  5EBW C;  4QNH B;  3K08 A;  3LUT B;  4I9W A;  1XL4 A;  4PDM A;  3SYP A;  3SYO A;  5B1A C;  4CBC A;  3FB8 C;  4PDV A;  3FB7 C;  4HZ3 A;  1JVM A;  2WLN A;  4R7C A;  4F4L A;  3WG7 C;  2HVK C;  3T4Z A;  3T2M A;  3K0D A;  3FB5 C;  3IFX A;  4P2Z A;  4X8A A;  4GX5 A;  1S5H C;  2WLL A;  2H8P C;  2HG5 C;  3ABM C;  3R65 A;  3SYA A;  2ITD C;  2DWE C;  1OCZ C;  2QKS A;  1K4C C;  3KG2 A;  3UKM A;  4J9Y B;  1OCR C;  5B3S C;  3VOU A;  3SPG A;  3STZ C;  3T1C A;  3F7Y C;  2EIM C;  2HJF C;  2AHZ A;  2Q69 A;  2Y69 C;  2DYS C;  2ITC C;  3LNM B;  3RVY A;  4MVQ A;  4ZBM A;  4MW8 A;  3SPI A;  1V54 C;  5EC2 C;  4P9P A;  2ATK C;  2X6C A;  4KFM A;  3TCU A;  4R6Z A;  2WLH A;  5CBF A;  3AG4 C;  3SJQ C;  2NLJ C;  4UUJ C;  4PA4 A;  2WLM A;  3ABL C;  3E8H A;  3UM7 A;  3LDD A;  4X88 A;  4GX2 A;  4H33 A;  4RUE A;  2WLJ A;  2K1E A;  2DYR C;  4XDK A;  2X6B A;  4TWK A;  1V55 C;  4PA3 A;  2OCC C;  3SPC A;  2BOB C;  2WLI A;  4P30 A;  1M57 C;  4J9Z B;  2DWD C;  1LNQ A;  5EC1 C;  2WLI B;  3E8B A;  4JTA B;  5J9P C;  4PDR A;  4MTO A;  5EBM C;  1G4Y B;  3LDE A;  4G28 B;  2R9R B;  5EK0 A;  2A0L A;  3SPH A;  3E8G A;  4XDL A;  4WFG A;  3FB6 C;  3TET A;  2Q68 A;  3AG2 C;  5CBG A;  3OR6 C;  3ABK C;  2EIN C;  3EFF K;  4H37 A;  5E1A C;  1R3L C;  4GX1 A;  5KUM A;  3OGC C;  3RW0 A;  3ASN C;  4R8C A;  3PJS K;  4G27 B;  3IGA C;  1OCO C;  2A9H A;  4JTC B;  4R50 A;  4PA9 A;  3STL C;  1KKD A;  2Q6A A;  2EIK C;  4LCU C;  2WLL B;  1BL8 A;  3OUS A;  4QE7 A;  1J95 A;  4RUF A;  5EBL C;  3LDC A;  3SYC A;  4EKW A;  3JYC A;  3ZRS A;  4MVU A;  4RO2 A;  4MTF A;  4HYO A;  3X2Q C;  2EIJ C;  1R3J C;  3F7V C;  1XL6 A;  3E89 A;  4PA7 A;  4P9O A;  4WFE A;  4XDJ A;  3E86 A;  4MTG A;  3SPJ A;  3AG1 C;  2YEV A;  3ASO C;  3E8F A;  2P7T C;  4OXS A;  4MSW C;  2Q67 A;  5IY5 C;  4WFF A;  2X6A A;  2HFE C;  3F5W C;  1K4D C;  3T4D A;  4BW5 A;  1QLE C;  3GB7 C;  2HVJ C;  1P7B A;  1M56 C;  4PDL A;  3K03 A;  2JK5 C;  2ZD9 A;  4X89 A;  3K0G A;  3K04 A;  4JTD B;  5KUK A;  4QE9 A;  2IH1 C;  4RAI A;  3E83 A;  1ZWI C;  2A79 B;  2BOC C;  4MS2 A;  2ZXW C;  4GX0 A;  4MVO A;  3RVZ A;  3ZJZ A;  3OUF A;  2W0F C;  5B1B C;  3OR7 C;  3K06 A;  4LP8 A;  4MVM A; 
#chains in the Genus database with same CATH topology
 2ODM A;  1YZB A;  4PI0 A;  3K9A A;  1N34 O;  1R3K C;  1EZJ A;  4J41 A;  3OAA G;  3W7X A;  1K92 A;  1H2G A;  1TVK A;  4PI2 A;  5LGN A;  2HHH O;  2A7W A;  4HZ3 A;  4JYB A;  3BVO A;  3RYH B;  1QQC A;  3I55 V;  4TV8 A;  4YJ3 A;  2BTQ B;  2YC0 A;  4DV4 B;  4BR6 A;  2ITD C;  2IU3 A;  1MMM A;  5GON B;  1K33 A;  2HJF C;  4MTX A;  3LNM B;  4JI7 B;  4NTW A;  4I4T B;  2ATK C;  2Q73 A;  5LHH A;  1S5J A;  4N23 A;  4GLX A;  4LH7 A;  1I5X A;  4U7N A;  2JJ1 G;  3ABU A;  4DR4 B;  1WLE A;  1XHZ A;  4RUE A;  5AG2 A;  4O4I A;  1V55 C;  1SS3 A;  4PJ0 Z;  5BY1 A;  3CHX A;  1YJ9 V;  4IYI A;  4J9Z B;  2EIJ B;  1LNQ A;  1K73 W;  4DR2 O;  3K5N A;  1KMI Z;  3EXA A;  3CWB H;  4UCT A;  1I5Y A;  3BAB A;  2HHH B;  1YJW V;  5IYC O;  3JCZ A;  2YI8 A;  4WFA V;  4I4T A;  4EB6 B;  2MW2 B;  3CRM A;  3RW0 A;  2EBO A;  1I94 B;  4CH5 A;  1OCO C;  1B04 A;  2XND G;  1SQG A;  1ZL8 A;  3OFN G;  4LF8 B;  3O9O A;  1QHT A;  1EM1 A;  1R3J C;  3AEI A;  4LF7 B;  2RDC A;  4P9O A;  2B5U A;  1IBK B;  1TVK B;  1AIL A;  2JS3 A;  4DV6 O;  5LP6 A;  3GB7 C;  2CUG A;  4NXN O;  4Z1M G;  3ZHT A;  1K97 A;  2P67 A;  4DRX A;  1SA0 B;  2A79 B;  4MVO A;  2ZXW C;  3MD0 A;  1V9P A;  4NKG B;  5FLX N;  3WFV A;  1Y74 B;  1B3Q A;  1N36 O;  2EIL C;  5CA1 B;  3BFR A;  4BAY A;  2R9A A;  4MVS A;  2Q5Z A;  5CBH A;  4KP4 A;  2Y0I A;  3K08 A;  3B77 A;  1XL4 A;  4XBF A;  5LXT B;  4JPR A;  1KYO F;  2AW9 A;  1GKF A;  3HKE A;  3WG7 C;  4FFB A;  4DR7 B;  3QTC A;  1H2K A;  3D8C A;  3ZRW A;  5KMG B;  3KG2 A;  4B3T O;  5FPR A;  1G1X B;  3HKE B;  3ABK B;  3C3S A;  2Q69 A;  4CC6 A;  3T1Y B;  2B1I A;  2DMX A;  2ADQ B;  3ABL C;  3ZMV A;  3ETE A;  4JI8 B;  2RJZ A;  2FL4 A;  4QPJ A;  1D5A A;  5EC1 C;  4IT5 A;  1S0V A;  1VQ6 V;  4OPA A;  5KHI A;  5LOV B;  3QVN A;  1EZV H;  3FAV B;  1R6K A;  4JI6 B;  5LP6 B;  4DV2 B;  3TET A;  1ZSP A;  3SJB C;  3AG2 C;  2DYS B;  2EIN C;  4DV2 O;  5LP6 C;  1BGY H;  2OTL V;  1OV9 A;  5KMG A;  4CS4 A;  1OCR B;  2UXN A;  5KX5 B;  1JQ0 A;  3BY6 A;  5EBL C;  4RQF A;  1GN2 A;  4RQE A;  1R6N A;  4XDJ A;  1NS1 A;  3SPJ A;  5L3B A;  2OYQ A;  4WCE V;  4DR1 B;  4JI5 B;  2P06 A;  4AQY O;  1PKX A;  3OMN B;  1HWY A;  4J7K A;  2F4V O;  3DGE A;  4FM2 A;  3RVZ A;  4JZ2 A;  3OUF A;  2ZM6 O;  1W2B U;  4A5U B;  3T1H B;  1R3I C;  2BTO A;  4QNH B;  2P5O A;  1KKC A;  4ASU G;  5IYD O;  4PDV A;  4UFZ A;  2WLN A;  2EIN B;  4JI6 O;  1L1F A;  1MZF A;  3K0D A;  1QVG U;  3AK1 A;  5F2V O;  1NTK H;  1SET A;  4LWS A;  3OD4 A;  3JAT A;  2UXD B;  1NR1 A;  1OCZ C;  2QKS A;  4J9Y B;  1OCR C;  2D2C B;  1N8R W;  4DV4 O;  2IJJ A;  2JGD B;  4E2L A;  4EB6 A;  2F93 B;  4L8J A;  1H2S B;  3P32 A;  2H94 A;  2KG7 B;  4OX9 B;  4E4E A;  4X88 A;  4GKK O;  1Z5V A;  1XOU A;  1KC8 W;  4JGS A;  5LGU A;  2EZP A;  4X66 O;  4JI0 B;  3C3T A;  1H2N A;  4GKJ B;  4JTA B;  1O9G A;  2OCH A;  4UVB A;  2AXT Z;  4B7E A;  1I0H A;  5LBQ A;  1N32 B;  2ZQM A;  1Y76 B;  2CTP A;  1NH2 D;  3O65 A;  4AI8 A;  3TXS A;  1BQZ A;  3TJT A;  2FML A;  2LO1 A;  5IYZ B;  2XAS A;  4DV0 B;  1KUQ A;  3MDS A;  1HNX O;  2QGN A;  2OCC B;  3OUS A;  1XNQ O;  1OCZ B;  4CH6 A;  1OHH G;  5CA3 A;  4WBN A;  1US6 A;  2Q67 A;  1JPX A;  1QCE A;  1W0K G;  2HFE C;  2IJK A;  3RFR A;  2ZKO A;  4X89 A;  4JYA O;  3H1K H;  1FPO A;  4DV3 B;  4BWA A;  2BOC C;  4FZ1 A;  3FX7 A;  1OCC C;  1NVP D;  3VQX A;  4G2K A;  4MVZ A;  4U3J A;  4KHP B;  3E22 A;  1FJG B;  2KB1 A;  3LSQ A;  4TT3 G;  4X1K B;  2H3O A;  4NXN B;  2F4V B;  1FXH A;  3D3Q A;  1AJQ A;  3FB7 C;  2X7R B;  1QR8 A;  3B40 A;  4TQF A;  5J2T B;  1VQ5 V;  4JI4 O;  4I50 A;  2DWE C;  4B3R O;  3JD0 A;  3UKM A;  5B1N A;  2CDY A;  3ZX6 A;  1JOY A;  1N4C A;  4UXN A;  1SF9 A;  2L6L A;  4CH4 A;  4NTY A;  3K5M A;  3EHB B;  1RFY A;  3SJQ C;  4PA4 A;  2OT5 A;  1IXM A;  5CB4 A;  1FAF A;  2W0X A;  4D7T A;  2ZE7 A;  2LGW A;  2Q4P A;  4LFB O;  1VF7 A;  1Q6U A;  4JI1 B;  5K1X A;  2MK3 A;  4DV3 O;  4Z1V A;  2KQX A;  1SQP H;  2GV9 A;  1K9M W;  3BA9 A;  5ITZ B;  2P4K A;  2A9H A;  1N34 B;  3ZMS A;  1NJI W;  3G4S V;  3T1Y O;  1THZ A;  2W6I G;  1VF6 C;  2BTQ A;  3JD4 A;  4FK5 C;  1GH6 A;  3Q4H B;  1NU1 H;  5IY5 B;  2BCC H;  4QGP A;  3F7V C;  2FYU H;  2JIZ G;  2Y0P A;  1WN7 A;  4MSW C;  1K8A W;  5IY5 C;  4WFF A;  1HNW O;  5DN6 G;  2VQF O;  3WG7 B;  1M56 C;  2JK5 C;  1LUV A;  5L3F A;  3K0G A;  1WPX A;  4JTD B;  4DK1 A;  5H2F Z;  4GT1 A;  3JAS A;  3FYE B;  4K3A A;  2DJV A;  2NN4 A;  3OGI B;  4MVM A;  3I56 V;  1EN5 A;  4O4I B;  3BEH A;  2YXL A;  3QNE A;  4WFB V;  2R70 A;  3RBZ A;  2ZDI A;  2ETN A;  4TOI A;  2Q9L A;  3CRA A;  1MNG A;  3NR7 A;  2XHB A;  1BHB A;  2JGU A;  1QLE B;  2UUC O;  1S77 D;  4OX9 O;  2F23 A;  2PUS A;  2E74 B;  1XMO O;  3ZRW B;  2WLL A;  3JAM N;  4LF7 O;  3L71 H;  2F95 B;  4PEL A;  4PV1 B;  2E75 B;  1YIT V;  3AG2 B;  2DYS C;  3J7A U;  5A9G A;  4MW8 A;  3SPI A;  5LA6 B;  1B06 A;  2X6C A;  3OTF A;  4ZHQ A;  3ZHR A;  5CBF A;  3AG4 C;  2X0L A;  3FAV A;  3B4S A;  1Q7Y W;  3TK1 A;  1NBM G;  1QVF U;  3JAK B;  5JVD A;  1PM9 A;  3JAL A;  4X64 O;  1S72 V;  4AHC A;  3J81 N;  2ZE5 A;  1WJZ A;  1G4Y B;  4FLZ A;  4JAA A;  4G28 B;  5EK0 A;  2EJ7 A;  2P4V A;  4X1Y A;  3E8G A;  3ZHQ A;  4BIU A;  4H37 A;  4BIO A;  2WA4 A;  1I94 O;  3SJA C;  5KUM A;  4DR6 B;  3OW2 U;  1EN4 A;  4G27 B;  4TV9 B;  4CC5 A;  5L3C A;  1GM8 A;  1IBK O;  4FPP A;  2QE7 G;  1BZK A;  4N21 A;  4B3M B;  5IDJ A;  1OJH A;  3D36 C;  2X6A A;  3QG5 A;  4I0X B;  1QU7 A;  2YXY A;  4ZIB A;  4ZI7 B;  1NR7 A;  3L9D A;  1IVS A;  3OM3 B;  5B1B C;  1CPY A;  4DRX B;  3OR7 C;  3CP1 A;  1XIL A;  3ETD A;  4PA6 A;  3ZMZ A;  2AHY A;  3QO8 A;  1W59 A;  1AI5 A;  3SYO A;  2RN9 A;  4X64 B;  4JI3 B;  1FFX A;  4J11 A;  4JAV A;  1P7G A;  1G8M A;  4O2A B;  1VP7 A;  3CCL V;  1ZL8 B;  3ABM C;  3VBB A;  4TV9 A;  1N33 O;  3H1H H;  3RYH A;  4PHZ A;  3CXC U;  5KHJ A;  3ZIA G;  1HNZ O;  3QF7 A;  2PZS A;  4X1Y B;  3UM7 A;  1P4R A;  2QTS A;  1RSO B;  2QM7 A;  2XOK G;  1CXZ B;  5JJJ B;  3JAL B;  4K8X A;  3RGB A;  1RPR A;  3MAQ A;  2JS5 A;  2P6J A;  4CS2 A;  5JQG A;  2R9R B;  3SPH A;  1RM1 C;  5EYP B;  3CCQ V;  5KA5 A;  3OR6 C;  3HKC B;  4WBN B;  3IC9 A;  1MOF A;  2IW5 A;  2ZXW B;  3OGC C;  1B6Q A;  2QR4 A;  4UV8 A;  3CCU V;  1BL8 A;  3MHS C;  1GN3 A;  2QEX V;  1GTO A;  4LR3 A;  3LDC A;  1EBO A;  4DUY B;  3X2Q C;  1XL6 A;  3B2E E;  4PA7 A;  4UCR A;  3AG1 C;  5DED A;  3ASO C;  1AR5 A;  5IWA O;  2ZR3 A;  1IXB A;  4BW5 A;  5JH7 B;  1WPB A;  3CSX A;  1BSM A;  2LGQ A;  3H1I H;  2ZD9 A;  2WPD G;  2JJ2 G;  5CA1 A;  1P49 A;  1WAZ A;  4FLV A;  1KP3 A;  1N33 B;  4QE9 A;  5B3S B;  3ASN B;  4GX0 A;  5HFM A;  2QWQ B;  5FNV A;  1M4U A;  1VQ9 V;  1P84 F;  4J7Z A;  4QIW F;  4EEQ A;  3L75 H;  4CBC A;  2DQ3 A;  1F51 A;  3T2M A;  2EIK B;  3FB5 C;  3KCX A;  2QKC A;  3P3N A;  2P90 A;  3ZHV A;  1K4C C;  3S3W A;  1WP8 A;  2EZO A;  1YXB A;  5HFL A;  3F7Y C;  2VWK A;  1X4T A;  3TCU A;  4LFC O;  4U7O A;  4DR3 B;  2Q8V A;  2V4D A;  3BCC H;  2QJ1 A;  2RMK B;  4H33 A;  2DYR C;  3OEE G;  4DR4 O;  4FMT A;  2WLI A;  2LFS A;  4F6R A;  1WA8 A;  4YHH O;  1YJN V;  1AP5 A;  2DWD C;  1QNM A;  3DC5 A;  4PDR A;  2ZCE A;  3R66 A;  5J2U B;  1XHX A;  2UUA O;  1JCH A;  2P22 C;  3H01 A;  2IU0 A;  4FJC C;  2EX3 A;  1TUB B;  4GX1 A;  3MHH C;  5D5P A;  4B3R B;  1Q86 W;  3JAR B;  4LF4 O;  4X9Q A;  1KD1 W;  1SRY A;  1JA8 A;  4JI8 O;  2Q0O C;  2N74 A;  3EVK A;  3E89 A;  2VRZ A;  1Q82 W;  5LYJ A;  1L8D A;  4X1K A;  1QLE C;  3JAW B;  1UJW B;  4JAS A;  4DV0 O;  2HR3 A;  4J42 A;  1AI4 A;  2CK3 G;  3ZJZ A;  5IJ9 B;  3UO2 A;  5LMU O;  4NB5 A;  4DK0 A;  3ZRV A;  1LR1 A;  3P3P A;  4K0K O;  4DV5 O;  4LBE C;  2GUZ B;  2LQT A;  2IH3 C;  4UCS A;  4I55 B;  3CCS V;  2ZE8 A;  1FYJ A;  4JI0 O;  1D5N A;  2L35 A;  4R7C A;  4ICG A;  1BT8 A;  5EIB C;  2N04 A;  1URF A;  1YHQ V;  1PPJ H;  3M7M X;  1PNL A;  2XAJ A;  1N36 B;  4TUY A;  2E76 B;  2YID A;  5K1P A;  4UCU A;  2WLJ A;  3UT5 A;  4UCV A;  3QO5 A;  1TUE B;  2HEP A;  3CYO A;  4P30 A;  1SKV A;  2UXC B;  1VAR A;  3RYI A;  3VQV A;  4DR5 O;  1OCC B;  3N2K B;  4WFG A;  2PI5 A;  4JYA B;  5GW7 A;  5E1A C;  3CCR V;  1EFR G;  5LYJ B;  1A32 A;  2Z5U A;  2YIA A;  3WB2 A;  1SC5 B;  3U10 A;  2JRI A;  3FFQ A;  5H5N A;  4UB6 Z;  1VQN V;  4F6E A;  2YXH A;  5H6Q A;  2GBO A;  5CA0 A;  2ZIM A;  4QE7 A;  1ZX3 A;  2IJI A;  4CH3 A;  3FD9 A;  1X59 A;  2Q0A A;  1PD3 A;  4MVU A;  4JYC A;  2W6J G;  2EIJ C;  3QO7 A;  1M90 W;  2HP8 A;  3W7T A;  5FL7 G;  1KB9 F;  1XDC A;  2Z3Y A;  2GHY A;  1CEZ A;  1PV0 A;  1VF6 A;  2XTA A;  3HR0 A;  4FZ0 A;  5KUK A;  2IH1 C;  3KKY A;  4LF8 O;  4RAI A;  1YTF D;  2W0F C;  4LF5 B;  4JF3 A;  1SES A;  2GTS A;  4W4K A;  1YTF B;  2DOS A;  5KA6 A;  2CH7 A;  3K3W A;  3H9V A;  3DXR A;  3SYQ A;  1BMF G;  3HPL C;  4O2B B;  2CE4 A;  4YIP A;  3CRQ A;  4PDM A;  3T1H O;  5B1A C;  3W7U A;  3K57 A;  3T4Z A;  2DW4 A;  3IAY A;  2UUB O;  4X8A A;  1COW G;  1RPO A;  4JV5 B;  5LHI A;  1K34 A;  3B09 A;  2DQ0 A;  2ITC C;  3AG7 A;  1V54 C;  4LF9 O;  2WAM A;  1K5S A;  5IJ0 B;  1AR4 A;  2QWO B;  3ZMT A;  3APO A;  1MAB G;  2QKA A;  4FLU A;  4I7Z B;  3N2G B;  5EIB D;  1PNK A;  2BSK B;  4ZOL A;  1JR9 A;  2JVD A;  2IM9 A;  3E35 A;  1J5E B;  2XAQ A;  3K9S A;  1NTM H;  4O4L B;  1ZLZ A;  1SER A;  3ASN C;  2GTA A;  2HJD A;  3ABL B;  3STL C;  3ZN0 A;  2Q6A A;  1R73 A;  4LFC B;  5IYZ A;  4TSF G;  2O57 A;  1TA8 A;  1CP9 A;  5LMU B;  3B8N A;  4GKK B;  4WFE A;  2F43 G;  1RP3 B;  5LXT A;  3K5L A;  3RN4 A;  2F1M A;  3ZHU A;  1Y76 A;  1JFF B;  3DTU B;  5EZY B;  2HVJ C;  4PDL A;  4FLT A;  3AG4 B;  1DF5 A;  2ILM A;  2BE3 A;  2XT9 A;  1M57 B;  1Z2G A;  5BMV B;  4JAU A;  4KXR A;  3CJH B;  1F4M A;  2VQE B;  4F6R B;  4ZOL B;  3FKS G;  2M6Y A;  1SZT A;  3L70 H;  2OIG A;  3CC4 V;  1PNM A;  4MW3 A;  4DXW A;  4JI5 O;  1IZ3 A;  3ZRX A;  1NTZ H;  1XEQ A;  1UPG A;  1T5E A;  2WLK A;  4Q20 A;  5LGT A;  3ZED A;  1GN4 A;  3SYP A;  1V55 B;  4YIO A;  2JGD A;  2KSD A;  1JVM A;  2QWP B;  2XUM A;  1SQV H;  4KUM A;  3TXQ A;  4JV5 O;  1HR0 O;  1Y4M A;  3ZN1 A;  2UXX A;  1BQ0 A;  2ZM6 B;  1UFI A;  3LNN A;  4LWS B;  3R65 A;  5FPO A;  1PP9 H;  1Z5W A;  3ABM B;  1IBL B;  4ZBM A;  1GK9 A;  4KFM A;  1F7Y A;  2CH7 B;  3DSQ A;  5J2U A;  2OCC C;  3RYI B;  1ZAU A;  4B3S B;  3JSL A;  2ZNJ A;  2ZIO A;  1M57 C;  2Q7H A;  3A0B Z;  4X1I A;  3WB1 A;  4WF9 V;  1U97 A;  3JSN A;  4Z2W A;  4I0X A;  1FS0 G;  3FB6 C;  3HKB A;  4DR1 O;  4FLX A;  5GON A;  3IGA C;  3E2E A;  1TAE A;  2Y69 B;  4FLW A;  3RYF A;  3KCY A;  4TV8 B;  4YJ3 B;  1VQK V;  4RO2 A;  4H0L B;  1I08 A;  3A8T A;  4JI4 B;  3ICX A;  3E86 A;  4FVM A;  1MA1 A;  1E1Q G;  3T4D A;  1K4D C;  2NR5 A;  4O4J B;  1DGS A;  4FLY A;  3D36 A;  3E22 B;  3K03 A;  1IBL O;  3RT3 C;  3JD2 A;  5GTI Z;  3K04 A;  4ZKI A;  3CCE V;  3OMA B;  2QWN B;  5IJ9 A;  3CME V;  5C8Y B;  1OCO B;  1ZUQ A;  4C7U A;  3CRR A;  3T1C A;  3ZRS A;  1AI6 A;  4DW0 A;  5BZB A;  3ETG A;  4B3M O;  2CTQ A;  4ABM A;  1Q43 A;  1DTO A;  3FYI B;  4UV9 A;  5EBW C;  4IHJ A;  4CS3 A;  3ZMU A;  1WP7 A;  1NI8 A;  4FM1 A;  4DW1 A;  1BS3 A;  1XRE A;  3G71 V;  2YIB D;  1H8E G;  3THO A;  4P2Z A;  4I9Q A;  1IX9 A;  3G67 A;  4KHP O;  3JAR A;  4HAM A;  1NT2 B;  1Q81 W;  1GM9 A;  5BR8 O;  4PD4 F;  5L3E A;  2RNB A;  4UVC A;  3RYC B;  2EUL A;  4P9P A;  1JJO A;  3X2Q B;  4NR1 A;  4L87 A;  4O2B A;  2NLJ C;  5JQG B;  4XDK A;  5IYB O;  1VQ7 V;  2V1D A;  1JJ2 U;  4PA3 A;  4DYL A;  3SPC A;  1HNW B;  5C93 A;  4X65 O;  4DV1 B;  4UVA A;  2DYR B;  1WB8 A;  2WLI B;  2PYJ A;  2YIB A;  2XAH A;  2PF4 E;  3BA8 A;  4NXM O;  1H8H G;  1D2D A;  2N05 A;  1XMO B;  3JD1 A;  1KU9 A;  1Q6H A;  4YJ2 A;  2EIK C;  5CMU A;  1S3J A;  1PL0 A;  4HYO A;  3GVM A;  3VQW A;  3A0H Z;  2D3O W;  1YF2 A;  1FXV A;  1TUB A;  2QSA A;  3HKD B;  3BRC A;  4LNU A;  1R1B A;  3DXR B;  2C2A A;  1ROP A;  2FB5 A;  1YEW A;  5BR8 B;  3OMI B;  1H38 A;  4MS2 A;  1NVP B;  4NYK A;  4H13 B;  2QDO A;  1BHA A;  1WNS A;  3CPW U;  2VQE O;  4GCZ A;  1V54 B;  2OTJ V;  3WU2 Z;  1EN6 A;  1VQL V;  1VQ8 V;  4WFH A;  1YDX A;  2XAF A;  2ZT9 B;  5JCO C;  4GUN A;  5KHK A;  4DV1 O;  5A2Q N;  2YDE A;  1L0N H;  1IUR A;  3U0Z A;  2PY5 A;  2YI9 A;  2PI4 A;  2PYL A;  1XUQ A;  2H8P C;  2HKO A;  2UUB B;  1G6U A;  4YJ2 B;  1YVW A;  3VOU A;  4DR2 B;  4U3F H;  3RVY A;  3J80 N;  5CN0 A;  3HKC A;  1SQQ H;  4UUJ C;  3M8A A;  4RWU A;  3ZBH A;  1YIJ V;  2GUZ A;  2QM4 A;  4BIZ A;  1VQ4 V;  1FXK C;  4X20 B;  5IT9 N;  4KL1 A;  1E79 G;  3CJH A;  2BSK A;  1QLN A;  1FXK B;  4BW9 A;  4YHH B;  1HR0 B;  5EBM C;  4DR3 O;  4QJF B;  5IJ0 A;  1JFF A;  1AI7 A;  2Y48 A;  3ZS8 C;  3K59 A;  3CB2 A;  5KAF Z;  1NKD A;  2WSS G;  1GM7 A;  3S3X A;  5KLV H;  2ZDI C;  5B1B B;  3RYF B;  4B08 A;  4LCU C;  3JD3 A;  1NZ6 A;  1J95 A;  1XMQ B;  1H2L A;  3JYC A;  4I5S A;  4MTF A;  2YS8 A;  1AJP A;  2AGA A;  1FFX B;  4MTG A;  4TQD A;  1Q3E A;  4UCO A;  2YEV A;  5JJN B;  4DUY O;  3CRC A;  4K35 A;  2AZ2 A;  4DR7 O;  3F5W C;  2Z0A A;  1OZ0 A;  3HB3 B;  1P7B A;  2OIE A;  1JX9 A;  2YIC A;  3F5T A;  1WB7 A;  2LP7 A;  1N32 O;  3K58 A;  3G6E V;  3E83 A;  4YXW G;  3RWR D;  4LFA B;  5JWP A;  3BPZ A;  1U96 A;  2QTO A;  4EFB A;  4J7J A;  1VQM V;  2QM8 A;  4JI2 O;  1NH2 B;  2LJ2 A;  2A3Q A;  2QWR B;  1DLB A;  1I7F A;  3HKD A;  3TGU H;  2M7W A;  5IE9 A;  1JMK C;  4DV6 B;  3Q4H A;  3H1L H;  5B1A B;  2KKW A;  4B7K A;  1GO3 F;  4DV7 O;  3SYA A;  1N0N A;  3P30 A;  4JZG A;  4O2A A;  4GYC B;  1RM1 B;  3SPG A;  2UXC O;  5ITZ A;  1SQX H;  1KEC A;  1HNZ B;  3AG3 B;  4GZR B;  2ZR2 A;  2EIL B;  4LF6 B;  2CTR A;  2CGN A;  3I5D A;  4X66 B;  4HNA A;  2HLD G;  4X1I B;  4OGQ B;  1WA8 B;  3IC7 A;  4Q6G A;  2Q7E A;  3ASO B;  4J80 A;  4X62 B;  1SZX A;  1KBH A;  3SJC C;  4TUY B;  5JH7 A;  2Q68 A;  5CBG A;  2CAZ C;  2LFR A;  3ABK C;  5LA6 A;  4ZHQ B;  2FKX A;  1ZTE A;  1LUW A;  2E3C A;  4OPH A;  5JJE B;  1Q6I A;  1Q8I A;  3PJS K;  5H6R A;  3AK3 A;  4D6T H;  4H44 B;  4PA9 A;  4MT8 A;  3SR2 C;  1KKD A;  2LW7 A;  2WLL B;  2EIM B;  4EKW A;  2RCV A;  3CCM V;  3VQY A;  4O4L A;  1VQO V;  4CZZ A;  2UU9 B;  2AZ0 A;  2E5L O;  3CMA V;  3BHP A;  1SQB H;  3N2K A;  2IJH A;  2NNU A;  2A06 H;  2G38 A;  3CS5 A;  2UXB B;  1QR9 A;  1RSO A;  3ZCC A;  5BMV A;  4LF5 O;  4LF4 B;  1Y66 A;  5JCO A;  4K8Z A;  4MVR A;  1PL4 A;  2YSU B;  4O4J A;  3GWK C;  5EZY A;  4I9W A;  3FB8 C;  4DV7 B;  3IFX A;  1VMG A;  2UUC B;  2UUA B;  2HG5 C;  4YY3 B;  2R9I A;  1Y6X A;  1GMG A;  1S5L Z;  5B3S C;  4YY3 O;  3CCV V;  2EIM C;  1VQP V;  3UQ8 A;  4MVQ A;  1AVM A;  3CCJ V;  2ZNI A;  4I55 A;  2WLH A;  1QBZ A;  2FTK A;  1KQS U;  2WLM A;  1HNX B;  2K1E A;  1XNQ B;  4TWK A;  3WB0 A;  3JCU Z;  5KHG A;  3A2F A;  3E8B A;  4HNA B;  5J9P C;  5CB4 B;  2VQF B;  4D7S A;  4DR5 B;  1F4N A;  2UXD O;  4XDL A;  3JAW A;  4B3T B;  4LNU B;  1Q90 D;  1F23 A;  3W7W A;  1R3L C;  1XNR O;  5IWA B;  1MG1 A;  1O9H A;  4B3S O;  1AJN A;  4R8C A;  3W7S A;  1VIB A;  3ABT A;  2K9P A;  5CA0 B;  3SYC A;  1XI1 A;  1R6T A;  2ARH A;  3N27 A;  2P7T C;  4GKJ O;  5GTH Z;  3H1J H;  3K5O A;  4J10 A;  4O4H B;  4U3J B;  5E79 Z;  1N0J A;  1YSC A;  2ZIN A;  1M93 A;  5B1O A;  1XQ8 A;  5L3G A;  4ZI7 A;  3K06 A;  1Y67 A;  4LFA O;  4DUZ B;  3L72 H;  3IJ4 A;  5L3D A;  2CGO A;  4IIJ B;  5TIS Z;  2PTM A;  1W0J G;  3RYC A;  1XMQ O;  1ENV A;  5H9C A;  3OTO B;  5DM6 V;  1S5H C;  2DN9 A;  2B1G A;  3L73 H;  2Y4T A;  1IBM B;  4DR6 O;  4K0K B;  3M99 B;  2IBZ H;  4JI7 O;  5LHG A;  1E1R G;  3NXS A;  3CC2 V;  3APQ A;  2Y69 C;  3GWO A;  5EC2 C;  4W4L A;  4X62 O;  4R6Z A;  1VEW A;  2JDI G;  1TGO A;  1VF5 B;  3LDD A;  4LH6 A;  5KHH A;  4UB8 Z;  2RQ6 A;  4JI2 B;  1MZE A;  4X20 A;  2YUA A;  3N2G A;  1FKA O;  3CEI A;  4NTX A;  5B5E Z;  4MTO A;  3UT5 B;  3LDE A;  3SDL A;  2A0L A;  2KG7 A;  2GDS A;  2UU9 O;  3B8M A;  2QA4 V;  2WA3 A;  5DEC A;  2E5L B;  1XBL A;  2V7Q G;  1K5Q A;  3K79 A;  5D5Q A;  3JAT B;  3CC7 V;  4RUF A;  2UXB O;  1IDS A;  4NXM B;  4FM0 A;  1AB3 A;  3BAA A;  3E8F A;  4OXS A;  1IBM O;  2DE0 X;  2Q7G A;  3HKB B;  3PN1 A;  3OE7 G;  1FJG O;  5EYP A;  4IIJ A;  5B66 Z;  1BCC H;  1KP2 A;  2F66 C;  3KZI Z;  1HDJ A;  3CXH F;  4LC1 A;  3UCS C;  1ZWI C;  1DK1 A;  5LL6 Y;  1SA0 A;  4LP8 A;  2XAG A;  3AG3 C;  4HBN A;  2R72 A;  2GSM B;  4O4H A;  5BXZ A;  1GRJ A;  1ORQ C;  3ZHS A;  3LUT B;  3DC6 A;  3AG1 B;  3ML0 A;  3UO3 A;  4F4L A;  2HVK C;  4NVP A;  4GX5 A;  1ARO P;  5KX5 A;  4DUZ O;  5LMN O;  4DV5 B;  4QPK A;  2VWJ A;  3STZ C;  3AK2 A;  2AHZ A;  4IGG A;  1M9N A;  1M56 B;  4JI1 O;  4FIP C;  3U11 A;  3E8H A;  4LF6 O;  4GX2 A;  3OTO O;  1L0L H;  4IYH A;  4JYY A;  2Y4U A;  2X6B A;  2PGG A;  3LSU A;  1MSD A;  2LW1 A;  2BOB C;  2CTW A;  2EJR A;  3CX5 F;  1FFT B;  4X65 B;  1YCI A;  1GN6 A;  1J5E O;  1SQF A;  4AIL C;  3CD6 V;  1HP8 A;  1DF4 A;  1NQT A;  3G6B A;  2B9Z A;  1H2M A;  3EFF K;  2JEX A;  2YEV B;  2ADP A;  5LMN B;  1GAX A;  1BE3 H;  2OWO A;  2WWW A;  3C90 A;  1M5I A;  2JEU A;  4JTC B;  4R50 A;  3D3I A;  4I50 B;  1Q5O A;  2ZE6 A;  4IL6 Z;  5J2T A;  3ETQ A;  2VS0 A;  4FFB B;  3SGI A;  5KAI Z;  3A0R A;  3LSS A;  4AQY B;  1AP6 A;  1MSW D;  4EFE A;  4IHJ B;  4DO2 A;  1K7D A;  3OEH G;  1K3E A;  1FD9 A;  3G80 A;  4LFB B;  3L74 H;  5LOV A;  5FNV B;  1S76 D;  4JI3 O;  1YI2 V;  1FXK A;  4FFK A;  1Y74 A;  1AR1 B;  3CE2 A;  3OT7 A;  1M1K W;  1XNR B;  5JVD B;  5C8Y A;  3JAS B;  4LF9 B;  1HW7 A;  3JAK A; 
#chains in the Genus database with same CATH homology
 3I56 V;  2QTO A;  1VQM V;  1YTF B;  2QM8 A;  3K9A A;  1R3K C;  1EZJ A;  5KA6 A;  3BEH A;  1NH2 B;  3K3W A;  3QNE A;  4WFB V;  3OAA G;  3RBZ A;  1K92 A;  3SYQ A;  1BMF G;  3W7X A;  2ZDI A;  3HPL C;  1H2G A;  4PDM A;  1DLB A;  5B1A C;  5LGN A;  3W7U A;  1BHB A;  4HZ3 A;  2M7W A;  4JYB A;  1QLE B;  3I55 V;  3T4Z A;  1S77 D;  2DW4 A;  4X8A A;  5B1A B;  1GO3 F;  1COW G;  1RPO A;  2WLL A;  3ZRW B;  3SYA A;  2ITD C;  3P30 A;  5LHI A;  4PEL A;  1K34 A;  2IU3 A;  1RM1 B;  3SPG A;  1K33 A;  2DQ0 A;  1YIT V;  2HJF C;  3AG2 B;  4MTX A;  1KEC A;  2DYS C;  2ITC C;  3LNM B;  3AG3 B;  4MW8 A;  3SPI A;  2ZR2 A;  1V54 C;  2ATK C;  2X6C A;  5LHH A;  2EIL B;  2WAM A;  1K5S A;  4N23 A;  5CBF A;  3AG4 C;  2X0L A;  1I5X A;  4U7N A;  2JJ1 G;  3ZMT A;  1Q7Y W;  3ABU A;  1MAB G;  1WLE A;  3TK1 A;  4RUE A;  1NBM G;  1V55 C;  1QVF U;  1PNK A;  2HLD G;  1YJ9 V;  4J9Z B;  2EIJ B;  1S72 V;  1LNQ A;  3IC7 A;  1K73 W;  1G4Y B;  3ASO B;  1I5Y A;  4G28 B;  3E35 A;  5EK0 A;  1YJW V;  3E8G A;  2XAQ A;  2Q68 A;  5IYC O;  3JCZ A;  5CBG A;  2LFR A;  3ABK C;  4BIU A;  4H37 A;  4WFA V;  5KUM A;  3OW2 U;  1SER A;  3RW0 A;  2EBO A;  3ASN C;  3PJS K;  4G27 B;  5H6R A;  1OCO C;  3ABL B;  2XND G;  4PA9 A;  4MT8 A;  3STL C;  2Q6A A;  3ZN0 A;  1KKD A;  1R73 A;  2WLL B;  3OFN G;  5L3C A;  2EIM B;  1GM8 A;  4EKW A;  4TSF G;  1CP9 A;  3CCM V;  3B8N A;  1R3J C;  3AEI A;  4FPP A;  4CZZ A;  4P9O A;  4WFE A;  2QE7 G;  2F43 G;  2B5U A;  1VQO V;  4N21 A;  5IDJ A;  2X6A A;  3CMA V;  3DTU B;  3GB7 C;  2HVJ C;  2IJH A;  2NNU A;  4PDL A;  3AG4 B;  4Z1M G;  1DF5 A;  1M57 B;  4JAU A;  1K97 A;  1NR7 A;  2P67 A;  2A79 B;  4MVO A;  1F4M A;  2ZXW C;  3MD0 A;  3OM3 B;  5B1B C;  1CPY A;  3FKS G;  3WFV A;  1QR9 A;  3OR7 C;  1SZT A;  3ZCC A;  2EIL C;  3CP1 A;  4PA6 A;  3ETD A;  3CC4 V;  3ZMZ A;  2AHY A;  1Y66 A;  1PNM A;  4BAY A;  4MW3 A;  4DXW A;  4MVS A;  3ZRX A;  5CBH A;  4KP4 A;  4MVR A;  2YSU B;  2WLK A;  3QO8 A;  4Q20 A;  3K08 A;  1AI5 A;  5LGT A;  4I9W A;  3B77 A;  1XL4 A;  4XBF A;  3SYP A;  1V55 B;  3SYO A;  4JPR A;  3FB8 C;  1JVM A;  1GKF A;  3WG7 C;  4JAV A;  4KUM A;  1Y4M A;  3IFX A;  1G8M A;  2UXX A;  3ZN1 A;  3CCL V;  2HG5 C;  3R65 A;  3ABM C;  2R9I A;  3ZRW A;  3KG2 A;  3VBB A;  1GMG A;  5B3S C;  3ABK B;  3CCV V;  2EIM C;  1VQP V;  2Q69 A;  3ABM B;  2B1I A;  4MVQ A;  1GK9 A;  4ZBM A;  3CXC U;  4KFM A;  3CCJ V;  2WLH A;  3ZIA G;  1QBZ A;  2FTK A;  1KQS U;  2WLM A;  3ABL C;  3UM7 A;  1P4R A;  3ZMV A;  3ETE A;  2K1E A;  4TWK A;  2OCC C;  2QM7 A;  2XOK G;  4QPJ A;  1M57 C;  5EC1 C;  4WF9 V;  3E8B A;  1S0V A;  1VQ6 V;  5J9P C;  1RPR A;  2P6J A;  2R9R B;  1F4N A;  3SPH A;  1R6K A;  1FS0 G;  4XDL A;  1RM1 C;  3FB6 C;  3TET A;  3CCQ V;  5KA5 A;  3AG2 C;  2DYS B;  3OR6 C;  1F23 A;  2EIN C;  3W7W A;  1R3L C;  1MOF A;  2IW5 A;  1MG1 A;  2ZXW B;  3OGC C;  1AJN A;  4R8C A;  3W7S A;  2OTL V;  3ABT A;  3IGA C;  1B6Q A;  3E2E A;  1OCR B;  4UV8 A;  2UXN A;  3CCU V;  1BL8 A;  1JQ0 A;  3BY6 A;  2Y69 B;  3MHS C;  5EBL C;  2QEX V;  1GTO A;  4RQF A;  3LDC A;  3SYC A;  1EBO A;  1VQK V;  4RO2 A;  4RQE A;  3X2Q C;  1R6N A;  1XL6 A;  4PA7 A;  4XDJ A;  3E86 A;  3SPJ A;  3AG1 C;  5L3B A;  3ASO C;  2P7T C;  4WCE V;  2ZR3 A;  1PKX A;  1E1Q G;  3OMN B;  1K4D C;  3T4D A;  4BW5 A;  1HWY A;  3D36 A;  3K03 A;  2ZD9 A;  3JD2 A;  2WPD G;  2JJ2 G;  3K04 A;  1YSC A;  4ZKI A;  1KP3 A;  3DGE A;  3CCE V;  3OMA B;  4QE9 A;  5B3S B;  3ASN B;  5B1O A;  3CME V;  3RVZ A;  4GX0 A;  5L3G A;  1OCO B;  3OUF A;  5HFM A;  3K06 A;  3T1C A;  3ZRS A;  1AI6 A;  5BZB A;  3ETG A;  5L3D A;  1VQ9 V;  1W2B U;  1DTO A;  3FYI B;  1R3I C;  4UV9 A;  5EBW C;  4QNH B;  4QIW F;  1W0J G;  4ASU G;  2DQ3 A;  3ZMU A;  4CBC A;  5IYD O;  4PDV A;  2WLN A;  2EIN B;  1L1F A;  3G71 V;  1F51 A;  3T2M A;  1ENV A;  1H8E G;  2EIK B;  3K0D A;  3FB5 C;  4P2Z A;  5H9C A;  1QVG U;  5DM6 V;  1S5H C;  1SET A;  2B1G A;  2P90 A;  1NR1 A;  1OCZ C;  2QKS A;  1K4C C;  4HAM A;  3M99 B;  4J9Y B;  1OCR C;  5LHG A;  1N8R W;  2EZO A;  1E1R G;  3NXS A;  1GM9 A;  5HFL A;  1Q81 W;  3CC2 V;  3F7Y C;  2IJJ A;  2Y69 C;  3GWO A;  5L3E A;  4E2L A;  4UVC A;  5EC2 C;  4P9P A;  3X2Q B;  3TCU A;  4L87 A;  4R6Z A;  4U7O A;  3P32 A;  2NLJ C;  2H94 A;  2JDI G;  3LDD A;  4X88 A;  4H33 A;  4XDK A;  2DYR C;  5IYB O;  1VQ7 V;  1KC8 W;  2V1D A;  1JJ2 U;  3OEE G;  4JGS A;  4PA3 A;  5LGU A;  3SPC A;  4FMT A;  5C93 A;  2WLI A;  2EZP A;  2LFS A;  1YJN V;  4UVA A;  2DWD C;  2DYR B;  2WLI B;  4JTA B;  4PDR A;  4MTO A;  4UVB A;  2XAH A;  3LDE A;  5LBQ A;  2A0L A;  1JCH A;  3H01 A;  2IU0 A;  4FJC C;  2ZQM A;  1NH2 D;  1H8H G;  3B8M A;  2QA4 V;  4GX1 A;  3JD1 A;  3MHH C;  2V7Q G;  1K5Q A;  1Q86 W;  2XAS A;  3K79 A;  2EIK C;  1KD1 W;  2OCC B;  5CMU A;  1S3J A;  1SRY A;  3OUS A;  3CC7 V;  4RUF A;  1PL0 A;  1OCZ B;  4HYO A;  3E89 A;  1OHH G;  5CA3 A;  2D3O W;  1Q82 W;  1FXV A;  3E8F A;  4OXS A;  2Q67 A;  1JPX A;  1QCE A;  1W0K G;  2HFE C;  3OE7 G;  1QLE C;  1UJW B;  2C2A A;  1ROP A;  2IJK A;  4JAS A;  1KP2 A;  4X89 A;  2HR3 A;  1AI4 A;  3OMI B;  4LC1 A;  1H38 A;  1ZWI C;  2BOC C;  4MS2 A;  2CK3 G;  3ZJZ A;  1NVP B;  1BHA A;  4LP8 A;  3CPW U;  3ZRV A;  1OCC C;  2XAG A;  1NVP D;  3AG3 C;  4G2K A;  4GCZ A;  1V54 B;  2OTJ V;  4MVZ A;  4LBE C;  2GSM B;  1VQL V;  2KB1 A;  4WFH A;  1VQ8 V;  3LSQ A;  2XAF A;  1ORQ C;  2IH3 C;  3LUT B;  4TT3 G;  1FXH A;  3AG1 B;  3ML0 A;  3CCS V;  1AJQ A;  3FB7 C;  2X7R B;  4R7C A;  1QR8 A;  4F4L A;  2HVK C;  2PI4 A;  4GX5 A;  1ARO P;  1VQ5 V;  2H8P C;  2HKO A;  2DWE C;  3JD0 A;  3UKM A;  5B1N A;  1JOY A;  4QPK A;  4UXN A;  3VOU A;  3STZ C;  2AHZ A;  3RVY A;  5CN0 A;  1YHQ V;  1M9N A;  1M56 B;  3EHB B;  1PNL A;  4FIP C;  2XAJ A;  3SJQ C;  4UUJ C;  4PA4 A;  2OT5 A;  1YIJ V;  3E8H A;  4BIZ A;  4GX2 A;  2WLJ A;  1IXM A;  2X6B A;  1VQ4 V;  3QO5 A;  1FXK C;  1TUE B;  3CYO A;  2BOB C;  4P30 A;  1E79 G;  2EJR A;  1QLN A;  1FXK B;  1FFT B;  5EBM C;  3CD6 V;  1DF4 A;  1NQT A;  1OCC B;  4QJF B;  4WFG A;  2MK3 A;  2PI5 A;  5GW7 A;  1AI7 A;  2Y48 A;  3EFF K;  5E1A C;  2JEX A;  1EFR G;  2YEV B;  3CCR V;  1K9M W;  2Z5U A;  1NKD A;  2WSS G;  1GM7 A;  2WWW A;  1VQN V;  2ZDI C;  2JEU A;  5B1B B;  2A9H A;  5H6Q A;  4JTC B;  4R50 A;  3ZMS A;  1NJI W;  3G4S V;  3D3I A;  1THZ A;  2W6I G;  4LCU C;  3JD3 A;  4QE7 A;  1J95 A;  2IJI A;  3JD4 A;  4FK5 C;  1PD3 A;  3JYC A;  4I5S A;  4MVU A;  5IY5 B;  4MTF A;  4JYC A;  2W6J G;  1AJP A;  2EIJ C;  3F7V C;  3A0R A;  3LSS A;  3QO7 A;  2JIZ G;  1M90 W;  4MTG A;  3W7T A;  2YEV A;  1MSW D;  4DO2 A;  5FL7 G;  4MSW C;  1K8A W;  2Z3Y A;  5IY5 C;  4WFF A;  1K7D A;  5DN6 G;  3F5W C;  3OEH G;  2GHY A;  1CEZ A;  1OZ0 A;  3WG7 B;  1K3E A;  3HB3 B;  1P7B A;  1M56 C;  1JX9 A;  2JK5 C;  5L3F A;  1S76 D;  3K0G A;  2LP7 A;  1WPX A;  4JTD B;  5KUK A;  3G6E V;  2IH1 C;  1FXK A;  4GT1 A;  1AR1 B;  1YI2 V;  4RAI A;  1M1K W;  3E83 A;  3FYE B;  4YXW G;  1YTF D;  2W0F C;  4JF3 A;  1SES A;  4MVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...