3K03A

Crystal structure of cng mimicking nak mutant, nak-dtpp, k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k03A00
2OCCC 3BEHA 4JTCB 4TWKA 3E8GA 4WFFA 5B1AC 4OXSA 3STZC 3SYPA 2QTOA 2WLNA 1V55C 3KG2A 1ORQC 4I9WA 4MVSA 3ABKC 3AG3C 3IFXA 4XDKA 2WLJA 1OCCC 2EINC 2IH3C 4X89A 3K06A 4GX1A 5EBMC 2AHZA 3FB7C 4PDMA 1S5HC 4RAIA 2BOBC 3EFFK 3RW0A 2AHYA 2X6AA 2A0LA 4MTOA 3HPLC 2P7TC 4PDLA 5EC2C 3E83A 3K08A 4RUFA 4MVRA 4PDRA 4QE9A 2HVKC 4P2ZA 4R50A 3E89A 3JYCA 4P30A 2ITCC 2WLKA 5B3SC 1OCOC 3LNMB 5J9PC 2HFEC 4MW8A 3F7YC 2DYRC 1LNQA 1OCZC 3SYQA 1XL6A 3OR7C 2WLLA 4MW3A 2ATKC 2X6BA 4G28B 3SPJA 2HJFC 4QNHB 1XL4A 3ASOC 4G27B 4DXWA 3STLC 3T2MA 2DWDC 4P9OA 2K1EA 4X8AA 1R3KC 2X6CA 4HYOA 5EC1C 2Q67A 4LBEC 3WG7C 3AG1C 4RUEA 1M56C 3E86A 2ZD9A 1JVMA 3E8HA 4WFEA 3T4ZA 3K04A 3F7VC 2QKSA 1P7BA 3AG2C 3RBZA 4PA4A 3ZJZA 1R3LC 3SYCA 4PDVA 3OUFA 5KUMA 3T1CA 3VOUA 3K0DA 3OUSA 2KB1A 3AG4C 4LP8A 4X88A 5EBWC 3UM7A 5CBHA 2WLIA 2Q68A 2Y69C 3LUTB 4J9YB 3SPGA 2JK5C 3K03A 3ZRSA 1QLEC 2DWEC 4P9PA 4XDLA 4GX2A 4MVOA 3SJQC 3X2QC 4BW5A 3PJSK 4R7CA 3IGAC 4PA9A 4H33A 3SYOA 3FB6C 5CBFA 1ZWIC 1V54C 3ASNC 4MVQA 3UKMA 2IH1C 3ABMC 3FB8C 5E1AC 4MTFA 1J95A 3R65A 1R3JC 1G4YB 4GX0A 3SPHA 2EILC 4PA6A 4XDJA 2WLLB 3FB5C 2NLJC 4WFGA 5B1BC 1OCRC 4PA3A 3T4DA 5BZBA 3OR6C 3TCUA 3RVZA 3K0GA 2EIKC 2WLHA 4PA7A 4ZBMA 3OGCC 2WLMA 5IY5C 5KUKA 3LDEA 3E8FA 4QE7A 2BOCC 3F5WC 4MVUA 4WFHA 1KKDA 1M57C 4MS2A 3SPCA 2Q69A 2YEVA 4GX5A 4JTDB 2HG5C 5EK0A 2ITDC 2DYSC 1BL8A 4F4LA 4JTAB 3RVYA 4CBCA 2R9RB 4MVZA 2WLIB 4MTGA 2HVJC 4H37A 3SYAA 2A79B 2A9HA 2ZXWC 4UUJC 3GB7C 2H8PC 4MSWC 5EBLC 4LCUC 4J9ZB 4KFMA 3TETA 4R8CA 4HZ3A 3E8BA 4R6ZA 2Q6AA 2W0FC 1K4CC 4RO2A 3SPIA 3ABLC 4EKWA 1K4DC 3LDDA 1R3IC 3LDCA 4MVMA 5CBGA 2EIMC 2EIJC
chains in the Genus database with same CATH superfamily
1RFYA 2W6IG 4OXSA 2Q7GA 4MVSA 3AG3C 2CTWA 4JPRA 1AJPA 1F51A 3FB7C 5EYPA 1X4TA 1Y6XA 2LO1A 3EFFK 2BTQA 4J80A 1DF5A 2GV9A 4J11A 4DV5O 2FB5A 2JGDB 1QCEA 2XAFA 5CA1A 3C3TA 3CCQV 3VQWA 2ATKC 3AG2B 3OEHG 4FMTA 3STLC 4JYBA 1XNQB 3OTOB 4LBEC 3A0RA 3UT5B 1JPXA 2MK3A 3AG2C 5GW7A 3CC7V 4I0XB 2N05A 1SQXH 2JS5A 4R7CA 2LW7A 2UUAB 1S3JA 4DW1A 3OTOO 3H1LH 2IJKA 4PA6A 1FPOA 4QPKA 1HW7A 1XREA 4CS4A 2Q7HA 2IM9A 3RVZA 2WLHA 3HKDA 3VQXA 2ZR2A 1OHHG 1G1XB 1XILA 3M99B 4DW0A 1JCHA 2OTJV 5KMGB 2PI5A 1RPRA 5LP6C 5TISZ 2UUAO 4YJ2B 2AZ2A 3ZMUA 4CZZA 1NQTA 4MVZA 5JQGA 1F4NA 4MTGA 4I4TA 2A9HA 1VQKV 1K7DA 3CC4V 2EIMB 3OGIB 4TT3G 1QBZA 3EVKA 4RO2A 1RM1B 2KKWA 5KLVH 2EIMC 2M6YA 4LH7A 1SA0A 2CK3G 1NH2B 2WA4A 3WB1A 2PF4E 3SJCC 2PUSA 1VEWA 4XBFA 1E79G 4PV1B 4W4LA 4FPPA 1XOUA 1JFFB 1OCOB 2XAGA 3BA8A 4UB6Z 5IWAB 1EN4A 3DSQA 5FNVB 5JH7B 3DC6A 4IT5A 3W7WA 1NKDA 1OCOC 1B3QA 3CRCA 3LNMB 3JAKB 1LNQA 1HNXB 2H3OA 3HKEA 2ZINA 3T2MA 2LGWA 1VQOV 4HYOA 2AGAA 2BE3A 3AG4B 3RYHA 1FXKC 5IWAO 1RPOA 4U7NA 1YJNV 2QDOA 3IC9A 1NI8A 4UCSA 3AG4C 4BWAA 4TUYA 4K8ZA 1K33A 2LP7A 5CBFA 1HNXO 1UPGA 1IZ3A 1GN6A 3H01A 4PI2A 3E2EA 1AR5A 1OCRB 1IXBA 5BXZA 2DQ0A 3D8CA 2QTSA 4DR7B 3OAAG 3QF7A 1GN3A 1L0LH 1PNLA 1OCRC 5D5QA 1HDJA 1WP7A 4DUZB 5L3GA 5L3CA 5H9CA 1COWG 4WFAV 3WB0A 4ABMA 3WFVA 4DUYB 3RGBA 4GT1A 1BT8A 1XHZA 1MOFA 2IU3A 4DRXB 3ABLB 4DR7O 1BCCH 5KX5B 1ZX3A 2P6JA 1K4CC 1M4UA 3ABLC 5B1AB 4DUZO 2WSSG 5C93A 1YCIA 4K0KB 4DV2B 2ZDIC 4DUYO 5B1AC 4LWSB 1SS3A 2Q7EA 2EULA 3AK2A 2LQTA 1PNKA 3JCZA 3D3QA 1CPYA 3G4SV 1YVWA 5B66Z 3H1HH 1D2DA 3BA9A 4AHCA 4K0KO 4DV2O 3OD4A 1SKVA 2JDIG 1P7GA 5IDJA 3OMIB 4H13B 1XL4A 3P3NA 1XI1A 1K5SA 2AW9A 2LFSA 4DR2B 2HEPA 4K35A 1JQ0A 3X2QB 4WBNB 1VMGA 3VQVA 3VOUA 3OUSA 1VQ7V 1ZSPA 3HKBB 3X2QC 1YTFB 4MVOA 2B1GA 3JAMN 3U0ZA 1ZWIC 5LHIA 1AP6A 4DR2O 5FPOA 1N34O 5BY1A 1Y66A 3K79A 1LR1A 4X62O 2EX3A 3RYCB 1B06A 2EBOA 3ZCCA 3RWRD 1Q7YW 4I55B 5IYBO 1VQ9V 2PI4A 4MTXA 1BL8A 1P84F 3RVYA 4O4IB 1KQSU 2GUZA 1EBOA 2QWRB 4U7OA 4UFZA 1ROPA 4JV5B 1L0NH 1LUWA 1K34A 2EIJB 3FD9A 1I94B 3APOA 3ZHUA 1K4DC 2Y4UA 3LSQA 3K9SA 4NTXA 1US6A 3OMAB 4GYCB 2EIJC 4TWKA 4WFFA 4UCTA 1ZAUA 5F2VO 2IJIA 3UT5A 1YITV 1MZFA 5JJEB 3ZMTA 4I0XA 4LF4B 5B5EZ 4JV5O 5EBMC 4LF7B 2ODMA 2IW5A 1S5HC 4BAYA 1TVKB 3RW0A 2KQXA 1I94O 4ZI7B 3E83A 3L72H 3A0BZ 2HVKC 4QJFB 1VF6C 1IDSA 1NVPB 2CTRA 1W59A 3SYQA 2HJFC 4LF4O 1F4MA 1VP7A 4LF7O 5KMGA 4B7EA 4YJ2A 3JAWB 3BY6A 2WA3A 1IX9A 1QR9A 1GN4A 3OW2U 3K59A 4YXWG 1SQQH 2LFRA 4MVQA 1KP2A 1AI5A 1VF7A 2DE0X 4CS3A 3OR6C 3JATB 1YTFD 3CCEV 4JF3A 2A06H 4WFHA 3UCSC 2ETNA 4CH4A 5K1XA 1KBHA 3ZIAG 2RQ6A 4GKJB 1PP9H 1JFFA 4JTAB 1N0JA 3K5NA 1SQGA 5JJNB 5FNVA 2FL4A 2HVJC 2OYQA 4TQFA 3ETEA 5JH7A 2JRIA 3JAKA 1AVMA 3CJHB 5CBGA 3CE2A 1GM7A 3BEHA 3STZC 4GKJO 5H6RA 1Q81W 3TXSA 1N32B 2YEVB 4EB6A 2DYRB 4PD4F 3K08A 4DR1B 1FS0G 3RFRA 5DN6G 3SJBC 5GTIZ 3Q4HB 2DYRC 1PD3A 2ZQMA 2F43G 3E22B 4MW3A 1S72V 3ABTA 5H6QA 3P30A 1N32O 3HKCB 5CA3A 3FYEB 4L8JA 4FFKA 1ZLZA 4DR5B 5IJ9B 4DR1O 3SYCA 1NVPD 3OUFA 3QTCA 3K0DA 1MMMA 4Q20A 3BVOA 4J7KA 1N36B 4AI8A 4P9PA 3THOA 4PA9A 3ASNC 2ZDIA 4X1IB 4LFAB 3DTUB 3JCUZ 4UVAA 3FB8C 2ZNJA 5E1AC 1AP5A 1J95A 1R3JC 1GM8A 4J10A 4FLTA 3JD4A 4NKGB 2WLLB 3D36A 5LYJB 2F23A 4DR5O 2NLJC 1K5QA 5B1BC 3N2KB 2XAQA 1YEWA 2V4DA 1F7YA 2CAZC 4UCOA 1X59A 2ADPA 1N36O 1KECA 1V54B 3HB3B 1M57C 5LGTA 1SZTA 5LOVA 1KB9F 2DN9A 4LFAO 4F4LA 2RJZA 2E5LB 2XT9A 1KD1W 3CCUV 3G80A 1OZ0A 2LW1A 2OIEA 3CRQA 1VARA 3MHHC 3E8BA 4UCUA 4CH3A 5GTHZ 5JVDB 1NTMH 3IC7A 3H1IH 4DV1B 2WLNA 2E5LO 1JX9A 1WB7A 2KG7B 4I5SA 1YF2A 1KYOF 3K06A 4AQYB 3ZHRA 3HKBA 4X66B 3ZMZA 4YJ3B 4IIJB 5JCOC 1WPXA 3UO3A 2JJ2G 2PGGA 1TAEA 3ZHQA 4GZRB 2QA4V 4JI4B 4KUMA 5BR8B 4DV1O 4FLWA 1XL6A 3JD2A 2XAHA 2X6BA 4G28B 3SPJA 4X1KB 3ZRWB 1JJ2U 1WN7A 2L6LA 3RYCA 4AQYO 1Y76B 4X66O 1XNRB 2KSDA 2DMXA 4NTWA 1R3LC 2EJ7A 4FLYA 1EN5A 1DGSA 5CB4A 3B2EE 2Q68A 4O4IA 4JI4O 5BR8O 1SZXA 2DJVA 1VQ4V 1H38A 3K9AA 1E1RG 4JZGA 1Z5WA 4O4HA 1FKAO 4FFBB 1VQ6V 1G4YB 3SPHA 1XNRO 1AROP 3FB5C 2E75B 4WFGA 1FFXA 5KUKA 2DYSB 2RNBA 1SQFA 4NR1A 4JTDB 4JGSA 1TVKA 2DYSC 3JD1A 1VF6A 1WP8A 2WLIB 1S77D 1MZEA 4JAAA 5BMVB 3DXRA 1K9MW 2PY5A 1M9NA 4TV9B 2DOSA 1XBLA 3QG5A 5LP6B 3D3IA 2EZOA 1V55B 1G6UA 3CRRA 2GDSA 1SERA 2JGUA 3B09A 1CEZA 5IJ0B 3F5TA 2BTOA 2Q8VA 4EEQA 1V55C 5IYZB 3ABKC 3IFXA 3KKYA 1YZBA 3JAWA 4YY3B 4YHHB 1NS1A 2BSKB 3T1HB 5LHGA 2N04A 3B77A 2YDEA 4MTOA 4UV8A 3C90A 3BPZA 4HBNA 2ITCC 2VRZA 4ZOLB 3AG1B 1H2NA 4DXWA 2GHYA 4YY3O 4YHHO 3JATA 2YXHA 2X6CA 5LBQA 3T1HO 3AG1C 3CB2A 4B08A 2RDCA 5H5NA 4KHPB 3RBZA 5KHKA 4LP8A 3OM3B 1YXBA 2QR4A 3K03A 4O2BB 4QIWF 2QM7A 1FXKB 4J42A 1S0VA 1K97A 3PN1A 4GX0A 4X64B 4KHPO 2Q0AA 3TCUA 2W6JG 4RQFA 1YDXA 2A3QA 2UXCB 1S5JA 3JASA 4F6RB 1PPJH 1PKXA 1THZA 2QJ1A 2YEVA 3ZEDA 2CGNA 5EK0A 5GONB 4LNUB 3CCLV 4ASUG 3H9VA 5LMUB 3ML0A 5J2TB 3EXAA 5DM6V 4X64O 4JI0B 4NYKA 3ETQA 4J9ZB 1I7FA 1KC8W 3MHSC 3G6BA 5KHGA 1FYJA 4J41A 2UXCO 1M5IA 4GLXA 4ZKIA 2YS8A 2OCCC 3HKCA 2PYLA 3RYFA 4B3RB 2NN4A 1IXMA 3ICXA 3K57A 3IAYA 5IJ9A 1TA8A 5LMUO 4JI0O 2IH3C 3B8MA 4DV0B 1SF9A 4LH6A 5J2UB 1FXVA 2R9AA 4IYHA 1WA8B 1Q3EA 4DV4B 5L3BA 4PDLA 2ZE5A 5LMNB 4QPJA 3B8NA 3CD6V 5L3DA 4FM1A 3L75H 3ASOB 1NJIW 4J7JA 5LYJA 2WLLA 4B3RO 4I50B 2RN9A 4W4KA 1QU7A 2EJRA 3N2GB 3W7TA 3ASOC 3QO8A 4P9OA 4DV0O 4UB8Z 4X8AA 1YJ9V 3CYOA 2QM8A 3F7VC 4DV4O 2QEXV 3TK1A 5LMNO 1IURA 3ZHVA 4TSFG 1HWYA 4NB5A 2KB1A 3DC5A 4O4JB 3O9OA 2JK5C 3SJQC 4H33A 3FB6C 4AILC 4JI2B 1O9HA 3WB2A 2HR3A 3ZRVA 3CCJV 5CMUA 2HJDA 3ZHTA 3S3WA 5JVDA 1JR9A 1YSCA 3MD0A 1MABG 3L70H 1N34B 3FAVA 2WLMA 4D7TA 3LDEA 2DW4A 4X62B 2AXTZ 3OT7A 1N4CA 5JWPA 2KG7A 4ICGA 3OE7G 2ZXWB 3SR2C 4GX5A 4JI2O 1P49A 3OTFA 3ZN1A 2C2AA 1VF5B 5LL6Y 3ZMSA 2ZXWC 2ILMA 4EFEA 4JZ2A 4E4EA 1H8HG 3RT3C 4IL6Z 1W0KG 1R3IC 3AK1A 4X1KA 3ZRWA 2YSUB 2M7WA 4C7UA 4JTCB 4UCRA 1Y76A 1SC5B 3JARB 4FLXA 4Q6GA 5LXTB 1I5XA 1QQCA 3BHPA 2WLJA 4Z1MG 3BABA 2EINC 2AHZA 3CSXA 1EFRG 3CEIA 2OWOA 1FJGB 2JGDA 4JYAB 1FFTB 2A0LA 2ZT9B 3KZIZ 4DYLA 4K3AA 1EZJA 4UXNA 3CCMV 4FFBA 2BTQB 3APQA 1PL0A 1V9PA 3K58A 1M56B 2JIZG 5IE9A 4OX9B 2K9PA 5CA1B 1MSWD 1FJGO 4RUEA 1M56C 5KHIA 4JYAO 2CTPA 4JASA 4G2KA 2WLIA 5BMVA 1F23A 2MW2B 2QM4A 4OX9O 3T1YB 3QO5A 1TUEB 1DF4A 5C8YB 5LP6A 4DR3B 5KA5A 3J81N 4CC5A 1IVSA 1VQ5V 2LGQA 5IJ0A 2NR5A 3OGCC 4OGQB 5IYZA 3W7UA 2QWQB 2QWPB 1Q6HA 4I9QA 2BSKA 2GTSA 3WU2Z 5A2QN 3T1YO 3K5MA 1PL4A 1OV9A 3J7AU 3TJTA 4DR3O 2H8PC 3M7MX 1GAXA 4ZOLA 5LA6B 3I5DA 3VBBA 2GSMB 4MVMA 1YIJV 2WPDG 4PHZA 1N0NA 5DEDA 5JJJB 5LGUA 5KAFZ 1GH6A 1S5LZ 1OCCC 2NNUA 4DO2A 1N33B 2V1DA 2UXDB 1VQLV 3BCCH 4O2BA 3LNNA 5EC2C 1OCZB 1I5YA 1XMQB 4B3TB 4LF9B 3GWOA 1FXKA 3JYCA 2OIGA 4P30A 4FJCC 4FM2A 1OCZC 1XEQA 2VWJA 2OCHA 2IJHA 1N33O 1S76D 2UXDO 4NXNB 1HNZB 1JVMA 4F6RA 1P7BA 4F6EA 4PA4A 2FTKA 1XMQO 4PDVA 5KUMA 4B3TO 4LF9O 1R6NA 2YICA 4X88A 5GONA 2F1MA 5J2TA 2PYJA 3L74H 1QLNA 2EILB 3LSSA 1GK9A 3VQYA 2ZR3A 3CPWU 3A2FA 4L87A 4NXNO 2EILC 2Z3YA 1HNZO 3CXCU 3SGIA 4GUNA 4U3JB 5BZBA 1KKCA 4DK1A 4FLUA 4PA7A 2YIBD 3CS5A 3E8FA 3K5LA 1HNWB 3ASNB 3SPCA 4DRXA 2Z0AA 5DECA 2Q69A 5J2UA 4IHJB 2D2CB 2YXLA 3I55V 5KX5A 4CBCA 4QGPA 4D6TH 1IBMB 5B1BB 1SESA 2PTMA 5IYCO 4UUJC 2E74B 1BGYH 4LCUC 4DR4B 1AI7A 1FD9A 2Q73A 4R8CA 4HZ3A 1A32A 1FXHA 2ADQB 2Q6AA 1M57B 4LWSA 4I50A 1AILA 3IJ4A 3N2GA 4NVPA 1HNWO 5KA6A 5AG2A 1IBLB 1H8EG 3SYPA 1WB8A 2QTOA 3U11A 1BHBA 1IBMO 3BFRA 2P06A 2Q5ZA 1NT2B 3FX7A 4ZIBA 4DR4O 4O4JA 1Y74B 2PZSA 1TUBB 1Y4MA 1Z5VA 1BQZA 1IBLO 3ZRXA 2UXXA 2WLKA 4JAUA 2HFEC 3QNEA 3AG7A 2ZKOA 3WG7B 2UUCB 4QNHB 2JEXA 2XHBA 1NTZH 2IJJA 2DWDC 4WBNA 4CC6A 3WG7C 3E86A 4IGGA 3M8AA 5KHJA 2QKSA 4O4LB 2XASA 3AK3A 4CS2A 4LF8B 1QVGU 3ZRSA 3ABMB 4Z1VA 1BSMA 4JI1B 1W0JG 2UUCO 2DQ3A 5FPRA 3ABMC 1H2MA 1G8MA 2ZE6A 4I55A 2VWKA 4LF8O 2Q0OC 5FL7G 4N21A 4QE7A 3F5WC 1DLBA 5B1OA 4JI1O 2P67A 2CUGA 3LSUA 1GKFA 1KMIZ 1SQVH 2X7RB 2JEUA 3CRMA 3SJAC 4MSWC 5EBLC 4X65B 2FYUH 1XHXA 4TOIA 5FLXN 2GUZB 3P32A 2ZE7A 3LDDA 4DK0A 2GBOA 2WAMA 1XMOB 3E8GA 1GO3F 4LF5B 3BRCA 4RWUA 2VQEB 1ORQC 3K3WA 1Z2GA 4I9WA 2QKCA 4XDKA 3H1JH 1JMKC 4ZI7A 4TQDA 4X65O 4X89A 3P3PA 1NR7A 2YIBA 2X6AA 1YI2V 5CA0B 4FK5C 1EM1A 1L8DA 4B3MB 1K92A 3ETDA 4P2ZA 4R50A 3E89A 5LGNA 1XMOO 2VQFB 4FZ1A 3S3XA 1WLEA 3ABKB 4LF5O 5C8YA 3I56V 2RMKB 2VQEO 4HNAB 2P22C 3JSNA 1UJWB 1GM9A 1XNQO 1E1QG 2YI9A 4KP4A 1QNMA 1K8AW 1VIBA 1EN6A 1K3EA 4FZ0A 3CCSV 4B3MO 3EHBB 5EZYB 2IBZH 4UCVA 2VQFO 1SQPH 3GVMA 1Q8IA 3NR7A 3QVNA 2HKOA 3CRAA 1Y67A 1Q82W 2XTAA 4E2LA 1NZ6A 5LA6A 4CH5A 1U97A 2D3OW 1HR0B 1JA8A 4NXMB 2P4KA 1UFIA 4PJ0Z 1IBKB 2OTLV 5CN0A 4HAMA 2ZCEA 1R6TA 4MVUA 1KKDA 3JD0A 1RM1C 1J5EB 4OPHA 2Q9LA 4LR3A 1EZVH 1M90W 1AB3A 3SYAA 1HR0O 4NXMO 3CJHA 1BMFG 4JYYA 1TGOA 1ZL8B 1IBKO 3TGUH 4EKWA 4DR6B 5L3EA 1WJZA 2G38A 1J5EO 1P4RA 2GTAA 3G71V 1AR4A 3MAQA 4LF6B 2L35A 3R66A 5H2FZ 1LUVA 4GX1A 2P4VA 4ZHQB 3RN4A 1WAZA 4A5UB 3Q4HA 2OCCB 4DR6O 2A7WA 3E22A 1NTKH 3ZBHA 2UXBB 4BIUA 4U3FH 4MW8A 4EB6B 1WNSA 4U3JA 4LF6O 3KCYA 4B3SB 3NXSA 1R3KC 2R9IA 3OFNG 2ZD9A 4WFEA 5D5PA 4FM0A 4X20B 1QLEB 1DTOA 1B6QA 4IHJA 2WWWA 4PELA 3H1KH 2UXBO 5EBWC 2BCCH 5CBHA 4X1IA 4J9YB 1QLEC 2FKXA 3ZHSA 4GX2A 3FFQA 3IGAC 3SYOA 3BAAA 4B3SO 2XOKG 2VS0A 2CE4A 3N2KA 1NBMG 4MTFA 2EIKB 4YIPA 2Y0PA 2V7QG 1W2BU 4LFCB 1AJQA 1GMGA 4BW9A 2EIKC 1K73W 3CWBH 1RSOB 3AEIA 1L1FA 1AJNA 2AZ0A 2Y48A 1RP3B 2YXYA 4GKKB 4OPAA 1Q6UA 4IYIA 4LFBB 2CH7B 1Y74A 4BIZA 3D36C 4KL1A 1TUBA 4LFCO 5LOVB 4KFMA 4UVBA 1WPBA 5HFLA 1PV0A 1ZUQA 3RYIB 1XDCA 2E76B 1NH2D 4MT8A 4GKKO 2HP8A 2QKAA 1KU9A 4LFBO 2X0LA 5JCOA 3OMNB 2RCVA 4H44B 1U96A 3KG2A 4O4LA 4YJ3A 1QR8A 4IIJA 1KUQA 2QWNB 4BR6A 1YJWV 3O65A 1MNGA 4FIPC 4YIOA 2B9ZA 1AI4A 3E35A 3JALB 4RAIA 5ITZB 1B04A 3HPLC 2P7TC 2Y4TA 4O2AB 4JI7B 4TV8B 4QE9A 5K1PA 4K8XA 4JI5B 3CCRV 3U10A 2EINB 1M93A 3MDSA 2F4VB 2LJ2A 1H2LA 4X1YB 1BZKA 5EC1C 1GTOA 1Q90D 5IY5B 3ZN0A 5IT9N 4JYCA 4JI7O 1CP9A 2UXNA 1NU1H 1JOYA 5IY5C 4JAVA 4JI5O 5EYPB 2N74A 2H94A 4XDLA 1CXZB 4BW5A 1AI6A 3GWKC 2JVDA 5E79Z 5CB4B 2F4VO 4EFBA 3UKMA 2IH1C 1GN2A 3A0HZ 3G67A 5EIBC 1R1BA 4O4HB 2P90A 4UVCA 1BHAA 2BOCC 3FYIB 1FFXB 2HLDG 3L73H 4TV9A 3UQ8A 2B5UA 5HFMA 5CA0A 2QGNA 2R9RB 1VQNV 2YIDA 4H37A 1URFA 3TETA 4R6ZA 1M1KW 2W0FC 1KP3A 3CMEV 3ETGA 4HNAA 3J80N 3DXRB 4WF9V 2XNDG 4JI6B 4WCEV 3CMAV 3L9DA 2CTQA 3B40A 3HKDB 5EZYA 4DV7B 2QE7G 4FVMA 4PDMA 4KXRA 4BIOA 2YIAA 5B3SB 2OT5A 5JQGB 1N8RW 3DGEA 2CDYA 4I4TB 4MVRA 4PDRA 3TXQA 4JI6O 1O9GA 4I7ZB 3B4SA 1R6KA 5B3SC 1Q6IA 1D5NA 3F7YC 2XUMA 1VQPV 1OCCB 4DV3B 3OR7C 3UO2A 2B1IA 2ZM6B 4G27B 4GCZA 4DV7O 5KAIZ 1VQ8V 2ZNIA 1SA0B 1D5AA 3SDLA 2ZIMA 3FKSG 2IU0A 3T4ZA 2Y69B 2Y0IA 3W7SA 2UUBB 3ABUA 5B1NA 3KCXA 1ENVA 3JSLA 2ZIOA 3T1CA 1XQ8A 4JI3B 3LUTB 2Y69C 4DV6B 3CXHF 2DWEC 1BS3A 4DV3O 2F95B 3N27A 3QO7A 4LC1A 1XUQA 1ZL8A 2R72A 2ZM6O 2UU9B 2O57A 1MSDA 4XDJA 2P5OA 3HKEB 4CH6A 4Z2WA 2UUBO 3T4DA 3K0GA 4ZBMA 4JI3O 5LHHA 4DV6O 1MA1A 5EIBD 3RYHB 3ZX6A 3HR0A 4LNUA 4MS2A 1Q86W 4ZHQA 2HG5C 2UU9O 3G6EV 3JASB 5KHHA 4TUYB 2A79B 2YUAA 4D7SA 4RQEA 1SRYA 3L71H 2JS3A 1R73A 5IYDO 5L3FA 3LDCA 2ZE8A 4WFBV 1YHQV 4PI0A 1H2GA 2EZPA 4N23A 3ZS8C 3CCVV 1VQMV 3CC2V 4X20A 1WA8A 4JI8B 4UV9A 1HP8A 2QSAA 3RYFB 1T5EA 2BOBC 2F66C 2AHYA 1H2SB 1H2KA 4RUFA 1SETA 2CGOA 1PNMA 5J9PC 1QHTA 3CX5F 1SQBH 1JJOA 2R70A 3CP1A 1ZTEA 4JI8O 2E3CA 1NR1A 3K5OA 1OJHA 2K1EA 2QWOB 1RSOA 2FMLA 2Q67A 2HHHB 3E8HA 1AR1B 3K04A 2CH7A 3ZJZA 1BQ0A 3UM7A 3SPGA 1BE3H 2YC0A 3PJSK 2F93B 2Q4PA 2Z5UA 1DK1A 1V54C 3OEEG 3ZMVA 3RYIA 1MG1A 3R65A 2HHHO 2ARHA 2JJ1G 1PM9A 4X9QA 4PA3A 4B7KA 4J7ZA 1Q43A 1GRJA 5A9GA 2XAJA 3FAVB 3JALA 5ITZA 1I08A 2ITDC 3CHXA 4O2AA 1QVFU 4FLVA 4TV8A 3GB7C 2YI8A 4H0LB 1Q5OA 4NTYA 1FAFA 3SPIA 4FLZA 3JARA 3A8TA 3JD3A 5LXTA 1I0HA 2W0XA 3C3SA 4DV5B 4X1YA 3AG3B 3W7XA
chains in the Genus database with same CATH topology
1GM7A 2YSUB 2M7WA 3BEHA 4JTCB 3STZC 2W6IG 4OXSA 1P4RA 1I5XA 5H6RA 3G71V 4MVSA 3AG3C 1Q81W 2WLJA 4Z1MG 2EINC 4JPRA 1AJPA 2YEVB 1F51A 2AHZA 4GX1A 3FB7C 1EFRG 3EFFK 1FFTB 2A0LA 2DYRB 2OCCB 3K08A 1DF5A 1EZJA 1FS0G 4BIUA 4UXNA 3CCMV 1QCEA 2XAFA 5DN6G 4MW8A 2DYRC 1PD3A 3CCQV 2ZQMA 1PL0A 2F43G 4MW3A 2ATKC 1S72V 1M56B 2JIZG 3ABTA 5H6QA 3AG2B 3OEHG 4FMTA 3P30A 3STLC 3NXSA 5CA3A 4JYBA 1R3KC 1MSWD 2R9IA 4LBEC 3OFNG 3A0RA 1M56C 4RUEA 3FYEB 2ZD9A 4WFEA 1JPXA 2MK3A 1QLEB 1DTOA 3AG2C 1B6QA 5GW7A 3CC7V 3SYCA 2WWWA 4JASA 3OUFA 4PELA 1NVPD 3K0DA 5EBWC 5CBHA 4G2KA 2WLIA 4J9YB 4Q20A 1QLEC 4P9PA 1F23A 4GX2A 4R7CA 3IGAC 4PA9A 3SYOA 2XOKG 3ASNC 2ZDIA 3DTUB 4UVAA 3FB8C 3QO5A 5E1AC 1NBMG 1S3JA 1J95A 2EIKB 1R3JC 1TUEB 4MTFA 1DF4A 1GM8A 2IJKA 2V7QG 4PA6A 4QPKA 1W2BU 5KA5A 1AJQA 3JD4A 2WLLB 3D36A 1VQ5V 1GMGA 2NLJC 1K5QA 5B1BC 2XAQA 3RVZA 2EIKC 2WLHA 1K73W 3OGCC 2ZR2A 1OHHG 3AEIA 1L1FA 3M99B 1AJNA 3W7UA 1KECA 1JCHA 1V54B 2Y48A 3HB3B 1M57C 2OTJV 2PI5A 5LGTA 1SZTA 1RPRA 4BIZA 4F4LA 3ZMUA 4CZZA 1NQTA 4MVZA 1F4NA 4MTGA 2A9HA 1KD1W 2H8PC 1K7DA 1VQKV 3CC4V 3CCUV 2EIMB 4KFMA 1OZ0A 3MHHC 4UVBA 4TT3G 3E8BA 1QBZA 4RO2A 5HFLA 1RM1B 3VBBA 2GSMB 4MVMA 1NH2D 4MT8A 2EIMC 3IC7A 1YIJV 2WPDG 2X0LA 3OMNB 2CK3G 1NH2B 2WLNA 3KG2A 5LGUA 1JX9A 1OCCC 1QR8A 4I5SA 2NNUA 4XBFA 3K06A 4DO2A 1YJWV 1E79G 4FIPC 2V1DA 1AI4A 3E35A 4RAIA 4FPPA 1VQLV 1OCOB 2XAGA 3ZMZA 3HPLC 2P7TC 5EC2C 1OCZB 1I5YA 1WPXA 2JJ2G 3GWOA 4QE9A 1FXKA 3JYCA 4P30A 3W7WA 4FJCC 1NKDA 1OCOC 3CCRV 3LNMB 2QA4V 4KUMA 1LNQA 1OCZC 1XL6A 2EINB 3JD2A 2XAHA 2X6BA 4G28B 3SPJA 3ZRWB 1JJ2U 3T2MA 2IJHA 1VQOV 4HYOA 1S76D 5EC1C 1GTOA 5IY5B 3AG4B 3ZN0A 1FXKC 1JVMA 4JYCA 1CP9A 1RPOA 2UXNA 1P7BA 4U7NA 4PA4A 1YJNV 2FTKA 1R3LC 4PDVA 5KUMA 1JOYA 5IY5C 1R6NA 3AG4C 4X88A 4JAVA 2Q68A 1K33A 2LP7A 2H94A 5CBFA 4XDLA 4BW5A 1VQ4V 1H38A 1AI6A 3K9AA 1QLNA 2EILB 1E1RG 3LSSA 1GK9A 2ZR3A 3H01A 3E2EA 3CPWU 3UKMA 2IH1C 1OCRB 2DQ0A 1G4YB 4L87A 3SPHA 1VQ6V 2EILC 2Z3YA 3CXCU 3OAAG 1AROP 3FB5C 4WFGA 1PNLA 1OCRC 5BZBA 2P90A 4UVCA 4PA7A 5KUKA 1BHAA 3E8FA 2DYSB 2BOCC 3ASNB 5L3GA 5L3CA 3SPCA 5H9CA 1COWG 3FYIB 2Q69A 4WFAV 3WFVA 4JGSA 4JTDB 2HLDG 4GT1A 1MOFA 2DYSC 2B5UA 3JD1A 5HFMA 3I55V 4CBCA 2R9RB 2WLIB 1S77D 1VQNV 2IU3A 4H37A 1SESA 5B1BB 3ABLB 5IYCO 4UUJC 1K9MW 1M9NA 4LCUC 1AI7A 3TETA 4R8CA 4HZ3A 2P6JA 1FXHA 4R6ZA 2Q6AA 2W0FC 1M1KW 1K4CC 1KP3A 1M57B 3ABLC 3CMEV 3ETGA 5B1AB 3D3IA 2EZOA 2WSSG 4WF9V 2XNDG 5C93A 1V55B 1SERA 5KA6A 4WCEV 3CMAV 2ZDIC 1H8EG 1CEZA 5B1AC 3SYPA 2QTOA 1BHBA 1V55C 3ABKC 3IFXA 1PNKA 2QE7G 3JCZA 4PDMA 5LHGA 3B77A 1CPYA 4MTOA 5B3SB 2OT5A 4UV8A 3G4SV 1N8RW 1Y4MA 3DGEA 4MVRA 4PDRA 2ITCC 3ZRXA 2WLKA 1R6KA 2UXXA 2JDIG 5B3SC 4JAUA 2HFEC 3F7YC 1VQPV 1OCCB 3QNEA 5IDJA 3OR7C 3OMIB 3WG7B 3AG1B 2B1IA 4QNHB 2JEXA 1XL4A 4G27B 4GCZA 4DXWA 2GHYA 2IJJA 2DWDC 2X6CA 1VQ8V 3WG7C 5LBQA 1K5SA 2LFSA 3AG1C 3E86A 3FKSG 2IU0A 3T4ZA 2Y69B 3W7SA 1JQ0A 3ABUA 2QKSA 3X2QB 2XASA 5B1NA 3RBZA 1ENVA 3T1CA 3VOUA 3OUSA 4LP8A 3OM3B 1VQ7V 3LUTB 2Y69C 1QVGU 3K03A 3ZRSA 3ABMB 2DWEC 3X2QC 1YTFB 4MVOA 3QO7A 4LC1A 1W0JG 2B1GA 4QIWF 2QM7A 1ZWIC 2DQ3A 1FXKB 3ABMC 5LHIA 1S0VA 1K97A 4GX0A 4XDJA 1G8MA 3T4DA 1Y66A 3TCUA 3K0GA 3K79A 4ZBMA 2W6JG 4RQFA 5FL7G 4N21A 5LHHA 4QE7A 3F5WC 2EBOA 1DLBA 3ZCCA 5B1OA 4MS2A 2P67A 1Q7YW 1PKXA 1THZA 1GKFA 2YEVA 5IYBO 1Q86W 2HG5C 5EK0A 1VQ9V 4MTXA 2PI4A 3G6EV 1BL8A 3RVYA 2X7RB 4ASUG 3CCLV 1KQSU 1EBOA 2A79B 2JEUA 4U7OA 3ML0A 1ROPA 4MSWC 5DM6V 5EBLC 4RQEA 4J9ZB 1K34A 1SRYA 2EIJB 1KC8W 3MHSC 1R73A 3P32A 5IYDO 1K4DC 5L3FA 3LDDA 3LSQA 3LDCA 3OMAB 2WAMA 2EIJC 4ZKIA 4WFBV 2OCCC 1YHQV 4TWKA 3E8GA 1GO3F 1H2GA 2EZPA 4WFFA 4N23A 2IJIA 1YITV 3CCVV 1VQMV 3CC2V 1IXMA 3ZMTA 1ORQC 3K3WA 4I9WA 4XDKA 4UV9A 2IH3C 4X89A 3B8MA 5EBMC 2IW5A 1S5HC 1FXVA 4BAYA 2BOBC 1NR7A 3RW0A 2AHYA 2X6AA 1YI2V 4FK5C 5L3BA 4PDLA 3E83A 4RUFA 4QPJA 3B8NA 3CD6V 1K92A 3ETDA 2HVKC 5L3DA 4P2ZA 4R50A 3E89A 4QJFB 5LGNA 1SETA 1PNMA 3ASOB 1NVPB 5J9PC 1WLEA 1NJIW 3ABKB 3SYQA 3I56V 2WLLA 2EJRA 2HJFC 3CP1A 1UJWB 3W7TA 1GM9A 3ASOC 1NR1A 3QO8A 1E1QG 1F4MA 4P9OA 2K1EA 4KP4A 4X8AA 2Q67A 1K8AW 1YJ9V 3CYOA 3E8HA 1AR1B 2QM8A 3F7VC 1K3EA 3K04A 2QEXV 3TK1A 3CCSV 3ZJZA 3EHBB 4TSFG 1HWYA 2KB1A 3UM7A 3BY6A 3SPGA 2JK5C 1QR9A 3SJQC 3OW2U 2HKOA 3PJSK 4YXWG 2Z5UA 4H33A 3FB6C 1Q82W 2LFRA 1V54C 4E2LA 3OEEG 2HR3A 4MVQA 1KP2A 1AI5A 3ZRVA 3ZMVA 5CMUA 3CCJV 1MG1A 3R65A 2D3OW 2JJ1G 1YSCA 3MD0A 1MABG 4PA3A 3OR6C 2OTLV 2WLMA 5CN0A 4HAMA 1YTFD 3CCEV 4JF3A 3LDEA 2DW4A 4MVUA 4WFHA 1KKDA 2XAJA 3JD0A 3OE7G 2ZXWB 1RM1C 4GX5A 3ZIAG 2ITDC 3ZN1A 4JTAB 2C2AA 1M90W 1QVFU 3ZMSA 2HVJC 3SYAA 2ZXWC 3ETEA 3GB7C 1BMFG 1H8HG 3SPIA 4EKWA 1W0KG 3JD3A 1R3IC 5CBGA 3ZRWA 5L3EA 3AG3B 3W7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC C;  3BEH A;  4JTC B;  4TWK A;  3E8G A;  4WFF A;  5B1A C;  4OXS A;  3STZ C;  3SYP A;  2QTO A;  2WLN A;  1V55 C;  3KG2 A;  1ORQ C;  4I9W A;  4MVS A;  3ABK C;  3AG3 C;  3IFX A;  4XDK A;  2WLJ A;  1OCC C;  2EIN C;  2IH3 C;  4X89 A;  3K06 A;  4GX1 A;  5EBM C;  2AHZ A;  3FB7 C;  4PDM A;  1S5H C;  4RAI A;  2BOB C;  3EFF K;  3RW0 A;  2AHY A;  2X6A A;  2A0L A;  4MTO A;  3HPL C;  2P7T C;  4PDL A;  5EC2 C;  3E83 A;  3K08 A;  4RUF A;  4MVR A;  4PDR A;  4QE9 A;  2HVK C;  4P2Z A;  4R50 A;  3E89 A;  3JYC A;  4P30 A;  2ITC C;  2WLK A;  5B3S C;  1OCO C;  3LNM B;  5J9P C;  2HFE C;  4MW8 A;  3F7Y C;  2DYR C;  1LNQ A;  1OCZ C;  3SYQ A;  1XL6 A;  3OR7 C;  2WLL A;  4MW3 A;  2ATK C;  2X6B A;  4G28 B;  3SPJ A;  2HJF C;  4QNH B;  1XL4 A;  3ASO C;  4G27 B;  4DXW A;  3STL C;  3T2M A;  2DWD C;  4P9O A;  2K1E A;  4X8A A;  1R3K C;  2X6C A;  4HYO A;  5EC1 C;  2Q67 A;  4LBE C;  3WG7 C;  3AG1 C;  4RUE A;  1M56 C;  3E86 A;  2ZD9 A;  1JVM A;  3E8H A;  4WFE A;  3T4Z A;  3K04 A;  3F7V C;  2QKS A;  1P7B A;  3AG2 C;  3RBZ A;  4PA4 A;  3ZJZ A;  1R3L C;  3SYC A;  4PDV A;  3OUF A;  5KUM A;  3T1C A;  3VOU A;  3K0D A;  3OUS A;  2KB1 A;  3AG4 C;  4LP8 A;  4X88 A;  5EBW C;  3UM7 A;  5CBH A;  2WLI A;  2Q68 A;  2Y69 C;  3LUT B;  4J9Y B;  3SPG A;  2JK5 C;  3K03 A;  3ZRS A;  1QLE C;  2DWE C;  4P9P A;  4XDL A;  4GX2 A;  4MVO A;  3SJQ C;  3X2Q C;  4BW5 A;  3PJS K;  4R7C A;  3IGA C;  4PA9 A;  4H33 A;  3SYO A;  3FB6 C;  5CBF A;  1ZWI C;  1V54 C;  3ASN C;  4MVQ A;  3UKM A;  2IH1 C;  3ABM C;  3FB8 C;  5E1A C;  4MTF A;  1J95 A;  3R65 A;  1R3J C;  1G4Y B;  4GX0 A;  3SPH A;  2EIL C;  4PA6 A;  4XDJ A;  2WLL B;  3FB5 C;  2NLJ C;  4WFG A;  5B1B C;  1OCR C;  4PA3 A;  3T4D A;  5BZB A;  3OR6 C;  3TCU A;  3RVZ A;  3K0G A;  2EIK C;  2WLH A;  4PA7 A;  4ZBM A;  3OGC C;  2WLM A;  5IY5 C;  5KUK A;  3LDE A;  3E8F A;  4QE7 A;  2BOC C;  3F5W C;  4MVU A;  4WFH A;  1KKD A;  1M57 C;  4MS2 A;  3SPC A;  2Q69 A;  2YEV A;  4GX5 A;  4JTD B;  2HG5 C;  5EK0 A;  2ITD C;  2DYS C;  1BL8 A;  4F4L A;  4JTA B;  3RVY A;  4CBC A;  2R9R B;  4MVZ A;  2WLI B;  4MTG A;  2HVJ C;  4H37 A;  3SYA A;  2A79 B;  2A9H A;  2ZXW C;  4UUJ C;  3GB7 C;  2H8P C;  4MSW C;  5EBL C;  4LCU C;  4J9Z B;  4KFM A;  3TET A;  4R8C A;  4HZ3 A;  3E8B A;  4R6Z A;  2Q6A A;  2W0F C;  1K4C C;  4RO2 A;  3SPI A;  3ABL C;  4EKW A;  1K4D C;  3LDD A;  1R3I C;  3LDC A;  4MVM A;  5CBG A;  2EIM C;  2EIJ C; 
#chains in the Genus database with same CATH topology
 1RFY A;  2W6I G;  4OXS A;  2Q7G A;  4MVS A;  3AG3 C;  2CTW A;  4JPR A;  1AJP A;  1F51 A;  3FB7 C;  5EYP A;  1X4T A;  1Y6X A;  2LO1 A;  3EFF K;  2BTQ A;  4J80 A;  1DF5 A;  2GV9 A;  4J11 A;  4DV5 O;  2FB5 A;  2JGD B;  1QCE A;  2XAF A;  5CA1 A;  3C3T A;  3CCQ V;  3VQW A;  2ATK C;  3AG2 B;  3OEH G;  4FMT A;  3STL C;  4JYB A;  1XNQ B;  3OTO B;  4LBE C;  3A0R A;  3UT5 B;  1JPX A;  2MK3 A;  3AG2 C;  5GW7 A;  3CC7 V;  4I0X B;  2N05 A;  1SQX H;  2JS5 A;  4R7C A;  2LW7 A;  2UUA B;  1S3J A;  4DW1 A;  3OTO O;  3H1L H;  2IJK A;  4PA6 A;  1FPO A;  4QPK A;  1HW7 A;  1XRE A;  4CS4 A;  2Q7H A;  2IM9 A;  3RVZ A;  2WLH A;  3HKD A;  3VQX A;  2ZR2 A;  1OHH G;  1G1X B;  1XIL A;  3M99 B;  4DW0 A;  1JCH A;  2OTJ V;  5KMG B;  2PI5 A;  1RPR A;  5LP6 C;  5TIS Z;  2UUA O;  4YJ2 B;  2AZ2 A;  3ZMU A;  4CZZ A;  1NQT A;  4MVZ A;  5JQG A;  1F4N A;  4MTG A;  4I4T A;  2A9H A;  1VQK V;  1K7D A;  3CC4 V;  2EIM B;  3OGI B;  4TT3 G;  1QBZ A;  3EVK A;  4RO2 A;  1RM1 B;  2KKW A;  5KLV H;  2EIM C;  2M6Y A;  4LH7 A;  1SA0 A;  2CK3 G;  1NH2 B;  2WA4 A;  3WB1 A;  2PF4 E;  3SJC C;  2PUS A;  1VEW A;  4XBF A;  1E79 G;  4PV1 B;  4W4L A;  4FPP A;  1XOU A;  1JFF B;  1OCO B;  2XAG A;  3BA8 A;  4UB6 Z;  5IWA B;  1EN4 A;  3DSQ A;  5FNV B;  5JH7 B;  3DC6 A;  4IT5 A;  3W7W A;  1NKD A;  1OCO C;  1B3Q A;  3CRC A;  3LNM B;  3JAK B;  1LNQ A;  1HNX B;  2H3O A;  3HKE A;  2ZIN A;  3T2M A;  2LGW A;  1VQO V;  4HYO A;  2AGA A;  2BE3 A;  3AG4 B;  3RYH A;  1FXK C;  5IWA O;  1RPO A;  4U7N A;  1YJN V;  2QDO A;  3IC9 A;  1NI8 A;  4UCS A;  3AG4 C;  4BWA A;  4TUY A;  4K8Z A;  1K33 A;  2LP7 A;  5CBF A;  1HNX O;  1UPG A;  1IZ3 A;  1GN6 A;  3H01 A;  4PI2 A;  3E2E A;  1AR5 A;  1OCR B;  1IXB A;  5BXZ A;  2DQ0 A;  3D8C A;  2QTS A;  4DR7 B;  3OAA G;  3QF7 A;  1GN3 A;  1L0L H;  1PNL A;  1OCR C;  5D5Q A;  1HDJ A;  1WP7 A;  4DUZ B;  5L3G A;  5L3C A;  5H9C A;  1COW G;  4WFA V;  3WB0 A;  4ABM A;  3WFV A;  4DUY B;  3RGB A;  4GT1 A;  1BT8 A;  1XHZ A;  1MOF A;  2IU3 A;  4DRX B;  3ABL B;  4DR7 O;  1BCC H;  5KX5 B;  1ZX3 A;  2P6J A;  1K4C C;  1M4U A;  3ABL C;  5B1A B;  4DUZ O;  2WSS G;  5C93 A;  1YCI A;  4K0K B;  4DV2 B;  2ZDI C;  4DUY O;  5B1A C;  4LWS B;  1SS3 A;  2Q7E A;  2EUL A;  3AK2 A;  2LQT A;  1PNK A;  3JCZ A;  3D3Q A;  1CPY A;  3G4S V;  1YVW A;  5B66 Z;  3H1H H;  1D2D A;  3BA9 A;  4AHC A;  4K0K O;  4DV2 O;  3OD4 A;  1SKV A;  2JDI G;  1P7G A;  5IDJ A;  3OMI B;  4H13 B;  1XL4 A;  3P3N A;  1XI1 A;  1K5S A;  2AW9 A;  2LFS A;  4DR2 B;  2HEP A;  4K35 A;  1JQ0 A;  3X2Q B;  4WBN B;  1VMG A;  3VQV A;  3VOU A;  3OUS A;  1VQ7 V;  1ZSP A;  3HKB B;  3X2Q C;  1YTF B;  4MVO A;  2B1G A;  3JAM N;  3U0Z A;  1ZWI C;  5LHI A;  1AP6 A;  4DR2 O;  5FPO A;  1N34 O;  5BY1 A;  1Y66 A;  3K79 A;  1LR1 A;  4X62 O;  2EX3 A;  3RYC B;  1B06 A;  2EBO A;  3ZCC A;  3RWR D;  1Q7Y W;  4I55 B;  5IYB O;  1VQ9 V;  2PI4 A;  4MTX A;  1BL8 A;  1P84 F;  3RVY A;  4O4I B;  1KQS U;  2GUZ A;  1EBO A;  2QWR B;  4U7O A;  4UFZ A;  1ROP A;  4JV5 B;  1L0N H;  1LUW A;  1K34 A;  2EIJ B;  3FD9 A;  1I94 B;  3APO A;  3ZHU A;  1K4D C;  2Y4U A;  3LSQ A;  3K9S A;  4NTX A;  1US6 A;  3OMA B;  4GYC B;  2EIJ C;  4TWK A;  4WFF A;  4UCT A;  1ZAU A;  5F2V O;  2IJI A;  3UT5 A;  1YIT V;  1MZF A;  5JJE B;  3ZMT A;  4I0X A;  4LF4 B;  5B5E Z;  4JV5 O;  5EBM C;  4LF7 B;  2ODM A;  2IW5 A;  1S5H C;  4BAY A;  1TVK B;  3RW0 A;  2KQX A;  1I94 O;  4ZI7 B;  3E83 A;  3L72 H;  3A0B Z;  2HVK C;  4QJF B;  1VF6 C;  1IDS A;  1NVP B;  2CTR A;  1W59 A;  3SYQ A;  2HJF C;  4LF4 O;  1F4M A;  1VP7 A;  4LF7 O;  5KMG A;  4B7E A;  4YJ2 A;  3JAW B;  3BY6 A;  2WA3 A;  1IX9 A;  1QR9 A;  1GN4 A;  3OW2 U;  3K59 A;  4YXW G;  1SQQ H;  2LFR A;  4MVQ A;  1KP2 A;  1AI5 A;  1VF7 A;  2DE0 X;  4CS3 A;  3OR6 C;  3JAT B;  1YTF D;  3CCE V;  4JF3 A;  2A06 H;  4WFH A;  3UCS C;  2ETN A;  4CH4 A;  5K1X A;  1KBH A;  3ZIA G;  2RQ6 A;  4GKJ B;  1PP9 H;  1JFF A;  4JTA B;  1N0J A;  3K5N A;  1SQG A;  5JJN B;  5FNV A;  2FL4 A;  2HVJ C;  2OYQ A;  4TQF A;  3ETE A;  5JH7 A;  2JRI A;  3JAK A;  1AVM A;  3CJH B;  5CBG A;  3CE2 A;  1GM7 A;  3BEH A;  3STZ C;  4GKJ O;  5H6R A;  1Q81 W;  3TXS A;  1N32 B;  2YEV B;  4EB6 A;  2DYR B;  4PD4 F;  3K08 A;  4DR1 B;  1FS0 G;  3RFR A;  5DN6 G;  3SJB C;  5GTI Z;  3Q4H B;  2DYR C;  1PD3 A;  2ZQM A;  2F43 G;  3E22 B;  4MW3 A;  1S72 V;  3ABT A;  5H6Q A;  3P30 A;  1N32 O;  3HKC B;  5CA3 A;  3FYE B;  4L8J A;  4FFK A;  1ZLZ A;  4DR5 B;  5IJ9 B;  4DR1 O;  3SYC A;  1NVP D;  3OUF A;  3QTC A;  3K0D A;  1MMM A;  4Q20 A;  3BVO A;  4J7K A;  1N36 B;  4AI8 A;  4P9P A;  3THO A;  4PA9 A;  3ASN C;  2ZDI A;  4X1I B;  4LFA B;  3DTU B;  3JCU Z;  4UVA A;  3FB8 C;  2ZNJ A;  5E1A C;  1AP5 A;  1J95 A;  1R3J C;  1GM8 A;  4J10 A;  4FLT A;  3JD4 A;  4NKG B;  2WLL B;  3D36 A;  5LYJ B;  2F23 A;  4DR5 O;  2NLJ C;  1K5Q A;  5B1B C;  3N2K B;  2XAQ A;  1YEW A;  2V4D A;  1F7Y A;  2CAZ C;  4UCO A;  1X59 A;  2ADP A;  1N36 O;  1KEC A;  1V54 B;  3HB3 B;  1M57 C;  5LGT A;  1SZT A;  5LOV A;  1KB9 F;  2DN9 A;  4LFA O;  4F4L A;  2RJZ A;  2E5L B;  2XT9 A;  1KD1 W;  3CCU V;  3G80 A;  1OZ0 A;  2LW1 A;  2OIE A;  3CRQ A;  1VAR A;  3MHH C;  3E8B A;  4UCU A;  4CH3 A;  5GTH Z;  5JVD B;  1NTM H;  3IC7 A;  3H1I H;  4DV1 B;  2WLN A;  2E5L O;  1JX9 A;  1WB7 A;  2KG7 B;  4I5S A;  1YF2 A;  1KYO F;  3K06 A;  4AQY B;  3ZHR A;  3HKB A;  4X66 B;  3ZMZ A;  4YJ3 B;  4IIJ B;  5JCO C;  1WPX A;  3UO3 A;  2JJ2 G;  2PGG A;  1TAE A;  3ZHQ A;  4GZR B;  2QA4 V;  4JI4 B;  4KUM A;  5BR8 B;  4DV1 O;  4FLW A;  1XL6 A;  3JD2 A;  2XAH A;  2X6B A;  4G28 B;  3SPJ A;  4X1K B;  3ZRW B;  1JJ2 U;  1WN7 A;  2L6L A;  3RYC A;  4AQY O;  1Y76 B;  4X66 O;  1XNR B;  2KSD A;  2DMX A;  4NTW A;  1R3L C;  2EJ7 A;  4FLY A;  1EN5 A;  1DGS A;  5CB4 A;  3B2E E;  2Q68 A;  4O4I A;  4JI4 O;  5BR8 O;  1SZX A;  2DJV A;  1VQ4 V;  1H38 A;  3K9A A;  1E1R G;  4JZG A;  1Z5W A;  4O4H A;  1FKA O;  4FFB B;  1VQ6 V;  1G4Y B;  3SPH A;  1XNR O;  1ARO P;  3FB5 C;  2E75 B;  4WFG A;  1FFX A;  5KUK A;  2DYS B;  2RNB A;  1SQF A;  4NR1 A;  4JTD B;  4JGS A;  1TVK A;  2DYS C;  3JD1 A;  1VF6 A;  1WP8 A;  2WLI B;  1S77 D;  1MZE A;  4JAA A;  5BMV B;  3DXR A;  1K9M W;  2PY5 A;  1M9N A;  4TV9 B;  2DOS A;  1XBL A;  3QG5 A;  5LP6 B;  3D3I A;  2EZO A;  1V55 B;  1G6U A;  3CRR A;  2GDS A;  1SER A;  2JGU A;  3B09 A;  1CEZ A;  5IJ0 B;  3F5T A;  2BTO A;  2Q8V A;  4EEQ A;  1V55 C;  5IYZ B;  3ABK C;  3IFX A;  3KKY A;  1YZB A;  3JAW A;  4YY3 B;  4YHH B;  1NS1 A;  2BSK B;  3T1H B;  5LHG A;  2N04 A;  3B77 A;  2YDE A;  4MTO A;  4UV8 A;  3C90 A;  3BPZ A;  4HBN A;  2ITC C;  2VRZ A;  4ZOL B;  3AG1 B;  1H2N A;  4DXW A;  2GHY A;  4YY3 O;  4YHH O;  3JAT A;  2YXH A;  2X6C A;  5LBQ A;  3T1H O;  3AG1 C;  3CB2 A;  4B08 A;  2RDC A;  5H5N A;  4KHP B;  3RBZ A;  5KHK A;  4LP8 A;  3OM3 B;  1YXB A;  2QR4 A;  3K03 A;  4O2B B;  4QIW F;  2QM7 A;  1FXK B;  4J42 A;  1S0V A;  1K97 A;  3PN1 A;  4GX0 A;  4X64 B;  4KHP O;  2Q0A A;  3TCU A;  2W6J G;  4RQF A;  1YDX A;  2A3Q A;  2UXC B;  1S5J A;  3JAS A;  4F6R B;  1PPJ H;  1PKX A;  1THZ A;  2QJ1 A;  2YEV A;  3ZED A;  2CGN A;  5EK0 A;  5GON B;  4LNU B;  3CCL V;  4ASU G;  3H9V A;  5LMU B;  3ML0 A;  5J2T B;  3EXA A;  5DM6 V;  4X64 O;  4JI0 B;  4NYK A;  3ETQ A;  4J9Z B;  1I7F A;  1KC8 W;  3MHS C;  3G6B A;  5KHG A;  1FYJ A;  4J41 A;  2UXC O;  1M5I A;  4GLX A;  4ZKI A;  2YS8 A;  2OCC C;  3HKC A;  2PYL A;  3RYF A;  4B3R B;  2NN4 A;  1IXM A;  3ICX A;  3K57 A;  3IAY A;  5IJ9 A;  1TA8 A;  5LMU O;  4JI0 O;  2IH3 C;  3B8M A;  4DV0 B;  1SF9 A;  4LH6 A;  5J2U B;  1FXV A;  2R9A A;  4IYH A;  1WA8 B;  1Q3E A;  4DV4 B;  5L3B A;  4PDL A;  2ZE5 A;  5LMN B;  4QPJ A;  3B8N A;  3CD6 V;  5L3D A;  4FM1 A;  3L75 H;  3ASO B;  1NJI W;  4J7J A;  5LYJ A;  2WLL A;  4B3R O;  4I50 B;  2RN9 A;  4W4K A;  1QU7 A;  2EJR A;  3N2G B;  3W7T A;  3ASO C;  3QO8 A;  4P9O A;  4DV0 O;  4UB8 Z;  4X8A A;  1YJ9 V;  3CYO A;  2QM8 A;  3F7V C;  4DV4 O;  2QEX V;  3TK1 A;  5LMN O;  1IUR A;  3ZHV A;  4TSF G;  1HWY A;  4NB5 A;  2KB1 A;  3DC5 A;  4O4J B;  3O9O A;  2JK5 C;  3SJQ C;  4H33 A;  3FB6 C;  4AIL C;  4JI2 B;  1O9H A;  3WB2 A;  2HR3 A;  3ZRV A;  3CCJ V;  5CMU A;  2HJD A;  3ZHT A;  3S3W A;  5JVD A;  1JR9 A;  1YSC A;  3MD0 A;  1MAB G;  3L70 H;  1N34 B;  3FAV A;  2WLM A;  4D7T A;  3LDE A;  2DW4 A;  4X62 B;  2AXT Z;  3OT7 A;  1N4C A;  5JWP A;  2KG7 A;  4ICG A;  3OE7 G;  2ZXW B;  3SR2 C;  4GX5 A;  4JI2 O;  1P49 A;  3OTF A;  3ZN1 A;  2C2A A;  1VF5 B;  5LL6 Y;  3ZMS A;  2ZXW C;  2ILM A;  4EFE A;  4JZ2 A;  4E4E A;  1H8H G;  3RT3 C;  4IL6 Z;  1W0K G;  1R3I C;  3AK1 A;  4X1K A;  3ZRW A;  2YSU B;  2M7W A;  4C7U A;  4JTC B;  4UCR A;  1Y76 A;  1SC5 B;  3JAR B;  4FLX A;  4Q6G A;  5LXT B;  1I5X A;  1QQC A;  3BHP A;  2WLJ A;  4Z1M G;  3BAB A;  2EIN C;  2AHZ A;  3CSX A;  1EFR G;  3CEI A;  2OWO A;  1FJG B;  2JGD A;  4JYA B;  1FFT B;  2A0L A;  2ZT9 B;  3KZI Z;  4DYL A;  4K3A A;  1EZJ A;  4UXN A;  3CCM V;  4FFB A;  2BTQ B;  3APQ A;  1PL0 A;  1V9P A;  3K58 A;  1M56 B;  2JIZ G;  5IE9 A;  4OX9 B;  2K9P A;  5CA1 B;  1MSW D;  1FJG O;  4RUE A;  1M56 C;  5KHI A;  4JYA O;  2CTP A;  4JAS A;  4G2K A;  2WLI A;  5BMV A;  1F23 A;  2MW2 B;  2QM4 A;  4OX9 O;  3T1Y B;  3QO5 A;  1TUE B;  1DF4 A;  5C8Y B;  5LP6 A;  4DR3 B;  5KA5 A;  3J81 N;  4CC5 A;  1IVS A;  1VQ5 V;  2LGQ A;  5IJ0 A;  2NR5 A;  3OGC C;  4OGQ B;  5IYZ A;  3W7U A;  2QWQ B;  2QWP B;  1Q6H A;  4I9Q A;  2BSK A;  2GTS A;  3WU2 Z;  5A2Q N;  3T1Y O;  3K5M A;  1PL4 A;  1OV9 A;  3J7A U;  3TJT A;  4DR3 O;  2H8P C;  3M7M X;  1GAX A;  4ZOL A;  5LA6 B;  3I5D A;  3VBB A;  2GSM B;  4MVM A;  1YIJ V;  2WPD G;  4PHZ A;  1N0N A;  5DED A;  5JJJ B;  5LGU A;  5KAF Z;  1GH6 A;  1S5L Z;  1OCC C;  2NNU A;  4DO2 A;  1N33 B;  2V1D A;  2UXD B;  1VQL V;  3BCC H;  4O2B A;  3LNN A;  5EC2 C;  1OCZ B;  1I5Y A;  1XMQ B;  4B3T B;  4LF9 B;  3GWO A;  1FXK A;  3JYC A;  2OIG A;  4P30 A;  4FJC C;  4FM2 A;  1OCZ C;  1XEQ A;  2VWJ A;  2OCH A;  2IJH A;  1N33 O;  1S76 D;  2UXD O;  4NXN B;  1HNZ B;  1JVM A;  4F6R A;  1P7B A;  4F6E A;  4PA4 A;  2FTK A;  1XMQ O;  4PDV A;  5KUM A;  4B3T O;  4LF9 O;  1R6N A;  2YIC A;  4X88 A;  5GON A;  2F1M A;  5J2T A;  2PYJ A;  3L74 H;  1QLN A;  2EIL B;  3LSS A;  1GK9 A;  3VQY A;  2ZR3 A;  3CPW U;  3A2F A;  4L87 A;  4NXN O;  2EIL C;  2Z3Y A;  1HNZ O;  3CXC U;  3SGI A;  4GUN A;  4U3J B;  5BZB A;  1KKC A;  4DK1 A;  4FLU A;  4PA7 A;  2YIB D;  3CS5 A;  3E8F A;  3K5L A;  1HNW B;  3ASN B;  3SPC A;  4DRX A;  2Z0A A;  5DEC A;  2Q69 A;  5J2U A;  4IHJ B;  2D2C B;  2YXL A;  3I55 V;  5KX5 A;  4CBC A;  4QGP A;  4D6T H;  1IBM B;  5B1B B;  1SES A;  2PTM A;  5IYC O;  4UUJ C;  2E74 B;  1BGY H;  4LCU C;  4DR4 B;  1AI7 A;  1FD9 A;  2Q73 A;  4R8C A;  4HZ3 A;  1A32 A;  1FXH A;  2ADQ B;  2Q6A A;  1M57 B;  4LWS A;  4I50 A;  1AIL A;  3IJ4 A;  3N2G A;  4NVP A;  1HNW O;  5KA6 A;  5AG2 A;  1IBL B;  1H8E G;  3SYP A;  1WB8 A;  2QTO A;  3U11 A;  1BHB A;  1IBM O;  3BFR A;  2P06 A;  2Q5Z A;  1NT2 B;  3FX7 A;  4ZIB A;  4DR4 O;  4O4J A;  1Y74 B;  2PZS A;  1TUB B;  1Y4M A;  1Z5V A;  1BQZ A;  1IBL O;  3ZRX A;  2UXX A;  2WLK A;  4JAU A;  2HFE C;  3QNE A;  3AG7 A;  2ZKO A;  3WG7 B;  2UUC B;  4QNH B;  2JEX A;  2XHB A;  1NTZ H;  2IJJ A;  2DWD C;  4WBN A;  4CC6 A;  3WG7 C;  3E86 A;  4IGG A;  3M8A A;  5KHJ A;  2QKS A;  4O4L B;  2XAS A;  3AK3 A;  4CS2 A;  4LF8 B;  1QVG U;  3ZRS A;  3ABM B;  4Z1V A;  1BSM A;  4JI1 B;  1W0J G;  2UUC O;  2DQ3 A;  5FPR A;  3ABM C;  1H2M A;  1G8M A;  2ZE6 A;  4I55 A;  2VWK A;  4LF8 O;  2Q0O C;  5FL7 G;  4N21 A;  4QE7 A;  3F5W C;  1DLB A;  5B1O A;  4JI1 O;  2P67 A;  2CUG A;  3LSU A;  1GKF A;  1KMI Z;  1SQV H;  2X7R B;  2JEU A;  3CRM A;  3SJA C;  4MSW C;  5EBL C;  4X65 B;  2FYU H;  1XHX A;  4TOI A;  5FLX N;  2GUZ B;  3P32 A;  2ZE7 A;  3LDD A;  4DK0 A;  2GBO A;  2WAM A;  1XMO B;  3E8G A;  1GO3 F;  4LF5 B;  3BRC A;  4RWU A;  2VQE B;  1ORQ C;  3K3W A;  1Z2G A;  4I9W A;  2QKC A;  4XDK A;  3H1J H;  1JMK C;  4ZI7 A;  4TQD A;  4X65 O;  4X89 A;  3P3P A;  1NR7 A;  2YIB A;  2X6A A;  1YI2 V;  5CA0 B;  4FK5 C;  1EM1 A;  1L8D A;  4B3M B;  1K92 A;  3ETD A;  4P2Z A;  4R50 A;  3E89 A;  5LGN A;  1XMO O;  2VQF B;  4FZ1 A;  3S3X A;  1WLE A;  3ABK B;  4LF5 O;  5C8Y A;  3I56 V;  2RMK B;  2VQE O;  4HNA B;  2P22 C;  3JSN A;  1UJW B;  1GM9 A;  1XNQ O;  1E1Q G;  2YI9 A;  4KP4 A;  1QNM A;  1K8A W;  1VIB A;  1EN6 A;  1K3E A;  4FZ0 A;  3CCS V;  4B3M O;  3EHB B;  5EZY B;  2IBZ H;  4UCV A;  2VQF O;  1SQP H;  3GVM A;  1Q8I A;  3NR7 A;  3QVN A;  2HKO A;  3CRA A;  1Y67 A;  1Q82 W;  2XTA A;  4E2L A;  1NZ6 A;  5LA6 A;  4CH5 A;  1U97 A;  2D3O W;  1HR0 B;  1JA8 A;  4NXM B;  2P4K A;  1UFI A;  4PJ0 Z;  1IBK B;  2OTL V;  5CN0 A;  4HAM A;  2ZCE A;  1R6T A;  4MVU A;  1KKD A;  3JD0 A;  1RM1 C;  1J5E B;  4OPH A;  2Q9L A;  4LR3 A;  1EZV H;  1M90 W;  1AB3 A;  3SYA A;  1HR0 O;  4NXM O;  3CJH A;  1BMF G;  4JYY A;  1TGO A;  1ZL8 B;  1IBK O;  3TGU H;  4EKW A;  4DR6 B;  5L3E A;  1WJZ A;  2G38 A;  1J5E O;  1P4R A;  2GTA A;  3G71 V;  1AR4 A;  3MAQ A;  4LF6 B;  2L35 A;  3R66 A;  5H2F Z;  1LUV A;  4GX1 A;  2P4V A;  4ZHQ B;  3RN4 A;  1WAZ A;  4A5U B;  3Q4H A;  2OCC B;  4DR6 O;  2A7W A;  3E22 A;  1NTK H;  3ZBH A;  2UXB B;  4BIU A;  4U3F H;  4MW8 A;  4EB6 B;  1WNS A;  4U3J A;  4LF6 O;  3KCY A;  4B3S B;  3NXS A;  1R3K C;  2R9I A;  3OFN G;  2ZD9 A;  4WFE A;  5D5P A;  4FM0 A;  4X20 B;  1QLE B;  1DTO A;  1B6Q A;  4IHJ A;  2WWW A;  4PEL A;  3H1K H;  2UXB O;  5EBW C;  2BCC H;  5CBH A;  4X1I A;  4J9Y B;  1QLE C;  2FKX A;  3ZHS A;  4GX2 A;  3FFQ A;  3IGA C;  3SYO A;  3BAA A;  4B3S O;  2XOK G;  2VS0 A;  2CE4 A;  3N2K A;  1NBM G;  4MTF A;  2EIK B;  4YIP A;  2Y0P A;  2V7Q G;  1W2B U;  4LFC B;  1AJQ A;  1GMG A;  4BW9 A;  2EIK C;  1K73 W;  3CWB H;  1RSO B;  3AEI A;  1L1F A;  1AJN A;  2AZ0 A;  2Y48 A;  1RP3 B;  2YXY A;  4GKK B;  4OPA A;  1Q6U A;  4IYI A;  4LFB B;  2CH7 B;  1Y74 A;  4BIZ A;  3D36 C;  4KL1 A;  1TUB A;  4LFC O;  5LOV B;  4KFM A;  4UVB A;  1WPB A;  5HFL A;  1PV0 A;  1ZUQ A;  3RYI B;  1XDC A;  2E76 B;  1NH2 D;  4MT8 A;  4GKK O;  2HP8 A;  2QKA A;  1KU9 A;  4LFB O;  2X0L A;  5JCO A;  3OMN B;  2RCV A;  4H44 B;  1U96 A;  3KG2 A;  4O4L A;  4YJ3 A;  1QR8 A;  4IIJ A;  1KUQ A;  2QWN B;  4BR6 A;  1YJW V;  3O65 A;  1MNG A;  4FIP C;  4YIO A;  2B9Z A;  1AI4 A;  3E35 A;  3JAL B;  4RAI A;  5ITZ B;  1B04 A;  3HPL C;  2P7T C;  2Y4T A;  4O2A B;  4JI7 B;  4TV8 B;  4QE9 A;  5K1P A;  4K8X A;  4JI5 B;  3CCR V;  3U10 A;  2EIN B;  1M93 A;  3MDS A;  2F4V B;  2LJ2 A;  1H2L A;  4X1Y B;  1BZK A;  5EC1 C;  1GTO A;  1Q90 D;  5IY5 B;  3ZN0 A;  5IT9 N;  4JYC A;  4JI7 O;  1CP9 A;  2UXN A;  1NU1 H;  1JOY A;  5IY5 C;  4JAV A;  4JI5 O;  5EYP B;  2N74 A;  2H94 A;  4XDL A;  1CXZ B;  4BW5 A;  1AI6 A;  3GWK C;  2JVD A;  5E79 Z;  5CB4 B;  2F4V O;  4EFB A;  3UKM A;  2IH1 C;  1GN2 A;  3A0H Z;  3G67 A;  5EIB C;  1R1B A;  4O4H B;  2P90 A;  4UVC A;  1BHA A;  2BOC C;  3FYI B;  1FFX B;  2HLD G;  3L73 H;  4TV9 A;  3UQ8 A;  2B5U A;  5HFM A;  5CA0 A;  2QGN A;  2R9R B;  1VQN V;  2YID A;  4H37 A;  1URF A;  3TET A;  4R6Z A;  1M1K W;  2W0F C;  1KP3 A;  3CME V;  3ETG A;  4HNA A;  3J80 N;  3DXR B;  4WF9 V;  2XND G;  4JI6 B;  4WCE V;  3CMA V;  3L9D A;  2CTQ A;  3B40 A;  3HKD B;  5EZY A;  4DV7 B;  2QE7 G;  4FVM A;  4PDM A;  4KXR A;  4BIO A;  2YIA A;  5B3S B;  2OT5 A;  5JQG B;  1N8R W;  3DGE A;  2CDY A;  4I4T B;  4MVR A;  4PDR A;  3TXQ A;  4JI6 O;  1O9G A;  4I7Z B;  3B4S A;  1R6K A;  5B3S C;  1Q6I A;  1D5N A;  3F7Y C;  2XUM A;  1VQP V;  1OCC B;  4DV3 B;  3OR7 C;  3UO2 A;  2B1I A;  2ZM6 B;  4G27 B;  4GCZ A;  4DV7 O;  5KAI Z;  1VQ8 V;  2ZNI A;  1SA0 B;  1D5A A;  3SDL A;  2ZIM A;  3FKS G;  2IU0 A;  3T4Z A;  2Y69 B;  2Y0I A;  3W7S A;  2UUB B;  3ABU A;  5B1N A;  3KCX A;  1ENV A;  3JSL A;  2ZIO A;  3T1C A;  1XQ8 A;  4JI3 B;  3LUT B;  2Y69 C;  4DV6 B;  3CXH F;  2DWE C;  1BS3 A;  4DV3 O;  2F95 B;  3N27 A;  3QO7 A;  4LC1 A;  1XUQ A;  1ZL8 A;  2R72 A;  2ZM6 O;  2UU9 B;  2O57 A;  1MSD A;  4XDJ A;  2P5O A;  3HKE B;  4CH6 A;  4Z2W A;  2UUB O;  3T4D A;  3K0G A;  4ZBM A;  4JI3 O;  5LHH A;  4DV6 O;  1MA1 A;  5EIB D;  3RYH B;  3ZX6 A;  3HR0 A;  4LNU A;  4MS2 A;  1Q86 W;  4ZHQ A;  2HG5 C;  2UU9 O;  3G6E V;  3JAS B;  5KHH A;  4TUY B;  2A79 B;  2YUA A;  4D7S A;  4RQE A;  1SRY A;  3L71 H;  2JS3 A;  1R73 A;  5IYD O;  5L3F A;  3LDC A;  2ZE8 A;  4WFB V;  1YHQ V;  4PI0 A;  1H2G A;  2EZP A;  4N23 A;  3ZS8 C;  3CCV V;  1VQM V;  3CC2 V;  4X20 A;  1WA8 A;  4JI8 B;  4UV9 A;  1HP8 A;  2QSA A;  3RYF B;  1T5E A;  2BOB C;  2F66 C;  2AHY A;  1H2S B;  1H2K A;  4RUF A;  1SET A;  2CGO A;  1PNM A;  5J9P C;  1QHT A;  3CX5 F;  1SQB H;  1JJO A;  2R70 A;  3CP1 A;  1ZTE A;  4JI8 O;  2E3C A;  1NR1 A;  3K5O A;  1OJH A;  2K1E A;  2QWO B;  1RSO A;  2FML A;  2Q67 A;  2HHH B;  3E8H A;  1AR1 B;  3K04 A;  2CH7 A;  3ZJZ A;  1BQ0 A;  3UM7 A;  3SPG A;  1BE3 H;  2YC0 A;  3PJS K;  2F93 B;  2Q4P A;  2Z5U A;  1DK1 A;  1V54 C;  3OEE G;  3ZMV A;  3RYI A;  1MG1 A;  3R65 A;  2HHH O;  2ARH A;  2JJ1 G;  1PM9 A;  4X9Q A;  4PA3 A;  4B7K A;  4J7Z A;  1Q43 A;  1GRJ A;  5A9G A;  2XAJ A;  3FAV B;  3JAL A;  5ITZ A;  1I08 A;  2ITD C;  3CHX A;  4O2A A;  1QVF U;  4FLV A;  4TV8 A;  3GB7 C;  2YI8 A;  4H0L B;  1Q5O A;  4NTY A;  1FAF A;  3SPI A;  4FLZ A;  3JAR A;  3A8T A;  3JD3 A;  5LXT A;  1I0H A;  2W0X A;  3C3S A;  4DV5 B;  4X1Y A;  3AG3 B;  3W7X A; 
#chains in the Genus database with same CATH homology
 1GM7 A;  2YSU B;  2M7W A;  3BEH A;  4JTC B;  3STZ C;  2W6I G;  4OXS A;  1P4R A;  1I5X A;  5H6R A;  3G71 V;  4MVS A;  3AG3 C;  1Q81 W;  2WLJ A;  4Z1M G;  2EIN C;  4JPR A;  1AJP A;  2YEV B;  1F51 A;  2AHZ A;  4GX1 A;  3FB7 C;  1EFR G;  3EFF K;  1FFT B;  2A0L A;  2DYR B;  2OCC B;  3K08 A;  1DF5 A;  1EZJ A;  1FS0 G;  4BIU A;  4UXN A;  3CCM V;  1QCE A;  2XAF A;  5DN6 G;  4MW8 A;  2DYR C;  1PD3 A;  3CCQ V;  2ZQM A;  1PL0 A;  2F43 G;  4MW3 A;  2ATK C;  1S72 V;  1M56 B;  2JIZ G;  3ABT A;  5H6Q A;  3AG2 B;  3OEH G;  4FMT A;  3P30 A;  3STL C;  3NXS A;  5CA3 A;  4JYB A;  1R3K C;  1MSW D;  2R9I A;  4LBE C;  3OFN G;  3A0R A;  1M56 C;  4RUE A;  3FYE B;  2ZD9 A;  4WFE A;  1JPX A;  2MK3 A;  1QLE B;  1DTO A;  3AG2 C;  1B6Q A;  5GW7 A;  3CC7 V;  3SYC A;  2WWW A;  4JAS A;  3OUF A;  4PEL A;  1NVP D;  3K0D A;  5EBW C;  5CBH A;  4G2K A;  2WLI A;  4J9Y B;  4Q20 A;  1QLE C;  4P9P A;  1F23 A;  4GX2 A;  4R7C A;  3IGA C;  4PA9 A;  3SYO A;  2XOK G;  3ASN C;  2ZDI A;  3DTU B;  4UVA A;  3FB8 C;  3QO5 A;  5E1A C;  1NBM G;  1S3J A;  1J95 A;  2EIK B;  1R3J C;  1TUE B;  4MTF A;  1DF4 A;  1GM8 A;  2IJK A;  2V7Q G;  4PA6 A;  4QPK A;  1W2B U;  5KA5 A;  1AJQ A;  3JD4 A;  2WLL B;  3D36 A;  1VQ5 V;  1GMG A;  2NLJ C;  1K5Q A;  5B1B C;  2XAQ A;  3RVZ A;  2EIK C;  2WLH A;  1K73 W;  3OGC C;  2ZR2 A;  1OHH G;  3AEI A;  1L1F A;  3M99 B;  1AJN A;  3W7U A;  1KEC A;  1JCH A;  1V54 B;  2Y48 A;  3HB3 B;  1M57 C;  2OTJ V;  2PI5 A;  5LGT A;  1SZT A;  1RPR A;  4BIZ A;  4F4L A;  3ZMU A;  4CZZ A;  1NQT A;  4MVZ A;  1F4N A;  4MTG A;  2A9H A;  1KD1 W;  2H8P C;  1K7D A;  1VQK V;  3CC4 V;  3CCU V;  2EIM B;  4KFM A;  1OZ0 A;  3MHH C;  4UVB A;  4TT3 G;  3E8B A;  1QBZ A;  4RO2 A;  5HFL A;  1RM1 B;  3VBB A;  2GSM B;  4MVM A;  1NH2 D;  4MT8 A;  2EIM C;  3IC7 A;  1YIJ V;  2WPD G;  2X0L A;  3OMN B;  2CK3 G;  1NH2 B;  2WLN A;  3KG2 A;  5LGU A;  1JX9 A;  1OCC C;  1QR8 A;  4I5S A;  2NNU A;  4XBF A;  3K06 A;  4DO2 A;  1YJW V;  1E79 G;  4FIP C;  2V1D A;  1AI4 A;  3E35 A;  4RAI A;  4FPP A;  1VQL V;  1OCO B;  2XAG A;  3ZMZ A;  3HPL C;  2P7T C;  5EC2 C;  1OCZ B;  1I5Y A;  1WPX A;  2JJ2 G;  3GWO A;  4QE9 A;  1FXK A;  3JYC A;  4P30 A;  3W7W A;  4FJC C;  1NKD A;  1OCO C;  3CCR V;  3LNM B;  2QA4 V;  4KUM A;  1LNQ A;  1OCZ C;  1XL6 A;  2EIN B;  3JD2 A;  2XAH A;  2X6B A;  4G28 B;  3SPJ A;  3ZRW B;  1JJ2 U;  3T2M A;  2IJH A;  1VQO V;  4HYO A;  1S76 D;  5EC1 C;  1GTO A;  5IY5 B;  3AG4 B;  3ZN0 A;  1FXK C;  1JVM A;  4JYC A;  1CP9 A;  1RPO A;  2UXN A;  1P7B A;  4U7N A;  4PA4 A;  1YJN V;  2FTK A;  1R3L C;  4PDV A;  5KUM A;  1JOY A;  5IY5 C;  1R6N A;  3AG4 C;  4X88 A;  4JAV A;  2Q68 A;  1K33 A;  2LP7 A;  2H94 A;  5CBF A;  4XDL A;  4BW5 A;  1VQ4 V;  1H38 A;  1AI6 A;  3K9A A;  1QLN A;  2EIL B;  1E1R G;  3LSS A;  1GK9 A;  2ZR3 A;  3H01 A;  3E2E A;  3CPW U;  3UKM A;  2IH1 C;  1OCR B;  2DQ0 A;  1G4Y B;  4L87 A;  3SPH A;  1VQ6 V;  2EIL C;  2Z3Y A;  3CXC U;  3OAA G;  1ARO P;  3FB5 C;  4WFG A;  1PNL A;  1OCR C;  5BZB A;  2P90 A;  4UVC A;  4PA7 A;  5KUK A;  1BHA A;  3E8F A;  2DYS B;  2BOC C;  3ASN B;  5L3G A;  5L3C A;  3SPC A;  5H9C A;  1COW G;  3FYI B;  2Q69 A;  4WFA V;  3WFV A;  4JGS A;  4JTD B;  2HLD G;  4GT1 A;  1MOF A;  2DYS C;  2B5U A;  3JD1 A;  5HFM A;  3I55 V;  4CBC A;  2R9R B;  2WLI B;  1S77 D;  1VQN V;  2IU3 A;  4H37 A;  1SES A;  5B1B B;  3ABL B;  5IYC O;  4UUJ C;  1K9M W;  1M9N A;  4LCU C;  1AI7 A;  3TET A;  4R8C A;  4HZ3 A;  2P6J A;  1FXH A;  4R6Z A;  2Q6A A;  2W0F C;  1M1K W;  1K4C C;  1KP3 A;  1M57 B;  3ABL C;  3CME V;  3ETG A;  5B1A B;  3D3I A;  2EZO A;  2WSS G;  4WF9 V;  2XND G;  5C93 A;  1V55 B;  1SER A;  5KA6 A;  4WCE V;  3CMA V;  2ZDI C;  1H8E G;  1CEZ A;  5B1A C;  3SYP A;  2QTO A;  1BHB A;  1V55 C;  3ABK C;  3IFX A;  1PNK A;  2QE7 G;  3JCZ A;  4PDM A;  5LHG A;  3B77 A;  1CPY A;  4MTO A;  5B3S B;  2OT5 A;  4UV8 A;  3G4S V;  1N8R W;  1Y4M A;  3DGE A;  4MVR A;  4PDR A;  2ITC C;  3ZRX A;  2WLK A;  1R6K A;  2UXX A;  2JDI G;  5B3S C;  4JAU A;  2HFE C;  3F7Y C;  1VQP V;  1OCC B;  3QNE A;  5IDJ A;  3OR7 C;  3OMI B;  3WG7 B;  3AG1 B;  2B1I A;  4QNH B;  2JEX A;  1XL4 A;  4G27 B;  4GCZ A;  4DXW A;  2GHY A;  2IJJ A;  2DWD C;  2X6C A;  1VQ8 V;  3WG7 C;  5LBQ A;  1K5S A;  2LFS A;  3AG1 C;  3E86 A;  3FKS G;  2IU0 A;  3T4Z A;  2Y69 B;  3W7S A;  1JQ0 A;  3ABU A;  2QKS A;  3X2Q B;  2XAS A;  5B1N A;  3RBZ A;  1ENV A;  3T1C A;  3VOU A;  3OUS A;  4LP8 A;  3OM3 B;  1VQ7 V;  3LUT B;  2Y69 C;  1QVG U;  3K03 A;  3ZRS A;  3ABM B;  2DWE C;  3X2Q C;  1YTF B;  4MVO A;  3QO7 A;  4LC1 A;  1W0J G;  2B1G A;  4QIW F;  2QM7 A;  1ZWI C;  2DQ3 A;  1FXK B;  3ABM C;  5LHI A;  1S0V A;  1K97 A;  4GX0 A;  4XDJ A;  1G8M A;  3T4D A;  1Y66 A;  3TCU A;  3K0G A;  3K79 A;  4ZBM A;  2W6J G;  4RQF A;  5FL7 G;  4N21 A;  5LHH A;  4QE7 A;  3F5W C;  2EBO A;  1DLB A;  3ZCC A;  5B1O A;  4MS2 A;  2P67 A;  1Q7Y W;  1PKX A;  1THZ A;  1GKF A;  2YEV A;  5IYB O;  1Q86 W;  2HG5 C;  5EK0 A;  1VQ9 V;  4MTX A;  2PI4 A;  3G6E V;  1BL8 A;  3RVY A;  2X7R B;  4ASU G;  3CCL V;  1KQS U;  1EBO A;  2A79 B;  2JEU A;  4U7O A;  3ML0 A;  1ROP A;  4MSW C;  5DM6 V;  5EBL C;  4RQE A;  4J9Z B;  1K34 A;  1SRY A;  2EIJ B;  1KC8 W;  3MHS C;  1R73 A;  3P32 A;  5IYD O;  1K4D C;  5L3F A;  3LDD A;  3LSQ A;  3LDC A;  3OMA B;  2WAM A;  2EIJ C;  4ZKI A;  4WFB V;  2OCC C;  1YHQ V;  4TWK A;  3E8G A;  1GO3 F;  1H2G A;  2EZP A;  4WFF A;  4N23 A;  2IJI A;  1YIT V;  3CCV V;  1VQM V;  3CC2 V;  1IXM A;  3ZMT A;  1ORQ C;  3K3W A;  4I9W A;  4XDK A;  4UV9 A;  2IH3 C;  4X89 A;  3B8M A;  5EBM C;  2IW5 A;  1S5H C;  1FXV A;  4BAY A;  2BOB C;  1NR7 A;  3RW0 A;  2AHY A;  2X6A A;  1YI2 V;  4FK5 C;  5L3B A;  4PDL A;  3E83 A;  4RUF A;  4QPJ A;  3B8N A;  3CD6 V;  1K92 A;  3ETD A;  2HVK C;  5L3D A;  4P2Z A;  4R50 A;  3E89 A;  4QJF B;  5LGN A;  1SET A;  1PNM A;  3ASO B;  1NVP B;  5J9P C;  1WLE A;  1NJI W;  3ABK B;  3SYQ A;  3I56 V;  2WLL A;  2EJR A;  2HJF C;  3CP1 A;  1UJW B;  3W7T A;  1GM9 A;  3ASO C;  1NR1 A;  3QO8 A;  1E1Q G;  1F4M A;  4P9O A;  2K1E A;  4KP4 A;  4X8A A;  2Q67 A;  1K8A W;  1YJ9 V;  3CYO A;  3E8H A;  1AR1 B;  2QM8 A;  3F7V C;  1K3E A;  3K04 A;  2QEX V;  3TK1 A;  3CCS V;  3ZJZ A;  3EHB B;  4TSF G;  1HWY A;  2KB1 A;  3UM7 A;  3BY6 A;  3SPG A;  2JK5 C;  1QR9 A;  3SJQ C;  3OW2 U;  2HKO A;  3PJS K;  4YXW G;  2Z5U A;  4H33 A;  3FB6 C;  1Q82 W;  2LFR A;  1V54 C;  4E2L A;  3OEE G;  2HR3 A;  4MVQ A;  1KP2 A;  1AI5 A;  3ZRV A;  3ZMV A;  5CMU A;  3CCJ V;  1MG1 A;  3R65 A;  2D3O W;  2JJ1 G;  1YSC A;  3MD0 A;  1MAB G;  4PA3 A;  3OR6 C;  2OTL V;  2WLM A;  5CN0 A;  4HAM A;  1YTF D;  3CCE V;  4JF3 A;  3LDE A;  2DW4 A;  4MVU A;  4WFH A;  1KKD A;  2XAJ A;  3JD0 A;  3OE7 G;  2ZXW B;  1RM1 C;  4GX5 A;  3ZIA G;  2ITD C;  3ZN1 A;  4JTA B;  2C2A A;  1M90 W;  1QVF U;  3ZMS A;  2HVJ C;  3SYA A;  2ZXW C;  3ETE A;  3GB7 C;  1BMF G;  1H8H G;  3SPI A;  4EKW A;  1W0K G;  3JD3 A;  1R3I C;  5CBG A;  3ZRW A;  5L3E A;  3AG3 B;  3W7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...