3K08A

Crystal structure of cng mimicking nak mutant, nak-ntpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k08A00
4RAIA 4LP8A 1JVMA 1G4YB 2IH1C 3FB7C 3LNMB 4J9YB 5EC1C 3ZJZA 2DYRC 2ITDC 3RBZA 2WLIA 3ABLC 3K03A 3RW0A 2WLKA 3GB7C 4WFEA 2WLIB 3F5WC 3FB5C 1M57C 4G27B 2EIJC 1ORQC 3SYAA 2OCCC 3F7VC 3PJSK 3K06A 4PA3A 3ASNC 3LDDA 1XL4A 4J9ZB 4F4LA 4JTAB 2QTOA 4RUEA 4MW8A 1K4DC 5EBMC 1M56C 4WFFA 1R3IC 2Q68A 3E83A 3STLC 2ATKC 3E8FA 2WLNA 2X6AA 1J95A 1OCCC 4PA9A 2Q6AA 2A79B 2KB1A 3OR6C 4MVSA 4R6ZA 3E86A 2Q69A 4R8CA 4RUFA 5KUMA 1KKDA 3E8BA 4R7CA 2BOCC 4RO2A 2AHYA 3K08A 4H33A 4PA4A 5EBLC 1S5HC 4H37A 4CBCA 2EINC 3E89A 4R50A 4X89A 4P2ZA 2HVKC 4XDKA 1V55C 4EKWA 3LDEA 2EIKC 3K0DA 2P7TC 4LBEC 4MTGA 4PDVA 3SPGA 3AG2C 2DWEC 2QKSA 2ZD9A 4MVUA 3SYOA 4DXWA 1R3JC 2IH3C 4PDRA 4UUJC 4MS2A 5J9PC 5CBGA 3LDCA 4OXSA 1QLEC 1OCOC 1R3LC 2EILC 2R9RB 4MTOA 3SYQA 4MW3A 4MVQA 3ABMC 4MVZA 5EC2C 4TWKA 1OCZC 4I9WA 3AG3C 4PDLA 1BL8A 3E8HA 3K0GA 4MSWC 1V54C 3SYCA 4P30A 1K4CC 2HG5C 3ASOC 1LNQA 2WLJA 3ABKC 2WLMA 3R65A 4WFHA 3HPLC 2AHZA 3EFFK 3JYCA 4P9PA 3UKMA 5BZBA 5B3SC 3KG2A 4GX0A 2Y69C 3BEHA 5EK0A 3AG4C 2HVJC 3SPIA 3SPCA 2ITCC 3OR7C 2X6CA 4X8AA 3T1CA 3SPJA 4GX2A 4JTCB 3SYPA 5IY5C 2YEVA 4GX1A 2NLJC 2H8PC 3K04A 4MVRA 2ZXWC 4PA6A 4XDJA 4PDMA 5B1BC 3T2MA 3F7YC 1OCRC 2A9HA 2X6BA 3FB8C 4HYOA 3X2QC 2HFEC 3OUFA 3SPHA 4ZBMA 2WLLA 2HJFC 4XDLA 1R3KC 3OGCC 1ZWIC 1XL6A 4QE7A 4BW5A 5CBHA 3AG1C 5KUKA 2WLLB 5E1AC 3RVZA 4HZ3A 4X88A 4G28B 4GX5A 3IGAC 3T4DA 3RVYA 3LUTB 3ZRSA 2Q67A 5B1AC 2A0LA 4MTFA 5EBWC 2W0FC 2JK5C 3IFXA 4WFGA 2EIMC 5CBFA 4MVOA 3TETA 3SJQC 4JTDB 2K1EA 3FB6C 4MVMA 3OUSA 3VOUA 3WG7C 4P9OA 2WLHA 2DYSC 3STZC 4QE9A 4LCUC 3UM7A 3E8GA 3TCUA 1P7BA 2BOBC 4QNHB 4PA7A 4KFMA 3T4ZA 2DWDC
chains in the Genus database with same CATH superfamily
1JVMA 4J9YB 4UCVA 5FNVB 3OE7G 2DYRC 2F23A 1K5SA 3JAWB 3SGIA 1K33A 2AZ0A 1GAXA 4IGGA 5KMGA 1EN5A 2OCCC 1KC8W 1O9GA 2UUCB 4F4LA 1AVMA 2JVDA 4B08A 1MZEA 4DRXA 4GUNA 2UUBB 5JVDA 4A5UB 4DV4O 1IVSA 5JQGA 2JS3A 4IIJB 3QO5A 2L35A 2BOCC 1YZBA 2AHYA 5BR8B 2VRZA 4ZHQA 1VMGA 4UCSA 3C3SA 5CB4B 2IH3C 1S5LZ 3PN1A 5IJ0B 1PV0A 2Y4UA 4EB6A 1KU9A 3DC5A 3HKEB 4JI0O 5EC2C 4G2KA 4X62B 2BTQB 3AG3C 1EM1A 3E8HA 4MSWC 1T5EA 3B2EE 1P7GA 5L3GA 4B3MB 4FZ0A 5JCOA 4WFHA 4UVAA 4LH7A 2XOKG 4DV6O 2CTQA 2ZNJA 4HNAA 1XMQO 1VF6A 1GO3F 2ITCC 2NR5A 2M6YA 2Q5ZA 2K9PA 3JALA 5EZYA 3DXRB 2JGDB 4LF7O 1I94B 4UV8A 4PDMA 3DSQA 4HYOA 4JI3B 1N8RW 1H8HG 1EZVH 1H2SB 3K79A 3O9OA 1XNRO 4MT8A 4EFEA 2JK5C 1SESA 4WFGA 4U7NA 2BTOA 2WWWA 3STZC 5K1XA 4HBNA 3ZHVA 4KFMA 3ZRWA 1LR1A 1TVKB 1FXKC 1IDSA 4TT3G 4ZOLB 2Q73A 5KHJA 5IYDO 4KP4A 3ZMTA 3RYIA 2IJHA 4X66O 4JTAB 4IHJB 2VQFB 4X20A 3SDLA 5LA6A 2GUZB 4ASUG 2XASA 5BXZA 4UCTA 1VQ7V 3E86A 2ZR3A 5IJ9B 5LOVA 4LF5O 5JJJB 4LF4B 3IC9A 2WSSG 3SYOA 1RSOB 4WFAV 2LO1A 1Q81W 4OPAA 1R3LC 3DGEA 2Q0AA 3N2KA 5JH7A 2VWJA 4QPKA 2E75B 4I9WA 5HFMA 3QG5A 2QA4V 3WU2Z 1B3QA 2B5UA 2W0XA 3BRCA 4F6RB 3ASOC 3CS5A 5L3CA 1JA8A 1SERA 2DOSA 1WPBA 4JI8B 5LMNB 1KMIZ 4YHHB 3F5TA 1OCZB 2Y69C 3TXSA 3J80N 1NR1A 4DR4B 4DV2O 3D8CA 1PPJH 4UCOA 4DV1B 1AR5A 1R6NA 2YEVA 4J7KA 2JJ1G 2XAQA 4DW0A 4I50B 2HFEC 2LQTA 4XDLA 1R3KC 1M5IA 1GK9A 3JD2A 5E1AC 3RVZA 4DR2B 1IBMB 3G80A 3RVYA 1JPXA 2A0LA 1WA8B 1VF5B 2ZR2A 1COWG 1R73A 3T1HB 3ZBHA 3ABLB 4TV9B 1YJWV 3RYFB 2QWNB 4U3JB 2BOBC 2BSKB 3AG1B 4AHCA 1S77D 2PF4E 3ZJZA 3CX5F 2UUCO 3RBZA 4JI7B 4LF6B 4X1YB 3FB5C 4G27B 3ZMZA 4LR3A 4IL6Z 1OCCB 3AK1A 1ZTEA 5H6RA 2ZM6O 3QF7A 1BE3H 1FFXB 1FFTB 3H1IH 2Q68A 2AGAA 5BR8O 2WLNA 1AP6A 5FPOA 1IZ3A 2A79B 3ZRXA 2YXHA 1KP2A 2LFRA 2FKXA 4H13B 1VQNV 4DUYB 4DR1B 3E22A 4FFKA 3IAYA 5EYPA 2PGGA 3K5MA 5LGNA 1QQCA 1Y66A 2EULA 4X62O 4AQYO 3RYCA 4FLTA 1PD3A 3VQWA 2R9RB 4B3MO 1JOYA 1OCZC 2IM9A 2AXTZ 1SQVH 1LNQA 2IJIA 2UXBB 3KKYA 2Q8VA 1I94O 1GMGA 3ABMB 1XNQB 3SPCA 4GX2A 3SYPA 2KKWA 1SRYA 1X4TA 2ZDIC 1BCCH 5FL7G 4X1IA 3T1YB 4PA6A 4FZ1A 3S3XA 4UVBA 4NVPA 2FTKA 2PY5A 4YY3B 4I55B 4QE7A 4BW5A 3AG1C 5IY5B 1FAFA 4DV0B 1JJ2U 3OGIB 2QJ1A 3L72H 1E1RG 4FPPA 1HW7A 4W4KA 2LW7A 1N36B 1SQPH 2Z3YA 2DYSC 3CCJV 1K5QA 3T4ZA 1G4YB 4LNUB 2ITDC 2GTAA 4JYCA 2GTSA 4O4LB 4LF9B 2VQFO 3OTFA 5LYJA 5B5EZ 3LSQA 3F7VC 2QGNA 1S72V 4UB6Z 2QTOA 5KAFZ 2YC0A 5CA0A 3UCSC 1YJNV 1QR9A 1Z5VA 4PD4F 2CGNA 3CJHA 2Q6AA 4FIPC 2Q69A 3K3WA 5GW7A 1I5XA 3ETEA 5A2QN 4KHPB 3RFRA 1WLEA 2EIKC 1FKAO 3K0DA 1SKVA 2YI8A 1E79G 1X59A 4CS2A 5LMUO 2QKAA 1FJGO 1QR8A 1Q90D 2QDOA 3P32A 3ABMC 5LHHA 5LMNO 4TWKA 1PNKA 5KA6A 3MDSA 4GKKO 4DV7B 2PUSA 4FFBA 1SZTA 4I7ZB 4DV1O 3CMEV 1GN4A 3HKBA 5DEDA 3BA9A 1GTOA 2RCVA 1NT2B 2FB5A 3FYEB 3ETGA 3L74H 1WB7A 2KG7B 5B1BB 4LFAO 4E2LA 1AJPA 5IY5C 4QIWF 5DM6V 2LW1A 1F23A 5IE9A 4CS4A 3JAWA 4CC5A 2R72A 2PTMA 2CH7A 3U11A 1RM1B 4CC6A 1Z2GA 5IYCO 3BPZA 5B66Z 1KKCA 1FXKA 3CC4V 4I4TB 1PNLA 4JI7O 4LF6O 3UT5B 3OUSA 3FD9A 1UJWB 3E8GA 4IIJA 1BGYH 3SYCA 3W7WA 1LUWA 1ZSPA 3IJ4A 4GT1A 2QE7G 4DR3O 1JX9A 3LSUA 2BE3A 1M57C 4BAYA 5EIBC 1SF9A 1NH2B 2CUGA 1DGSA 1EFRG 2YS8A 4K0KO 4K8ZA 4DR1O 2EINB 1Q3EA 4DR5B 1RFYA 4JYAB 1AJNA 2KQXA 4R6ZA 2LP7A 5H2FZ 3BHPA 2F4VO 1WAZA 2ZE5A 2ZKOA 1Q6HA 3E89A 1L0NH 4XDKA 2XAFA 3JARA 3ZHSA 2R70A 1KB9F 4PDVA 2JGDA 4DXWA 1XDCA 1FPOA 2HJDA 3ZMSA 1KYOF 1MMMA 1QVGU 4FM2A 1AI7A 3C3TA 1NVPD 3HB3B 3CRCA 3K0GA 1XNQO 5DN6G 4X1KA 1CP9A 1N33B 2P4KA 5BMVA 3CCMV 3HPLC 4TQDA 5B3SC 3VQYA 4BWAA 2E74B 1K3EA 1VQ6V 2A3QA 3ABTA 2X6CA 2VQEB 4YY3O 4DV3B 4RWUA 2MK3A 3H1KH 1HWYA 1OCRC 3OEEG 1ZL8B 5B1AB 4ZOLA 4ZBMA 3E2EA 1XL6A 4YXWG 2QWRB 3ZHRA 4G28B 3K59A 5J2TB 2GUZA 3U10A 4D7SA 3QO8A 4O4HA 1KQSU 2WAMA 4QE9A 4DR7O 4UB8Z 4JYYA 4JI4O 1HR0B 1N4CA 2N05A 3TGUH 4CH4A 4JI5B 2WLKA 1RSOA 1S0VA 1AR4A 2F43G 5J2UB 3H1LH 3UO2A 1W2BU 2RNBA 2O57A 5F2VO 4KHPO 4W4LA 2X6AA 2GSMB 2EIJB 1XEQA 4JI2O 1O9HA 1IXBA 4RO2A 3N27A 1QLEB 4CBCA 1F7YA 3ICXA 2P06A 3GWKC 4X89A 5D5QA 4JI1B 1OV9A 3LDEA 4B3SO 3JATA 4OX9B 1I0HA 1WB8A 1IBLB 4IT5A 5GTHZ 3SJCC 1K8AW 1N32B 4L87A 3FX7A 1Y67A 4BR6A 2WLJA 2ZDIA 4J41A 3G4SV 2WLMA 3VBBA 3HKCB 3JYCA 4TUYB 3RYFA 4U3JA 1XQ8A 3ZHTA 3OR7C 2BSKA 4X8AA 1FXVA 1Q82W 3N2GA 1E1QG 4GZRB 5BY1A 1NJIW 5CA3A 1NZ6A 2IJJA 1SQXH 5LGUA 3ZHUA 2BCCH 5ITZB 3WG7B 1ZLZA 3RGBA 1TA8A 1FFXA 4JV5B 1UPGA 4NTWA 1XREA 3FAVB 3K5OA 5IWAO 4DR6B 1Y76B 3B8MA 3ZN1A 2GHYA 3W7UA 1HNXO 1GM9A 2H94A 2LGWA 5L3FA 2ZT9B 5CMUA 3RW0A 2EJ7A 4JGSA 3A2FA 4O4JB 1NTKH 4L8JA 2EIJC 5C8YB 4E4EA 4FM1A 1WN7A 2P5OA 4DR5O 3MHSC 1CXZB 4JI6B 1VQ8V 5IT9N 2Q7GA 2YIBA 1XBLA 3L9DA 1K97A 1Q86W 3STLC 1OZ0A 3CCLV 5LXTB 1MA1A 4JZGA 5KX5B 2B9ZA 4YJ3B 1OCOB 1AI4A 2HVKC 3AG7A 1JJOA 4LBEC 3G6EV 4LF8O 1R3JC 4MS2A 1V9PA 1N33O 3TJTA 4ZI7B 1TUEB 4I55A 4K8XA 4CH6A 4I5SA 4XBFA 4QJFB 3WFVA 1AJQA 5GONB 2IU0A 1EZJA 1VQ5V 1MSWD 1YTFB 3MD0A 2HEPA 2UXXA 1M90W 3Q4HA 2B1GA 4JTCB 1H2GA 4KUMA 4WBNA 2PZSA 3CC7V 5CA1A 2D2CB 3F7YC 2DQ3A 2D3OW 2P6JA 3TK1A 4FLYA 1J5EO 2EZOA 1RPRA 3IGAC 4LH6A 1MABG 3CRAA 3FKSG 1N0JA 4X65B 1QBZA 2YUAA 1HNWO 3B4SA 4JTDB 2AZ2A 4JI5O 3B09A 4P9OA 1I08A 4J7ZA 1DF5A 1GM8A 1K92A 1YSCA 2IBZH 3W7TA 3SYAA 5KMGB 3CCVV 4X64B 1R3IC 4BW9A 3OTOB 4GKJB 1MNGA 3CCQV 2P67A 4H0LB 1SA0A 4RUFA 4PA4A 2KG7A 5JQGB 1SETA 2P7TC 3B77A 2UUBO 1TUBB 2E76B 3CD6V 4ZHQB 2AW9A 4JASA 4EFBA 4DUZB 4O2AA 1F4NA 3L73H 3K9AA 4EB6B 2XT9A 1Q6UA 2YIDA 3NXSA 4P30A 1GH6A 1N0NA 2DQ0A 3ZEDA 1QVFU 4I4TA 4JZ2A 1NI8A 3JD4A 5KHGA 2JEUA 1TGOA 1V54B 2G38A 1NS1A 4TOIA 3OMNB 2UXDB 2JJ2G 1MZFA 4HAMA 3JALB 4MVRA 3FB8C 1PNMA 2WLLA 3ETDA 3AG4B 4DR6O 3TXQA 5CBHA 1IX9A 1BQ0A 3CRMA 3X2QB 5L3DA 4JI3O 3CMAV 1PM9A 1JR9A 1SC5B 3JAKB 3SPIA 5KHIA 2XHBA 1ENVA 1DK1A 4B3RB 1JFFB 4LFCB 1W0KG 4JI6O 2WLIA 3ABLC 1VQ9V 3P3NA 1U96A 5TISZ 2Y4TA 1F51A 4PHZA 4NXMB 3PJSK 3EVKA 2ZIMA 3K06A 2DJVA 1BT8A 2UU9B 4WCEV 1VQPV 4DW1A 1RPOA 3A0BZ 1MG1A 1OCCC 5LA6B 2PI4A 1EN4A 3E8BA 3J7AU 4R7CA 4N21A 4AI8A 1AI5A 3GWOA 2HLDG 4JAAA 2WPDG 1DTOA 1ZL8A 4LF4O 1Z5WA 2IJKA 3N2KB 3AK3A 4D6TH 5JH7B 1YDXA 1V54C 3OMAB 2YIBD 1BHAA 1GN3A 4DK1A 2HHHB 1AB3A 3R65A 5IYZB 1EBOA 4J80A 3UKMA 1QNMA 3AG4C 3ZX6A 1RP3B 4I0XB 1VF7A 2H8PC 4XDJA 4JI8O 2YEVB 3X2QC 3JCUZ 4YHHO 1Y4MA 1BZKA 3ZS8C 1K9MW 3HKDB 4DR4O 3BVOA 5J2UA 4FM0A 2NN4A 2CAZC 4UVCA 3ZMVA 1B04A 4CH5A 2Y0IA 1D5AA 1VQKV 5LBQA 4K3AA 3OT7A 3L75H 4YJ2B 5FNVA 5L3EA 1H2LA 4DR2O 1P4RA 4LP8A 1QCEA 3ASNB 1HNZB 1IBMO 3K03A 1DLBA 2F1MA 3T1HO 4J11A 2KSDA 1M56B 4X64O 4N23A 2ARHA 1KECA 2OT5A 4NB5A 3DTUB 4J9ZB 3HR0A 5A9GA 4LFBB 3ZRVA 4RQEA 5EBMC 1BMFG 4WFFA 4C7UA 1FD9A 3A0RA 4H44B 1J95A 2KB1A 4MVSA 3AG2B 4O4IB 4R8CA 1FYJA 3HKCA 2ZE7A 5EIBD 5EBLC 1S5HC 4DUZO 4JI0B 3A0HZ 5CB4A 1VQMV 2JRIA 2N04A 3E22B 3JD1A 5H6QA 5IJ0A 5EYPB 4UUJC 5JJEB 5CBGA 3JAMN 3HKEA 3RYCB 2YI9A 2BTQA 4DUYO 1M1KW 4MVZA 2ETNA 4UFZA 1XMQB 3EXAA 4PDLA 2R9AA 3H01A 5JJNB 4LF7B 3K9SA 2GV9A 1XILA 3FAVA 4DYLA 2WA3A 3EFFK 4P9PA 5LGTA 3BA8A 3DXRA 4NXNB 4NKGB 3NR7A 1YXBA 2Q7EA 2UXBO 1B06A 2DMXA 4GX1A 3K04A 5B1BC 3T2MA 4NTXA 1QU7A 4FMTA 2ZINA 4O4JA 4X1IB 3QTCA 1US6A 3JSLA 1EN6A 1A32A 1R6TA 2QWPB 1HDJA 1CPYA 4FVMA 3OW2U 3T4DA 2B1IA 1K7DA 5KA5A 3T1YO 4NR1A 4WF9V 2DYRB 1RM1C 1S5JA 3SJQC 3CCUV 1KD1W 5D5PA 3RN4A 1TVKA 1YF2A 2VS0A 4J42A 2DWDC 2ILMA 2OCCB 4YJ3A 4DV0O 4B7KA 4X66B 3MAQA 2UU9O 3GB7C 1N36O 1R6KA 1PL4A 1L8DA 4IHJA 4JAUA 4Q6GA 1XL4A 4ZI7A 1NH2D 2V4DA 4LF5B 4RUEA 1QHTA 3BY6A 5HFLA 3P3PA 2FMLA 1GKFA 2CDYA 4LF9O 4YIPA 1N34B 5GONA 3KCXA 5IJ9A 4J10A 1SQFA 3CPWU 3CCSV 1YIJV 5KUMA 1KKDA 1H38A 3CJHB 2V7QG 3GVMA 4FK5C 2EINC 4P2ZA 1Y6XA 2ZD9A 1B6QA 3AG3B 5J9PC 4QPJA 4FJCC 3OD4A 2V1DA 2UXCB 2ZIOA 3H9VA 2ODMA 3RYHB 4MTOA 4LWSB 3SYQA 4F6RA 2P4VA 4U7OA 2CE4A 2HKOA 1VP7A 2PI5A 2QKCA 3HKBB 5EK0A 3JASB 4DV7O 1WP8A 4I50A 1JCHA 4U3FH 1NR7A 1AROP 2RMKB 3CRQA 3RWRD 3SPHA 3OM3B 3ZIAG 3CSXA 2XNDG 1VIBA 1WA8A 2CH7B 1YVWA 2A06H 4D7TA 2P90A 4TV9A 5B1AC 4PJ0Z 4MTFA 3A8TA 1HNZO 3H1HH 2F66C 1FXKB 1TAEA 4MVMA 3VOUA 2CTWA 3TCUA 1SZXA 1YJ9V 2IH1C 2ZM6B 1KP3A 1M9NA 2Z0AA 4X1YA 5LHIA 4X9QA 4FLXA 2Q9LA 4UCUA 4LFBO 2OWOA 1Y74B 2F93B 3UQ8A 2R9IA 1TUBA 3VQVA 5CN0A 4PA3A 2YIAA 4DO2A 1F4MA 3K5LA 3CE2A 2RDCA 2PYLA 3SJBC 4RQFA 2Y0PA 3JSNA 4Q20A 4AQYB 4PA9A 1IBKB 1GN6A 5DECA 3K5NA 2OYQA 1I7FA 2ADPA 1P49A 3LNNA 2A7WA 3I55V 2JIZG 3BAAA 3CYOA 2QM8A 4O2BB 1THZA 4JYAO 1ZAUA 3JARB 5LP6B 1QLEC 3ASOB 4IYHA 4ZKIA 4TSFG 1XI1A 1YEWA 2RJZA 2Y69B 3IC7A 1P84F 4NXNO 2QWOB 1K34A 1KUQA 2EJRA 4X1KB 3KG2A 5IYBO 4DV5B 5BMVB 3JAKA 1VQ4V 2UUAB 2Q0OC 2HVJC 2X7RB 4BIUA 1JFFA 3ABKB 1Q43A 3CCEV 4ICGA 2YXLA 3E35A 4BIZA 3D36C 1XOUA 4J7JA 4UV9A 1ZWIC 2VQEO 4DV3O 5H5NA 3ZRSA 2DN9A 3CB2A 2ZXWB 5IDJA 4AILC 2ZQMA 5CBFA 1H2NA 5KAIZ 1NU1H 1AR1B 2W6IG 2ADQB 3WG7C 4LNUA 3D3QA 1ZUQA 4R50A 1D5NA 4O4HB 1DF4A 3CEIA 3FB7C 4O4LA 3OFNG 2C2AA 3I56V 4TV8B 3OMIB 4ZIBA 1R1BA 2IW5A 1YI2V 3JD3A 1N34O 3CXCU 1S76D 3I5DA 3LDDA 2RQ6A 5H9CA 1HR0O 3ZN0A 4MW8A 1D2DA 2XAJA 2EBOA 3SJAC 3E8FA 1NKDA 5LP6C 5IYZA 3ABUA 5LMUB 2YSUB 1L1FA 3RT3C 1FJGB 2QTSA 2UXCO 4H37A 2E5LB 5KHHA 4IYIA 5B1OA 4GKKB 4MTGA 4I0XA 1YCIA 2OIEA 1SQBH 2QKSA 2OTJV 4B3TB 3LDCA 3ZHQA 1OCOC 3JATB 1KBHA 1URFA 4MVQA 5FLXN 1YITV 4LFAB 4JI1O 1V55B 3FYIB 3HKDA 3C90A 1SS3A 4KL1A 4DRXB 3MHHC 2LFSA 2HG5C 4OX9O 4LC1A 4FLWA 3ABKC 1IBLO 5JVDB 4K35A 2Z5UA 1WPXA 2Q7HA 3H1JH 1VQLV 4CZZA 1YTFD 1N32O 4YJ2A 3OEHG 3THOA 3SR2C 2FL4A 2ZNIA 1VQOV 2ZXWC 3CWBH 3EHBB 4PI0A 3N2GB 2OIGA 3OUFA 4MTXA 2QWQB 5KLVH 2HR3A 2XTAA 2QR4A 2M7WA 5LL6Y 2DYSB 3L71H 4X88A 4GX5A 3WB2A 2VWKA 3UT5A 4DR3B 3IFXA 3CP1A 3TETA 2MW2B 1H2KA 4O4IA 4HNAB 1PKXA 2YICA 4OPHA 3K08A 3D3IA 1NTMH 4RAIA 5EZYB 4NYKA 2EZPA 4JV5O 4K0KB 2N74A 4UXNA 4OGQB 4WFEA 1Q7YW 3F5WC 2QSAA 1ORQC 3O65A 4FLVA 2YDEA 1Q5OA 2H3OA 2F4VB 5L3BA 3ZMUA 1IBKO 1OHHG 3E83A 1ZX3A 2EIKB 3ETQA 2HP8A 3CC2V 3VQXA 3APQA 4QGPA 3ZRWB 1JMKC 3B8NA 1OJHA 1V55C 5K1PA 4MVUA 2JS5A 5LHGA 2IU3A 2GDSA 1G6UA 3RYIB 2EX3A 4MW3A 3B40A 2E3CA 3FFQA 1UFIA 2YXYA 4KXRA 4X20B 4DV5O 1NBMG 2UUAO 1PP9H 1HP8A 1W0JG 3K58A 4Z1MG 1G8MA 2F95B 1SQQH 5LOVB 1WJZA 5AG2A 1PL0A 1IURA 1M4UA 2OTLV 3Q4HB 2NLJC 2XUMA 3LSSA 2JGUA 4BIOA 1XUQA 5JCOC 2A9HA 4WBNB 1BHBA 1WNSA 5CA1B 4YIOA 1XMOB 1VF6C 1Q8IA 3OGCC 4DR7B 5J2TA 3U0ZA 4JI4B 1M93A 3LUTB 1U97A 3APOA 4PV1B 3S3WA 3ML0A 2W0FC 1ROPA 3FB6C 2FYUH 2GBOA 2WLHA 5FPRA 3BABA 1M57B 1QLNA 4PA7A 5EBWC 3LNMB 3AEIA 4I9QA 1XHZA 3M8AA 4X65O 2Y48A 4JI2B 1I5YA 5B1NA 2P22C 3RYHA 4LWSA 3J81N 2ZE6A 4PI2A 4EEQA 1K4DC 1S3JA 1MOFA 2ATKC 4B3SB 2E5LO 3M7MX 3OR6C 4FLUA 4B3TO 1SA0B 1NTZH 4H33A 3JASA 4EKWA 5C93A 3OTOO 4JYBA 4GKJO 2OCHA 3SPGA 4DV4B 2RN9A 2DWEC 4OXSA 2JEXA 1VARA 3AK2A 1NVPB 2JDIG 2DE0X 4O2AB 3UO3A 1LUVA 5B3SB 3W7XA 1BL8A 3CCRV 2ZCEA 4TUYA 2EILB 3D36A 2AHZA 2LJ2A 5BZBA 1XHXA 4PELA 2L6LA 1OCRB 3BEHA 4Z1VA 3P30A 2WA4A 2CK3G 5E79Z 1Q6IA 1K73W 2CTPA 5GTIZ 4DV6B 3QNEA 1Y74A 4DK0A 1H8EG 5IWAB 1BS3A 5ITZA 2DW4A 2HJFC 1HNXB 2QM7A 2WLLB 4HZ3A 2UXDO 1FS0G 1AILA 1Y76A 1G1XB 3KZIZ 4F6EA 4ABMA 3CRRA 2PYJA 4GCZA 3JD0A 1BQZA 4QNHB 1P7BA 1XNRB 4TQFA 5EC1C 3CHXA 5C8YA 2X0LA 2EIMB 4O2BA 1L0LH 4Z2WA 1GM7A 2WLIB 4NTYA 5LP6A 3BCCH 3R66A 3CXHF 3ASNC 2XAHA 1IXMA 1AP5A 1GN2A 5KHKA 4B3RO 4LFCO 2QM4A 1M56C 1AI6A 5LXTA 5JWPA 3BFRA 1YHQV 4LF8B 3W7SA 4NXMO 2LGQA 5KX5A 3OAAG 1VEWA 4JPRA 2QEXV 3G71V 4UCRA 4JAVA 3AG2C 1GRJA 4PDRA 5LYJB 4GLXA 1SQGA 3G6BA 1FXHA 4B7EA 2EILC 1CEZA 2NNUA 3L70H 3QVNA 2CTRA 5CA0B 1K4CC 4CS3A 1W59A 4FLZA 3ZCCA 3QO7A 3G67A 4GX0A 4GYCB 4WFBV 1J5EB 1MSDA 1H2MA 1WP7A 1XMOO 3T1CA 3SPJA 4JF3A 1BSMA 3WB1A 2HHHO 4CH3A 2ZE8A 2XAGA 3WB0A 4TV8A 2X6BA 2UXNA 1HNWB 4DV2B 3KCYA 4FFBB 5KUKA 2W6JG 3DC6A 1NQTA 3JCZA 2Q67A 1JQ0A 2EIMC 3K57A 4MVOA 2CGOA 2K1EA 2Q4PA 4LCUC 3M99B 3UM7A
chains in the Genus database with same CATH topology
1ENVA 3W7WA 1JVMA 1DF4A 3FB7C 4J9YB 1W0KG 3OE7G 3OFNG 2DYRC 2C2AA 3I56V 4GT1A 2WLIA 3ABLC 1K5SA 2QE7G 1VQ9V 1JX9A 1K33A 3OMIB 1F51A 1M57C 4BAYA 2IW5A 1YI2V 1NH2B 2OCCC 3PJSK 3JD3A 3K06A 3CXCU 1KC8W 1S76D 3LDDA 5H9CA 4F4LA 4WCEV 3ZN0A 1VQPV 1EFRG 4MW8A 2XAJA 2EBOA 1RPOA 2EINB 3E8FA 1MG1A 1AJNA 1NKDA 1OCCC 4R6ZA 3ABUA 2LP7A 2YSUB 1L1FA 2PI4A 3E8BA 3QO5A 4R7CA 2BOCC 2AHYA 4H37A 4N21A 3E89A 4XDKA 2XAFA 5B1OA 1AI5A 4MTGA 4PDVA 3GWOA 2HLDG 2QKSA 4DXWA 2IH3C 2OTJV 2WPDG 3ZMSA 3LDCA 1OCOC 1QVGU 1DTOA 4MVQA 1YITV 5EC2C 1AI7A 1V55B 3FYIB 2IJKA 3HB3B 4G2KA 1NVPD 3AG3C 3E8HA 3K0GA 4MSWC 1V54C 3MHHC 2LFSA 2HG5C 3OMAB 3SYCA 4LC1A 5DN6G 1BHAA 3ABKC 1CP9A 5L3GA 3R65A 1EBOA 2Z5UA 4WFHA 4UVAA 1WPXA 3CCMV 2XOKG 3HPLC 3UKMA 5B3SC 1VQLV 4CZZA 1YTFD 1K3EA 1VQ6V 3AG4C 1GO3F 3OEHG 3ABTA 2ITCC 2X6CA 2MK3A 1VQOV 2H8PC 2ZXWC 1HWYA 3EHBB 4UV8A 4XDJA 4PDMA 2YEVB 1OCRC 3OEEG 4HYOA 3X2QC 5B1AB 3OUFA 1Y4MA 4ZBMA 4MTXA 1K9MW 1N8RW 1H8HG 2HR3A 3E2EA 1XL6A 2M7WA 4YXWG 3K79A 2DYSB 4X88A 4G28B 4GX5A 4UVCA 4MT8A 3ZMVA 2JK5C 1SESA 3IFXA 3CP1A 4WFGA 3TETA 4U7NA 5LBQA 1VQKV 2WWWA 3QO8A 3STZC 1KQSU 2WAMA 1PKXA 4QE9A 5L3EA 3K08A 4KFMA 1P4RA 3D3IA 4RAIA 4LP8A 3ZRWA 1QCEA 3ASNB 2EZPA 1FXKC 3K03A 1DLBA 4UXNA 2WLKA 4WFEA 1M56B 1Q7YW 4TT3G 1S0VA 4N23A 3F5WC 1KECA 2OT5A 1ORQC 5IYDO 2F43G 4KP4A 3ZMTA 3DTUB 2IJHA 4J9ZB 5L3BA 4JTAB 3ZMUA 1W2BU 3ZRVA 4RQEA 5EBMC 1BMFG 4WFFA 1OHHG 3E83A 3A0RA 2X6AA 4ASUG 2XASA 2GSMB 2EIKB 1VQ7V 1J95A 2EIJB 3CC2V 2KB1A 4MVSA 3AG2B 3E86A 4R8CA 2ZR3A 4RO2A 1QLEB 4CBCA 3ZRWB 5EBLC 1S5HC 3B8NA 4X89A 1V55C 3LDEA 1VQMV 2WSSG 3JD1A 5H6QA 3SYOA 4MVUA 4WFAV 4UUJC 5LHGA 5CBGA 1Q81W 2IU3A 1R3LC 3DGEA 1M1KW 4MW3A 4MVZA 1K8AW 4L87A 4QPKA 4I9WA 5HFMA 4PDLA 2QA4V 1NBMG 2B5UA 3H01A 3ASOC 2WLJA 2ZDIA 5L3CA 3G4SV 1SERA 2WLMA 1W0JG 4Z1MG 3VBBA 1G8MA 3EFFK 3JYCA 4P9PA 5LGTA 1OCZB 2Y69C 1NR1A 1PL0A 3OR7C 4X8AA 1FXVA 1Q82W 1R6NA 2YEVA 2OTLV 2JJ1G 1E1QG 2NLJC 3LSSA 3K04A 4GX1A 2XAQA 5B1BC 3T2MA 1NJIW 2A9HA 4FMTA 1BHBA 5CA3A 2HFEC 2IJJA 4XDLA 1R3KC 5LGUA 3OGCC 1GK9A 3WG7B 3JD2A 1CPYA 5E1AC 3RVZA 3OW2U 3T4DA 2B1IA 3LUTB 3RVYA 1JPXA 1K7DA 2A0LA 5KA5A 3ML0A 2W0FC 2ZR2A 1COWG 1R73A 1ROPA 4WF9V 2DYRB 1RM1C 3ABLB 3SJQC 1YJWV 3FB6C 3CCUV 3B8MA 3ZN1A 1KD1W 2GHYA 2WLHA 3W7UA 1GM9A 1M57B 2BOBC 3AG1B 4PA7A 2H94A 5EBWC 2DWDC 1S77D 1QLNA 3ZJZA 2OCCB 5L3FA 3LNMB 3AEIA 3RBZA 5CMUA 3RW0A 3GB7C 4JGSA 3FB5C 1R6KA 4G27B 2EIJC 2Y48A 3ZMZA 4JAUA 1I5YA 1OCCB 3MHSC 5B1NA 1XL4A 5H6RA 1NH2D 1VQ8V 4RUEA 1K4DC 3BY6A 5HFLA 1S3JA 1FFTB 1K97A 1MOFA 1GKFA 2Q68A 3STLC 1Q86W 1OZ0A 2ATKC 2WLNA 3CCLV 2A79B 3OR6C 3ZRXA 3CPWU 3CCSV 1YIJV 1KP2A 5KUMA 1KKDA 2LFRA 1H38A 1VQNV 1OCOB 1AI4A 2V7QG 4H33A 4FK5C 2EINC 4P2ZA 2HVKC 4EKWA 5C93A 5LGNA 1Y66A 4JYBA 4LBEC 3G6EV 3SPGA 2DWEC 2ZD9A 1B6QA 1R3JC 3AG3B 5J9PC 4MS2A 1PD3A 4QPJA 4FJCC 2JEXA 4OXSA 2V1DA 2R9RB 1NVPB 4MTOA 1TUEB 2JDIG 3SYQA 1JOYA 1OCZC 5B3SB 4U7OA 3W7XA 1BL8A 2HKOA 3CCRV 4I5SA 4XBFA 4QJFB 3WFVA 1AJQA 1LNQA 2IJIA 2IU0A 1EZJA 1VQ5V 1MSWD 1YTFB 2PI5A 2EILB 3D36A 2AHZA 3MD0A 5BZBA 1GMGA 3ABMB 4PELA 1OCRB 2UXXA 3BEHA 5EK0A 3P30A 1M90W 2B1GA 2CK3G 3SPCA 4GX2A 4JTCB 3SYPA 1K73W 1H2GA 1SRYA 4KUMA 2ZDIC 1JCHA 3QNEA 5FL7G 3CC7V 1NR7A 4PA6A 3F7YC 2DQ3A 2D3OW 1AROP 1H8EG 2P6JA 3TK1A 4UVBA 3SPHA 2FTKA 2EZOA 2DW4A 3OM3B 2HJFC 3ZIAG 2QM7A 1RPRA 2XNDG 4QE7A 4BW5A 3AG1C 2WLLB 4HZ3A 5IY5B 1JJ2U 3IGAC 1FS0G 2P90A 1MABG 5B1AC 4MTFA 3FKSG 1E1RG 4FPPA 1QBZA 1FXKB 4JTDB 4MVMA 3VOUA 4P9OA 2Z3YA 2DYSC 4GCZA 3JD0A 3CCJV 3TCUA 1P7BA 4QNHB 1YJ9V 1K5QA 3T4ZA 2IH1C 1G4YB 5EC1C 1KP3A 1M9NA 1DF5A 5LHIA 2ITDC 4JYCA 1GM8A 2X0LA 1K92A 2EIMB 1GM7A 1YSCA 2R9IA 2WLIB 5CN0A 3W7TA 3LSQA 3SYAA 3F7VC 4PA3A 4DO2A 3ASNC 2XAHA 1F4MA 1IXMA 1S72V 2QTOA 3CCVV 1M56C 1YJNV 1AI6A 1QR9A 4RQFA 1R3IC 1YHQV 3CCQV 2P67A 4Q20A 3W7SA 4FIPC 2Q6AA 4PA9A 2Q69A 4RUFA 3K3WA 5GW7A 1I5XA 3OAAG 3ETEA 4JPRA 4PA4A 2QEXV 3G71V 1SETA 1WLEA 2JIZG 3CYOA 2EIKC 3I55V 2QM8A 3K0DA 4JAVA 2P7TC 1THZA 1E79G 3AG2C 3B77A 4PDRA 3CD6V 1FXHA 1QLEC 3ASOB 4JASA 1QR8A 2EILC 1CEZA 1F4NA 3P32A 2NNUA 4ZKIA 3ABMC 5LHHA 4TSFG 1PNKA 4TWKA 3K9AA 5KA6A 1SZTA 2Y69B 3IC7A 3NXSA 4P30A 1K4CC 2DQ0A 1K34A 3ZCCA 3CMEV 2EJRA 1QVFU 1GTOA 3QO7A 3FYEB 3KG2A 3ETGA 5IYBO 4GX0A 4WFBV 5B1BB 3JD4A 1VQ4V 2HVJC 4E2LA 2JEUA 1AJPA 1V54B 2X7RB 3SPJA 4JF3A 3T1CA 4BIUA 3OMNB 3ABKB 5IY5C 3CCEV 2JJ2G 4HAMA 2XAGA 3E35A 4QIWF 5DM6V 4MVRA 4BIZA 1F23A 2X6BA 3FB8C 2UXNA 4UV9A 1PNMA 2WLLA 3ETDA 3AG4B 1RM1B 5IYCO 1ZWIC 5CBHA 5KUKA 2W6JG 1FXKA 1NQTA 3JCZA 3ZRSA 2Q67A 1JQ0A 3CC4V 5IDJA 2ZXWB 3X2QB 5L3DA 2EIMC 2ZQMA 1PNLA 4MVOA 5CBFA 3CMAV 1AR1B 2W6IG 2K1EA 3OUSA 3WG7C 1UJWB 4LCUC 3E8GA 3M99B 3SPIA 4R50A 3UM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAI A;  4LP8 A;  1JVM A;  1G4Y B;  2IH1 C;  3FB7 C;  3LNM B;  4J9Y B;  5EC1 C;  3ZJZ A;  2DYR C;  2ITD C;  3RBZ A;  2WLI A;  3ABL C;  3K03 A;  3RW0 A;  2WLK A;  3GB7 C;  4WFE A;  2WLI B;  3F5W C;  3FB5 C;  1M57 C;  4G27 B;  2EIJ C;  1ORQ C;  3SYA A;  2OCC C;  3F7V C;  3PJS K;  3K06 A;  4PA3 A;  3ASN C;  3LDD A;  1XL4 A;  4J9Z B;  4F4L A;  4JTA B;  2QTO A;  4RUE A;  4MW8 A;  1K4D C;  5EBM C;  1M56 C;  4WFF A;  1R3I C;  2Q68 A;  3E83 A;  3STL C;  2ATK C;  3E8F A;  2WLN A;  2X6A A;  1J95 A;  1OCC C;  4PA9 A;  2Q6A A;  2A79 B;  2KB1 A;  3OR6 C;  4MVS A;  4R6Z A;  3E86 A;  2Q69 A;  4R8C A;  4RUF A;  5KUM A;  1KKD A;  3E8B A;  4R7C A;  2BOC C;  4RO2 A;  2AHY A;  3K08 A;  4H33 A;  4PA4 A;  5EBL C;  1S5H C;  4H37 A;  4CBC A;  2EIN C;  3E89 A;  4R50 A;  4X89 A;  4P2Z A;  2HVK C;  4XDK A;  1V55 C;  4EKW A;  3LDE A;  2EIK C;  3K0D A;  2P7T C;  4LBE C;  4MTG A;  4PDV A;  3SPG A;  3AG2 C;  2DWE C;  2QKS A;  2ZD9 A;  4MVU A;  3SYO A;  4DXW A;  1R3J C;  2IH3 C;  4PDR A;  4UUJ C;  4MS2 A;  5J9P C;  5CBG A;  3LDC A;  4OXS A;  1QLE C;  1OCO C;  1R3L C;  2EIL C;  2R9R B;  4MTO A;  3SYQ A;  4MW3 A;  4MVQ A;  3ABM C;  4MVZ A;  5EC2 C;  4TWK A;  1OCZ C;  4I9W A;  3AG3 C;  4PDL A;  1BL8 A;  3E8H A;  3K0G A;  4MSW C;  1V54 C;  3SYC A;  4P30 A;  1K4C C;  2HG5 C;  3ASO C;  1LNQ A;  2WLJ A;  3ABK C;  2WLM A;  3R65 A;  4WFH A;  3HPL C;  2AHZ A;  3EFF K;  3JYC A;  4P9P A;  3UKM A;  5BZB A;  5B3S C;  3KG2 A;  4GX0 A;  2Y69 C;  3BEH A;  5EK0 A;  3AG4 C;  2HVJ C;  3SPI A;  3SPC A;  2ITC C;  3OR7 C;  2X6C A;  4X8A A;  3T1C A;  3SPJ A;  4GX2 A;  4JTC B;  3SYP A;  5IY5 C;  2YEV A;  4GX1 A;  2NLJ C;  2H8P C;  3K04 A;  4MVR A;  2ZXW C;  4PA6 A;  4XDJ A;  4PDM A;  5B1B C;  3T2M A;  3F7Y C;  1OCR C;  2A9H A;  2X6B A;  3FB8 C;  4HYO A;  3X2Q C;  2HFE C;  3OUF A;  3SPH A;  4ZBM A;  2WLL A;  2HJF C;  4XDL A;  1R3K C;  3OGC C;  1ZWI C;  1XL6 A;  4QE7 A;  4BW5 A;  5CBH A;  3AG1 C;  5KUK A;  2WLL B;  5E1A C;  3RVZ A;  4HZ3 A;  4X88 A;  4G28 B;  4GX5 A;  3IGA C;  3T4D A;  3RVY A;  3LUT B;  3ZRS A;  2Q67 A;  5B1A C;  2A0L A;  4MTF A;  5EBW C;  2W0F C;  2JK5 C;  3IFX A;  4WFG A;  2EIM C;  5CBF A;  4MVO A;  3TET A;  3SJQ C;  4JTD B;  2K1E A;  3FB6 C;  4MVM A;  3OUS A;  3VOU A;  3WG7 C;  4P9O A;  2WLH A;  2DYS C;  3STZ C;  4QE9 A;  4LCU C;  3UM7 A;  3E8G A;  3TCU A;  1P7B A;  2BOB C;  4QNH B;  4PA7 A;  4KFM A;  3T4Z A;  2DWD C; 
#chains in the Genus database with same CATH topology
 1JVM A;  4J9Y B;  4UCV A;  5FNV B;  3OE7 G;  2DYR C;  2F23 A;  1K5S A;  3JAW B;  3SGI A;  1K33 A;  2AZ0 A;  1GAX A;  4IGG A;  5KMG A;  1EN5 A;  2OCC C;  1KC8 W;  1O9G A;  2UUC B;  4F4L A;  1AVM A;  2JVD A;  4B08 A;  1MZE A;  4DRX A;  4GUN A;  2UUB B;  5JVD A;  4A5U B;  4DV4 O;  1IVS A;  5JQG A;  2JS3 A;  4IIJ B;  3QO5 A;  2L35 A;  2BOC C;  1YZB A;  2AHY A;  5BR8 B;  2VRZ A;  4ZHQ A;  1VMG A;  4UCS A;  3C3S A;  5CB4 B;  2IH3 C;  1S5L Z;  3PN1 A;  5IJ0 B;  1PV0 A;  2Y4U A;  4EB6 A;  1KU9 A;  3DC5 A;  3HKE B;  4JI0 O;  5EC2 C;  4G2K A;  4X62 B;  2BTQ B;  3AG3 C;  1EM1 A;  3E8H A;  4MSW C;  1T5E A;  3B2E E;  1P7G A;  5L3G A;  4B3M B;  4FZ0 A;  5JCO A;  4WFH A;  4UVA A;  4LH7 A;  2XOK G;  4DV6 O;  2CTQ A;  2ZNJ A;  4HNA A;  1XMQ O;  1VF6 A;  1GO3 F;  2ITC C;  2NR5 A;  2M6Y A;  2Q5Z A;  2K9P A;  3JAL A;  5EZY A;  3DXR B;  2JGD B;  4LF7 O;  1I94 B;  4UV8 A;  4PDM A;  3DSQ A;  4HYO A;  4JI3 B;  1N8R W;  1H8H G;  1EZV H;  1H2S B;  3K79 A;  3O9O A;  1XNR O;  4MT8 A;  4EFE A;  2JK5 C;  1SES A;  4WFG A;  4U7N A;  2BTO A;  2WWW A;  3STZ C;  5K1X A;  4HBN A;  3ZHV A;  4KFM A;  3ZRW A;  1LR1 A;  1TVK B;  1FXK C;  1IDS A;  4TT3 G;  4ZOL B;  2Q73 A;  5KHJ A;  5IYD O;  4KP4 A;  3ZMT A;  3RYI A;  2IJH A;  4X66 O;  4JTA B;  4IHJ B;  2VQF B;  4X20 A;  3SDL A;  5LA6 A;  2GUZ B;  4ASU G;  2XAS A;  5BXZ A;  4UCT A;  1VQ7 V;  3E86 A;  2ZR3 A;  5IJ9 B;  5LOV A;  4LF5 O;  5JJJ B;  4LF4 B;  3IC9 A;  2WSS G;  3SYO A;  1RSO B;  4WFA V;  2LO1 A;  1Q81 W;  4OPA A;  1R3L C;  3DGE A;  2Q0A A;  3N2K A;  5JH7 A;  2VWJ A;  4QPK A;  2E75 B;  4I9W A;  5HFM A;  3QG5 A;  2QA4 V;  3WU2 Z;  1B3Q A;  2B5U A;  2W0X A;  3BRC A;  4F6R B;  3ASO C;  3CS5 A;  5L3C A;  1JA8 A;  1SER A;  2DOS A;  1WPB A;  4JI8 B;  5LMN B;  1KMI Z;  4YHH B;  3F5T A;  1OCZ B;  2Y69 C;  3TXS A;  3J80 N;  1NR1 A;  4DR4 B;  4DV2 O;  3D8C A;  1PPJ H;  4UCO A;  4DV1 B;  1AR5 A;  1R6N A;  2YEV A;  4J7K A;  2JJ1 G;  2XAQ A;  4DW0 A;  4I50 B;  2HFE C;  2LQT A;  4XDL A;  1R3K C;  1M5I A;  1GK9 A;  3JD2 A;  5E1A C;  3RVZ A;  4DR2 B;  1IBM B;  3G80 A;  3RVY A;  1JPX A;  2A0L A;  1WA8 B;  1VF5 B;  2ZR2 A;  1COW G;  1R73 A;  3T1H B;  3ZBH A;  3ABL B;  4TV9 B;  1YJW V;  3RYF B;  2QWN B;  4U3J B;  2BOB C;  2BSK B;  3AG1 B;  4AHC A;  1S77 D;  2PF4 E;  3ZJZ A;  3CX5 F;  2UUC O;  3RBZ A;  4JI7 B;  4LF6 B;  4X1Y B;  3FB5 C;  4G27 B;  3ZMZ A;  4LR3 A;  4IL6 Z;  1OCC B;  3AK1 A;  1ZTE A;  5H6R A;  2ZM6 O;  3QF7 A;  1BE3 H;  1FFX B;  1FFT B;  3H1I H;  2Q68 A;  2AGA A;  5BR8 O;  2WLN A;  1AP6 A;  5FPO A;  1IZ3 A;  2A79 B;  3ZRX A;  2YXH A;  1KP2 A;  2LFR A;  2FKX A;  4H13 B;  1VQN V;  4DUY B;  4DR1 B;  3E22 A;  4FFK A;  3IAY A;  5EYP A;  2PGG A;  3K5M A;  5LGN A;  1QQC A;  1Y66 A;  2EUL A;  4X62 O;  4AQY O;  3RYC A;  4FLT A;  1PD3 A;  3VQW A;  2R9R B;  4B3M O;  1JOY A;  1OCZ C;  2IM9 A;  2AXT Z;  1SQV H;  1LNQ A;  2IJI A;  2UXB B;  3KKY A;  2Q8V A;  1I94 O;  1GMG A;  3ABM B;  1XNQ B;  3SPC A;  4GX2 A;  3SYP A;  2KKW A;  1SRY A;  1X4T A;  2ZDI C;  1BCC H;  5FL7 G;  4X1I A;  3T1Y B;  4PA6 A;  4FZ1 A;  3S3X A;  4UVB A;  4NVP A;  2FTK A;  2PY5 A;  4YY3 B;  4I55 B;  4QE7 A;  4BW5 A;  3AG1 C;  5IY5 B;  1FAF A;  4DV0 B;  1JJ2 U;  3OGI B;  2QJ1 A;  3L72 H;  1E1R G;  4FPP A;  1HW7 A;  4W4K A;  2LW7 A;  1N36 B;  1SQP H;  2Z3Y A;  2DYS C;  3CCJ V;  1K5Q A;  3T4Z A;  1G4Y B;  4LNU B;  2ITD C;  2GTA A;  4JYC A;  2GTS A;  4O4L B;  4LF9 B;  2VQF O;  3OTF A;  5LYJ A;  5B5E Z;  3LSQ A;  3F7V C;  2QGN A;  1S72 V;  4UB6 Z;  2QTO A;  5KAF Z;  2YC0 A;  5CA0 A;  3UCS C;  1YJN V;  1QR9 A;  1Z5V A;  4PD4 F;  2CGN A;  3CJH A;  2Q6A A;  4FIP C;  2Q69 A;  3K3W A;  5GW7 A;  1I5X A;  3ETE A;  5A2Q N;  4KHP B;  3RFR A;  1WLE A;  2EIK C;  1FKA O;  3K0D A;  1SKV A;  2YI8 A;  1E79 G;  1X59 A;  4CS2 A;  5LMU O;  2QKA A;  1FJG O;  1QR8 A;  1Q90 D;  2QDO A;  3P32 A;  3ABM C;  5LHH A;  5LMN O;  4TWK A;  1PNK A;  5KA6 A;  3MDS A;  4GKK O;  4DV7 B;  2PUS A;  4FFB A;  1SZT A;  4I7Z B;  4DV1 O;  3CME V;  1GN4 A;  3HKB A;  5DED A;  3BA9 A;  1GTO A;  2RCV A;  1NT2 B;  2FB5 A;  3FYE B;  3ETG A;  3L74 H;  1WB7 A;  2KG7 B;  5B1B B;  4LFA O;  4E2L A;  1AJP A;  5IY5 C;  4QIW F;  5DM6 V;  2LW1 A;  1F23 A;  5IE9 A;  4CS4 A;  3JAW A;  4CC5 A;  2R72 A;  2PTM A;  2CH7 A;  3U11 A;  1RM1 B;  4CC6 A;  1Z2G A;  5IYC O;  3BPZ A;  5B66 Z;  1KKC A;  1FXK A;  3CC4 V;  4I4T B;  1PNL A;  4JI7 O;  4LF6 O;  3UT5 B;  3OUS A;  3FD9 A;  1UJW B;  3E8G A;  4IIJ A;  1BGY H;  3SYC A;  3W7W A;  1LUW A;  1ZSP A;  3IJ4 A;  4GT1 A;  2QE7 G;  4DR3 O;  1JX9 A;  3LSU A;  2BE3 A;  1M57 C;  4BAY A;  5EIB C;  1SF9 A;  1NH2 B;  2CUG A;  1DGS A;  1EFR G;  2YS8 A;  4K0K O;  4K8Z A;  4DR1 O;  2EIN B;  1Q3E A;  4DR5 B;  1RFY A;  4JYA B;  1AJN A;  2KQX A;  4R6Z A;  2LP7 A;  5H2F Z;  3BHP A;  2F4V O;  1WAZ A;  2ZE5 A;  2ZKO A;  1Q6H A;  3E89 A;  1L0N H;  4XDK A;  2XAF A;  3JAR A;  3ZHS A;  2R70 A;  1KB9 F;  4PDV A;  2JGD A;  4DXW A;  1XDC A;  1FPO A;  2HJD A;  3ZMS A;  1KYO F;  1MMM A;  1QVG U;  4FM2 A;  1AI7 A;  3C3T A;  1NVP D;  3HB3 B;  3CRC A;  3K0G A;  1XNQ O;  5DN6 G;  4X1K A;  1CP9 A;  1N33 B;  2P4K A;  5BMV A;  3CCM V;  3HPL C;  4TQD A;  5B3S C;  3VQY A;  4BWA A;  2E74 B;  1K3E A;  1VQ6 V;  2A3Q A;  3ABT A;  2X6C A;  2VQE B;  4YY3 O;  4DV3 B;  4RWU A;  2MK3 A;  3H1K H;  1HWY A;  1OCR C;  3OEE G;  1ZL8 B;  5B1A B;  4ZOL A;  4ZBM A;  3E2E A;  1XL6 A;  4YXW G;  2QWR B;  3ZHR A;  4G28 B;  3K59 A;  5J2T B;  2GUZ A;  3U10 A;  4D7S A;  3QO8 A;  4O4H A;  1KQS U;  2WAM A;  4QE9 A;  4DR7 O;  4UB8 Z;  4JYY A;  4JI4 O;  1HR0 B;  1N4C A;  2N05 A;  3TGU H;  4CH4 A;  4JI5 B;  2WLK A;  1RSO A;  1S0V A;  1AR4 A;  2F43 G;  5J2U B;  3H1L H;  3UO2 A;  1W2B U;  2RNB A;  2O57 A;  5F2V O;  4KHP O;  4W4L A;  2X6A A;  2GSM B;  2EIJ B;  1XEQ A;  4JI2 O;  1O9H A;  1IXB A;  4RO2 A;  3N27 A;  1QLE B;  4CBC A;  1F7Y A;  3ICX A;  2P06 A;  3GWK C;  4X89 A;  5D5Q A;  4JI1 B;  1OV9 A;  3LDE A;  4B3S O;  3JAT A;  4OX9 B;  1I0H A;  1WB8 A;  1IBL B;  4IT5 A;  5GTH Z;  3SJC C;  1K8A W;  1N32 B;  4L87 A;  3FX7 A;  1Y67 A;  4BR6 A;  2WLJ A;  2ZDI A;  4J41 A;  3G4S V;  2WLM A;  3VBB A;  3HKC B;  3JYC A;  4TUY B;  3RYF A;  4U3J A;  1XQ8 A;  3ZHT A;  3OR7 C;  2BSK A;  4X8A A;  1FXV A;  1Q82 W;  3N2G A;  1E1Q G;  4GZR B;  5BY1 A;  1NJI W;  5CA3 A;  1NZ6 A;  2IJJ A;  1SQX H;  5LGU A;  3ZHU A;  2BCC H;  5ITZ B;  3WG7 B;  1ZLZ A;  3RGB A;  1TA8 A;  1FFX A;  4JV5 B;  1UPG A;  4NTW A;  1XRE A;  3FAV B;  3K5O A;  5IWA O;  4DR6 B;  1Y76 B;  3B8M A;  3ZN1 A;  2GHY A;  3W7U A;  1HNX O;  1GM9 A;  2H94 A;  2LGW A;  5L3F A;  2ZT9 B;  5CMU A;  3RW0 A;  2EJ7 A;  4JGS A;  3A2F A;  4O4J B;  1NTK H;  4L8J A;  2EIJ C;  5C8Y B;  4E4E A;  4FM1 A;  1WN7 A;  2P5O A;  4DR5 O;  3MHS C;  1CXZ B;  4JI6 B;  1VQ8 V;  5IT9 N;  2Q7G A;  2YIB A;  1XBL A;  3L9D A;  1K97 A;  1Q86 W;  3STL C;  1OZ0 A;  3CCL V;  5LXT B;  1MA1 A;  4JZG A;  5KX5 B;  2B9Z A;  4YJ3 B;  1OCO B;  1AI4 A;  2HVK C;  3AG7 A;  1JJO A;  4LBE C;  3G6E V;  4LF8 O;  1R3J C;  4MS2 A;  1V9P A;  1N33 O;  3TJT A;  4ZI7 B;  1TUE B;  4I55 A;  4K8X A;  4CH6 A;  4I5S A;  4XBF A;  4QJF B;  3WFV A;  1AJQ A;  5GON B;  2IU0 A;  1EZJ A;  1VQ5 V;  1MSW D;  1YTF B;  3MD0 A;  2HEP A;  2UXX A;  1M90 W;  3Q4H A;  2B1G A;  4JTC B;  1H2G A;  4KUM A;  4WBN A;  2PZS A;  3CC7 V;  5CA1 A;  2D2C B;  3F7Y C;  2DQ3 A;  2D3O W;  2P6J A;  3TK1 A;  4FLY A;  1J5E O;  2EZO A;  1RPR A;  3IGA C;  4LH6 A;  1MAB G;  3CRA A;  3FKS G;  1N0J A;  4X65 B;  1QBZ A;  2YUA A;  1HNW O;  3B4S A;  4JTD B;  2AZ2 A;  4JI5 O;  3B09 A;  4P9O A;  1I08 A;  4J7Z A;  1DF5 A;  1GM8 A;  1K92 A;  1YSC A;  2IBZ H;  3W7T A;  3SYA A;  5KMG B;  3CCV V;  4X64 B;  1R3I C;  4BW9 A;  3OTO B;  4GKJ B;  1MNG A;  3CCQ V;  2P67 A;  4H0L B;  1SA0 A;  4RUF A;  4PA4 A;  2KG7 A;  5JQG B;  1SET A;  2P7T C;  3B77 A;  2UUB O;  1TUB B;  2E76 B;  3CD6 V;  4ZHQ B;  2AW9 A;  4JAS A;  4EFB A;  4DUZ B;  4O2A A;  1F4N A;  3L73 H;  3K9A A;  4EB6 B;  2XT9 A;  1Q6U A;  2YID A;  3NXS A;  4P30 A;  1GH6 A;  1N0N A;  2DQ0 A;  3ZED A;  1QVF U;  4I4T A;  4JZ2 A;  1NI8 A;  3JD4 A;  5KHG A;  2JEU A;  1TGO A;  1V54 B;  2G38 A;  1NS1 A;  4TOI A;  3OMN B;  2UXD B;  2JJ2 G;  1MZF A;  4HAM A;  3JAL B;  4MVR A;  3FB8 C;  1PNM A;  2WLL A;  3ETD A;  3AG4 B;  4DR6 O;  3TXQ A;  5CBH A;  1IX9 A;  1BQ0 A;  3CRM A;  3X2Q B;  5L3D A;  4JI3 O;  3CMA V;  1PM9 A;  1JR9 A;  1SC5 B;  3JAK B;  3SPI A;  5KHI A;  2XHB A;  1ENV A;  1DK1 A;  4B3R B;  1JFF B;  4LFC B;  1W0K G;  4JI6 O;  2WLI A;  3ABL C;  1VQ9 V;  3P3N A;  1U96 A;  5TIS Z;  2Y4T A;  1F51 A;  4PHZ A;  4NXM B;  3PJS K;  3EVK A;  2ZIM A;  3K06 A;  2DJV A;  1BT8 A;  2UU9 B;  4WCE V;  1VQP V;  4DW1 A;  1RPO A;  3A0B Z;  1MG1 A;  1OCC C;  5LA6 B;  2PI4 A;  1EN4 A;  3E8B A;  3J7A U;  4R7C A;  4N21 A;  4AI8 A;  1AI5 A;  3GWO A;  2HLD G;  4JAA A;  2WPD G;  1DTO A;  1ZL8 A;  4LF4 O;  1Z5W A;  2IJK A;  3N2K B;  3AK3 A;  4D6T H;  5JH7 B;  1YDX A;  1V54 C;  3OMA B;  2YIB D;  1BHA A;  1GN3 A;  4DK1 A;  2HHH B;  1AB3 A;  3R65 A;  5IYZ B;  1EBO A;  4J80 A;  3UKM A;  1QNM A;  3AG4 C;  3ZX6 A;  1RP3 B;  4I0X B;  1VF7 A;  2H8P C;  4XDJ A;  4JI8 O;  2YEV B;  3X2Q C;  3JCU Z;  4YHH O;  1Y4M A;  1BZK A;  3ZS8 C;  1K9M W;  3HKD B;  4DR4 O;  3BVO A;  5J2U A;  4FM0 A;  2NN4 A;  2CAZ C;  4UVC A;  3ZMV A;  1B04 A;  4CH5 A;  2Y0I A;  1D5A A;  1VQK V;  5LBQ A;  4K3A A;  3OT7 A;  3L75 H;  4YJ2 B;  5FNV A;  5L3E A;  1H2L A;  4DR2 O;  1P4R A;  4LP8 A;  1QCE A;  3ASN B;  1HNZ B;  1IBM O;  3K03 A;  1DLB A;  2F1M A;  3T1H O;  4J11 A;  2KSD A;  1M56 B;  4X64 O;  4N23 A;  2ARH A;  1KEC A;  2OT5 A;  4NB5 A;  3DTU B;  4J9Z B;  3HR0 A;  5A9G A;  4LFB B;  3ZRV A;  4RQE A;  5EBM C;  1BMF G;  4WFF A;  4C7U A;  1FD9 A;  3A0R A;  4H44 B;  1J95 A;  2KB1 A;  4MVS A;  3AG2 B;  4O4I B;  4R8C A;  1FYJ A;  3HKC A;  2ZE7 A;  5EIB D;  5EBL C;  1S5H C;  4DUZ O;  4JI0 B;  3A0H Z;  5CB4 A;  1VQM V;  2JRI A;  2N04 A;  3E22 B;  3JD1 A;  5H6Q A;  5IJ0 A;  5EYP B;  4UUJ C;  5JJE B;  5CBG A;  3JAM N;  3HKE A;  3RYC B;  2YI9 A;  2BTQ A;  4DUY O;  1M1K W;  4MVZ A;  2ETN A;  4UFZ A;  1XMQ B;  3EXA A;  4PDL A;  2R9A A;  3H01 A;  5JJN B;  4LF7 B;  3K9S A;  2GV9 A;  1XIL A;  3FAV A;  4DYL A;  2WA3 A;  3EFF K;  4P9P A;  5LGT A;  3BA8 A;  3DXR A;  4NXN B;  4NKG B;  3NR7 A;  1YXB A;  2Q7E A;  2UXB O;  1B06 A;  2DMX A;  4GX1 A;  3K04 A;  5B1B C;  3T2M A;  4NTX A;  1QU7 A;  4FMT A;  2ZIN A;  4O4J A;  4X1I B;  3QTC A;  1US6 A;  3JSL A;  1EN6 A;  1A32 A;  1R6T A;  2QWP B;  1HDJ A;  1CPY A;  4FVM A;  3OW2 U;  3T4D A;  2B1I A;  1K7D A;  5KA5 A;  3T1Y O;  4NR1 A;  4WF9 V;  2DYR B;  1RM1 C;  1S5J A;  3SJQ C;  3CCU V;  1KD1 W;  5D5P A;  3RN4 A;  1TVK A;  1YF2 A;  2VS0 A;  4J42 A;  2DWD C;  2ILM A;  2OCC B;  4YJ3 A;  4DV0 O;  4B7K A;  4X66 B;  3MAQ A;  2UU9 O;  3GB7 C;  1N36 O;  1R6K A;  1PL4 A;  1L8D A;  4IHJ A;  4JAU A;  4Q6G A;  1XL4 A;  4ZI7 A;  1NH2 D;  2V4D A;  4LF5 B;  4RUE A;  1QHT A;  3BY6 A;  5HFL A;  3P3P A;  2FML A;  1GKF A;  2CDY A;  4LF9 O;  4YIP A;  1N34 B;  5GON A;  3KCX A;  5IJ9 A;  4J10 A;  1SQF A;  3CPW U;  3CCS V;  1YIJ V;  5KUM A;  1KKD A;  1H38 A;  3CJH B;  2V7Q G;  3GVM A;  4FK5 C;  2EIN C;  4P2Z A;  1Y6X A;  2ZD9 A;  1B6Q A;  3AG3 B;  5J9P C;  4QPJ A;  4FJC C;  3OD4 A;  2V1D A;  2UXC B;  2ZIO A;  3H9V A;  2ODM A;  3RYH B;  4MTO A;  4LWS B;  3SYQ A;  4F6R A;  2P4V A;  4U7O A;  2CE4 A;  2HKO A;  1VP7 A;  2PI5 A;  2QKC A;  3HKB B;  5EK0 A;  3JAS B;  4DV7 O;  1WP8 A;  4I50 A;  1JCH A;  4U3F H;  1NR7 A;  1ARO P;  2RMK B;  3CRQ A;  3RWR D;  3SPH A;  3OM3 B;  3ZIA G;  3CSX A;  2XND G;  1VIB A;  1WA8 A;  2CH7 B;  1YVW A;  2A06 H;  4D7T A;  2P90 A;  4TV9 A;  5B1A C;  4PJ0 Z;  4MTF A;  3A8T A;  1HNZ O;  3H1H H;  2F66 C;  1FXK B;  1TAE A;  4MVM A;  3VOU A;  2CTW A;  3TCU A;  1SZX A;  1YJ9 V;  2IH1 C;  2ZM6 B;  1KP3 A;  1M9N A;  2Z0A A;  4X1Y A;  5LHI A;  4X9Q A;  4FLX A;  2Q9L A;  4UCU A;  4LFB O;  2OWO A;  1Y74 B;  2F93 B;  3UQ8 A;  2R9I A;  1TUB A;  3VQV A;  5CN0 A;  4PA3 A;  2YIA A;  4DO2 A;  1F4M A;  3K5L A;  3CE2 A;  2RDC A;  2PYL A;  3SJB C;  4RQF A;  2Y0P A;  3JSN A;  4Q20 A;  4AQY B;  4PA9 A;  1IBK B;  1GN6 A;  5DEC A;  3K5N A;  2OYQ A;  1I7F A;  2ADP A;  1P49 A;  3LNN A;  2A7W A;  3I55 V;  2JIZ G;  3BAA A;  3CYO A;  2QM8 A;  4O2B B;  1THZ A;  4JYA O;  1ZAU A;  3JAR B;  5LP6 B;  1QLE C;  3ASO B;  4IYH A;  4ZKI A;  4TSF G;  1XI1 A;  1YEW A;  2RJZ A;  2Y69 B;  3IC7 A;  1P84 F;  4NXN O;  2QWO B;  1K34 A;  1KUQ A;  2EJR A;  4X1K B;  3KG2 A;  5IYB O;  4DV5 B;  5BMV B;  3JAK A;  1VQ4 V;  2UUA B;  2Q0O C;  2HVJ C;  2X7R B;  4BIU A;  1JFF A;  3ABK B;  1Q43 A;  3CCE V;  4ICG A;  2YXL A;  3E35 A;  4BIZ A;  3D36 C;  1XOU A;  4J7J A;  4UV9 A;  1ZWI C;  2VQE O;  4DV3 O;  5H5N A;  3ZRS A;  2DN9 A;  3CB2 A;  2ZXW B;  5IDJ A;  4AIL C;  2ZQM A;  5CBF A;  1H2N A;  5KAI Z;  1NU1 H;  1AR1 B;  2W6I G;  2ADQ B;  3WG7 C;  4LNU A;  3D3Q A;  1ZUQ A;  4R50 A;  1D5N A;  4O4H B;  1DF4 A;  3CEI A;  3FB7 C;  4O4L A;  3OFN G;  2C2A A;  3I56 V;  4TV8 B;  3OMI B;  4ZIB A;  1R1B A;  2IW5 A;  1YI2 V;  3JD3 A;  1N34 O;  3CXC U;  1S76 D;  3I5D A;  3LDD A;  2RQ6 A;  5H9C A;  1HR0 O;  3ZN0 A;  4MW8 A;  1D2D A;  2XAJ A;  2EBO A;  3SJA C;  3E8F A;  1NKD A;  5LP6 C;  5IYZ A;  3ABU A;  5LMU B;  2YSU B;  1L1F A;  3RT3 C;  1FJG B;  2QTS A;  2UXC O;  4H37 A;  2E5L B;  5KHH A;  4IYI A;  5B1O A;  4GKK B;  4MTG A;  4I0X A;  1YCI A;  2OIE A;  1SQB H;  2QKS A;  2OTJ V;  4B3T B;  3LDC A;  3ZHQ A;  1OCO C;  3JAT B;  1KBH A;  1URF A;  4MVQ A;  5FLX N;  1YIT V;  4LFA B;  4JI1 O;  1V55 B;  3FYI B;  3HKD A;  3C90 A;  1SS3 A;  4KL1 A;  4DRX B;  3MHH C;  2LFS A;  2HG5 C;  4OX9 O;  4LC1 A;  4FLW A;  3ABK C;  1IBL O;  5JVD B;  4K35 A;  2Z5U A;  1WPX A;  2Q7H A;  3H1J H;  1VQL V;  4CZZ A;  1YTF D;  1N32 O;  4YJ2 A;  3OEH G;  3THO A;  3SR2 C;  2FL4 A;  2ZNI A;  1VQO V;  2ZXW C;  3CWB H;  3EHB B;  4PI0 A;  3N2G B;  2OIG A;  3OUF A;  4MTX A;  2QWQ B;  5KLV H;  2HR3 A;  2XTA A;  2QR4 A;  2M7W A;  5LL6 Y;  2DYS B;  3L71 H;  4X88 A;  4GX5 A;  3WB2 A;  2VWK A;  3UT5 A;  4DR3 B;  3IFX A;  3CP1 A;  3TET A;  2MW2 B;  1H2K A;  4O4I A;  4HNA B;  1PKX A;  2YIC A;  4OPH A;  3K08 A;  3D3I A;  1NTM H;  4RAI A;  5EZY B;  4NYK A;  2EZP A;  4JV5 O;  4K0K B;  2N74 A;  4UXN A;  4OGQ B;  4WFE A;  1Q7Y W;  3F5W C;  2QSA A;  1ORQ C;  3O65 A;  4FLV A;  2YDE A;  1Q5O A;  2H3O A;  2F4V B;  5L3B A;  3ZMU A;  1IBK O;  1OHH G;  3E83 A;  1ZX3 A;  2EIK B;  3ETQ A;  2HP8 A;  3CC2 V;  3VQX A;  3APQ A;  4QGP A;  3ZRW B;  1JMK C;  3B8N A;  1OJH A;  1V55 C;  5K1P A;  4MVU A;  2JS5 A;  5LHG A;  2IU3 A;  2GDS A;  1G6U A;  3RYI B;  2EX3 A;  4MW3 A;  3B40 A;  2E3C A;  3FFQ A;  1UFI A;  2YXY A;  4KXR A;  4X20 B;  4DV5 O;  1NBM G;  2UUA O;  1PP9 H;  1HP8 A;  1W0J G;  3K58 A;  4Z1M G;  1G8M A;  2F95 B;  1SQQ H;  5LOV B;  1WJZ A;  5AG2 A;  1PL0 A;  1IUR A;  1M4U A;  2OTL V;  3Q4H B;  2NLJ C;  2XUM A;  3LSS A;  2JGU A;  4BIO A;  1XUQ A;  5JCO C;  2A9H A;  4WBN B;  1BHB A;  1WNS A;  5CA1 B;  4YIO A;  1XMO B;  1VF6 C;  1Q8I A;  3OGC C;  4DR7 B;  5J2T A;  3U0Z A;  4JI4 B;  1M93 A;  3LUT B;  1U97 A;  3APO A;  4PV1 B;  3S3W A;  3ML0 A;  2W0F C;  1ROP A;  3FB6 C;  2FYU H;  2GBO A;  2WLH A;  5FPR A;  3BAB A;  1M57 B;  1QLN A;  4PA7 A;  5EBW C;  3LNM B;  3AEI A;  4I9Q A;  1XHZ A;  3M8A A;  4X65 O;  2Y48 A;  4JI2 B;  1I5Y A;  5B1N A;  2P22 C;  3RYH A;  4LWS A;  3J81 N;  2ZE6 A;  4PI2 A;  4EEQ A;  1K4D C;  1S3J A;  1MOF A;  2ATK C;  4B3S B;  2E5L O;  3M7M X;  3OR6 C;  4FLU A;  4B3T O;  1SA0 B;  1NTZ H;  4H33 A;  3JAS A;  4EKW A;  5C93 A;  3OTO O;  4JYB A;  4GKJ O;  2OCH A;  3SPG A;  4DV4 B;  2RN9 A;  2DWE C;  4OXS A;  2JEX A;  1VAR A;  3AK2 A;  1NVP B;  2JDI G;  2DE0 X;  4O2A B;  3UO3 A;  1LUV A;  5B3S B;  3W7X A;  1BL8 A;  3CCR V;  2ZCE A;  4TUY A;  2EIL B;  3D36 A;  2AHZ A;  2LJ2 A;  5BZB A;  1XHX A;  4PEL A;  2L6L A;  1OCR B;  3BEH A;  4Z1V A;  3P30 A;  2WA4 A;  2CK3 G;  5E79 Z;  1Q6I A;  1K73 W;  2CTP A;  5GTI Z;  4DV6 B;  3QNE A;  1Y74 A;  4DK0 A;  1H8E G;  5IWA B;  1BS3 A;  5ITZ A;  2DW4 A;  2HJF C;  1HNX B;  2QM7 A;  2WLL B;  4HZ3 A;  2UXD O;  1FS0 G;  1AIL A;  1Y76 A;  1G1X B;  3KZI Z;  4F6E A;  4ABM A;  3CRR A;  2PYJ A;  4GCZ A;  3JD0 A;  1BQZ A;  4QNH B;  1P7B A;  1XNR B;  4TQF A;  5EC1 C;  3CHX A;  5C8Y A;  2X0L A;  2EIM B;  4O2B A;  1L0L H;  4Z2W A;  1GM7 A;  2WLI B;  4NTY A;  5LP6 A;  3BCC H;  3R66 A;  3CXH F;  3ASN C;  2XAH A;  1IXM A;  1AP5 A;  1GN2 A;  5KHK A;  4B3R O;  4LFC O;  2QM4 A;  1M56 C;  1AI6 A;  5LXT A;  5JWP A;  3BFR A;  1YHQ V;  4LF8 B;  3W7S A;  4NXM O;  2LGQ A;  5KX5 A;  3OAA G;  1VEW A;  4JPR A;  2QEX V;  3G71 V;  4UCR A;  4JAV A;  3AG2 C;  1GRJ A;  4PDR A;  5LYJ B;  4GLX A;  1SQG A;  3G6B A;  1FXH A;  4B7E A;  2EIL C;  1CEZ A;  2NNU A;  3L70 H;  3QVN A;  2CTR A;  5CA0 B;  1K4C C;  4CS3 A;  1W59 A;  4FLZ A;  3ZCC A;  3QO7 A;  3G67 A;  4GX0 A;  4GYC B;  4WFB V;  1J5E B;  1MSD A;  1H2M A;  1WP7 A;  1XMO O;  3T1C A;  3SPJ A;  4JF3 A;  1BSM A;  3WB1 A;  2HHH O;  4CH3 A;  2ZE8 A;  2XAG A;  3WB0 A;  4TV8 A;  2X6B A;  2UXN A;  1HNW B;  4DV2 B;  3KCY A;  4FFB B;  5KUK A;  2W6J G;  3DC6 A;  1NQT A;  3JCZ A;  2Q67 A;  1JQ0 A;  2EIM C;  3K57 A;  4MVO A;  2CGO A;  2K1E A;  2Q4P A;  4LCU C;  3M99 B;  3UM7 A; 
#chains in the Genus database with same CATH homology
 1ENV A;  3W7W A;  1JVM A;  1DF4 A;  3FB7 C;  4J9Y B;  1W0K G;  3OE7 G;  3OFN G;  2DYR C;  2C2A A;  3I56 V;  4GT1 A;  2WLI A;  3ABL C;  1K5S A;  2QE7 G;  1VQ9 V;  1JX9 A;  1K33 A;  3OMI B;  1F51 A;  1M57 C;  4BAY A;  2IW5 A;  1YI2 V;  1NH2 B;  2OCC C;  3PJS K;  3JD3 A;  3K06 A;  3CXC U;  1KC8 W;  1S76 D;  3LDD A;  5H9C A;  4F4L A;  4WCE V;  3ZN0 A;  1VQP V;  1EFR G;  4MW8 A;  2XAJ A;  2EBO A;  1RPO A;  2EIN B;  3E8F A;  1MG1 A;  1AJN A;  1NKD A;  1OCC C;  4R6Z A;  3ABU A;  2LP7 A;  2YSU B;  1L1F A;  2PI4 A;  3E8B A;  3QO5 A;  4R7C A;  2BOC C;  2AHY A;  4H37 A;  4N21 A;  3E89 A;  4XDK A;  2XAF A;  5B1O A;  1AI5 A;  4MTG A;  4PDV A;  3GWO A;  2HLD G;  2QKS A;  4DXW A;  2IH3 C;  2OTJ V;  2WPD G;  3ZMS A;  3LDC A;  1OCO C;  1QVG U;  1DTO A;  4MVQ A;  1YIT V;  5EC2 C;  1AI7 A;  1V55 B;  3FYI B;  2IJK A;  3HB3 B;  4G2K A;  1NVP D;  3AG3 C;  3E8H A;  3K0G A;  4MSW C;  1V54 C;  3MHH C;  2LFS A;  2HG5 C;  3OMA B;  3SYC A;  4LC1 A;  5DN6 G;  1BHA A;  3ABK C;  1CP9 A;  5L3G A;  3R65 A;  1EBO A;  2Z5U A;  4WFH A;  4UVA A;  1WPX A;  3CCM V;  2XOK G;  3HPL C;  3UKM A;  5B3S C;  1VQL V;  4CZZ A;  1YTF D;  1K3E A;  1VQ6 V;  3AG4 C;  1GO3 F;  3OEH G;  3ABT A;  2ITC C;  2X6C A;  2MK3 A;  1VQO V;  2H8P C;  2ZXW C;  1HWY A;  3EHB B;  4UV8 A;  4XDJ A;  4PDM A;  2YEV B;  1OCR C;  3OEE G;  4HYO A;  3X2Q C;  5B1A B;  3OUF A;  1Y4M A;  4ZBM A;  4MTX A;  1K9M W;  1N8R W;  1H8H G;  2HR3 A;  3E2E A;  1XL6 A;  2M7W A;  4YXW G;  3K79 A;  2DYS B;  4X88 A;  4G28 B;  4GX5 A;  4UVC A;  4MT8 A;  3ZMV A;  2JK5 C;  1SES A;  3IFX A;  3CP1 A;  4WFG A;  3TET A;  4U7N A;  5LBQ A;  1VQK V;  2WWW A;  3QO8 A;  3STZ C;  1KQS U;  2WAM A;  1PKX A;  4QE9 A;  5L3E A;  3K08 A;  4KFM A;  1P4R A;  3D3I A;  4RAI A;  4LP8 A;  3ZRW A;  1QCE A;  3ASN B;  2EZP A;  1FXK C;  3K03 A;  1DLB A;  4UXN A;  2WLK A;  4WFE A;  1M56 B;  1Q7Y W;  4TT3 G;  1S0V A;  4N23 A;  3F5W C;  1KEC A;  2OT5 A;  1ORQ C;  5IYD O;  2F43 G;  4KP4 A;  3ZMT A;  3DTU B;  2IJH A;  4J9Z B;  5L3B A;  4JTA B;  3ZMU A;  1W2B U;  3ZRV A;  4RQE A;  5EBM C;  1BMF G;  4WFF A;  1OHH G;  3E83 A;  3A0R A;  2X6A A;  4ASU G;  2XAS A;  2GSM B;  2EIK B;  1VQ7 V;  1J95 A;  2EIJ B;  3CC2 V;  2KB1 A;  4MVS A;  3AG2 B;  3E86 A;  4R8C A;  2ZR3 A;  4RO2 A;  1QLE B;  4CBC A;  3ZRW B;  5EBL C;  1S5H C;  3B8N A;  4X89 A;  1V55 C;  3LDE A;  1VQM V;  2WSS G;  3JD1 A;  5H6Q A;  3SYO A;  4MVU A;  4WFA V;  4UUJ C;  5LHG A;  5CBG A;  1Q81 W;  2IU3 A;  1R3L C;  3DGE A;  1M1K W;  4MW3 A;  4MVZ A;  1K8A W;  4L87 A;  4QPK A;  4I9W A;  5HFM A;  4PDL A;  2QA4 V;  1NBM G;  2B5U A;  3H01 A;  3ASO C;  2WLJ A;  2ZDI A;  5L3C A;  3G4S V;  1SER A;  2WLM A;  1W0J G;  4Z1M G;  3VBB A;  1G8M A;  3EFF K;  3JYC A;  4P9P A;  5LGT A;  1OCZ B;  2Y69 C;  1NR1 A;  1PL0 A;  3OR7 C;  4X8A A;  1FXV A;  1Q82 W;  1R6N A;  2YEV A;  2OTL V;  2JJ1 G;  1E1Q G;  2NLJ C;  3LSS A;  3K04 A;  4GX1 A;  2XAQ A;  5B1B C;  3T2M A;  1NJI W;  2A9H A;  4FMT A;  1BHB A;  5CA3 A;  2HFE C;  2IJJ A;  4XDL A;  1R3K C;  5LGU A;  3OGC C;  1GK9 A;  3WG7 B;  3JD2 A;  1CPY A;  5E1A C;  3RVZ A;  3OW2 U;  3T4D A;  2B1I A;  3LUT B;  3RVY A;  1JPX A;  1K7D A;  2A0L A;  5KA5 A;  3ML0 A;  2W0F C;  2ZR2 A;  1COW G;  1R73 A;  1ROP A;  4WF9 V;  2DYR B;  1RM1 C;  3ABL B;  3SJQ C;  1YJW V;  3FB6 C;  3CCU V;  3B8M A;  3ZN1 A;  1KD1 W;  2GHY A;  2WLH A;  3W7U A;  1GM9 A;  1M57 B;  2BOB C;  3AG1 B;  4PA7 A;  2H94 A;  5EBW C;  2DWD C;  1S77 D;  1QLN A;  3ZJZ A;  2OCC B;  5L3F A;  3LNM B;  3AEI A;  3RBZ A;  5CMU A;  3RW0 A;  3GB7 C;  4JGS A;  3FB5 C;  1R6K A;  4G27 B;  2EIJ C;  2Y48 A;  3ZMZ A;  4JAU A;  1I5Y A;  1OCC B;  3MHS C;  5B1N A;  1XL4 A;  5H6R A;  1NH2 D;  1VQ8 V;  4RUE A;  1K4D C;  3BY6 A;  5HFL A;  1S3J A;  1FFT B;  1K97 A;  1MOF A;  1GKF A;  2Q68 A;  3STL C;  1Q86 W;  1OZ0 A;  2ATK C;  2WLN A;  3CCL V;  2A79 B;  3OR6 C;  3ZRX A;  3CPW U;  3CCS V;  1YIJ V;  1KP2 A;  5KUM A;  1KKD A;  2LFR A;  1H38 A;  1VQN V;  1OCO B;  1AI4 A;  2V7Q G;  4H33 A;  4FK5 C;  2EIN C;  4P2Z A;  2HVK C;  4EKW A;  5C93 A;  5LGN A;  1Y66 A;  4JYB A;  4LBE C;  3G6E V;  3SPG A;  2DWE C;  2ZD9 A;  1B6Q A;  1R3J C;  3AG3 B;  5J9P C;  4MS2 A;  1PD3 A;  4QPJ A;  4FJC C;  2JEX A;  4OXS A;  2V1D A;  2R9R B;  1NVP B;  4MTO A;  1TUE B;  2JDI G;  3SYQ A;  1JOY A;  1OCZ C;  5B3S B;  4U7O A;  3W7X A;  1BL8 A;  2HKO A;  3CCR V;  4I5S A;  4XBF A;  4QJF B;  3WFV A;  1AJQ A;  1LNQ A;  2IJI A;  2IU0 A;  1EZJ A;  1VQ5 V;  1MSW D;  1YTF B;  2PI5 A;  2EIL B;  3D36 A;  2AHZ A;  3MD0 A;  5BZB A;  1GMG A;  3ABM B;  4PEL A;  1OCR B;  2UXX A;  3BEH A;  5EK0 A;  3P30 A;  1M90 W;  2B1G A;  2CK3 G;  3SPC A;  4GX2 A;  4JTC B;  3SYP A;  1K73 W;  1H2G A;  1SRY A;  4KUM A;  2ZDI C;  1JCH A;  3QNE A;  5FL7 G;  3CC7 V;  1NR7 A;  4PA6 A;  3F7Y C;  2DQ3 A;  2D3O W;  1ARO P;  1H8E G;  2P6J A;  3TK1 A;  4UVB A;  3SPH A;  2FTK A;  2EZO A;  2DW4 A;  3OM3 B;  2HJF C;  3ZIA G;  2QM7 A;  1RPR A;  2XND G;  4QE7 A;  4BW5 A;  3AG1 C;  2WLL B;  4HZ3 A;  5IY5 B;  1JJ2 U;  3IGA C;  1FS0 G;  2P90 A;  1MAB G;  5B1A C;  4MTF A;  3FKS G;  1E1R G;  4FPP A;  1QBZ A;  1FXK B;  4JTD B;  4MVM A;  3VOU A;  4P9O A;  2Z3Y A;  2DYS C;  4GCZ A;  3JD0 A;  3CCJ V;  3TCU A;  1P7B A;  4QNH B;  1YJ9 V;  1K5Q A;  3T4Z A;  2IH1 C;  1G4Y B;  5EC1 C;  1KP3 A;  1M9N A;  1DF5 A;  5LHI A;  2ITD C;  4JYC A;  1GM8 A;  2X0L A;  1K92 A;  2EIM B;  1GM7 A;  1YSC A;  2R9I A;  2WLI B;  5CN0 A;  3W7T A;  3LSQ A;  3SYA A;  3F7V C;  4PA3 A;  4DO2 A;  3ASN C;  2XAH A;  1F4M A;  1IXM A;  1S72 V;  2QTO A;  3CCV V;  1M56 C;  1YJN V;  1AI6 A;  1QR9 A;  4RQF A;  1R3I C;  1YHQ V;  3CCQ V;  2P67 A;  4Q20 A;  3W7S A;  4FIP C;  2Q6A A;  4PA9 A;  2Q69 A;  4RUF A;  3K3W A;  5GW7 A;  1I5X A;  3OAA G;  3ETE A;  4JPR A;  4PA4 A;  2QEX V;  3G71 V;  1SET A;  1WLE A;  2JIZ G;  3CYO A;  2EIK C;  3I55 V;  2QM8 A;  3K0D A;  4JAV A;  2P7T C;  1THZ A;  1E79 G;  3AG2 C;  3B77 A;  4PDR A;  3CD6 V;  1FXH A;  1QLE C;  3ASO B;  4JAS A;  1QR8 A;  2EIL C;  1CEZ A;  1F4N A;  3P32 A;  2NNU A;  4ZKI A;  3ABM C;  5LHH A;  4TSF G;  1PNK A;  4TWK A;  3K9A A;  5KA6 A;  1SZT A;  2Y69 B;  3IC7 A;  3NXS A;  4P30 A;  1K4C C;  2DQ0 A;  1K34 A;  3ZCC A;  3CME V;  2EJR A;  1QVF U;  1GTO A;  3QO7 A;  3FYE B;  3KG2 A;  3ETG A;  5IYB O;  4GX0 A;  4WFB V;  5B1B B;  3JD4 A;  1VQ4 V;  2HVJ C;  4E2L A;  2JEU A;  1AJP A;  1V54 B;  2X7R B;  3SPJ A;  4JF3 A;  3T1C A;  4BIU A;  3OMN B;  3ABK B;  5IY5 C;  3CCE V;  2JJ2 G;  4HAM A;  2XAG A;  3E35 A;  4QIW F;  5DM6 V;  4MVR A;  4BIZ A;  1F23 A;  2X6B A;  3FB8 C;  2UXN A;  4UV9 A;  1PNM A;  2WLL A;  3ETD A;  3AG4 B;  1RM1 B;  5IYC O;  1ZWI C;  5CBH A;  5KUK A;  2W6J G;  1FXK A;  1NQT A;  3JCZ A;  3ZRS A;  2Q67 A;  1JQ0 A;  3CC4 V;  5IDJ A;  2ZXW B;  3X2Q B;  5L3D A;  2EIM C;  2ZQM A;  1PNL A;  4MVO A;  5CBF A;  3CMA V;  1AR1 B;  2W6I G;  2K1E A;  3OUS A;  3WG7 C;  1UJW B;  4LCU C;  3E8G A;  3M99 B;  3SPI A;  4R50 A;  3UM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...