3K08A

Crystal structure of cng mimicking nak mutant, nak-ntpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k08A00
5CBGA 3TETA 4CBCA 1LNQA 5CBFA 4HZ3A 3SJQC 4DXWA 3SPGA 4F4LA 4P2ZA 2Q69A 4XDKA 4ZBMA 5B1BC 1M56C 2X6AA 3ABMC 4GX2A 4UUJC 3SPHA 3E83A 3E8HA 2QKSA 4RO2A 2Q6AA 4OXSA 3AG4C 3R65A 1V55C 3SPJA 5IY5C 4P9OA 4BW5A 2Y69C 5J9PC 2DYRC 1OCOC 1ZWIC 3JYCA 2NLJC 4QE9A 3LDEA 4MSWC 4PDLA 2AHYA 1G4YB 3K06A 5E1AC 4MVRA 1OCRC 3SYQA 5BZBA 3WG7C 2H8PC 3RBZA 2WLMA 3OGCC 4R7CA 1V54C 3K08A 2EINC 3EFFK 2EIJC 4MVUA 4LCUC 3UM7A 2DWDC 4MTGA 3RVZA 3SPIA 4GX0A 4KFMA 4MVSA 4H33A 5EK0A 2ZXWC 3LDCA 5KUMA 1R3KC 3E8FA 4RUEA 3UKMA 4PA4A 5EC2C 3VOUA 2P7TC 1J95A 4R50A 4PA6A 4PA3A 3STLC 1XL4A 3E8BA 4G27B 2EIKC 3LNMB 3PJSK 4GX1A 5EBWC 1R3LC 4EKWA 1R3JC 2A79B 3FB8C 3OR6C 2WLLB 4MTFA 1KKDA 1ORQC 3T2MA 4MW8A 5EBLC 4WFGA 2BOCC 2EILC 2W0FC 4LP8A 4MS2A 2Q67A 3OR7C 3AG1C 3STZC 2KB1A 3F5WC 4QE7A 1M57C 2WLJA 3IGAC 1OCCC 3E89A 4MVQA 4R6ZA 2JK5C 2ITDC 2DYSC 2K1EA 3AG3C 4HYOA 4QNHB 2HVJC 2IH3C 2OCCC 4PDVA 4PA9A 4X89A 1K4DC 1XL6A 3K0DA 3SPCA 3T1CA 3F7YC 4J9ZB 3ZJZA 5EC1C 2WLNA 4R8CA 1JVMA 4P30A 5CBHA 1S5HC 2R9RB 3E8GA 3ABLC 4JTDB 2HG5C 2BOBC 3IFXA 4H37A 4PA7A 2X6BA 4MW3A 2ATKC 3OUFA 1OCZC 4XDJA 3FB6C 3AG2C 3KG2A 4JTAB 3SYCA 2WLLA 4X8AA 3SYAA 4WFHA 5EBMC 4WFEA 2AHZA 2ZD9A 5B1AC 2WLHA 2HJFC 1K4CC 2ITCC 3ASOC 4J9YB 4MTOA 4P9PA 3BEHA 3RVYA 2X6CA 3TCUA 2EIMC 2WLIA 5B3SC 4MVMA 2WLIB 3FB7C 3GB7C 1R3IC 1BL8A 2HFEC 3LUTB 4XDLA 3SYPA 3T4DA 3F7VC 3T4ZA 3K0GA 4X88A 3SYOA 4G28B 3HPLC 2DWEC 2QTOA 4LBEC 3ABKC 3LDDA 3OUSA 2A0LA 3FB5C 3K03A 5KUKA 3E86A 3ASNC 3ZRSA 2YEVA 4JTCB 4TWKA 2HVKC 2WLKA 4GX5A 1P7BA 4I9WA 4MVOA 2A9HA 4RAIA 4RUFA 1QLEC 4WFFA 3K04A 4PDRA 3X2QC 2IH1C 2Q68A 3RW0A 4MVZA 4PDMA
chains in the Genus database with same CATH superfamily
3B8NA 1ZL8A 3SJQC 1W0KG 4QJFB 2OTLV 2JRIA 2PY5A 3ABMC 2ZQMA 5C8YA 3E8HA 3AK3A 1RFYA 1BT8A 4WFBV 1Y74B 1ZAUA 2YIBA 1UFIA 1XNQB 4CH5A 3CCMV 2CUGA 4JF3A 3HB3B 4GLXA 2Y4UA 1R1BA 1US6A 2QWOB 5LYJB 3THOA 4L87A 2UXDB 3W7TA 5BY1A 1RM1B 3CRMA 2ZXWC 1AR4A 5H6RA 1BZKA 4CS2A 5EBWC 1YDXA 4B3TB 4FFKA 4NXNB 1HNWB 3EHBB 2Q73A 2WLLB 4MW8A 3DXRB 3TJTA 5HFMA 3ZMZA 3M8AA 5KMGB 1OCCC 3E89A 4BR6A 4I9QA 1YCIA 2OIEA 3T1CA 3ZJZA 4J80A 5CBHA 4HNAB 2W6JG 4JI8O 1SERA 2ZNIA 1KYOF 4BIZA 4LF8O 5EBMC 1KU9A 5L3EA 1ZL8B 4LF9O 1XNRB 1JFFA 1NU1H 4B08A 3RVYA 1VMGA 1M93A 4XDLA 1BL8A 2OCHA 5C8YB 4LWSA 3HPLC 5KUKA 3G80A 4WFAV 3Q4HA 1BS3A 2JGDA 1B6QA 2ZDIC 1OCOB 4JI0B 1K34A 5CA1A 5IYZA 2ADQB 3P32A 1GH6A 4H44B 1SESA 5IJ0A 5LHGA 4TSFG 3J7AU 4K8ZA 1MABG 1WB8A 4OXSA 1J5EO 1V55C 1Q6IA 3PN1A 4LFBO 2DYRC 3IJ4A 5EYPA 3K06A 1I08A 2OT5A 3OT7A 4OX9B 2PZSA 4QPKA 2EBOA 2L6LA 2Q4PA 3MAQA 3OGIB 4A5UB 4BAYA 3H1LH 1IZ3A 1FFTB 3JSNA 4YY3B 3OMIB 4DR7B 4NXMB 2YDEA 4X65B 5LMUO 1GRJA 2N04A 3ETEA 1Y67A 4JI4B 2EJRA 3T1YB 2P06A 1L0LH 4JI7B 4BWAA 5H2FZ 2XHBA 1JFFB 3B4SA 3ZMUA 3OR7C 4GZRB 3IGAC 1FFXA 2JK5C 4B7EA 2XAHA 1K4DC 4LWSB 3ABKB 5LGNA 2P5OA 5CA3A 4B3RB 2ATKC 4XDJA 2QM7A 3Q4HB 2JGDB 4UCSA 1NQTA 2Q0OC 4JYBA 1QBZA 1SC5B 2WSSG 3L72H 2QR4A 4WFHA 5CA1B 5IYZB 3CC2V 4YHHB 1VQKV 5KHGA 2X6CA 1N4CA 2YI9A 3D3IA 5B1BB 4NTYA 1Q8IA 2ODMA 5IJ0B 2PGGA 3L73H 4GKKB 1SQXH 2EULA 3L74H 1WP8A 3K58A 1AI7A 3CMEV 4TV8A 1TAEA 4TQDA 1YVWA 4UV9A 3T1HO 2CTRA 4RUFA 1QLEC 4Q6GA 2EILB 5EYPB 3TETA 3CCUV 3K5MA 5IT9N 1Q43A 4DUYO 2WPDG 1D5NA 3TK1A 1WPXA 2PUSA 1VF6A 4YXWG 2OYQA 5JJJB 2JIZG 3K5OA 1MOFA 3JAWA 2JEUA 5J9PC 2NLJC 3LDEA 1DLBA 4EFEA 1VQMV 1DGSA 2GHYA 4QPJA 1Q7YW 2H8PC 4WBNA 1XHZA 3K08A 1Z2GA 1W59A 1ZLZA 1FFXB 4LCUC 3G4SV 3AG3B 3G6BA 1YJ9V 4W4KA 2PTMA 3U10A 2VRZA 3VQXA 2QGNA 1HNZB 2PYLA 2JS3A 3AK2A 4MTFA 3ZMTA 1K33A 3M7MX 3RGBA 2YXHA 5B1AB 3JSLA 1GN3A 4LF5O 5DECA 3ZN0A 3F5WC 2UUBO 4MVQA 2ZE6A 4FM1A 2HVJC 3MHHC 1XL6A 4J9ZB 1IBKO 1KC8W 1NKDA 4TV8B 1HNXB 5FNVA 3SYCA 3OAAG 2Q0AA 3DC6A 4LH6A 1NI8A 5FL7G 4GUNA 1WAZA 4CH6A 1B06A 5CA0A 4JZGA 3GB7C 1M56B 3IC7A 1BE3H 3OTOO 2DOSA 4X88A 4DV5O 1XOUA 1NR1A 4LBEC 2R70A 5LHHA 4DV4B 5A9GA 4RWUA 4TWKA 2HVKC 3CCSV 2WLKA 3JAWB 4CC6A 3BHPA 4JAAA 1QVGU 1SKVA 4WBNB 5GTIZ 3VBBA 4K0KO 1SRYA 2EJ7A 4IGGA 4X64O 3BA8A 1XEQA 4UCOA 3BAAA 4W4LA 1FJGB 3ZRVA 3K3WA 2X0LA 4P9OA 1ZWIC 3B40A 3OTFA 4JI6O 3SDLA 5E1AC 1G4YB 4DV7B 4PI2A 1AR5A 5H5NA 2E5LO 2WLMA 3OGCC 4R7CA 3UM7A 2RNBA 3RVZA 4MVSA 2D2CB 4K35A 5KUMA 1H2NA 2OTJV 2X7RB 1SQGA 2A06H 1J95A 4PA3A 5FNVB 5IWAO 3GWOA 2GTAA 5LMNB 4B3SB 2AGAA 4WFGA 2BOCC 1SQQH 2KKWA 4LF5B 4EFBA 2Q67A 2UUCB 3HKCA 3AG1C 4ZIBA 3ETGA 5CA0B 4DR1O 1AI4A 2N74A 4LF6O 3F7YC 4B3MB 4R8CA 5DM6V 1E79G 3ABLC 1KBHA 3K9AA 2ZDIA 2EZOA 3QTCA 1AR1B 3C3SA 2BCCH 2MW2B 3L9DA 3L71H 4DW1A 1IXMA 2W0XA 5KHIA 4MTOA 1K4CC 2ITCC 3K5NA 3OD4A 1XREA 1PV0A 1QNMA 5FLXN 2WLIB 3SYPA 3T4DA 1GO3F 3F7VC 3S3WA 5JCOC 5IDJA 3ZN1A 4IIJA 3N2GA 4U7OA 4JV5O 1M90W 2LP7A 1I94B 4IYHA 2Y69B 1Q3EA 4RQEA 1H2SB 4PDMA 2ETNA 1NJIW 1JPXA 2NN4A 1DF4A 3BFRA 4UCVA 1YXBA 3SPHA 4PD4F 1YZBA 1A32A 2BSKA 3ZS8C 1EN6A 3FYEB 4JYAO 4NVPA 5D5QA 1EZJA 4IL6Z 1AJNA 3RN4A 1PNKA 4MSWC 2QWNB 1OCRC 2Q7HA 3HKCB 5LHIA 4FK5C 4KFMA 2A7WA 4FFBA 2Q5ZA 3M99B 4R50A 2LW7A 3CMAV 1K73W 1XNQO 3B77A 4EKWA 4I50A 4FM0A 3H1JH 2B1GA 1ZTEA 5L3DA 1VQ4V 4O4IA 1SA0A 2UXDO 4H0LB 4L8JA 2QE7G 4F6RA 4DYLA 2YIDA 4IIJB 5EC1C 1VF7A 1TA8A 4HAMA 2X6BA 2Q8VA 5ITZA 1OCZC 2V1DA 3JCZA 4LF4B 4FIPC 4Q20A 4B3TO 4NXNO 1HNWO 1SETA 4H13B 2V7QG 1R6KA 3W7SA 3WB0A 3BEHA 1S76D 2IW5A 3ABTA 3TCUA 1SQVH 4ZHQA 1K5SA 3D36C 4O2AA 1HDJA 5B1OA 1GKFA 2AXTZ 4U7NA 5JQGA 2P6JA 1RSOA 3LDDA 3SJAC 4DV3B 2VQFO 2YEVA 4LH7A 2PYJA 3I55V 2UU9B 5LBQA 4D7SA 4MVZA 5BR8B 4FMTA 1LNQA 1N32B 4DXWA 1FKAO 4DR2B 1XNRO 2CH7A 2EINB 1D2DA 1P49A 4GX2A 1EZVH 3E83A 4ZOLA 1X4TA 4FFBB 2XOKG 2CE4A 2FTKA 5K1XA 3F5TA 2HR3A 1ZX3A 3DGEA 4JYAB 4I50B 4JI2B 4NB5A 4JI0O 5KAFZ 1I5XA 2Z0AA 4O4IB 1L1FA 1SA0B 1M57B 4DR5B 1U96A 2AW9A 1Y6XA 4F6RB 2E76B 5B66Z 3UKMA 4OPHA 5H6QA 3CCLV 5ITZB 3ZRXA 2Z5UA 5EZYA 2HHHB 2WA3A 1HW7A 4QIWF 1VEWA 1XUQA 3ASOB 4OX9O 4ZI7A 1NTZH 3FX7A 2KSDA 3UO2A 3MDSA 4ZHQB 1E1QG 1HWYA 4O2AB 1AJPA 1FXKB 4YJ2A 1GM8A 2QWPB 4FZ1A 5JQGB 4YY3O 4NXMO 1RSOB 4DR7O 4KHPO 4X65O 2Q9LA 5IJ9A 4H37A 4MT8A 2YEVB 1SZTA 3AG2C 4JI4O 5LGUA 1AROP 1M1KW 2MK3A 3T1YO 4J9YB 4JI7O 2HEPA 3L75H 3AG7A 3QO5A 5B3SC 4DV2B 4MVMA 2NR5A 2F23A 2CDYA 3K0GA 1VIBA 1F4NA 3ZMSA 3LSQA 2A0LA 2VQFB 4XBFA 4B3RO 1RPRA 1QQCA 2IH1C 3RW0A 1YJNV 2UUAB 1COWG 4FJCC 2Q69A 4TUYA 4JAUA 4YHHO 2EIJB 2XT9A 2X6AA 2XAFA 4KUMA 1KECA 4DV6B 4GKKO 5FPRA 2Q7GA 3ZEDA 1DF5A 2EIKB 1FYJA 1N0JA 4KXRA 1SQBH 1NTMH 1XBLA 5EZYB 1UPGA 1GM9A 3P3NA 2YXLA 4PDLA 1L0NH 4ZI7B 1WPBA 1M4UA 3BABA 4UB6Z 5GONA 1H8HG 2R9AA 3QF7A 1FD9A 4YJ2B 4O4LA 1XMQB 5IJ9B 4JYYA 3LNMB 5JWPA 3FB8C 1YITV 2QWQB 2E75B 3ZHRA 2L35A 2P4KA 1YHQV 3CCRV 1K3EA 2YI8A 1FPOA 1IBLB 2IH3C 1LUVA 5L3CA 4KHPB 4P30A 1JJOA 1K9MW 1TGOA 1XILA 4JASA 4PJ0Z 1HNZO 4X8AA 5LP6C 2ARHA 3SR2C 1OV9A 2RQ6A 3CP1A 3DC5A 2F43G 4TUYB 2JGUA 2HFEC 1PM9A 4U3FH 3NR7A 2DWEC 1P4RA 5EIBC 3RYCA 5BXZA 1KD1W 1HR0B 1AI6A 1FXHA 2VWJA 5BMVA 3B2EE 3R66A 3E86A 3RT3C 1HNXO 2DQ0A 1BQ0A 3CCEV 4LNUA 4MTXA 1LR1A 4HZ3A 4E4EA 3WG7B 1DK1A 4YIPA 4AI8A 5KAIZ 1EFRG 1V54B 5GONB 1EBOA 2UXCB 3KZIZ 1WB7A 4O4LB 2Z3YA 1JX9A 4DV4O 1MA1A 2Y48A 1VQNV 4LFCB 1M9NA 2KQXA 2V4DA 1VQPV 4MVRA 2RDCA 2B9ZA 2P4VA 4K3AA 2IJJA 4MVUA 3S3XA 4FLWA 2DYSB 4JYCA 4H33A 3A0RA 2ZR3A 1R3KC 3E8FA 4RUEA 1FJGO 1P7GA 3P3PA 1XL4A 4NTWA 4O4JA 1R3LC 3TXSA 1Q6HA 3VQYA 4I0XA 5KHHA 5JJNB 3JD0A 4DV7O 2IU3A 1Y4MA 2EIMB 2KB1A 5HFLA 3D36A 4X62B 5LA6A 2LW1A 1BMFG 3K0DA 3ZHQA 1ROPA 1U97A 3RYCB 4DUZB 1BCCH 5BMVB 3E2EA 3CXCU 2JJ1G 3JD3A 3H1KH 1GM7A 5B5EZ 4LNUB 1NVPB 4WFEA 1IDSA 5LMNO 4B3SO 2GDSA 1N33B 2UUCO 1NR7A 3JAMN 2XAGA 4CH3A 3APOA 1OJHA 3K9SA 4B3MO 1QHTA 4J7KA 3ZRSA 4YJ3A 1R6TA 2FL4A 4QE9A 2ZE8A 4CBCA 4X9QA 3SPGA 4ZBMA 4UVBA 4UCUA 3HKDA 1AP6A 1ZUQA 5LGTA 1NBMG 4UV8A 1H2GA 3CWBH 4DR6O 1FAFA 4O4JB 2QKAA 1I94O 4J10A 1WLEA 1OCOC 4DRXA 1NVPD 2OWOA 2XAJA 4I0XB 1Q86W 4HBNA 1XI1A 3SYQA 5BZBA 3D8CA 1Z5VA 1H2LA 4AQYB 2EX3A 4JI1O 1N0NA 3EFFK 2YICA 4EEQA 5LA6B 2O57A 2YC0A 4WF9V 1FS0G 5KX5A 1KP3A 2VQEB 2B1IA 1S77D 2RN9A 4AHCA 3OR6C 3JD1A 3SJBC 1ORQC 3CB2A 4QGPA 3LNNA 1I5YA 4QE7A 4R6ZA 3SGIA 1GAXA 1JVMA 1O9GA 3IFXA 4MW3A 4FLXA 1GN2A 3FB6C 4YJ3B 4NR1A 2ZIOA 4ASUG 3H9VA 3RYHA 2H94A 4BIUA 3HKDB 3ABMB 3RYIA 5JJEB 4JI5B 3ABKC 2B5UA 4CZZA 2QWRB 1K92A 5AG2A 3JATA 2Q68A 4DRXB 4LF4O 1NH2D 1Z5WA 1DTOA 5CBGA 2P67A 4DV1B 1Y66A 4EB6A 2Y0IA 4D7TA 1XDCA 5B1BC 1H38A 4IYIA 1IVSA 4JPRA 2ZXWB 2A3QA 4DR6B 3JALA 2UXBB 4DV3O 3JASA 3W7XA 2QEXV 2ZKOA 4C7UA 3A8TA 3K5LA 3CC7V 2UU9O 1N36B 3H01A 3JD4A 5BR8O 1N32O 3WU2Z 4ZKIA 2WAMA 4DR2O 4JI1B 2RJZA 1OCCB 1THZA 2HLDG 3SPIA 1WP7A 1WN7A 3E35A 4PA4A 3VOUA 5LXTA 4N23A 3PJSK 4NYKA 3WFVA 1K5QA 3JD2A 1F23A 1O9HA 1KKDA 4JI2O 2QTSA 3LSSA 1N34B 1YIJV 3A0HZ 3RYHB 3MD0A 5JH7A 2QM4A 1IURA 2PF4E 4JI3O 1NZ6A 4DR5O 3AG3C 4QNHB 3VQWA 3RYIB 2W6IG 1NT2B 5JVDA 3OUFA 2CTPA 4DV0B 5K1PA 1OZ0A 3JATB 2DN9A 5B1AC 3K79A 2HHHO 4EB6B 4X1KA 2CK3G 2PI4A 1WA8A 4TOIA 3L70H 3CYOA 1PL4A 3N2GB 3JALB 1V55B 3UT5A 1B04A 3W7UA 4TV9A 1BGYH 4MVOA 4GKJB 2M6YA 2DYRB 1KKCA 4O2BA 3JARA 3JCUZ 1YF2A 4IHJA 1QR9A 5J2TA 3CCVV 1M56C 4DV2O 3EVKA 2E74B 1WJZA 2P22C 3CX5F 5LXTB 5IY5C 2VS0A 2BSKB 2F95B 4Z1VA 5E79Z 3FFQA 4NTXA 2JVDA 2UUAO 1Q6UA 4JGSA 1CXZB 2ZM6B 5JH7B 2RMKB 3ML0A 3N2KA 1VQ9V 5C93A 1NTKH 1MG1A 2ZE7A 3HKEA 1XQ8A 4DV6O 5JVDB 4UCRA 2LFSA 2FB5A 1PKXA 2PI5A 2FYUH 3GWKC 1F51A 2Q7EA 1AILA 1D5AA 4DR4B 1EN5A 3DXRA 1RP3B 4LP8A 3U11A 4X1KB 1GMGA 2DW4A 4O4HA 4GYCB 2IJKA 3STZC 4JI3B 1WA8B 1YI2V 2H3OA 3RYFA 2OCCC 2CTQA 4PELA 2IU0A 4X89A 2M7WA 4HNAA 3QO7A 4JTDB 1XMQO 1EM1A 2BOBC 3UT5B 3KKYA 4TV9B 1QLEB 1VQ6V 4DW0A 2JEXA 1JQ0A 3JARB 2HJFC 2F4VB 4IHJB 1SQFA 2F66C 5J2TB 3CJHA 3LUTB 1IBLO 1PL0A 5EIBD 2ZE5A 3BPZA 3OM3B 3JAKA 1Q81W 3A0BZ 3ASNC 2ZCEA 5F2VO 4UVAA 3CS5A 4CC5A 2A9HA 4RAIA 3X2QC 3K04A 1SF9A 4X66B 2XNDG 3C90A 4Z2WA 2CH7B 3N2KB 1QU7A 4B7KA 1YTFB 3HKEB 4ZOLB 2Q6AA 4LF7B 1HR0O 3SPJA 1JJ2U 4X1YA 3CRQA 2Y69C 3H1HH 2F1MA 1IBMB 2ZNJA 1XMOB 2AHYA 2UXXA 2ILMA 4TT3G 1JCHA 3G6EV 4O4HB 3TXQA 2JS5A 2DWDC 4U3JA 3RYFB 3IAYA 4Z1MG 4DO2A 2UXCO 1EN4A 4CS4A 5GW7A 4PA6A 3STLC 2Y4TA 4PHZA 5IYDO 1PP9H 3UQ8A 2XASA 4LFCO 4UXNA 1IXBA 1P84F 3T2MA 4FZ0A 2BTOA 3CD6V 2VWKA 3CJHB 1UJWB 1JA8A 3UCSC 1YTFD 1MNGA 2CAZC 1TVKA 4J42A 4FLUA 3CEIA 3JAKB 1S5HC 3E22A 2HG5C 4LFAB 2LGWA 2AZ0A 2D3OW 1ZSPA 3VQVA 5DN6G 4TQFA 4F6EA 3K57A 3OMNB 2ZD9A 1K8AW 2R72A 5KHKA 3LSUA 4X62O 1N8RW 5JCOA 3SYOA 3HKBA 3BCCH 4J7JA 4DUZO 4FLVA 4X1YB 5CMUA 4BIOA 2Y0PA 2YSUB 4BW9A 2QDOA 3CRAA 4I9WA 1P7BA 2FMLA 3KCYA 1SQPH 3OEEG 3ZIAG 3BRCA 3ZHVA 3ETDA 1KQSU 1AP5A 4XDKA 2LQTA 1N33O 4KL1A 4U3JB 4UUJC 1URFA 5CB4A 2YIBD 4RO2A 2JJ2G 3AG4C 3R65A 3QG5A 2OIGA 5KHJA 3MHSC 5FPOA 1AI5A 1H2MA 2ZINA 3ETQA 4YIOA 4FVMA 4UVCA 1WNSA 3FYIB 3AG1B 1AJQA 2EINC 3WB1A 1S5JA 3OEHG 1E1RG 1TVKB 5TISZ 2ADPA 2LO1A 1IX9A 3LDCA 4JI8B 4I7ZB 2DMXA 3E22B 3ABLB 2K9PA 2NNUA 2YXYA 2C2AA 3HR0A 1KB9F 4LF8B 1F4MA 5B1NA 4LF9B 2W0FC 4OPAA 3ZBHA 2YUAA 1M57C 4AQYO 2XTAA 3QO8A 1G1XB 4PDVA 1SZXA 3HKBB 4D6TH 3N27A 4PA7A 4ICGA 1AB3A 5L3GA 3K59A 2VQEO 1CP9A 4PI0A 2WLHA 3ASOC 5IYCO 4J11A 1PNLA 1YSCA 4X1IA 1RPOA 5CB4B 2IBZH 1FXKC 4DK1A 4G28B 1RM1C 5DEDA 1J5EB 2QTOA 1V9PA 4JTCB 2ZR2A 4LFBB 2HKOA 1KP2A 4PDRA 1Q90D 4FM2A 2LFRA 1MZEA 3SJCC 4G2KA 1OCRB 3OMAB 2P90A 5IYBO 1SS3A 4P2ZA 2EZPA 1MZFA 4CH4A 3CXHF 1KUQA 3BVOA 2RCVA 1Q5OA 3ZRWA 2XAQA 1VQ7V 2BE3A 5LMUB 2QKSA 3FKSG 4JI5O 1MSDA 4BW5A 2AZ2A 1H8EG 2FKXA 3JYCA 1W0JG 1I0HA 2ZIMA 1QVFU 1G8MA 1R73A 4DV1O 3OW2U 1S5LZ 4K8XA 3C3TA 1VQ5V 4AILC 1T5EA 1JR9A 2EIJC 1PD3A 4MTGA 3ZCCA 5GTHZ 4GX0A 5EK0A 2F93B 1BQZA 2N05A 5EC2C 2P7TC 3ICXA 1TUBA 1OCZB 2EIKC 3QNEA 2UXBO 1XHXA 3WB2A 2HP8A 1VF5B 1S72V 1N36O 4I55A 4DR3O 3B8MA 3NXSA 5J2UA 2LJ2A 4X20A 2WLJA 4X1IB 2ITDC 4GCZA 4UFZA 2QM8A 2WLNA 5IY5B 3H1IH 2DJVA 4LR3A 1QLNA 2YIAA 3T1HB 2ZT9B 3I5DA 5KA5A 4FPPA 3FD9A 3G67A 1NH2B 1X59A 1PNMA 1N34O 2G38A 4DUYB 2BTQA 1GK9A 2WLIA 4UB8Z 3ZRWB 1G6UA 2WA4A 4CS3A 1VP7A 3IC9A 4ABMA 2DE0X 3OUSA 2E3CA 5A2QN 1B3QA 4DV0O 5LOVA 3EXAA 3ABUA 3BY6A 2HJDA 3AEIA 4RQFA 5CN0A 3APQA 3FAVA 4F4LA 1VARA 3D3QA 3AK1A 2IJHA 2OCCB 2JDIG 3DSQA 1H2KA 5IE9A 1TUBB 4I4TA 3W7WA 1FXVA 4GKJO 4PV1B 1ENVA 1YEWA 3CRRA 4I5SA 4LC1A 3WG7C 4I55B 1W2BU 3RBZA 1Y76A 5J2UB 5L3BA 2UUBB 1V54C 4X20B 5H9CA 1K97A 3DTUB 1IBKB 3O65A 1BSMA 1GTOA 2KG7A 5KX5B 3ASNB 1KMIZ 3CHXA 5L3FA 4G27B 3A2FA 3AG2B 3X2QB 2GV9A 3KCXA 1MSWD 5EBLC 2EILC 4MS2A 4DR3B 2ZM6O 2BTQB 5B3SB 3RWRD 3OTOB 2DYSC 2GSMB 3CCJV 4DV5B 1VQOV 3CRCA 4JAVA 3KG2A 4JTAB 5LOVB 1QCEA 5LP6A 2AHZA 4DR4O 4P9PA 4K0KB 3FAVB 3ZHUA 3OFNG 4X64B 2CGOA 2EIMC 3I56V 1F7YA 5KA6A 1R3IC 2QA4V 4FLTA 3T4ZA 3CCQV 1QR8A 4NKGB 3OE7G 3FB5C 4I4TB 2QSAA 3BA9A 3CPWU 2GBOA 3CC4V 4JI6B 2CTWA 3O9OA 4WFFA 4J7ZA 3ZHSA 2LGQA 2WWWA 1GN4A 3B09A 2E5LB 5CBFA 1Y76B 1JOYA 2F4VO 2GUZA 1L8DA 3QVNA 1PPJH 2CGNA 2QKCA 3ZHTA 2KG7B 3ZMVA 5IWAB 3JASB 1TUEB 1M5IA 4N21A 1CEZA 2QJ1A 4X66O 4IT5A 1HP8A 4KP4A 4DR1B 1LUWA 2IM9A 4GT1A 2YS8A 1BHBA 4LF6B 2XUMA 1VQ8V 1Y74A 2R9IA 4LF7O 1JMKC 3E8BA 4GX1A 3UO3A 3P30A 1VF6C 3CSXA 1R3JC 2A79B 5KLVH 1IBMO 5LP6B 2DQ3A 5LL6Y 1XMOO 1CPYA 1GN6A 4WCEV 5LYJA 3G71V 5D5PA 1I7FA 2GTSA 1VQLV 2K1EA 4HYOA 1FXKA 4E2LA 4PA9A 3SPCA 4JV5B 3AG4B 1S3JA 3ZX6A 3E8GA 1R6NA 2R9RB 2UXNA 3TGUH 1AVMA 1K7DA 1BHAA 2WLLA 3SYAA 1YJWV 2IJIA 4DK0A 1S0VA 2GUZB 3J80N 5KMGA 1Q82W 3FB7C 4UCTA 3U0ZA 3J81N 4FLZA 3GVMA 1NS1A 4FLYA 4JZ2A 3K03A 4LFAO 4GX5A 4J41A 4OGQB 1OHHG 3RFRA 1MMMA 3CE2A 4O2BB
chains in the Genus database with same CATH topology
3B8NA 4CBCA 3ZIAG 1NJIW 3SJQC 1JPXA 1W0KG 3ETDA 3SPGA 4QJFB 1KQSU 2OTLV 1DF4A 4XDKA 4UVBA 4ZBMA 5LGTA 3ABMC 4UUJC 2ZQMA 3SPHA 1NBMG 4UV8A 1H2GA 3E8HA 4RO2A 4WFBV 2JJ2G 3AG4C 3R65A 3FYEB 3MHSC 1AI5A 3CCMV 1EZJA 1WLEA 4JF3A 1OCOC 3HB3B 1NVPD 1AJNA 2XAJA 1PNKA 4MSWC 1Q86W 1OCRC 4UVCA 3SYQA 5BZBA 3FYIB 3AG1B 4L87A 1AJQA 5LHIA 2EINC 3EFFK 3W7TA 3OEHG 1E1RG 4FK5C 4KFMA 1RM1B 4WF9V 1FS0G 2ZXWC 3LDCA 1KP3A 3ABLB 3M99B 4R50A 5H6RA 3CMAV 2B1IA 2NNUA 5EBWC 1K73W 1S77D 3B77A 2C2AA 4EKWA 3EHBB 3OR6C 2WLLB 1F4MA 3JD1A 5B1NA 1ORQC 4MW8A 2B1GA 2W0FC 5L3DA 5HFMA 3ZMZA 1VQ4V 1I5YA 4QE7A 1M57C 1OCCC 3E89A 3QO8A 4R6ZA 4PDVA 2QE7G 3T1CA 3ZJZA 5EC1C 1JVMA 5CBHA 2W6JG 4HAMA 4PA7A 3IFXA 2X6BA 4MW3A 1OCZC 2V1DA 5L3GA 1SERA 3FB6C 3JCZA 4BIZA 1CP9A 4FIPC 4Q20A 1SETA 5EBMC 5L3EA 2V7QG 2WLHA 3ASOC 4ASUG 1R6KA 3W7SA 2H94A 4BIUA 5IYCO 3BEHA 1PNLA 1S76D 2IW5A 3RVYA 3ABTA 3TCUA 4XDLA 1BL8A 1K5SA 3ABMB 1YSCA 1RPOA 5B1OA 1GKFA 1FXKC 4G28B 1RM1C 3HPLC 4U7NA 2P6JA 2QTOA 3ABKC 3LDDA 5KUKA 4WFAV 2B5UA 2YEVA 4JTCB 2ZR2A 4CZZA 2ZDIC 2HKOA 1B6QA 1K92A 3I55V 1KP2A 1OCOB 4PDRA 2Q68A 5LBQA 4MVZA 1NH2D 2LFRA 1DTOA 5CBGA 2P67A 4FMTA 1LNQA 1OCRB 3OMAB 4G2KA 1K34A 1Y66A 2P90A 4DXWA 5IYBO 4P2ZA 2EZPA 3P32A 2EINB 5B1BC 1H38A 1SESA 3ZRWA 4GX2A 2XAQA 5LHGA 1VQ7V 4TSFG 3E83A 4JPRA 2ZXWB 1MABG 2QKSA 3FKSG 4OXSA 2XOKG 2FTKA 1V55C 2HR3A 3DGEA 4BW5A 3W7XA 2QEXV 1H8EG 2DYRC 3JYCA 3CC7V 1W0JG 3K06A 2OT5A 1I5XA 3H01A 3JD4A 1G8MA 1QVFU 1R73A 3OW2U 4QPKA 2EBOA 4ZKIA 2WAMA 1VQ5V 1L1FA 1M57B 1OCCB 2EIJC 4BAYA 1PD3A 4MTGA 3ZCCA 1FFTB 1THZA 2HLDG 3SPIA 4GX0A 3OMIB 5EK0A 3E35A 3UKMA 4PA4A 5EC2C 3VOUA 2P7TC 5H6QA 3ETEA 3CCLV 1OCZB 2EIKC 4N23A 2EJRA 3PJSK 3QNEA 3WFVA 1K5QA 3JD2A 1F23A 3ZRXA 2Z5UA 1KKDA 4QIWF 1S72V 3ASOB 3LSSA 1YIJV 3ZMUA 3MD0A 3B8MA 3NXSA 3OR7C 2WLJA 3IGAC 1E1QG 1HWYA 2JK5C 2ITDC 4GCZA 3AG3C 2XAHA 4QNHB 1AJPA 1FXKB 1K4DC 1GM8A 2W6IG 2QM8A 2WLNA 3ABKB 5IY5B 5LGNA 4H37A 4MT8A 5CA3A 2YEVB 1SZTA 1QLNA 2ATKC 3OUFA 2QM7A 4XDJA 3AG2C 5LGUA 1NQTA 1AROP 1OZ0A 4JYBA 1QBZA 1M1KW 5KA5A 2MK3A 2WSSG 4FPPA 4WFHA 1NH2B 5B1AC 3K79A 4J9YB 1PNMA 3CC2V 1VQKV 3QO5A 2X6CA 5B1BB 3D3IA 1GK9A 2WLIA 2CK3G 4MVMA 5B3SC 2PI4A 3ZRWB 3K0GA 3CYOA 1F4NA 1AI7A 3ZMSA 3CMEV 3LSQA 2A0LA 3OUSA 1V55B 4XBFA 3W7UA 4UV9A 4MVOA 2DYRB 4RUFA 1QLEC 1RPRA 2IH1C 3RW0A 3ABUA 3BY6A 4RQFA 3AEIA 1YJNV 2EILB 5CN0A 3TETA 3CCUV 1COWG 4F4LA 4FJCC 1QR9A 2Q69A 2IJHA 3CCVV 4JAUA 2EIJB 2WPDG 1M56C 2X6AA 2XAFA 2OCCB 4KUMA 1KECA 3TK1A 2JDIG 1WPXA 1DF5A 5IY5C 2EIKB 4YXWG 3W7WA 2JIZG 1FXVA 1MOFA 2JEUA 5J9PC 2NLJC 3LDEA 1GM9A 1ENVA 1DLBA 4PDLA 1VQMV 2GHYA 4JGSA 4QPJA 4I5SA 4LC1A 3WG7C 1W2BU 1Q7YW 2H8PC 3RBZA 5L3BA 3ML0A 1V54C 3K08A 1H8HG 5H9CA 1VQ9V 4LCUC 1K97A 3G4SV 3AG3B 1YJ9V 5C93A 1MG1A 3DTUB 1GTOA 3ASNB 5L3FA 2LFSA 4G27B 1PKXA 3LNMB 2PI5A 3AG2B 3X2QB 3FB8C 1YITV 1F51A 4MTFA 3ZMTA 1K33A 1MSWD 5EBLC 1YHQV 5B1AB 2EILC 3CCRV 4LP8A 4MS2A 1GMGA 3ZN0A 1K3EA 2DW4A 2IJKA 3STZC 5B3SB 3F5WC 1YI2V 4MVQA 2DYSC 2GSMB 3CCJV 2HVJC 2IH3C 2OCCC 3MHHC 4PELA 2IU0A 4X89A 1XL6A 1VQOV 5L3CA 4J9ZB 2M7WA 4P30A 1KC8W 3QO7A 1NKDA 4JAVA 4JTDB 1K9MW 2BOBC 4JASA 3KG2A 4JTAB 1QLEB 3SYCA 3OAAG 1VQ6V 2JEXA 4X8AA 1JQ0A 1QCEA 2AHZA 3CP1A 2HJFC 4P9PA 5FL7G 3OFNG 2F43G 2EIMC 3I56V 5KA6A 3GB7C 1M56B 1R3IC 2HFEC 3LUTB 2QA4V 3IC7A 1PL0A 3T4ZA 4X88A 3CCQV 1QR8A 3OM3B 2DWEC 1P4RA 1NR1A 3OE7G 4LBEC 1KD1W 1AI6A 1FXHA 5LHHA 3FB5C 1Q81W 3E86A 3ASNC 4TWKA 2HVKC 3CPWU 3CCSV 2WLKA 3CC4V 4UVAA 2DQ0A 2A9HA 4RAIA 4WFFA 3X2QC 3K04A 3CCEV 2WWWA 4MTXA 5CBFA 4HZ3A 2XNDG 3WG7B 1QVGU 3VBBA 1JOYA 1SRYA 1EFRG 1V54B 1EBOA 1YTFB 2Q6AA 2Z3YA 3ZMVA 3SPJA 1JJ2U 1JX9A 3ZRVA 3K3WA 2X0LA 4P9OA 2Y69C 2Y48A 1VQNV 1TUEB 1ZWIC 4N21A 1CEZA 1M9NA 2AHYA 1G4YB 2UXXA 5E1AC 1VQPV 4MVRA 4TT3G 1JCHA 3G6EV 2WLMA 3OGCC 4R7CA 4KP4A 2IJJA 4GT1A 4MVUA 2DWDC 3UM7A 2DYSB 1BHBA 3RVZA 4Z1MG 4MVSA 4DO2A 4JYCA 4H33A 3A0RA 2ZR3A 5KUMA 1VQ8V 2OTJV 1R3KC 2X7RB 3E8FA 4RUEA 2R9IA 5GW7A 1J95A 4PA6A 4PA3A 3STLC 1XL4A 3E8BA 4GX1A 3P30A 1R3LC 1R3JC 2A79B 5IYDO 3GWOA 2XASA 4UXNA 2DQ3A 3T2MA 4WFGA 2BOCC 1CPYA 3JD0A 2IU3A 2Q67A 4WCEV 3G71V 3CD6V 1Y4MA 3AG1C 1UJWB 3ETGA 2EIMB 2KB1A 5HFLA 3D36A 1AI4A 1YTFD 1VQLV 2K1EA 4HYOA 1FXKA 4E2LA 4PA9A 1BMFG 3SPCA 3K0DA 1ROPA 3F7YC 3AG4B 4R8CA 1S3JA 5DM6V 1E79G 1R6NA 1S5HC 3ABLC 2R9RB 2HG5C 2UXNA 3E8GA 3CXCU 2JJ1G 3E2EA 3K9AA 2ZDIA 2EZOA 2D3OW 1K7DA 1AR1B 1BHAA 3JD3A 5DN6G 1GM7A 2WLLA 3SYAA 1NVPB 3OMNB 4WFEA 1IXMA 1YJWV 2ZD9A 4MTOA 1K4CC 2ITCC 1K8AW 2IJIA 1S0VA 1Q82W 2WLIB 3FB7C 3SYPA 1NR7A 3T4DA 1GO3F 3F7VC 1N8RW 2XAGA 3SYOA 5IDJA 3ZN1A 4U7OA 1M90W 3K03A 2LP7A 5CMUA 3ZRSA 2YSUB 2Y69B 4GX5A 1P7BA 4I9WA 1OHHG 4RQEA 4QE9A 3OEEG 4PDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBG A;  3TET A;  4CBC A;  1LNQ A;  5CBF A;  4HZ3 A;  3SJQ C;  4DXW A;  3SPG A;  4F4L A;  4P2Z A;  2Q69 A;  4XDK A;  4ZBM A;  5B1B C;  1M56 C;  2X6A A;  3ABM C;  4GX2 A;  4UUJ C;  3SPH A;  3E83 A;  3E8H A;  2QKS A;  4RO2 A;  2Q6A A;  4OXS A;  3AG4 C;  3R65 A;  1V55 C;  3SPJ A;  5IY5 C;  4P9O A;  4BW5 A;  2Y69 C;  5J9P C;  2DYR C;  1OCO C;  1ZWI C;  3JYC A;  2NLJ C;  4QE9 A;  3LDE A;  4MSW C;  4PDL A;  2AHY A;  1G4Y B;  3K06 A;  5E1A C;  4MVR A;  1OCR C;  3SYQ A;  5BZB A;  3WG7 C;  2H8P C;  3RBZ A;  2WLM A;  3OGC C;  4R7C A;  1V54 C;  3K08 A;  2EIN C;  3EFF K;  2EIJ C;  4MVU A;  4LCU C;  3UM7 A;  2DWD C;  4MTG A;  3RVZ A;  3SPI A;  4GX0 A;  4KFM A;  4MVS A;  4H33 A;  5EK0 A;  2ZXW C;  3LDC A;  5KUM A;  1R3K C;  3E8F A;  4RUE A;  3UKM A;  4PA4 A;  5EC2 C;  3VOU A;  2P7T C;  1J95 A;  4R50 A;  4PA6 A;  4PA3 A;  3STL C;  1XL4 A;  3E8B A;  4G27 B;  2EIK C;  3LNM B;  3PJS K;  4GX1 A;  5EBW C;  1R3L C;  4EKW A;  1R3J C;  2A79 B;  3FB8 C;  3OR6 C;  2WLL B;  4MTF A;  1KKD A;  1ORQ C;  3T2M A;  4MW8 A;  5EBL C;  4WFG A;  2BOC C;  2EIL C;  2W0F C;  4LP8 A;  4MS2 A;  2Q67 A;  3OR7 C;  3AG1 C;  3STZ C;  2KB1 A;  3F5W C;  4QE7 A;  1M57 C;  2WLJ A;  3IGA C;  1OCC C;  3E89 A;  4MVQ A;  4R6Z A;  2JK5 C;  2ITD C;  2DYS C;  2K1E A;  3AG3 C;  4HYO A;  4QNH B;  2HVJ C;  2IH3 C;  2OCC C;  4PDV A;  4PA9 A;  4X89 A;  1K4D C;  1XL6 A;  3K0D A;  3SPC A;  3T1C A;  3F7Y C;  4J9Z B;  3ZJZ A;  5EC1 C;  2WLN A;  4R8C A;  1JVM A;  4P30 A;  5CBH A;  1S5H C;  2R9R B;  3E8G A;  3ABL C;  4JTD B;  2HG5 C;  2BOB C;  3IFX A;  4H37 A;  4PA7 A;  2X6B A;  4MW3 A;  2ATK C;  3OUF A;  1OCZ C;  4XDJ A;  3FB6 C;  3AG2 C;  3KG2 A;  4JTA B;  3SYC A;  2WLL A;  4X8A A;  3SYA A;  4WFH A;  5EBM C;  4WFE A;  2AHZ A;  2ZD9 A;  5B1A C;  2WLH A;  2HJF C;  1K4C C;  2ITC C;  3ASO C;  4J9Y B;  4MTO A;  4P9P A;  3BEH A;  3RVY A;  2X6C A;  3TCU A;  2EIM C;  2WLI A;  5B3S C;  4MVM A;  2WLI B;  3FB7 C;  3GB7 C;  1R3I C;  1BL8 A;  2HFE C;  3LUT B;  4XDL A;  3SYP A;  3T4D A;  3F7V C;  3T4Z A;  3K0G A;  4X88 A;  3SYO A;  4G28 B;  3HPL C;  2DWE C;  2QTO A;  4LBE C;  3ABK C;  3LDD A;  3OUS A;  2A0L A;  3FB5 C;  3K03 A;  5KUK A;  3E86 A;  3ASN C;  3ZRS A;  2YEV A;  4JTC B;  4TWK A;  2HVK C;  2WLK A;  4GX5 A;  1P7B A;  4I9W A;  4MVO A;  2A9H A;  4RAI A;  4RUF A;  1QLE C;  4WFF A;  3K04 A;  4PDR A;  3X2Q C;  2IH1 C;  2Q68 A;  3RW0 A;  4MVZ A;  4PDM A; 
#chains in the Genus database with same CATH topology
 3B8N A;  1ZL8 A;  3SJQ C;  1W0K G;  4QJF B;  2OTL V;  2JRI A;  2PY5 A;  3ABM C;  2ZQM A;  5C8Y A;  3E8H A;  3AK3 A;  1RFY A;  1BT8 A;  4WFB V;  1Y74 B;  1ZAU A;  2YIB A;  1UFI A;  1XNQ B;  4CH5 A;  3CCM V;  2CUG A;  4JF3 A;  3HB3 B;  4GLX A;  2Y4U A;  1R1B A;  1US6 A;  2QWO B;  5LYJ B;  3THO A;  4L87 A;  2UXD B;  3W7T A;  5BY1 A;  1RM1 B;  3CRM A;  2ZXW C;  1AR4 A;  5H6R A;  1BZK A;  4CS2 A;  5EBW C;  1YDX A;  4B3T B;  4FFK A;  4NXN B;  1HNW B;  3EHB B;  2Q73 A;  2WLL B;  4MW8 A;  3DXR B;  3TJT A;  5HFM A;  3ZMZ A;  3M8A A;  5KMG B;  1OCC C;  3E89 A;  4BR6 A;  4I9Q A;  1YCI A;  2OIE A;  3T1C A;  3ZJZ A;  4J80 A;  5CBH A;  4HNA B;  2W6J G;  4JI8 O;  1SER A;  2ZNI A;  1KYO F;  4BIZ A;  4LF8 O;  5EBM C;  1KU9 A;  5L3E A;  1ZL8 B;  4LF9 O;  1XNR B;  1JFF A;  1NU1 H;  4B08 A;  3RVY A;  1VMG A;  1M93 A;  4XDL A;  1BL8 A;  2OCH A;  5C8Y B;  4LWS A;  3HPL C;  5KUK A;  3G80 A;  4WFA V;  3Q4H A;  1BS3 A;  2JGD A;  1B6Q A;  2ZDI C;  1OCO B;  4JI0 B;  1K34 A;  5CA1 A;  5IYZ A;  2ADQ B;  3P32 A;  1GH6 A;  4H44 B;  1SES A;  5IJ0 A;  5LHG A;  4TSF G;  3J7A U;  4K8Z A;  1MAB G;  1WB8 A;  4OXS A;  1J5E O;  1V55 C;  1Q6I A;  3PN1 A;  4LFB O;  2DYR C;  3IJ4 A;  5EYP A;  3K06 A;  1I08 A;  2OT5 A;  3OT7 A;  4OX9 B;  2PZS A;  4QPK A;  2EBO A;  2L6L A;  2Q4P A;  3MAQ A;  3OGI B;  4A5U B;  4BAY A;  3H1L H;  1IZ3 A;  1FFT B;  3JSN A;  4YY3 B;  3OMI B;  4DR7 B;  4NXM B;  2YDE A;  4X65 B;  5LMU O;  1GRJ A;  2N04 A;  3ETE A;  1Y67 A;  4JI4 B;  2EJR A;  3T1Y B;  2P06 A;  1L0L H;  4JI7 B;  4BWA A;  5H2F Z;  2XHB A;  1JFF B;  3B4S A;  3ZMU A;  3OR7 C;  4GZR B;  3IGA C;  1FFX A;  2JK5 C;  4B7E A;  2XAH A;  1K4D C;  4LWS B;  3ABK B;  5LGN A;  2P5O A;  5CA3 A;  4B3R B;  2ATK C;  4XDJ A;  2QM7 A;  3Q4H B;  2JGD B;  4UCS A;  1NQT A;  2Q0O C;  4JYB A;  1QBZ A;  1SC5 B;  2WSS G;  3L72 H;  2QR4 A;  4WFH A;  5CA1 B;  5IYZ B;  3CC2 V;  4YHH B;  1VQK V;  5KHG A;  2X6C A;  1N4C A;  2YI9 A;  3D3I A;  5B1B B;  4NTY A;  1Q8I A;  2ODM A;  5IJ0 B;  2PGG A;  3L73 H;  4GKK B;  1SQX H;  2EUL A;  3L74 H;  1WP8 A;  3K58 A;  1AI7 A;  3CME V;  4TV8 A;  1TAE A;  4TQD A;  1YVW A;  4UV9 A;  3T1H O;  2CTR A;  4RUF A;  1QLE C;  4Q6G A;  2EIL B;  5EYP B;  3TET A;  3CCU V;  3K5M A;  5IT9 N;  1Q43 A;  4DUY O;  2WPD G;  1D5N A;  3TK1 A;  1WPX A;  2PUS A;  1VF6 A;  4YXW G;  2OYQ A;  5JJJ B;  2JIZ G;  3K5O A;  1MOF A;  3JAW A;  2JEU A;  5J9P C;  2NLJ C;  3LDE A;  1DLB A;  4EFE A;  1VQM V;  1DGS A;  2GHY A;  4QPJ A;  1Q7Y W;  2H8P C;  4WBN A;  1XHZ A;  3K08 A;  1Z2G A;  1W59 A;  1ZLZ A;  1FFX B;  4LCU C;  3G4S V;  3AG3 B;  3G6B A;  1YJ9 V;  4W4K A;  2PTM A;  3U10 A;  2VRZ A;  3VQX A;  2QGN A;  1HNZ B;  2PYL A;  2JS3 A;  3AK2 A;  4MTF A;  3ZMT A;  1K33 A;  3M7M X;  3RGB A;  2YXH A;  5B1A B;  3JSL A;  1GN3 A;  4LF5 O;  5DEC A;  3ZN0 A;  3F5W C;  2UUB O;  4MVQ A;  2ZE6 A;  4FM1 A;  2HVJ C;  3MHH C;  1XL6 A;  4J9Z B;  1IBK O;  1KC8 W;  1NKD A;  4TV8 B;  1HNX B;  5FNV A;  3SYC A;  3OAA G;  2Q0A A;  3DC6 A;  4LH6 A;  1NI8 A;  5FL7 G;  4GUN A;  1WAZ A;  4CH6 A;  1B06 A;  5CA0 A;  4JZG A;  3GB7 C;  1M56 B;  3IC7 A;  1BE3 H;  3OTO O;  2DOS A;  4X88 A;  4DV5 O;  1XOU A;  1NR1 A;  4LBE C;  2R70 A;  5LHH A;  4DV4 B;  5A9G A;  4RWU A;  4TWK A;  2HVK C;  3CCS V;  2WLK A;  3JAW B;  4CC6 A;  3BHP A;  4JAA A;  1QVG U;  1SKV A;  4WBN B;  5GTI Z;  3VBB A;  4K0K O;  1SRY A;  2EJ7 A;  4IGG A;  4X64 O;  3BA8 A;  1XEQ A;  4UCO A;  3BAA A;  4W4L A;  1FJG B;  3ZRV A;  3K3W A;  2X0L A;  4P9O A;  1ZWI C;  3B40 A;  3OTF A;  4JI6 O;  3SDL A;  5E1A C;  1G4Y B;  4DV7 B;  4PI2 A;  1AR5 A;  5H5N A;  2E5L O;  2WLM A;  3OGC C;  4R7C A;  3UM7 A;  2RNB A;  3RVZ A;  4MVS A;  2D2C B;  4K35 A;  5KUM A;  1H2N A;  2OTJ V;  2X7R B;  1SQG A;  2A06 H;  1J95 A;  4PA3 A;  5FNV B;  5IWA O;  3GWO A;  2GTA A;  5LMN B;  4B3S B;  2AGA A;  4WFG A;  2BOC C;  1SQQ H;  2KKW A;  4LF5 B;  4EFB A;  2Q67 A;  2UUC B;  3HKC A;  3AG1 C;  4ZIB A;  3ETG A;  5CA0 B;  4DR1 O;  1AI4 A;  2N74 A;  4LF6 O;  3F7Y C;  4B3M B;  4R8C A;  5DM6 V;  1E79 G;  3ABL C;  1KBH A;  3K9A A;  2ZDI A;  2EZO A;  3QTC A;  1AR1 B;  3C3S A;  2BCC H;  2MW2 B;  3L9D A;  3L71 H;  4DW1 A;  1IXM A;  2W0X A;  5KHI A;  4MTO A;  1K4C C;  2ITC C;  3K5N A;  3OD4 A;  1XRE A;  1PV0 A;  1QNM A;  5FLX N;  2WLI B;  3SYP A;  3T4D A;  1GO3 F;  3F7V C;  3S3W A;  5JCO C;  5IDJ A;  3ZN1 A;  4IIJ A;  3N2G A;  4U7O A;  4JV5 O;  1M90 W;  2LP7 A;  1I94 B;  4IYH A;  2Y69 B;  1Q3E A;  4RQE A;  1H2S B;  4PDM A;  2ETN A;  1NJI W;  1JPX A;  2NN4 A;  1DF4 A;  3BFR A;  4UCV A;  1YXB A;  3SPH A;  4PD4 F;  1YZB A;  1A32 A;  2BSK A;  3ZS8 C;  1EN6 A;  3FYE B;  4JYA O;  4NVP A;  5D5Q A;  1EZJ A;  4IL6 Z;  1AJN A;  3RN4 A;  1PNK A;  4MSW C;  2QWN B;  1OCR C;  2Q7H A;  3HKC B;  5LHI A;  4FK5 C;  4KFM A;  2A7W A;  4FFB A;  2Q5Z A;  3M99 B;  4R50 A;  2LW7 A;  3CMA V;  1K73 W;  1XNQ O;  3B77 A;  4EKW A;  4I50 A;  4FM0 A;  3H1J H;  2B1G A;  1ZTE A;  5L3D A;  1VQ4 V;  4O4I A;  1SA0 A;  2UXD O;  4H0L B;  4L8J A;  2QE7 G;  4F6R A;  4DYL A;  2YID A;  4IIJ B;  5EC1 C;  1VF7 A;  1TA8 A;  4HAM A;  2X6B A;  2Q8V A;  5ITZ A;  1OCZ C;  2V1D A;  3JCZ A;  4LF4 B;  4FIP C;  4Q20 A;  4B3T O;  4NXN O;  1HNW O;  1SET A;  4H13 B;  2V7Q G;  1R6K A;  3W7S A;  3WB0 A;  3BEH A;  1S76 D;  2IW5 A;  3ABT A;  3TCU A;  1SQV H;  4ZHQ A;  1K5S A;  3D36 C;  4O2A A;  1HDJ A;  5B1O A;  1GKF A;  2AXT Z;  4U7N A;  5JQG A;  2P6J A;  1RSO A;  3LDD A;  3SJA C;  4DV3 B;  2VQF O;  2YEV A;  4LH7 A;  2PYJ A;  3I55 V;  2UU9 B;  5LBQ A;  4D7S A;  4MVZ A;  5BR8 B;  4FMT A;  1LNQ A;  1N32 B;  4DXW A;  1FKA O;  4DR2 B;  1XNR O;  2CH7 A;  2EIN B;  1D2D A;  1P49 A;  4GX2 A;  1EZV H;  3E83 A;  4ZOL A;  1X4T A;  4FFB B;  2XOK G;  2CE4 A;  2FTK A;  5K1X A;  3F5T A;  2HR3 A;  1ZX3 A;  3DGE A;  4JYA B;  4I50 B;  4JI2 B;  4NB5 A;  4JI0 O;  5KAF Z;  1I5X A;  2Z0A A;  4O4I B;  1L1F A;  1SA0 B;  1M57 B;  4DR5 B;  1U96 A;  2AW9 A;  1Y6X A;  4F6R B;  2E76 B;  5B66 Z;  3UKM A;  4OPH A;  5H6Q A;  3CCL V;  5ITZ B;  3ZRX A;  2Z5U A;  5EZY A;  2HHH B;  2WA3 A;  1HW7 A;  4QIW F;  1VEW A;  1XUQ A;  3ASO B;  4OX9 O;  4ZI7 A;  1NTZ H;  3FX7 A;  2KSD A;  3UO2 A;  3MDS A;  4ZHQ B;  1E1Q G;  1HWY A;  4O2A B;  1AJP A;  1FXK B;  4YJ2 A;  1GM8 A;  2QWP B;  4FZ1 A;  5JQG B;  4YY3 O;  4NXM O;  1RSO B;  4DR7 O;  4KHP O;  4X65 O;  2Q9L A;  5IJ9 A;  4H37 A;  4MT8 A;  2YEV B;  1SZT A;  3AG2 C;  4JI4 O;  5LGU A;  1ARO P;  1M1K W;  2MK3 A;  3T1Y O;  4J9Y B;  4JI7 O;  2HEP A;  3L75 H;  3AG7 A;  3QO5 A;  5B3S C;  4DV2 B;  4MVM A;  2NR5 A;  2F23 A;  2CDY A;  3K0G A;  1VIB A;  1F4N A;  3ZMS A;  3LSQ A;  2A0L A;  2VQF B;  4XBF A;  4B3R O;  1RPR A;  1QQC A;  2IH1 C;  3RW0 A;  1YJN V;  2UUA B;  1COW G;  4FJC C;  2Q69 A;  4TUY A;  4JAU A;  4YHH O;  2EIJ B;  2XT9 A;  2X6A A;  2XAF A;  4KUM A;  1KEC A;  4DV6 B;  4GKK O;  5FPR A;  2Q7G A;  3ZED A;  1DF5 A;  2EIK B;  1FYJ A;  1N0J A;  4KXR A;  1SQB H;  1NTM H;  1XBL A;  5EZY B;  1UPG A;  1GM9 A;  3P3N A;  2YXL A;  4PDL A;  1L0N H;  4ZI7 B;  1WPB A;  1M4U A;  3BAB A;  4UB6 Z;  5GON A;  1H8H G;  2R9A A;  3QF7 A;  1FD9 A;  4YJ2 B;  4O4L A;  1XMQ B;  5IJ9 B;  4JYY A;  3LNM B;  5JWP A;  3FB8 C;  1YIT V;  2QWQ B;  2E75 B;  3ZHR A;  2L35 A;  2P4K A;  1YHQ V;  3CCR V;  1K3E A;  2YI8 A;  1FPO A;  1IBL B;  2IH3 C;  1LUV A;  5L3C A;  4KHP B;  4P30 A;  1JJO A;  1K9M W;  1TGO A;  1XIL A;  4JAS A;  4PJ0 Z;  1HNZ O;  4X8A A;  5LP6 C;  2ARH A;  3SR2 C;  1OV9 A;  2RQ6 A;  3CP1 A;  3DC5 A;  2F43 G;  4TUY B;  2JGU A;  2HFE C;  1PM9 A;  4U3F H;  3NR7 A;  2DWE C;  1P4R A;  5EIB C;  3RYC A;  5BXZ A;  1KD1 W;  1HR0 B;  1AI6 A;  1FXH A;  2VWJ A;  5BMV A;  3B2E E;  3R66 A;  3E86 A;  3RT3 C;  1HNX O;  2DQ0 A;  1BQ0 A;  3CCE V;  4LNU A;  4MTX A;  1LR1 A;  4HZ3 A;  4E4E A;  3WG7 B;  1DK1 A;  4YIP A;  4AI8 A;  5KAI Z;  1EFR G;  1V54 B;  5GON B;  1EBO A;  2UXC B;  3KZI Z;  1WB7 A;  4O4L B;  2Z3Y A;  1JX9 A;  4DV4 O;  1MA1 A;  2Y48 A;  1VQN V;  4LFC B;  1M9N A;  2KQX A;  2V4D A;  1VQP V;  4MVR A;  2RDC A;  2B9Z A;  2P4V A;  4K3A A;  2IJJ A;  4MVU A;  3S3X A;  4FLW A;  2DYS B;  4JYC A;  4H33 A;  3A0R A;  2ZR3 A;  1R3K C;  3E8F A;  4RUE A;  1FJG O;  1P7G A;  3P3P A;  1XL4 A;  4NTW A;  4O4J A;  1R3L C;  3TXS A;  1Q6H A;  3VQY A;  4I0X A;  5KHH A;  5JJN B;  3JD0 A;  4DV7 O;  2IU3 A;  1Y4M A;  2EIM B;  2KB1 A;  5HFL A;  3D36 A;  4X62 B;  5LA6 A;  2LW1 A;  1BMF G;  3K0D A;  3ZHQ A;  1ROP A;  1U97 A;  3RYC B;  4DUZ B;  1BCC H;  5BMV B;  3E2E A;  3CXC U;  2JJ1 G;  3JD3 A;  3H1K H;  1GM7 A;  5B5E Z;  4LNU B;  1NVP B;  4WFE A;  1IDS A;  5LMN O;  4B3S O;  2GDS A;  1N33 B;  2UUC O;  1NR7 A;  3JAM N;  2XAG A;  4CH3 A;  3APO A;  1OJH A;  3K9S A;  4B3M O;  1QHT A;  4J7K A;  3ZRS A;  4YJ3 A;  1R6T A;  2FL4 A;  4QE9 A;  2ZE8 A;  4CBC A;  4X9Q A;  3SPG A;  4ZBM A;  4UVB A;  4UCU A;  3HKD A;  1AP6 A;  1ZUQ A;  5LGT A;  1NBM G;  4UV8 A;  1H2G A;  3CWB H;  4DR6 O;  1FAF A;  4O4J B;  2QKA A;  1I94 O;  4J10 A;  1WLE A;  1OCO C;  4DRX A;  1NVP D;  2OWO A;  2XAJ A;  4I0X B;  1Q86 W;  4HBN A;  1XI1 A;  3SYQ A;  5BZB A;  3D8C A;  1Z5V A;  1H2L A;  4AQY B;  2EX3 A;  4JI1 O;  1N0N A;  3EFF K;  2YIC A;  4EEQ A;  5LA6 B;  2O57 A;  2YC0 A;  4WF9 V;  1FS0 G;  5KX5 A;  1KP3 A;  2VQE B;  2B1I A;  1S77 D;  2RN9 A;  4AHC A;  3OR6 C;  3JD1 A;  3SJB C;  1ORQ C;  3CB2 A;  4QGP A;  3LNN A;  1I5Y A;  4QE7 A;  4R6Z A;  3SGI A;  1GAX A;  1JVM A;  1O9G A;  3IFX A;  4MW3 A;  4FLX A;  1GN2 A;  3FB6 C;  4YJ3 B;  4NR1 A;  2ZIO A;  4ASU G;  3H9V A;  3RYH A;  2H94 A;  4BIU A;  3HKD B;  3ABM B;  3RYI A;  5JJE B;  4JI5 B;  3ABK C;  2B5U A;  4CZZ A;  2QWR B;  1K92 A;  5AG2 A;  3JAT A;  2Q68 A;  4DRX B;  4LF4 O;  1NH2 D;  1Z5W A;  1DTO A;  5CBG A;  2P67 A;  4DV1 B;  1Y66 A;  4EB6 A;  2Y0I A;  4D7T A;  1XDC A;  5B1B C;  1H38 A;  4IYI A;  1IVS A;  4JPR A;  2ZXW B;  2A3Q A;  4DR6 B;  3JAL A;  2UXB B;  4DV3 O;  3JAS A;  3W7X A;  2QEX V;  2ZKO A;  4C7U A;  3A8T A;  3K5L A;  3CC7 V;  2UU9 O;  1N36 B;  3H01 A;  3JD4 A;  5BR8 O;  1N32 O;  3WU2 Z;  4ZKI A;  2WAM A;  4DR2 O;  4JI1 B;  2RJZ A;  1OCC B;  1THZ A;  2HLD G;  3SPI A;  1WP7 A;  1WN7 A;  3E35 A;  4PA4 A;  3VOU A;  5LXT A;  4N23 A;  3PJS K;  4NYK A;  3WFV A;  1K5Q A;  3JD2 A;  1F23 A;  1O9H A;  1KKD A;  4JI2 O;  2QTS A;  3LSS A;  1N34 B;  1YIJ V;  3A0H Z;  3RYH B;  3MD0 A;  5JH7 A;  2QM4 A;  1IUR A;  2PF4 E;  4JI3 O;  1NZ6 A;  4DR5 O;  3AG3 C;  4QNH B;  3VQW A;  3RYI B;  2W6I G;  1NT2 B;  5JVD A;  3OUF A;  2CTP A;  4DV0 B;  5K1P A;  1OZ0 A;  3JAT B;  2DN9 A;  5B1A C;  3K79 A;  2HHH O;  4EB6 B;  4X1K A;  2CK3 G;  2PI4 A;  1WA8 A;  4TOI A;  3L70 H;  3CYO A;  1PL4 A;  3N2G B;  3JAL B;  1V55 B;  3UT5 A;  1B04 A;  3W7U A;  4TV9 A;  1BGY H;  4MVO A;  4GKJ B;  2M6Y A;  2DYR B;  1KKC A;  4O2B A;  3JAR A;  3JCU Z;  1YF2 A;  4IHJ A;  1QR9 A;  5J2T A;  3CCV V;  1M56 C;  4DV2 O;  3EVK A;  2E74 B;  1WJZ A;  2P22 C;  3CX5 F;  5LXT B;  5IY5 C;  2VS0 A;  2BSK B;  2F95 B;  4Z1V A;  5E79 Z;  3FFQ A;  4NTX A;  2JVD A;  2UUA O;  1Q6U A;  4JGS A;  1CXZ B;  2ZM6 B;  5JH7 B;  2RMK B;  3ML0 A;  3N2K A;  1VQ9 V;  5C93 A;  1NTK H;  1MG1 A;  2ZE7 A;  3HKE A;  1XQ8 A;  4DV6 O;  5JVD B;  4UCR A;  2LFS A;  2FB5 A;  1PKX A;  2PI5 A;  2FYU H;  3GWK C;  1F51 A;  2Q7E A;  1AIL A;  1D5A A;  4DR4 B;  1EN5 A;  3DXR A;  1RP3 B;  4LP8 A;  3U11 A;  4X1K B;  1GMG A;  2DW4 A;  4O4H A;  4GYC B;  2IJK A;  3STZ C;  4JI3 B;  1WA8 B;  1YI2 V;  2H3O A;  3RYF A;  2OCC C;  2CTQ A;  4PEL A;  2IU0 A;  4X89 A;  2M7W A;  4HNA A;  3QO7 A;  4JTD B;  1XMQ O;  1EM1 A;  2BOB C;  3UT5 B;  3KKY A;  4TV9 B;  1QLE B;  1VQ6 V;  4DW0 A;  2JEX A;  1JQ0 A;  3JAR B;  2HJF C;  2F4V B;  4IHJ B;  1SQF A;  2F66 C;  5J2T B;  3CJH A;  3LUT B;  1IBL O;  1PL0 A;  5EIB D;  2ZE5 A;  3BPZ A;  3OM3 B;  3JAK A;  1Q81 W;  3A0B Z;  3ASN C;  2ZCE A;  5F2V O;  4UVA A;  3CS5 A;  4CC5 A;  2A9H A;  4RAI A;  3X2Q C;  3K04 A;  1SF9 A;  4X66 B;  2XND G;  3C90 A;  4Z2W A;  2CH7 B;  3N2K B;  1QU7 A;  4B7K A;  1YTF B;  3HKE B;  4ZOL B;  2Q6A A;  4LF7 B;  1HR0 O;  3SPJ A;  1JJ2 U;  4X1Y A;  3CRQ A;  2Y69 C;  3H1H H;  2F1M A;  1IBM B;  2ZNJ A;  1XMO B;  2AHY A;  2UXX A;  2ILM A;  4TT3 G;  1JCH A;  3G6E V;  4O4H B;  3TXQ A;  2JS5 A;  2DWD C;  4U3J A;  3RYF B;  3IAY A;  4Z1M G;  4DO2 A;  2UXC O;  1EN4 A;  4CS4 A;  5GW7 A;  4PA6 A;  3STL C;  2Y4T A;  4PHZ A;  5IYD O;  1PP9 H;  3UQ8 A;  2XAS A;  4LFC O;  4UXN A;  1IXB A;  1P84 F;  3T2M A;  4FZ0 A;  2BTO A;  3CD6 V;  2VWK A;  3CJH B;  1UJW B;  1JA8 A;  3UCS C;  1YTF D;  1MNG A;  2CAZ C;  1TVK A;  4J42 A;  4FLU A;  3CEI A;  3JAK B;  1S5H C;  3E22 A;  2HG5 C;  4LFA B;  2LGW A;  2AZ0 A;  2D3O W;  1ZSP A;  3VQV A;  5DN6 G;  4TQF A;  4F6E A;  3K57 A;  3OMN B;  2ZD9 A;  1K8A W;  2R72 A;  5KHK A;  3LSU A;  4X62 O;  1N8R W;  5JCO A;  3SYO A;  3HKB A;  3BCC H;  4J7J A;  4DUZ O;  4FLV A;  4X1Y B;  5CMU A;  4BIO A;  2Y0P A;  2YSU B;  4BW9 A;  2QDO A;  3CRA A;  4I9W A;  1P7B A;  2FML A;  3KCY A;  1SQP H;  3OEE G;  3ZIA G;  3BRC A;  3ZHV A;  3ETD A;  1KQS U;  1AP5 A;  4XDK A;  2LQT A;  1N33 O;  4KL1 A;  4U3J B;  4UUJ C;  1URF A;  5CB4 A;  2YIB D;  4RO2 A;  2JJ2 G;  3AG4 C;  3R65 A;  3QG5 A;  2OIG A;  5KHJ A;  3MHS C;  5FPO A;  1AI5 A;  1H2M A;  2ZIN A;  3ETQ A;  4YIO A;  4FVM A;  4UVC A;  1WNS A;  3FYI B;  3AG1 B;  1AJQ A;  2EIN C;  3WB1 A;  1S5J A;  3OEH G;  1E1R G;  1TVK B;  5TIS Z;  2ADP A;  2LO1 A;  1IX9 A;  3LDC A;  4JI8 B;  4I7Z B;  2DMX A;  3E22 B;  3ABL B;  2K9P A;  2NNU A;  2YXY A;  2C2A A;  3HR0 A;  1KB9 F;  4LF8 B;  1F4M A;  5B1N A;  4LF9 B;  2W0F C;  4OPA A;  3ZBH A;  2YUA A;  1M57 C;  4AQY O;  2XTA A;  3QO8 A;  1G1X B;  4PDV A;  1SZX A;  3HKB B;  4D6T H;  3N27 A;  4PA7 A;  4ICG A;  1AB3 A;  5L3G A;  3K59 A;  2VQE O;  1CP9 A;  4PI0 A;  2WLH A;  3ASO C;  5IYC O;  4J11 A;  1PNL A;  1YSC A;  4X1I A;  1RPO A;  5CB4 B;  2IBZ H;  1FXK C;  4DK1 A;  4G28 B;  1RM1 C;  5DED A;  1J5E B;  2QTO A;  1V9P A;  4JTC B;  2ZR2 A;  4LFB B;  2HKO A;  1KP2 A;  4PDR A;  1Q90 D;  4FM2 A;  2LFR A;  1MZE A;  3SJC C;  4G2K A;  1OCR B;  3OMA B;  2P90 A;  5IYB O;  1SS3 A;  4P2Z A;  2EZP A;  1MZF A;  4CH4 A;  3CXH F;  1KUQ A;  3BVO A;  2RCV A;  1Q5O A;  3ZRW A;  2XAQ A;  1VQ7 V;  2BE3 A;  5LMU B;  2QKS A;  3FKS G;  4JI5 O;  1MSD A;  4BW5 A;  2AZ2 A;  1H8E G;  2FKX A;  3JYC A;  1W0J G;  1I0H A;  2ZIM A;  1QVF U;  1G8M A;  1R73 A;  4DV1 O;  3OW2 U;  1S5L Z;  4K8X A;  3C3T A;  1VQ5 V;  4AIL C;  1T5E A;  1JR9 A;  2EIJ C;  1PD3 A;  4MTG A;  3ZCC A;  5GTH Z;  4GX0 A;  5EK0 A;  2F93 B;  1BQZ A;  2N05 A;  5EC2 C;  2P7T C;  3ICX A;  1TUB A;  1OCZ B;  2EIK C;  3QNE A;  2UXB O;  1XHX A;  3WB2 A;  2HP8 A;  1VF5 B;  1S72 V;  1N36 O;  4I55 A;  4DR3 O;  3B8M A;  3NXS A;  5J2U A;  2LJ2 A;  4X20 A;  2WLJ A;  4X1I B;  2ITD C;  4GCZ A;  4UFZ A;  2QM8 A;  2WLN A;  5IY5 B;  3H1I H;  2DJV A;  4LR3 A;  1QLN A;  2YIA A;  3T1H B;  2ZT9 B;  3I5D A;  5KA5 A;  4FPP A;  3FD9 A;  3G67 A;  1NH2 B;  1X59 A;  1PNM A;  1N34 O;  2G38 A;  4DUY B;  2BTQ A;  1GK9 A;  2WLI A;  4UB8 Z;  3ZRW B;  1G6U A;  2WA4 A;  4CS3 A;  1VP7 A;  3IC9 A;  4ABM A;  2DE0 X;  3OUS A;  2E3C A;  5A2Q N;  1B3Q A;  4DV0 O;  5LOV A;  3EXA A;  3ABU A;  3BY6 A;  2HJD A;  3AEI A;  4RQF A;  5CN0 A;  3APQ A;  3FAV A;  4F4L A;  1VAR A;  3D3Q A;  3AK1 A;  2IJH A;  2OCC B;  2JDI G;  3DSQ A;  1H2K A;  5IE9 A;  1TUB B;  4I4T A;  3W7W A;  1FXV A;  4GKJ O;  4PV1 B;  1ENV A;  1YEW A;  3CRR A;  4I5S A;  4LC1 A;  3WG7 C;  4I55 B;  1W2B U;  3RBZ A;  1Y76 A;  5J2U B;  5L3B A;  2UUB B;  1V54 C;  4X20 B;  5H9C A;  1K97 A;  3DTU B;  1IBK B;  3O65 A;  1BSM A;  1GTO A;  2KG7 A;  5KX5 B;  3ASN B;  1KMI Z;  3CHX A;  5L3F A;  4G27 B;  3A2F A;  3AG2 B;  3X2Q B;  2GV9 A;  3KCX A;  1MSW D;  5EBL C;  2EIL C;  4MS2 A;  4DR3 B;  2ZM6 O;  2BTQ B;  5B3S B;  3RWR D;  3OTO B;  2DYS C;  2GSM B;  3CCJ V;  4DV5 B;  1VQO V;  3CRC A;  4JAV A;  3KG2 A;  4JTA B;  5LOV B;  1QCE A;  5LP6 A;  2AHZ A;  4DR4 O;  4P9P A;  4K0K B;  3FAV B;  3ZHU A;  3OFN G;  4X64 B;  2CGO A;  2EIM C;  3I56 V;  1F7Y A;  5KA6 A;  1R3I C;  2QA4 V;  4FLT A;  3T4Z A;  3CCQ V;  1QR8 A;  4NKG B;  3OE7 G;  3FB5 C;  4I4T B;  2QSA A;  3BA9 A;  3CPW U;  2GBO A;  3CC4 V;  4JI6 B;  2CTW A;  3O9O A;  4WFF A;  4J7Z A;  3ZHS A;  2LGQ A;  2WWW A;  1GN4 A;  3B09 A;  2E5L B;  5CBF A;  1Y76 B;  1JOY A;  2F4V O;  2GUZ A;  1L8D A;  3QVN A;  1PPJ H;  2CGN A;  2QKC A;  3ZHT A;  2KG7 B;  3ZMV A;  5IWA B;  3JAS B;  1TUE B;  1M5I A;  4N21 A;  1CEZ A;  2QJ1 A;  4X66 O;  4IT5 A;  1HP8 A;  4KP4 A;  4DR1 B;  1LUW A;  2IM9 A;  4GT1 A;  2YS8 A;  1BHB A;  4LF6 B;  2XUM A;  1VQ8 V;  1Y74 A;  2R9I A;  4LF7 O;  1JMK C;  3E8B A;  4GX1 A;  3UO3 A;  3P30 A;  1VF6 C;  3CSX A;  1R3J C;  2A79 B;  5KLV H;  1IBM O;  5LP6 B;  2DQ3 A;  5LL6 Y;  1XMO O;  1CPY A;  1GN6 A;  4WCE V;  5LYJ A;  3G71 V;  5D5P A;  1I7F A;  2GTS A;  1VQL V;  2K1E A;  4HYO A;  1FXK A;  4E2L A;  4PA9 A;  3SPC A;  4JV5 B;  3AG4 B;  1S3J A;  3ZX6 A;  3E8G A;  1R6N A;  2R9R B;  2UXN A;  3TGU H;  1AVM A;  1K7D A;  1BHA A;  2WLL A;  3SYA A;  1YJW V;  2IJI A;  4DK0 A;  1S0V A;  2GUZ B;  3J80 N;  5KMG A;  1Q82 W;  3FB7 C;  4UCT A;  3U0Z A;  3J81 N;  4FLZ A;  3GVM A;  1NS1 A;  4FLY A;  4JZ2 A;  3K03 A;  4LFA O;  4GX5 A;  4J41 A;  4OGQ B;  1OHH G;  3RFR A;  1MMM A;  3CE2 A;  4O2B B; 
#chains in the Genus database with same CATH homology
 3B8N A;  4CBC A;  3ZIA G;  1NJI W;  3SJQ C;  1JPX A;  1W0K G;  3ETD A;  3SPG A;  4QJF B;  1KQS U;  2OTL V;  1DF4 A;  4XDK A;  4UVB A;  4ZBM A;  5LGT A;  3ABM C;  4UUJ C;  2ZQM A;  3SPH A;  1NBM G;  4UV8 A;  1H2G A;  3E8H A;  4RO2 A;  4WFB V;  2JJ2 G;  3AG4 C;  3R65 A;  3FYE B;  3MHS C;  1AI5 A;  3CCM V;  1EZJ A;  1WLE A;  4JF3 A;  1OCO C;  3HB3 B;  1NVP D;  1AJN A;  2XAJ A;  1PNK A;  4MSW C;  1Q86 W;  1OCR C;  4UVC A;  3SYQ A;  5BZB A;  3FYI B;  3AG1 B;  4L87 A;  1AJQ A;  5LHI A;  2EIN C;  3EFF K;  3W7T A;  3OEH G;  1E1R G;  4FK5 C;  4KFM A;  1RM1 B;  4WF9 V;  1FS0 G;  2ZXW C;  3LDC A;  1KP3 A;  3ABL B;  3M99 B;  4R50 A;  5H6R A;  3CMA V;  2B1I A;  2NNU A;  5EBW C;  1K73 W;  1S77 D;  3B77 A;  2C2A A;  4EKW A;  3EHB B;  3OR6 C;  2WLL B;  1F4M A;  3JD1 A;  5B1N A;  1ORQ C;  4MW8 A;  2B1G A;  2W0F C;  5L3D A;  5HFM A;  3ZMZ A;  1VQ4 V;  1I5Y A;  4QE7 A;  1M57 C;  1OCC C;  3E89 A;  3QO8 A;  4R6Z A;  4PDV A;  2QE7 G;  3T1C A;  3ZJZ A;  5EC1 C;  1JVM A;  5CBH A;  2W6J G;  4HAM A;  4PA7 A;  3IFX A;  2X6B A;  4MW3 A;  1OCZ C;  2V1D A;  5L3G A;  1SER A;  3FB6 C;  3JCZ A;  4BIZ A;  1CP9 A;  4FIP C;  4Q20 A;  1SET A;  5EBM C;  5L3E A;  2V7Q G;  2WLH A;  3ASO C;  4ASU G;  1R6K A;  3W7S A;  2H94 A;  4BIU A;  5IYC O;  3BEH A;  1PNL A;  1S76 D;  2IW5 A;  3RVY A;  3ABT A;  3TCU A;  4XDL A;  1BL8 A;  1K5S A;  3ABM B;  1YSC A;  1RPO A;  5B1O A;  1GKF A;  1FXK C;  4G28 B;  1RM1 C;  3HPL C;  4U7N A;  2P6J A;  2QTO A;  3ABK C;  3LDD A;  5KUK A;  4WFA V;  2B5U A;  2YEV A;  4JTC B;  2ZR2 A;  4CZZ A;  2ZDI C;  2HKO A;  1B6Q A;  1K92 A;  3I55 V;  1KP2 A;  1OCO B;  4PDR A;  2Q68 A;  5LBQ A;  4MVZ A;  1NH2 D;  2LFR A;  1DTO A;  5CBG A;  2P67 A;  4FMT A;  1LNQ A;  1OCR B;  3OMA B;  4G2K A;  1K34 A;  1Y66 A;  2P90 A;  4DXW A;  5IYB O;  4P2Z A;  2EZP A;  3P32 A;  2EIN B;  5B1B C;  1H38 A;  1SES A;  3ZRW A;  4GX2 A;  2XAQ A;  5LHG A;  1VQ7 V;  4TSF G;  3E83 A;  4JPR A;  2ZXW B;  1MAB G;  2QKS A;  3FKS G;  4OXS A;  2XOK G;  2FTK A;  1V55 C;  2HR3 A;  3DGE A;  4BW5 A;  3W7X A;  2QEX V;  1H8E G;  2DYR C;  3JYC A;  3CC7 V;  1W0J G;  3K06 A;  2OT5 A;  1I5X A;  3H01 A;  3JD4 A;  1G8M A;  1QVF U;  1R73 A;  3OW2 U;  4QPK A;  2EBO A;  4ZKI A;  2WAM A;  1VQ5 V;  1L1F A;  1M57 B;  1OCC B;  2EIJ C;  4BAY A;  1PD3 A;  4MTG A;  3ZCC A;  1FFT B;  1THZ A;  2HLD G;  3SPI A;  4GX0 A;  3OMI B;  5EK0 A;  3E35 A;  3UKM A;  4PA4 A;  5EC2 C;  3VOU A;  2P7T C;  5H6Q A;  3ETE A;  3CCL V;  1OCZ B;  2EIK C;  4N23 A;  2EJR A;  3PJS K;  3QNE A;  3WFV A;  1K5Q A;  3JD2 A;  1F23 A;  3ZRX A;  2Z5U A;  1KKD A;  4QIW F;  1S72 V;  3ASO B;  3LSS A;  1YIJ V;  3ZMU A;  3MD0 A;  3B8M A;  3NXS A;  3OR7 C;  2WLJ A;  3IGA C;  1E1Q G;  1HWY A;  2JK5 C;  2ITD C;  4GCZ A;  3AG3 C;  2XAH A;  4QNH B;  1AJP A;  1FXK B;  1K4D C;  1GM8 A;  2W6I G;  2QM8 A;  2WLN A;  3ABK B;  5IY5 B;  5LGN A;  4H37 A;  4MT8 A;  5CA3 A;  2YEV B;  1SZT A;  1QLN A;  2ATK C;  3OUF A;  2QM7 A;  4XDJ A;  3AG2 C;  5LGU A;  1NQT A;  1ARO P;  1OZ0 A;  4JYB A;  1QBZ A;  1M1K W;  5KA5 A;  2MK3 A;  2WSS G;  4FPP A;  4WFH A;  1NH2 B;  5B1A C;  3K79 A;  4J9Y B;  1PNM A;  3CC2 V;  1VQK V;  3QO5 A;  2X6C A;  5B1B B;  3D3I A;  1GK9 A;  2WLI A;  2CK3 G;  4MVM A;  5B3S C;  2PI4 A;  3ZRW B;  3K0G A;  3CYO A;  1F4N A;  1AI7 A;  3ZMS A;  3CME V;  3LSQ A;  2A0L A;  3OUS A;  1V55 B;  4XBF A;  3W7U A;  4UV9 A;  4MVO A;  2DYR B;  4RUF A;  1QLE C;  1RPR A;  2IH1 C;  3RW0 A;  3ABU A;  3BY6 A;  4RQF A;  3AEI A;  1YJN V;  2EIL B;  5CN0 A;  3TET A;  3CCU V;  1COW G;  4F4L A;  4FJC C;  1QR9 A;  2Q69 A;  2IJH A;  3CCV V;  4JAU A;  2EIJ B;  2WPD G;  1M56 C;  2X6A A;  2XAF A;  2OCC B;  4KUM A;  1KEC A;  3TK1 A;  2JDI G;  1WPX A;  1DF5 A;  5IY5 C;  2EIK B;  4YXW G;  3W7W A;  2JIZ G;  1FXV A;  1MOF A;  2JEU A;  5J9P C;  2NLJ C;  3LDE A;  1GM9 A;  1ENV A;  1DLB A;  4PDL A;  1VQM V;  2GHY A;  4JGS A;  4QPJ A;  4I5S A;  4LC1 A;  3WG7 C;  1W2B U;  1Q7Y W;  2H8P C;  3RBZ A;  5L3B A;  3ML0 A;  1V54 C;  3K08 A;  1H8H G;  5H9C A;  1VQ9 V;  4LCU C;  1K97 A;  3G4S V;  3AG3 B;  1YJ9 V;  5C93 A;  1MG1 A;  3DTU B;  1GTO A;  3ASN B;  5L3F A;  2LFS A;  4G27 B;  1PKX A;  3LNM B;  2PI5 A;  3AG2 B;  3X2Q B;  3FB8 C;  1YIT V;  1F51 A;  4MTF A;  3ZMT A;  1K33 A;  1MSW D;  5EBL C;  1YHQ V;  5B1A B;  2EIL C;  3CCR V;  4LP8 A;  4MS2 A;  1GMG A;  3ZN0 A;  1K3E A;  2DW4 A;  2IJK A;  3STZ C;  5B3S B;  3F5W C;  1YI2 V;  4MVQ A;  2DYS C;  2GSM B;  3CCJ V;  2HVJ C;  2IH3 C;  2OCC C;  3MHH C;  4PEL A;  2IU0 A;  4X89 A;  1XL6 A;  1VQO V;  5L3C A;  4J9Z B;  2M7W A;  4P30 A;  1KC8 W;  3QO7 A;  1NKD A;  4JAV A;  4JTD B;  1K9M W;  2BOB C;  4JAS A;  3KG2 A;  4JTA B;  1QLE B;  3SYC A;  3OAA G;  1VQ6 V;  2JEX A;  4X8A A;  1JQ0 A;  1QCE A;  2AHZ A;  3CP1 A;  2HJF C;  4P9P A;  5FL7 G;  3OFN G;  2F43 G;  2EIM C;  3I56 V;  5KA6 A;  3GB7 C;  1M56 B;  1R3I C;  2HFE C;  3LUT B;  2QA4 V;  3IC7 A;  1PL0 A;  3T4Z A;  4X88 A;  3CCQ V;  1QR8 A;  3OM3 B;  2DWE C;  1P4R A;  1NR1 A;  3OE7 G;  4LBE C;  1KD1 W;  1AI6 A;  1FXH A;  5LHH A;  3FB5 C;  1Q81 W;  3E86 A;  3ASN C;  4TWK A;  2HVK C;  3CPW U;  3CCS V;  2WLK A;  3CC4 V;  4UVA A;  2DQ0 A;  2A9H A;  4RAI A;  4WFF A;  3X2Q C;  3K04 A;  3CCE V;  2WWW A;  4MTX A;  5CBF A;  4HZ3 A;  2XND G;  3WG7 B;  1QVG U;  3VBB A;  1JOY A;  1SRY A;  1EFR G;  1V54 B;  1EBO A;  1YTF B;  2Q6A A;  2Z3Y A;  3ZMV A;  3SPJ A;  1JJ2 U;  1JX9 A;  3ZRV A;  3K3W A;  2X0L A;  4P9O A;  2Y69 C;  2Y48 A;  1VQN V;  1TUE B;  1ZWI C;  4N21 A;  1CEZ A;  1M9N A;  2AHY A;  1G4Y B;  2UXX A;  5E1A C;  1VQP V;  4MVR A;  4TT3 G;  1JCH A;  3G6E V;  2WLM A;  3OGC C;  4R7C A;  4KP4 A;  2IJJ A;  4GT1 A;  4MVU A;  2DWD C;  3UM7 A;  2DYS B;  1BHB A;  3RVZ A;  4Z1M G;  4MVS A;  4DO2 A;  4JYC A;  4H33 A;  3A0R A;  2ZR3 A;  5KUM A;  1VQ8 V;  2OTJ V;  1R3K C;  2X7R B;  3E8F A;  4RUE A;  2R9I A;  5GW7 A;  1J95 A;  4PA6 A;  4PA3 A;  3STL C;  1XL4 A;  3E8B A;  4GX1 A;  3P30 A;  1R3L C;  1R3J C;  2A79 B;  5IYD O;  3GWO A;  2XAS A;  4UXN A;  2DQ3 A;  3T2M A;  4WFG A;  2BOC C;  1CPY A;  3JD0 A;  2IU3 A;  2Q67 A;  4WCE V;  3G71 V;  3CD6 V;  1Y4M A;  3AG1 C;  1UJW B;  3ETG A;  2EIM B;  2KB1 A;  5HFL A;  3D36 A;  1AI4 A;  1YTF D;  1VQL V;  2K1E A;  4HYO A;  1FXK A;  4E2L A;  4PA9 A;  1BMF G;  3SPC A;  3K0D A;  1ROP A;  3F7Y C;  3AG4 B;  4R8C A;  1S3J A;  5DM6 V;  1E79 G;  1R6N A;  1S5H C;  3ABL C;  2R9R B;  2HG5 C;  2UXN A;  3E8G A;  3CXC U;  2JJ1 G;  3E2E A;  3K9A A;  2ZDI A;  2EZO A;  2D3O W;  1K7D A;  1AR1 B;  1BHA A;  3JD3 A;  5DN6 G;  1GM7 A;  2WLL A;  3SYA A;  1NVP B;  3OMN B;  4WFE A;  1IXM A;  1YJW V;  2ZD9 A;  4MTO A;  1K4C C;  2ITC C;  1K8A W;  2IJI A;  1S0V A;  1Q82 W;  2WLI B;  3FB7 C;  3SYP A;  1NR7 A;  3T4D A;  1GO3 F;  3F7V C;  1N8R W;  2XAG A;  3SYO A;  5IDJ A;  3ZN1 A;  4U7O A;  1M90 W;  3K03 A;  2LP7 A;  5CMU A;  3ZRS A;  2YSU B;  2Y69 B;  4GX5 A;  1P7B A;  4I9W A;  1OHH G;  4RQE A;  4QE9 A;  3OEE G;  4PDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...