3K08A

Crystal structure of cng mimicking nak mutant, nak-ntpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGNTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k08A00
2BOCC 2EILC 4R6ZA 3BEHA 2P7TC 5J9PC 2K1EA 3STLC 4HYOA 1XL4A 3SPJA 4PDVA 1XL6A 3ABKC 3E89A 3F7VC 4PA6A 4X88A 5EBLC 3AG4C 4JTAB 3OUFA 5B1BC 3UKMA 4MTFA 5EK0A 3RBZA 2EIMC 3T1CA 2WLMA 4WFGA 3FB7C 3AG3C 3ASOC 4MS2A 1QLEC 2WLIB 4RUFA 1JVMA 2YEVA 3AG2C 4F4LA 4CBCA 3TETA 2QKSA 4R7CA 2ZD9A 2DYSC 3R65A 1M57C 2HVJC 3FB6C 4PA4A 2AHZA 3SPCA 1LNQA 2WLHA 3UM7A 3WG7C 4EKWA 2ITCC 4R50A 4JTCB 3OGCC 1M56C 2HJFC 3SPIA 2ZXWC 3FB5C 2NLJC 4GX1A 4KFMA 4XDLA 5BZBA 3SYAA 3OR6C 2R9RB 1OCRC 4J9ZB 1P7BA 2EIKC 4MSWC 3RVYA 4BW5A 3K08A 1S5HC 3T2MA 4PA7A 3TCUA 2H8PC 5B3SC 5CBFA 2KB1A 2DWDC 4MVUA 3LDCA 2Q67A 5KUMA 2DWEC 3K06A 4GX0A 3RVZA 3JYCA 2AHYA 5KUKA 2Y69C 3AG1C 4MTGA 3SYPA 3E83A 4MW3A 3SYCA 3LDEA 5EBWC 3E86A 4J9YB 3SYQA 2IH1C 2EIJC 4G28B 4I9WA 4P9OA 2W0FC 3KG2A 4QE9A 4XDKA 3EFFK 4MTOA 5EC1C 5B1AC 3STZC 1R3JC 4PDMA 4R8CA 4P2ZA 3SYOA 3X2QC 2WLIA 3E8FA 4MVOA 1OCCC 1V55C 1BL8A 3RW0A 3K03A 4X8AA 4H37A 4LBEC 1KKDA 3E8GA 4MVRA 3ZRSA 1J95A 4QE7A 3FB8C 4MVMA 2X6BA 2WLLB 4UUJC 1OCOC 4JTDB 3K04A 3ABLC 2JK5C 4LCUC 4RAIA 4H33A 2WLNA 3HPLC 4MW8A 2IH3C 4PDRA 1R3IC 1K4CC 5EBMC 4WFEA 3ASNC 1R3KC 3IFXA 3T4ZA 3VOUA 2Q69A 4MVSA 3ABMC 4PA9A 3SPHA 4XDJA 2HFEC 2A79B 3PJSK 3LNMB 2ATKC 1V54C 1K4DC 4P30A 4TWKA 2ITDC 4HZ3A 3E8HA 4PDLA 2BOBC 2X6CA 4RUEA 4WFFA 3E8BA 4MVQA 4WFHA 2OCCC 1ORQC 3LDDA 4G27B 4ZBMA 3T4DA 3F7YC 2WLKA 5E1AC 4OXSA 4QNHB 2WLJA 3OR7C 2Q68A 3OUSA 5IY5C 3IGAC 2A9HA 2HVKC 3K0GA 3GB7C 4PA3A 5CBGA 2QTOA 3LUTB 5EC2C 3SPGA 3K0DA 4GX5A 1OCZC 2HG5C 2EINC 1R3LC 4LP8A 3F5WC 5CBHA 2A0LA 2WLLA 2Q6AA 4X89A 4MVZA 1ZWIC 4DXWA 3ZJZA 2DYRC 4P9PA 3SJQC 2X6AA 4GX2A 4RO2A 1G4YB
chains in the Genus database with same CATH superfamily
1SRYA 4WBNB 4OPHA 1SERA 1RP3B 1YEWA 4H13B 5JQGA 1S72V 3H01A 2EULA 3OGIB 4TUYB 5EK0A 4O4LB 3O9OA 1QBZA 3AG3C 1THZA 4CBCA 1MMMA 3CCVV 1TUBB 5J9PC 5JH7A 5LHHA 2AHZA 5B1BB 1AB3A 3CC7V 1AJPA 2NLJC 4DV1O 4GLXA 4DV2B 2OT5A 1Q6UA 2DJVA 3CXCU 2IBZH 3W7TA 2LFRA 3CHXA 1RPOA 4DR7B 5LMNO 1COWG 2QKAA 5JQGB 1HNZB 3CPWU 1OCRB 4RQEA 1EFRG 4OX9B 1WP7A 4HAMA 1F4MA 1S5JA 2P4VA 1ZTEA 1VIBA 1N32B 2QKCA 5JH7B 2YS8A 4TV9B 3WB1A 1TUEB 2JDIG 5EZYA 2WLNA 3L9DA 4NTWA 1R3IC 1XHZA 5CA3A 5CA0B 4PD4F 4DR2O 4LF8O 1Q90D 4KXRA 2ITDC 3E8HA 2X6CA 4X1KB 4X62O 2CH7B 1F7YA 2HLDG 2YXLA 4DO2A 3T1HB 4AQYB 4CH3A 3BFRA 1XDCA 1S76D 4PA3A 3CCLV 2UXBO 4I5SA 4UB8Z 3RYCA 4DYLA 1VQ8V 2FL4A 2X6AA 4NTXA 5LHIA 5KA6A 4LF4B 4D6TH 1NTZH 3J81N 3SDLA 3AG3B 2P7TC 3TK1A 1KYOF 1NTMH 1SA0B 1GH6A 5KA5A 4PHZA 1Z5WA 5DEDA 2OTJV 1HNXB 2PTMA 3TXSA 1PV0A 3W7WA 1NU1H 4BAYA 3N2GA 3HKBB 1YITV 3OTFA 3ZHTA 1N4CA 3B40A 3L72H 2H8PC 4MVUA 5FPRA 3B8NA 1PD3A 3K06A 4GX0A 2HHHB 1WA8B 5EYPA 4CH5A 5IWAO 3JALA 4O2AA 4TV8A 4XDKA 4Q20A 3L75H 4H0LB 1X4TA 1CXZB 4R8CA 4UCOA 2FKXA 3RYFA 2OIEA 1PNMA 2QDOA 4B3SB 1XOUA 2K9PA 4ABMA 4E4EA 4WFAV 4K8XA 3I5DA 2XT9A 3K5NA 2ZDIC 3HPLC 2CTWA 3CMEV 1FKAO 2XOKG 1V55B 1J5EO 1KC8W 3T4ZA 3VOUA 1SKVA 2Q69A 2QR4A 3OMAB 3ML0A 3SPHA 2LFSA 1VARA 1G8MA 4DV7B 5LGTA 3B77A 2UU9B 4K0KO 1FFTB 5H5NA 5E1AC 3FD9A 4QNHB 1PM9A 5BMVB 1U97A 1Y74A 3M8AA 3WB2A 3RYFB 4DR3O 1R3LC 3VBBA 4DR5B 2Q6AA 4X89A 4DV6O 5J2TB 4D7SA 1NJIW 4UCUA 4CS2A 2LW1A 2BOCC 2EILC 1FXHA 3SPJA 1F51A 1LUVA 3FYIB 4TSFG 4G2KA 2Y0IA 2F23A 1IBLO 2WLIB 2ZDIA 4X64B 3JD4A 3SPCA 1QNMA 4BIZA 3OMNB 5EIBD 1HNWB 1M56C 5BZBA 2HKOA 3SYAA 2R9RB 4ICGA 1P7BA 1TA8A 3ZMUA 4UVCA 3ABTA 2G38A 4LH7A 2QM7A 5FPOA 1TVKB 1XREA 3THOA 2DQ0A 1ZX3A 1BQZA 3P3PA 1S3JA 3JATA 1K5QA 1SF9A 2IW5A 3ZRWB 3CX5F 2IH1C 2FB5A 1GN6A 4X65B 1S77D 1FXKC 1QU7A 1IVSA 2ZM6O 2Q7EA 3OD4A 2A7WA 3H1HH 3ZRSA 5LMUB 3LSQA 4QE7A 3ZRVA 2ZE6A 2R72A 4JV5B 3QTCA 4RAIA 4H33A 4F6RA 4DV4B 1ENVA 1XNQO 1DF4A 1K33A 1ZL8B 1R3KC 2ZNIA 1UFIA 3ABLB 4WFFA 1HR0O 2N04A 3JD0A 1L8DA 1W59A 4ZOLA 5IY5C 4IGGA 1H38A 3D8CA 3K0GA 4DW1A 1YDXA 5FL7G 3LUTB 4GKKO 5IT9N 1SZTA 4FM1A 2ZT9B 3GWKC 2Q8VA 4DV1B 2CE4A 1KUQA 4FLWA 1FXKA 4R6ZA 5H2FZ 5ITZA 4LFCO 1XL4A 5KHIA 4JTAB 4U3JB 4KHPO 1N0NA 4K35A 2JGDB 1RSOB 4JYCA 5D5PA 5LMNB 4A5UB 1KECA 1R73A 1JVMA 1JA8A 3R65A 3B4SA 1I94O 1IBMO 1P7GA 2PYJA 2ADQB 3CCEV 4X20A 1JCHA 2F43G 4J10A 4UXNA 1YZBA 3T2MA 5CBFA 2KB1A 3LDCA 4FIPC 3CC2V 4DR2B 4LF8B 3TXQA 3I56V 4MW3A 3CCSV 4UV8A 2Z3YA 4J11A 4JZ2A 2W0FC 2FTKA 2DQ3A 2YXHA 4X62B 3HR0A 2UUAO 2Q9LA 1Z2GA 1NT2B 1GN4A 2W6JG 2XAJA 3ETGA 4LF7O 1N33O 1OCOC 2UXBB 1L0NH 2KG7B 3AK2A 4MW8A 4PDRA 4IYIA 5DN6G 5KX5B 1XQ8A 3APQA 4YJ3A 1VQNV 4B3MO 4J42A 4JI5O 5IY5B 1D2DA 1CPYA 4CC6A 1ZAUA 4I55A 1BT8A 1Q43A 2JJ1G 2LQTA 1K7DA 2QA4V 3I55V 2ZQMA 3BA9A 1D5NA 2GTSA 3NR7A 5CBGA 3CCJV 3PN1A 2F95B 1IBKO 1K97A 3BVOA 2DMXA 5IJ0B 1ZSPA 2V7QG 4O4HB 2WLLA 1E1QG 1US6A 1FD9A 2QWQB 1M9NA 1LUWA 1K73W 1JJ2U 1QHTA 3L71H 1MOFA 1XL6A 1S0VA 4MTFA 4TT3G 4DR4O 3UT5B 3AG7A 4Z1MG 3ICXA 1YCIA 4JI0O 5IWAB 4JI8O 2C2AA 4N23A 3Q4HB 3AG2C 4F4LA 4R7CA 2OCHA 2PI5A 3FYEB 3CCQV 3CC4V 4YXWG 1LNQA 2KKWA 2WLHA 2PY5A 2AZ2A 2Y4UA 4H44B 2EIKC 4CC5A 4MSWC 1VQOV 1DGSA 3K08A 1S5HC 4FLYA 1I5XA 1VF5B 2ZE8A 2QE7G 2DYSB 3B09A 1J5EB 2PF4E 4FK5C 3AG1C 3O65A 3SYPA 2UUCO 2UXCO 3KG2A 2AGAA 5CA1A 3K57A 1OCOB 1F4NA 4BIOA 4MVOA 1OCCC 1SS3A 2P6JA 2EJRA 4FLUA 3MHSC 1U96A 2YC0A 1PL0A 4DR3B 4JTDB 2W6IG 2WPDG 4UCVA 5B1AB 2E75B 2JS5A 4DV6B 1XI1A 1EN6A 3SJAC 4AILC 2E74B 3X2QB 4JAVA 5JCOC 2EZOA 1E1RG 3HKCB 3FAVB 4FZ1A 3ETDA 3HKEB 1B6QA 1H8HG 3RFRA 1FS0G 3U0ZA 4FVMA 4I4TB 3RWRD 2AZ0A 2E3CA 1IBLB 3DC6A 5CA1B 4LNUB 4FFBA 1NKDA 1UPGA 5JVDB 4QPJA 3K0DA 1VQ5V 1DF5A 4LWSB 3DTUB 4LP8A 1AP5A 3M7MX 5CBHA 4ZHQA 2Q4PA 2YDEA 4B3RO 4GX2A 1ZLZA 3OFNG 1FFXA 1IURA 3D3IA 1OJHA 1NS1A 3STLC 1YVWA 3JSLA 4EB6A 3F7VC 5D5QA 3SR2C 3G4SV 4UFZA 1K34A 5K1XA 5K1PA 1B06A 1QLEC 2FMLA 3TGUH 1RM1B 1H8EG 3CCMV 4DR1O 5IYZB 3B8MA 5JCOA 3QVNA 1B3QA 3J80N 2ZM6B 3KZIZ 4I0XB 1R6KA 1XMQO 2OYQA 4NYKA 3BABA 1IZ3A 4I9QA 2LW7A 4BR6A 4J9ZB 5KLVH 3RVYA 1QVFU 4NTYA 1OZ0A 3HB3B 1XNQB 5KUMA 4YIPA 3K79A 4I9WA 2Z0AA 1KMIZ 1HR0B 1ZUQA 3EFFK 1MA1A 5LXTA 4JZGA 4Z1VA 4GUNA 1VF7A 4X8AA 2UXDO 1MSDA 3DGEA 2F66C 4MVMA 1YJNV 2X6BA 2Y0PA 3CYOA 2BTQB 4GKKB 5KHGA 1KBHA 4NR1A 3K9AA 2QWNB 3JD3A 2HEPA 1O9HA 5J2UA 5GONA 3KCXA 1IDSA 5KMGA 3JARA 3ABMC 4KUMA 4LFCB 5JWPA 2P5OA 3IC7A 2P67A 3QO5A 4KHPB 1ORQC 3BAAA 5KHHA 4O4IA 2A9HA 3ASNB 2ZR2A 1Y66A 4BIUA 3H1JH 1I94B 1IBMB 2QEXV 5HFMA 5L3BA 2R9AA 2Z5UA 3BEHA 1MSWD 4NXMO 4X88A 1Q82W 5C8YA 1BQ0A 4JASA 3ASOC 1L0LH 4U7NA 2JGUA 4FLZA 3TETA 2UUAB 5CN0A 2GDSA 3K9SA 3BA8A 4LF7B 4DV3O 1Q3EA 5EZYB 1N33B 2GTAA 3QF7A 3K59A 2OTLV 5CMUA 2E76B 3R66A 3JAWA 4JI4O 4B3MB 4IIJA 4X1YA 4JI5B 4JI2O 3LDEA 3ZHQA 4OPAA 1VF6A 4G28B 2VQEB 5HFLA 3STZC 1H2NA 1Y6XA 1MZFA 2ARHA 2PUSA 1BGYH 1BL8A 2QTSA 5LA6A 3OEEG 3P3NA 1SQFA 5B66Z 1IBKB 2L6LA 2Y4TA 3F5TA 3RYCB 1VQLV 3DXRA 2IH3C 1VQ7V 3ZHVA 4JGSA 1VQ4V 1CEZA 2PGGA 1DLBA 5DM6V 3IFXA 4MVSA 1FJGO 1F23A 3KKYA 3PJSK 4PDLA 4ZKIA 3ZRXA 4DR4B 2OCCC 3H9VA 1K5SA 2ADPA 4JI0B 3CP1A 4JI8B 1M5IA 1NH2B 1KU9A 1Y76A 3ZS8C 4JI7O 3W7SA 1T5EA 5EC2C 4J80A 3A0HZ 4X66O 1GN3A 1NVPB 3N2GB 2QWOB 4P9PA 4EFBA 1UJWB 1BHBA 1PKXA 1N34O 1YTFB 2XNDG 3ASOB 3UCSC 5IYDO 5EYPB 5KHJA 3AG4C 3RT3C 3JALB 4O2AB 4TV8B 1QQCA 4B7EA 2UUCB 4FFKA 1GM9A 2UXCB 1M4UA 3ZIAG 1MNGA 1M57C 4PI2A 4NKGB 3WG7C 4EKWA 2M6YA 5H6RA 2ZXWC 3FB5C 4GX1A 4D7TA 3CJHA 3P30A 3ZMZA 4JYBA 2GSMB 3BPZA 3CMAV 3UO3A 4F6EA 5KAIZ 2RNBA 2PZSA 1SQGA 4MTGA 5IYCO 3E86A 5EIBC 1H2MA 2EIJC 4PJ0Z 1Y74B 4CH4A 2B1IA 3E8GA 1J95A 1KD1W 1TGOA 1B04A 1FXVA 1PP9H 5IJ9A 2MW2B 4B3RB 2VS0A 3E22A 1QR9A 1M90W 4XDJA 2ATKC 1O9GA 1H2LA 3CRQA 3C3SA 1K92A 3JAKA 4OXSA 4DR1B 1G6UA 1WN7A 4QGPA 2DOSA 3JCUZ 1OCZC 2CGOA 1XMQB 2A0LA 4MVZA 1K9MW 3AG4B 1HP8A 4O2BA 2PI4A 1OHHG 4FLTA 1FYJA 1HWYA 4OGQB 1AJQA 3JATB 2ZE5A 3UKMA 1TAEA 3HKDA 2BSKA 1W0KG 5LOVA 3H1KH 4ZI7A 2IJKA 1SC5B 1PPJH 2ZXWB 2RDCA 1WB8A 4YHHO 2EILB 5IYBO 1V9PA 2HVJC 3UM7A 2UXDB 3OW2U 2Q0AA 4KFMA 4F6RB 1RPRA 4BW5A 1EBOA 2B1GA 2RMKB 4JF3A 3RVZA 3EXAA 2ZIMA 1M56B 3W7UA 4B7KA 3M99B 1LR1A 4LFAO 5FLXN 4MTOA 4ZOLB 2BSKB 3SYOA 1XNRO 3E8FA 5H6QA 4HNAA 2D2CB 4DR6O 2QM8A 3FB8C 4C7UA 1YI2V 1NTKH 1AI4A 2D3OW 1FPOA 2P90A 3ZN0A 1FXKB 5ITZB 1W2BU 5AG2A 3N2KA 4LH6A 1PL4A 4NXMB 2A79B 2ZCEA 3G71V 4P30A 5KHKA 2Y48A 4WFHA 1NBMG 1ROPA 5LGUA 2H94A 4W4KA 1OCZB 2N74A 2WLJA 5BR8O 2F1MA 3MDSA 2YXYA 3JASA 3ZEDA 4X20B 2CTRA 1SESA 1GKFA 4GX5A 3U11A 1YHQV 1W0JG 2DYRC 3H1LH 4I7ZB 4YJ2A 2V1DA 3E89A 5EBLC 4JI4B 4O4JA 3AK1A 2EIMC 4JI2B 3A2FA 2MK3A 5L3GA 2YEVA 2QWRB 2XUMA 4UB6Z 3SJBC 1BHAA 3FB6C 3QO8A 2ITCC 4R50A 3BRCA 2HJFC 3SPIA 3ZHUA 4NXNO 2DW4A 4L8JA 4DV0O 1FAFA 1GAXA 5JJJB 4U7OA 4YJ3B 4PA7A 2NN4A 4GT1A 2AXTZ 2IU3A 4Q6GA 1GTOA 3E83A 2R70A 1FJGB 5EBWC 3RYHA 4JYYA 1JPXA 3SYQA 4I55B 1A32A 2LGQA 2YUAA 4EFEA 4DW0A 4P2ZA 1X59A 3AEIA 3A0BZ 1KKDA 3UO2A 3A0RA 2P06A 2YICA 2WLLB 4JI7B 4FLVA 1Q7YW 3QG5A 4LF5O 2W0XA 4X66B 2B9ZA 2RN9A 1QR8A 2RCVA 5CB4A 4U3FH 1N34B 4B3TO 1JJOA 1AR4A 4WFEA 4PELA 2ZNJA 2H3OA 4ZIBA 4DUYO 2JEXA 4K0KB 1Q6HA 1K4DC 1I0HA 3EHBB 2XAQA 1Y4MA 4JI6O 2WLKA 3DSQA 2OIGA 1JFFA 5JJEB 4GYCB 3MHHC 5FNVA 2CTQA 3RYIA 2ZIOA 1YXBA 3F5WC 1EN5A 4B08A 1PNKA 4XBFA 1MZEA 4LF6O 1HW7A 4KP4A 4X9QA 2EIMB 3OAAG 1DTOA 5LYJA 4HYOA 2YIBD 4PDVA 4FMTA 5B1BC 4PV1B 2WA4A 3FB7C 4RWUA 4FJCC 1R6NA 2QM4A 3H1IH 4FM0A 2JVDA 4I50A 1GM7A 2Q7GA 4IYHA 1OCRC 2KSDA 5LGNA 3AG2B 1XMOO 1VQPV 3TCUA 1JQ0A 2DWDC 3JAMN 2UXXA 4WBNA 4QPKA 3ABUA 3WFVA 1QLNA 2AHYA 5LYJB 2GBOA 4UCSA 4TUYA 1XBLA 1AJNA 3WB0A 2EIKB 4UCTA 4CS4A 2CAZC 2P22C 4IL6Z 4J7JA 4FFBB 2A3QA 2IJJA 4DUZO 1SQPH 1SZXA 4TOIA 4WFBV 3CE2A 3AG1B 2O57A 4ZHQB 4JYAO 3K58A 2RJZA 3ZX6A 1FFXB 4YY3O 3CCRV 1MG1A 1OCCB 5L3DA 4EB6B 2BE3A 4PA9A 2JIZG 1Q81W 1I7FA 1K3EA 2HFEC 2RQ6A 4UCRA 1AI6A 1KQSU 1EN4A 2WAMA 5LHGA 3ZMSA 3OR7C 3IGAC 4YHHB 4J41A 3SPGA 2WWWA 1M1KW 4FPPA 4J7KA 1YSCA 4TV9A 1RFYA 3BY6A 3U10A 1MABG 3J7AU 1KP2A 3ABKC 5CA0A 1N36O 3T1CA 5LXTB 4TQFA 4LFAB 2ZINA 4X1KA 2CH7A 3ZN1A 3FFQA 1VF6C 1P49A 4FLXA 1XNRB 4JI1O 4PA4A 2CGNA 4DR6B 2L35A 3B2EE 1AROP 1QLEB 1KKCA 4JPRA 3N27A 5J2UB 5GONB 4LF9O 5B3SC 5KMGB 1XUQA 3JARB 2WSSG 1WJZA 2DWEC 2XTAA 2JS3A 3SYCA 1Q5OA 2EJ7A 1SA0A 4QE9A 2QWPB 2VWKA 4O4IB 4PDMA 1GRJA 3G6EV 1NH2D 1IXMA 2XASA 5BR8B 1V55C 3RW0A 3D3QA 4LBEC 4MVRA 1KP3A 5L3CA 1NVPD 4DV5O 1N8RW 1YTFD 2CTPA 1R1BA 2A06H 3QO7A 3HKBA 5BY1A 5E79Z 5C8YB 3RGBA 1V54C 4L87A 1WA8A 4HBNA 2E5LO 2P4KA 1KB9F 4KL1A 2ZKOA 1XEQA 2F4VO 2Q68A 3OUSA 2JEUA 3CSXA 1YF2A 1M93A 1AVMA 3GB7C 4JAUA 3ABMB 2QTOA 3CRAA 3ABKB 3JSNA 3OTOO 4NXNB 4DV0B 1VQ9V 3CD6V 1G4YB 5C93A 3JAWB 5IDJA 1SQVH 4IIJB 1EZVH 1Q86W 1NZ6A 4X1YB 5GW7A 3OUFA 1WB7A 2X7RB 4JI3O 2CDYA 3VQYA 4RUFA 5L3EA 5LA6B 2HJDA 5BMVA 3S3WA 2NNUA 2UUBO 2VQFO 4BW9A 5B5EZ 1JX9A 3CRRA 5B3SB 2UXNA 4UVAA 1SETA 3DXRB 1GMGA 4LF5B 2GUZA 2JRIA 2OWOA 1AILA 5J2TA 1Z5VA 3APOA 4B3TB 2ZE7A 4PI0A 4DUYB 5EC1C 4LFBO 1VQ6V 3VQVA 2WLIA 2HR3A 4JI6B 5A9GA 2Q0OC 1Y76B 2Q7HA 3OE7G 1Q6IA 1NI8A 3ABLC 3ETQA 3JD1A 4LCUC 3OEHG 1V54B 1PNLA 5LP6C 4LF6B 2XAFA 5A2QN 2GUZB 1URFA 3LNNA 1WPXA 3T1YO 3CCUV 2V4DA 1TVKA 4UV9A 3LNMB 4GKJO 3BHPA 2DN9A 2PYLA 3L73H 3LDDA 3ZRWA 3T4DA 3F7YC 2LJ2A 4TQDA 4GCZA 1IXBA 1E79G 1BMFG 2EINC 3FKSG 3CJHB 2OCCB 3D36C 3ZMTA 4DXWA 1IX9A 4RO2A 2QGNA 1XMOB 1ZL8A 1AR1B 3LSSA 4RQFA 2Q73A 4WFGA 1P84F 4DK0A 2EX3A 1QVGU 2R9IA 4FZ0A 3A8TA 5LP6A 1H2SB 1VP7A 4DUZB 4WF9V 3L70H 1AI7A 5IJ9B 3CRCA 3OR6C 3TJTA 3E2EA 4JYAB 2GV9A 2ODMA 3E22B 1AP6A 1SQQH 2JJ2G 2VRZA 4YY3B 4CH6A 2Q67A 1M57B 5BXZA 3WG7B 3JYCA 5KAFZ 1WAZA 2Y69C 1K8AW 1CP9A 4U3JA 4J9YB 2JGDA 1RSOA 3CWBH 2QJ1A 1G1XB 3JAKB 3ZHRA 3D36A 1R3JC 2ETNA 2IJIA 3K03A 5LP6B 4UUJC 4QIWF 1H2GA 1WPBA 4DV2O 1H2KA 2EIJB 4O2BB 5L3FA 4K8ZA 2IU0A 3K5LA 4QJFB 2IM9A 1K4CC 5F2VO 3QNEA 4DR7O 5LBQA 3SGIA 2XHBA 3HKDB 1HNZO 5LOVB 4ZI7B 5B1OA 4OX9O 4G27B 1N36B 4ZBMA 4E2LA 1WP8A 2EINB 1N32O 2XAGA 1XILA 4JI1B 4JAAA 5DECA 2YI8A 3ZCCA 3ZJZA 2CK3G 2KG7A 2IJHA 5KX5A 1P4RA 4LF9B 3G80A 4PA6A 4DK1A 2ZR3A 3RBZA 4Z2WA 2WLMA 4EEQA 4LR3A 4NVPA 4ASUG 3T1HO 1S5LZ 4FM2A 4AQYO 2YI9A 3CS5A 4HNAB 5IE9A 4DV3B 3GVMA 2ZD9A 2DYSC 3ZBHA 3GWOA 1SQBH 3OGCC 4XDLA 1DK1A 5IJ0A 4O4HA 1GK9A 1GO3F 3IJ4A 2Y69B 4LF4O 2ILMA 3N2KB 3C3TA 4DV5B 5JJNB 1BCCH 2N05A 4YIOA 2EBOA 3UQ8A 5B1NA 1EZJA 1SQXH 2BCCH 1QCEA 4BWAA 2KQXA 5KUKA 4AHCA 4LC1A 1WNSA 3UT5A 4P9OA 3KCYA 2E5LB 2AW9A 5B1AC 2QSAA 3VQXA 1AI5A 3X2QC 1Q8IA 3Q4HA 2VQEO 1HNXO 3JASB 2F4VB 2YIAA 3IC9A 2GHYA 1BE3H 1BZKA 3K04A 3OMIB 5H9CA 3OTOB 5TISZ 4NB5A 4YJ2B 2LP7A 2HHHO 1WLEA 4O4JB 1AR5A 4HZ3A 3LSUA 4MVQA 4JI3B 1YIJV 4N21A 2YEVB 2VWJA 4B3SO 1YJ9V 1Y67A 2UUBB 2VQFB 3DC5A 1N0JA 3G6BA 2EZPA 4UVBA 2XAHA 3E35A 2WA3A 3SJQC 3EVKA 4IHJA 1RM1C 2LO1A 2Q5ZA 4DRXA 3K3WA 1BS3A 2NR5A 2K1EA 1VMGA 4CZZA 4MTXA 1D5AA 1R6TA 4DV7O 3HKCA 3FAVA 3RYHB 2UU9O 1OV9A 3HKEA 2BTOA 1VQMV 2DYRB 3MD0A 4MS2A 3K5OA 2F93B 2FYUH 2HP8A 4IT5A 4I4TA 2QKSA 4LFBB 4MT8A 3IAYA 4X1IA 3VQWA 4LNUA 4GZRB 3ZMVA 4AI8A 3W7XA 3JCZA 4DR5O 4JTCB 5JVDA 1NR7A 3CXHF 4LWSA 3K5MA 5CB4B 3L74H 3C90A 5GTHZ 1VQKV 3RN4A 4WCEV 4IHJB 4DRXB 3T1YB 1VEWA 4GKJB 1XHXA 4K3AA 1HDJA 4X64O 1JFFB 1JR9A 1NQTA 4CS3A 5LL6Y 5FNVB 3SJCC 2CUGA 3CEIA 3FX7A 3RYIB 4H37A 3JD2A 1HNWO 5IYZA 1EM1A 2YIDA 3NXSA 2M7WA 4X1IB 4J7ZA 4I0XA 2B5UA 3G67A 2JK5C 3ZHSA 1BSMA 2X0LA 3OT7A 1YJWV 1NR1A 3BCCH 5EBMC 1GN2A 3ASNC 3P32A 4O4LA 3OM3B 4TWKA 2YIBA 1GM8A 2BOBC 4RUEA 3E8BA 4W4LA 4X65O 3AK3A 1JOYA 1I08A 1TUBA 2HVKC 5LMUO 4I50B 5GTIZ 1I5YA 1JMKC 2LGWA 1L1FA 2HG5C 4JV5O 2DE0X 2YSUB 3WU2Z 3CB2A 1ZWIC 2BTQA 3S3XA 4DV4O 3CRMA 3ETEA 3MAQA
chains in the Genus database with same CATH topology
1SRYA 1K73W 1JJ2U 1HWYA 1SERA 5IDJA 1MOFA 1S72V 1Q86W 3H01A 1AJQA 1XL6A 5GW7A 3UKMA 3OUFA 1S0VA 4MTFA 4TT3G 2X7RB 5EK0A 1W0KG 4Z1MG 1QBZA 3AG3C 2IJKA 2C2AA 4RUFA 1THZA 4N23A 2ZXWB 5L3EA 3AG2C 4F4LA 4CBCA 2EILB 4R7CA 2PI5A 2NNUA 5IYBO 3CCVV 3FYEB 3CCQV 5J9PC 3CC4V 2HVJC 4YXWG 1JX9A 2AHZA 1LNQA 2WLHA 5B1BB 3UM7A 5LHHA 5B3SB 3OW2U 2UXNA 4UVAA 3CC7V 1AJPA 1SETA 4KFMA 2NLJC 1GMGA 2OT5A 1RPRA 2EIKC 3CXCU 4MSWC 1VQOV 4BW5A 3K08A 1S5HC 3W7TA 1EBOA 2B1GA 1I5XA 4JF3A 2LFRA 2QE7G 2DYSB 1RPOA 3RVZA 4FK5C 3AG1C 3SYPA 1COWG 1M56B 3W7UA 3CPWU 3M99B 1OCRB 3KG2A 4RQEA 5EC1C 1EFRG 4MTOA 1VQ6V 1OCOB 3SYOA 4HAMA 1F4MA 1F4NA 2HR3A 2WLIA 3E8FA 4MVOA 1OCCC 5H6QA 3OE7G 2P6JA 2QM8A 3FB8C 2EJRA 3MHSC 1PL0A 4JTDB 2W6IG 2WPDG 3ABLC 3JD1A 4LCUC 1TUEB 2JDIG 1YI2V 5B1AB 2WLNA 3OEHG 1AI4A 2D3OW 1V54B 1PNLA 2P90A 1R3IC 3ZN0A 3X2QB 1FXKB 2XAFA 1W2BU 4JAVA 2EZOA 1WPXA 5CA3A 1E1RG 3CCUV 4UV9A 2A79B 3ETDA 3LNMB 3G71V 4P30A 2ITDC 3E8HA 1B6QA 2X6CA 1H8HG 2Y48A 1NBMG 1ROPA 4WFHA 5LGUA 2H94A 1FS0G 3LDDA 3ZRWA 3T4DA 3F7YC 2HLDG 1OCZB 4DO2A 2WLJA 4GCZA 1S76D 4PA3A 1NKDA 4QPJA 3CCLV 1SESA 3K0DA 1E79G 1BMFG 1GKFA 1DF5A 4GX5A 2EINC 3DTUB 4LP8A 1YHQV 3FKSG 4I5SA 5CBHA 1W0JG 2OCCB 3ZMTA 4DXWA 2DYRC 1VQ8V 2X6AA 4GX2A 3OFNG 4RO2A 5LHIA 5KA6A 3D3IA 3AG3B 2P7TC 3STLC 2V1DA 3E89A 3F7VC 1AR1B 5EBLC 3TK1A 3G4SV 1K34A 2EIMC 3LSSA 4RQFA 4WFGA 2MK3A 1QLEC 5KA5A 1QVGU 2R9IA 5L3GA 1RM1B 1H8EG 2YEVA 3CCMV 1BHAA 3B8MA 2OTJV 3FB6C 4WF9V 3QO8A 1R6KA 2ITCC 4R50A 2HJFC 3SPIA 1AI7A 2DW4A 3W7WA 3OR6C 3E2EA 4J9ZB 4BAYA 3RVYA 4U7OA 1YITV 1QVFU 4PA7A 2H8PC 2JJ2G 1OZ0A 3HB3B 4MVUA 3B8NA 1PD3A 2Q67A 4GT1A 5KUMA 1M57B 3K06A 4GX0A 2IU3A 3WG7B 1GTOA 3JYCA 2Y69C 3E83A 5EBWC 1K8AW 1CP9A 4J9YB 1JPXA 3K79A 3SYQA 4I9WA 4XDKA 4Q20A 3EFFK 3D36A 1R3JC 4R8CA 4P2ZA 2IJIA 3K03A 1PNMA 4X8AA 3AEIA 1KKDA 3A0RA 3DGEA 4WFAV 4MVMA 4UUJC 2X6BA 2WLLB 3CYOA 4QIWF 1H2GA 1YJNV 1Q7YW 2EIJB 5L3FA 2ZDIC 3K9AA 3HPLC 1QR8A 2IU0A 3JD3A 3CMEV 4QJFB 1K4CC 2XOKG 3QNEA 1V55B 4WFEA 4PELA 5LBQA 3T4ZA 3VOUA 1KC8W 2Q69A 3OMAB 3SPHA 3ABMC 3ML0A 2LFSA 4KUMA 2JEXA 1G8MA 3IC7A 1K4DC 5LGTA 3B77A 2P67A 3QO5A 5B1OA 3EHBB 1ORQC 2XAQA 4G27B 4ZBMA 1Y4MA 4E2LA 1FFTB 2WLKA 5E1AC 2EINB 4QNHB 2A9HA 3ASNB 2ZR2A 2XAGA 3MHHC 1Y66A 4BIUA 2QEXV 1R3LC 5HFMA 3F5WC 3VBBA 3ZCCA 2Q6AA 4X89A 1PNKA 4XBFA 3ZJZA 5L3BA 1NJIW 4KP4A 2CK3G 2EIMB 3OAAG 2IJHA 2BOCC 2EILC 2Z5UA 1DTOA 1P4RA 3BEHA 1MSWD 4HYOA 1FXHA 3SPJA 4PDVA 1F51A 4FMTA 4PA6A 4X88A 5B1BC 1Q82W 3FYIB 4TSFG 2ZR3A 4G2KA 3RBZA 2WLMA 4JASA 3FB7C 3ASOC 4ASUG 4U7NA 2WLIB 2ZDIA 4FJCC 3TETA 1R6NA 5CN0A 2ZD9A 2DYSC 3JD4A 3SPCA 4BIZA 3OMNB 3GWOA 3OGCC 1M56C 4XDLA 5BZBA 1GM7A 2HKOA 3SYAA 1GK9A 1GO3F 2R9RB 1OCRC 1P7BA 2Y69B 2OTLV 5LGNA 5CMUA 3ZMUA 4UVCA 3ABTA 3AG2B 1VQPV 3TCUA 1JQ0A 2EBOA 2DWDC 5B1NA 1EZJA 2QM7A 2UXXA 4QPKA 3ABUA 1QCEA 2DQ0A 3WFVA 1QLNA 2AHYA 1S3JA 5KUKA 1K5QA 3LDEA 2IW5A 3ZRWB 4LC1A 2IH1C 4G28B 4P9OA 1AJNA 2EIKB 5B1AC 5HFLA 3STZC 1S77D 1AI5A 3X2QC 1FXKC 2IJJA 1BL8A 4WFBV 3OEEG 3ZRSA 3AG1B 3LSQA 2GHYA 4QE7A 3ZRVA 3K04A 1VQLV 3OMIB 4RAIA 4H33A 2IH3C 1VQ7V 5H9CA 3CCRV 1ENVA 1MG1A 4JGSA 1VQ4V 1CEZA 1OCCB 5L3DA 1DLBA 1DF4A 1K33A 2LP7A 5DM6V 1R3KC 3IFXA 1WLEA 4MVSA 4PA9A 1F23A 2JIZG 1Q81W 1K3EA 2HFEC 3PJSK 4HZ3A 1AI6A 4PDLA 4ZKIA 3ZRXA 3ABLB 4WFFA 1KQSU 4MVQA 1YIJV 2OCCC 3JD0A 1K5SA 4N21A 2YEVB 2WAMA 5LHGA 3ZMSA 3CP1A 3OR7C 5IY5C 1H38A 3IGAC 3K0GA 1NH2B 1YJ9V 5FL7G 3W7SA 3LUTB 5EC2C 1SZTA 3SPGA 2WWWA 1M1KW 2EZPA 4UVBA 4FPPA 2XAHA 1YSCA 3E35A 1NVPB 4P9PA 3BY6A 3SJQC 1UJWB 1PKXA 1BHBA 1YTFB 1RM1C 3K3WA 1FXKA 4R6ZA 2XNDG 1MABG 3ASOB 2K1EA 4CZZA 4MTXA 1KP2A 1XL4A 5IYDO 3ABKC 3AG4C 4JTAB 4JYCA 3T1CA 1VQMV 1KECA 2DYRB 1GM9A 3MD0A 1R73A 4MS2A 3ZN1A 1JVMA 3ZIAG 2QKSA 4MT8A 1VQ5V 3R65A 1M57C 3ZMVA 4PA4A 3W7XA 3JCZA 3WG7C 4EKWA 4JTCB 1NR7A 5H6RA 3CCEV 1JCHA 2ZXWC 1AROP 3FB5C 4GX1A 2F43G 1QLEB 3P30A 3ZMZA 4JYBA 2GSMB 4UXNA 4JPRA 3T2MA 5B3SC 5CBFA 3CMAV 1VQKV 2KB1A 3LDCA 2WSSG 4WCEV 4FIPC 3CC2V 2DWEC 3I56V 4MTGA 3SYCA 4MW3A 5IYCO 3E86A 3CCSV 4UV8A 2Z3YA 2EIJC 2W0FC 4QE9A 2FTKA 2DQ3A 4PDMA 2B1IA 3G6EV 1NH2D 1IXMA 1NQTA 2XASA 1V55C 3RW0A 2W6JG 4H37A 2XAJA 3JD2A 4LBEC 3E8GA 3ETGA 1KP3A 4MVRA 1J95A 3NXSA 1KD1W 2M7WA 5L3CA 2B5UA 1OCOC 1NVPD 2JK5C 1FXVA 1N8RW 1YTFD 4MW8A 4PDRA 5DN6G 2X0LA 3QO7A 1YJWV 1NR1A 5EBMC 1QR9A 3ASNC 1VQNV 3P32A 1M90W 5IY5B 3OM3B 4XDJA 4TWKA 1V54C 2ATKC 4L87A 1GM8A 1CPYA 2BOBC 4RUEA 3E8BA 1K92A 4OXSA 1JOYA 2Q68A 2JJ1G 3OUSA 1K7DA 2JEUA 2QA4V 3I55V 2ZQMA 2HVKC 3GB7C 4JAUA 3ABMB 5CBGA 3CCJV 1I5YA 2QTOA 1K97A 1L1FA 1OCZC 2HG5C 2YSUB 2V7QG 2A0LA 1E1QG 2WLLA 4MVZA 1ZWIC 3ABKB 1K9MW 3AG4B 1VQ9V 3ETEA 3CD6V 1G4YB 2PI4A 1OHHG 1M9NA 5C93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOC C;  2EIL C;  4R6Z A;  3BEH A;  2P7T C;  5J9P C;  2K1E A;  3STL C;  4HYO A;  1XL4 A;  3SPJ A;  4PDV A;  1XL6 A;  3ABK C;  3E89 A;  3F7V C;  4PA6 A;  4X88 A;  5EBL C;  3AG4 C;  4JTA B;  3OUF A;  5B1B C;  3UKM A;  4MTF A;  5EK0 A;  3RBZ A;  2EIM C;  3T1C A;  2WLM A;  4WFG A;  3FB7 C;  3AG3 C;  3ASO C;  4MS2 A;  1QLE C;  2WLI B;  4RUF A;  1JVM A;  2YEV A;  3AG2 C;  4F4L A;  4CBC A;  3TET A;  2QKS A;  4R7C A;  2ZD9 A;  2DYS C;  3R65 A;  1M57 C;  2HVJ C;  3FB6 C;  4PA4 A;  2AHZ A;  3SPC A;  1LNQ A;  2WLH A;  3UM7 A;  3WG7 C;  4EKW A;  2ITC C;  4R50 A;  4JTC B;  3OGC C;  1M56 C;  2HJF C;  3SPI A;  2ZXW C;  3FB5 C;  2NLJ C;  4GX1 A;  4KFM A;  4XDL A;  5BZB A;  3SYA A;  3OR6 C;  2R9R B;  1OCR C;  4J9Z B;  1P7B A;  2EIK C;  4MSW C;  3RVY A;  4BW5 A;  3K08 A;  1S5H C;  3T2M A;  4PA7 A;  3TCU A;  2H8P C;  5B3S C;  5CBF A;  2KB1 A;  2DWD C;  4MVU A;  3LDC A;  2Q67 A;  5KUM A;  2DWE C;  3K06 A;  4GX0 A;  3RVZ A;  3JYC A;  2AHY A;  5KUK A;  2Y69 C;  3AG1 C;  4MTG A;  3SYP A;  3E83 A;  4MW3 A;  3SYC A;  3LDE A;  5EBW C;  3E86 A;  4J9Y B;  3SYQ A;  2IH1 C;  2EIJ C;  4G28 B;  4I9W A;  4P9O A;  2W0F C;  3KG2 A;  4QE9 A;  4XDK A;  3EFF K;  4MTO A;  5EC1 C;  5B1A C;  3STZ C;  1R3J C;  4PDM A;  4R8C A;  4P2Z A;  3SYO A;  3X2Q C;  2WLI A;  3E8F A;  4MVO A;  1OCC C;  1V55 C;  1BL8 A;  3RW0 A;  3K03 A;  4X8A A;  4H37 A;  4LBE C;  1KKD A;  3E8G A;  4MVR A;  3ZRS A;  1J95 A;  4QE7 A;  3FB8 C;  4MVM A;  2X6B A;  2WLL B;  4UUJ C;  1OCO C;  4JTD B;  3K04 A;  3ABL C;  2JK5 C;  4LCU C;  4RAI A;  4H33 A;  2WLN A;  3HPL C;  4MW8 A;  2IH3 C;  4PDR A;  1R3I C;  1K4C C;  5EBM C;  4WFE A;  3ASN C;  1R3K C;  3IFX A;  3T4Z A;  3VOU A;  2Q69 A;  4MVS A;  3ABM C;  4PA9 A;  3SPH A;  4XDJ A;  2HFE C;  2A79 B;  3PJS K;  3LNM B;  2ATK C;  1V54 C;  1K4D C;  4P30 A;  4TWK A;  2ITD C;  4HZ3 A;  3E8H A;  4PDL A;  2BOB C;  2X6C A;  4RUE A;  4WFF A;  3E8B A;  4MVQ A;  4WFH A;  2OCC C;  1ORQ C;  3LDD A;  4G27 B;  4ZBM A;  3T4D A;  3F7Y C;  2WLK A;  5E1A C;  4OXS A;  4QNH B;  2WLJ A;  3OR7 C;  2Q68 A;  3OUS A;  5IY5 C;  3IGA C;  2A9H A;  2HVK C;  3K0G A;  3GB7 C;  4PA3 A;  5CBG A;  2QTO A;  3LUT B;  5EC2 C;  3SPG A;  3K0D A;  4GX5 A;  1OCZ C;  2HG5 C;  2EIN C;  1R3L C;  4LP8 A;  3F5W C;  5CBH A;  2A0L A;  2WLL A;  2Q6A A;  4X89 A;  4MVZ A;  1ZWI C;  4DXW A;  3ZJZ A;  2DYR C;  4P9P A;  3SJQ C;  2X6A A;  4GX2 A;  4RO2 A;  1G4Y B; 
#chains in the Genus database with same CATH topology
 1SRY A;  4WBN B;  4OPH A;  1SER A;  1RP3 B;  1YEW A;  4H13 B;  5JQG A;  1S72 V;  3H01 A;  2EUL A;  3OGI B;  4TUY B;  5EK0 A;  4O4L B;  3O9O A;  1QBZ A;  3AG3 C;  1THZ A;  4CBC A;  1MMM A;  3CCV V;  1TUB B;  5J9P C;  5JH7 A;  5LHH A;  2AHZ A;  5B1B B;  1AB3 A;  3CC7 V;  1AJP A;  2NLJ C;  4DV1 O;  4GLX A;  4DV2 B;  2OT5 A;  1Q6U A;  2DJV A;  3CXC U;  2IBZ H;  3W7T A;  2LFR A;  3CHX A;  1RPO A;  4DR7 B;  5LMN O;  1COW G;  2QKA A;  5JQG B;  1HNZ B;  3CPW U;  1OCR B;  4RQE A;  1EFR G;  4OX9 B;  1WP7 A;  4HAM A;  1F4M A;  1S5J A;  2P4V A;  1ZTE A;  1VIB A;  1N32 B;  2QKC A;  5JH7 B;  2YS8 A;  4TV9 B;  3WB1 A;  1TUE B;  2JDI G;  5EZY A;  2WLN A;  3L9D A;  4NTW A;  1R3I C;  1XHZ A;  5CA3 A;  5CA0 B;  4PD4 F;  4DR2 O;  4LF8 O;  1Q90 D;  4KXR A;  2ITD C;  3E8H A;  2X6C A;  4X1K B;  4X62 O;  2CH7 B;  1F7Y A;  2HLD G;  2YXL A;  4DO2 A;  3T1H B;  4AQY B;  4CH3 A;  3BFR A;  1XDC A;  1S76 D;  4PA3 A;  3CCL V;  2UXB O;  4I5S A;  4UB8 Z;  3RYC A;  4DYL A;  1VQ8 V;  2FL4 A;  2X6A A;  4NTX A;  5LHI A;  5KA6 A;  4LF4 B;  4D6T H;  1NTZ H;  3J81 N;  3SDL A;  3AG3 B;  2P7T C;  3TK1 A;  1KYO F;  1NTM H;  1SA0 B;  1GH6 A;  5KA5 A;  4PHZ A;  1Z5W A;  5DED A;  2OTJ V;  1HNX B;  2PTM A;  3TXS A;  1PV0 A;  3W7W A;  1NU1 H;  4BAY A;  3N2G A;  3HKB B;  1YIT V;  3OTF A;  3ZHT A;  1N4C A;  3B40 A;  3L72 H;  2H8P C;  4MVU A;  5FPR A;  3B8N A;  1PD3 A;  3K06 A;  4GX0 A;  2HHH B;  1WA8 B;  5EYP A;  4CH5 A;  5IWA O;  3JAL A;  4O2A A;  4TV8 A;  4XDK A;  4Q20 A;  3L75 H;  4H0L B;  1X4T A;  1CXZ B;  4R8C A;  4UCO A;  2FKX A;  3RYF A;  2OIE A;  1PNM A;  2QDO A;  4B3S B;  1XOU A;  2K9P A;  4ABM A;  4E4E A;  4WFA V;  4K8X A;  3I5D A;  2XT9 A;  3K5N A;  2ZDI C;  3HPL C;  2CTW A;  3CME V;  1FKA O;  2XOK G;  1V55 B;  1J5E O;  1KC8 W;  3T4Z A;  3VOU A;  1SKV A;  2Q69 A;  2QR4 A;  3OMA B;  3ML0 A;  3SPH A;  2LFS A;  1VAR A;  1G8M A;  4DV7 B;  5LGT A;  3B77 A;  2UU9 B;  4K0K O;  1FFT B;  5H5N A;  5E1A C;  3FD9 A;  4QNH B;  1PM9 A;  5BMV B;  1U97 A;  1Y74 A;  3M8A A;  3WB2 A;  3RYF B;  4DR3 O;  1R3L C;  3VBB A;  4DR5 B;  2Q6A A;  4X89 A;  4DV6 O;  5J2T B;  4D7S A;  1NJI W;  4UCU A;  4CS2 A;  2LW1 A;  2BOC C;  2EIL C;  1FXH A;  3SPJ A;  1F51 A;  1LUV A;  3FYI B;  4TSF G;  4G2K A;  2Y0I A;  2F23 A;  1IBL O;  2WLI B;  2ZDI A;  4X64 B;  3JD4 A;  3SPC A;  1QNM A;  4BIZ A;  3OMN B;  5EIB D;  1HNW B;  1M56 C;  5BZB A;  2HKO A;  3SYA A;  2R9R B;  4ICG A;  1P7B A;  1TA8 A;  3ZMU A;  4UVC A;  3ABT A;  2G38 A;  4LH7 A;  2QM7 A;  5FPO A;  1TVK B;  1XRE A;  3THO A;  2DQ0 A;  1ZX3 A;  1BQZ A;  3P3P A;  1S3J A;  3JAT A;  1K5Q A;  1SF9 A;  2IW5 A;  3ZRW B;  3CX5 F;  2IH1 C;  2FB5 A;  1GN6 A;  4X65 B;  1S77 D;  1FXK C;  1QU7 A;  1IVS A;  2ZM6 O;  2Q7E A;  3OD4 A;  2A7W A;  3H1H H;  3ZRS A;  5LMU B;  3LSQ A;  4QE7 A;  3ZRV A;  2ZE6 A;  2R72 A;  4JV5 B;  3QTC A;  4RAI A;  4H33 A;  4F6R A;  4DV4 B;  1ENV A;  1XNQ O;  1DF4 A;  1K33 A;  1ZL8 B;  1R3K C;  2ZNI A;  1UFI A;  3ABL B;  4WFF A;  1HR0 O;  2N04 A;  3JD0 A;  1L8D A;  1W59 A;  4ZOL A;  5IY5 C;  4IGG A;  1H38 A;  3D8C A;  3K0G A;  4DW1 A;  1YDX A;  5FL7 G;  3LUT B;  4GKK O;  5IT9 N;  1SZT A;  4FM1 A;  2ZT9 B;  3GWK C;  2Q8V A;  4DV1 B;  2CE4 A;  1KUQ A;  4FLW A;  1FXK A;  4R6Z A;  5H2F Z;  5ITZ A;  4LFC O;  1XL4 A;  5KHI A;  4JTA B;  4U3J B;  4KHP O;  1N0N A;  4K35 A;  2JGD B;  1RSO B;  4JYC A;  5D5P A;  5LMN B;  4A5U B;  1KEC A;  1R73 A;  1JVM A;  1JA8 A;  3R65 A;  3B4S A;  1I94 O;  1IBM O;  1P7G A;  2PYJ A;  2ADQ B;  3CCE V;  4X20 A;  1JCH A;  2F43 G;  4J10 A;  4UXN A;  1YZB A;  3T2M A;  5CBF A;  2KB1 A;  3LDC A;  4FIP C;  3CC2 V;  4DR2 B;  4LF8 B;  3TXQ A;  3I56 V;  4MW3 A;  3CCS V;  4UV8 A;  2Z3Y A;  4J11 A;  4JZ2 A;  2W0F C;  2FTK A;  2DQ3 A;  2YXH A;  4X62 B;  3HR0 A;  2UUA O;  2Q9L A;  1Z2G A;  1NT2 B;  1GN4 A;  2W6J G;  2XAJ A;  3ETG A;  4LF7 O;  1N33 O;  1OCO C;  2UXB B;  1L0N H;  2KG7 B;  3AK2 A;  4MW8 A;  4PDR A;  4IYI A;  5DN6 G;  5KX5 B;  1XQ8 A;  3APQ A;  4YJ3 A;  1VQN V;  4B3M O;  4J42 A;  4JI5 O;  5IY5 B;  1D2D A;  1CPY A;  4CC6 A;  1ZAU A;  4I55 A;  1BT8 A;  1Q43 A;  2JJ1 G;  2LQT A;  1K7D A;  2QA4 V;  3I55 V;  2ZQM A;  3BA9 A;  1D5N A;  2GTS A;  3NR7 A;  5CBG A;  3CCJ V;  3PN1 A;  2F95 B;  1IBK O;  1K97 A;  3BVO A;  2DMX A;  5IJ0 B;  1ZSP A;  2V7Q G;  4O4H B;  2WLL A;  1E1Q G;  1US6 A;  1FD9 A;  2QWQ B;  1M9N A;  1LUW A;  1K73 W;  1JJ2 U;  1QHT A;  3L71 H;  1MOF A;  1XL6 A;  1S0V A;  4MTF A;  4TT3 G;  4DR4 O;  3UT5 B;  3AG7 A;  4Z1M G;  3ICX A;  1YCI A;  4JI0 O;  5IWA B;  4JI8 O;  2C2A A;  4N23 A;  3Q4H B;  3AG2 C;  4F4L A;  4R7C A;  2OCH A;  2PI5 A;  3FYE B;  3CCQ V;  3CC4 V;  4YXW G;  1LNQ A;  2KKW A;  2WLH A;  2PY5 A;  2AZ2 A;  2Y4U A;  4H44 B;  2EIK C;  4CC5 A;  4MSW C;  1VQO V;  1DGS A;  3K08 A;  1S5H C;  4FLY A;  1I5X A;  1VF5 B;  2ZE8 A;  2QE7 G;  2DYS B;  3B09 A;  1J5E B;  2PF4 E;  4FK5 C;  3AG1 C;  3O65 A;  3SYP A;  2UUC O;  2UXC O;  3KG2 A;  2AGA A;  5CA1 A;  3K57 A;  1OCO B;  1F4N A;  4BIO A;  4MVO A;  1OCC C;  1SS3 A;  2P6J A;  2EJR A;  4FLU A;  3MHS C;  1U96 A;  2YC0 A;  1PL0 A;  4DR3 B;  4JTD B;  2W6I G;  2WPD G;  4UCV A;  5B1A B;  2E75 B;  2JS5 A;  4DV6 B;  1XI1 A;  1EN6 A;  3SJA C;  4AIL C;  2E74 B;  3X2Q B;  4JAV A;  5JCO C;  2EZO A;  1E1R G;  3HKC B;  3FAV B;  4FZ1 A;  3ETD A;  3HKE B;  1B6Q A;  1H8H G;  3RFR A;  1FS0 G;  3U0Z A;  4FVM A;  4I4T B;  3RWR D;  2AZ0 A;  2E3C A;  1IBL B;  3DC6 A;  5CA1 B;  4LNU B;  4FFB A;  1NKD A;  1UPG A;  5JVD B;  4QPJ A;  3K0D A;  1VQ5 V;  1DF5 A;  4LWS B;  3DTU B;  4LP8 A;  1AP5 A;  3M7M X;  5CBH A;  4ZHQ A;  2Q4P A;  2YDE A;  4B3R O;  4GX2 A;  1ZLZ A;  3OFN G;  1FFX A;  1IUR A;  3D3I A;  1OJH A;  1NS1 A;  3STL C;  1YVW A;  3JSL A;  4EB6 A;  3F7V C;  5D5Q A;  3SR2 C;  3G4S V;  4UFZ A;  1K34 A;  5K1X A;  5K1P A;  1B06 A;  1QLE C;  2FML A;  3TGU H;  1RM1 B;  1H8E G;  3CCM V;  4DR1 O;  5IYZ B;  3B8M A;  5JCO A;  3QVN A;  1B3Q A;  3J80 N;  2ZM6 B;  3KZI Z;  4I0X B;  1R6K A;  1XMQ O;  2OYQ A;  4NYK A;  3BAB A;  1IZ3 A;  4I9Q A;  2LW7 A;  4BR6 A;  4J9Z B;  5KLV H;  3RVY A;  1QVF U;  4NTY A;  1OZ0 A;  3HB3 B;  1XNQ B;  5KUM A;  4YIP A;  3K79 A;  4I9W A;  2Z0A A;  1KMI Z;  1HR0 B;  1ZUQ A;  3EFF K;  1MA1 A;  5LXT A;  4JZG A;  4Z1V A;  4GUN A;  1VF7 A;  4X8A A;  2UXD O;  1MSD A;  3DGE A;  2F66 C;  4MVM A;  1YJN V;  2X6B A;  2Y0P A;  3CYO A;  2BTQ B;  4GKK B;  5KHG A;  1KBH A;  4NR1 A;  3K9A A;  2QWN B;  3JD3 A;  2HEP A;  1O9H A;  5J2U A;  5GON A;  3KCX A;  1IDS A;  5KMG A;  3JAR A;  3ABM C;  4KUM A;  4LFC B;  5JWP A;  2P5O A;  3IC7 A;  2P67 A;  3QO5 A;  4KHP B;  1ORQ C;  3BAA A;  5KHH A;  4O4I A;  2A9H A;  3ASN B;  2ZR2 A;  1Y66 A;  4BIU A;  3H1J H;  1I94 B;  1IBM B;  2QEX V;  5HFM A;  5L3B A;  2R9A A;  2Z5U A;  3BEH A;  1MSW D;  4NXM O;  4X88 A;  1Q82 W;  5C8Y A;  1BQ0 A;  4JAS A;  3ASO C;  1L0L H;  4U7N A;  2JGU A;  4FLZ A;  3TET A;  2UUA B;  5CN0 A;  2GDS A;  3K9S A;  3BA8 A;  4LF7 B;  4DV3 O;  1Q3E A;  5EZY B;  1N33 B;  2GTA A;  3QF7 A;  3K59 A;  2OTL V;  5CMU A;  2E76 B;  3R66 A;  3JAW A;  4JI4 O;  4B3M B;  4IIJ A;  4X1Y A;  4JI5 B;  4JI2 O;  3LDE A;  3ZHQ A;  4OPA A;  1VF6 A;  4G28 B;  2VQE B;  5HFL A;  3STZ C;  1H2N A;  1Y6X A;  1MZF A;  2ARH A;  2PUS A;  1BGY H;  1BL8 A;  2QTS A;  5LA6 A;  3OEE G;  3P3N A;  1SQF A;  5B66 Z;  1IBK B;  2L6L A;  2Y4T A;  3F5T A;  3RYC B;  1VQL V;  3DXR A;  2IH3 C;  1VQ7 V;  3ZHV A;  4JGS A;  1VQ4 V;  1CEZ A;  2PGG A;  1DLB A;  5DM6 V;  3IFX A;  4MVS A;  1FJG O;  1F23 A;  3KKY A;  3PJS K;  4PDL A;  4ZKI A;  3ZRX A;  4DR4 B;  2OCC C;  3H9V A;  1K5S A;  2ADP A;  4JI0 B;  3CP1 A;  4JI8 B;  1M5I A;  1NH2 B;  1KU9 A;  1Y76 A;  3ZS8 C;  4JI7 O;  3W7S A;  1T5E A;  5EC2 C;  4J80 A;  3A0H Z;  4X66 O;  1GN3 A;  1NVP B;  3N2G B;  2QWO B;  4P9P A;  4EFB A;  1UJW B;  1BHB A;  1PKX A;  1N34 O;  1YTF B;  2XND G;  3ASO B;  3UCS C;  5IYD O;  5EYP B;  5KHJ A;  3AG4 C;  3RT3 C;  3JAL B;  4O2A B;  4TV8 B;  1QQC A;  4B7E A;  2UUC B;  4FFK A;  1GM9 A;  2UXC B;  1M4U A;  3ZIA G;  1MNG A;  1M57 C;  4PI2 A;  4NKG B;  3WG7 C;  4EKW A;  2M6Y A;  5H6R A;  2ZXW C;  3FB5 C;  4GX1 A;  4D7T A;  3CJH A;  3P30 A;  3ZMZ A;  4JYB A;  2GSM B;  3BPZ A;  3CMA V;  3UO3 A;  4F6E A;  5KAI Z;  2RNB A;  2PZS A;  1SQG A;  4MTG A;  5IYC O;  3E86 A;  5EIB C;  1H2M A;  2EIJ C;  4PJ0 Z;  1Y74 B;  4CH4 A;  2B1I A;  3E8G A;  1J95 A;  1KD1 W;  1TGO A;  1B04 A;  1FXV A;  1PP9 H;  5IJ9 A;  2MW2 B;  4B3R B;  2VS0 A;  3E22 A;  1QR9 A;  1M90 W;  4XDJ A;  2ATK C;  1O9G A;  1H2L A;  3CRQ A;  3C3S A;  1K92 A;  3JAK A;  4OXS A;  4DR1 B;  1G6U A;  1WN7 A;  4QGP A;  2DOS A;  3JCU Z;  1OCZ C;  2CGO A;  1XMQ B;  2A0L A;  4MVZ A;  1K9M W;  3AG4 B;  1HP8 A;  4O2B A;  2PI4 A;  1OHH G;  4FLT A;  1FYJ A;  1HWY A;  4OGQ B;  1AJQ A;  3JAT B;  2ZE5 A;  3UKM A;  1TAE A;  3HKD A;  2BSK A;  1W0K G;  5LOV A;  3H1K H;  4ZI7 A;  2IJK A;  1SC5 B;  1PPJ H;  2ZXW B;  2RDC A;  1WB8 A;  4YHH O;  2EIL B;  5IYB O;  1V9P A;  2HVJ C;  3UM7 A;  2UXD B;  3OW2 U;  2Q0A A;  4KFM A;  4F6R B;  1RPR A;  4BW5 A;  1EBO A;  2B1G A;  2RMK B;  4JF3 A;  3RVZ A;  3EXA A;  2ZIM A;  1M56 B;  3W7U A;  4B7K A;  3M99 B;  1LR1 A;  4LFA O;  5FLX N;  4MTO A;  4ZOL B;  2BSK B;  3SYO A;  1XNR O;  3E8F A;  5H6Q A;  4HNA A;  2D2C B;  4DR6 O;  2QM8 A;  3FB8 C;  4C7U A;  1YI2 V;  1NTK H;  1AI4 A;  2D3O W;  1FPO A;  2P90 A;  3ZN0 A;  1FXK B;  5ITZ B;  1W2B U;  5AG2 A;  3N2K A;  4LH6 A;  1PL4 A;  4NXM B;  2A79 B;  2ZCE A;  3G71 V;  4P30 A;  5KHK A;  2Y48 A;  4WFH A;  1NBM G;  1ROP A;  5LGU A;  2H94 A;  4W4K A;  1OCZ B;  2N74 A;  2WLJ A;  5BR8 O;  2F1M A;  3MDS A;  2YXY A;  3JAS A;  3ZED A;  4X20 B;  2CTR A;  1SES A;  1GKF A;  4GX5 A;  3U11 A;  1YHQ V;  1W0J G;  2DYR C;  3H1L H;  4I7Z B;  4YJ2 A;  2V1D A;  3E89 A;  5EBL C;  4JI4 B;  4O4J A;  3AK1 A;  2EIM C;  4JI2 B;  3A2F A;  2MK3 A;  5L3G A;  2YEV A;  2QWR B;  2XUM A;  4UB6 Z;  3SJB C;  1BHA A;  3FB6 C;  3QO8 A;  2ITC C;  4R50 A;  3BRC A;  2HJF C;  3SPI A;  3ZHU A;  4NXN O;  2DW4 A;  4L8J A;  4DV0 O;  1FAF A;  1GAX A;  5JJJ B;  4U7O A;  4YJ3 B;  4PA7 A;  2NN4 A;  4GT1 A;  2AXT Z;  2IU3 A;  4Q6G A;  1GTO A;  3E83 A;  2R70 A;  1FJG B;  5EBW C;  3RYH A;  4JYY A;  1JPX A;  3SYQ A;  4I55 B;  1A32 A;  2LGQ A;  2YUA A;  4EFE A;  4DW0 A;  4P2Z A;  1X59 A;  3AEI A;  3A0B Z;  1KKD A;  3UO2 A;  3A0R A;  2P06 A;  2YIC A;  2WLL B;  4JI7 B;  4FLV A;  1Q7Y W;  3QG5 A;  4LF5 O;  2W0X A;  4X66 B;  2B9Z A;  2RN9 A;  1QR8 A;  2RCV A;  5CB4 A;  4U3F H;  1N34 B;  4B3T O;  1JJO A;  1AR4 A;  4WFE A;  4PEL A;  2ZNJ A;  2H3O A;  4ZIB A;  4DUY O;  2JEX A;  4K0K B;  1Q6H A;  1K4D C;  1I0H A;  3EHB B;  2XAQ A;  1Y4M A;  4JI6 O;  2WLK A;  3DSQ A;  2OIG A;  1JFF A;  5JJE B;  4GYC B;  3MHH C;  5FNV A;  2CTQ A;  3RYI A;  2ZIO A;  1YXB A;  3F5W C;  1EN5 A;  4B08 A;  1PNK A;  4XBF A;  1MZE A;  4LF6 O;  1HW7 A;  4KP4 A;  4X9Q A;  2EIM B;  3OAA G;  1DTO A;  5LYJ A;  4HYO A;  2YIB D;  4PDV A;  4FMT A;  5B1B C;  4PV1 B;  2WA4 A;  3FB7 C;  4RWU A;  4FJC C;  1R6N A;  2QM4 A;  3H1I H;  4FM0 A;  2JVD A;  4I50 A;  1GM7 A;  2Q7G A;  4IYH A;  1OCR C;  2KSD A;  5LGN A;  3AG2 B;  1XMO O;  1VQP V;  3TCU A;  1JQ0 A;  2DWD C;  3JAM N;  2UXX A;  4WBN A;  4QPK A;  3ABU A;  3WFV A;  1QLN A;  2AHY A;  5LYJ B;  2GBO A;  4UCS A;  4TUY A;  1XBL A;  1AJN A;  3WB0 A;  2EIK B;  4UCT A;  4CS4 A;  2CAZ C;  2P22 C;  4IL6 Z;  4J7J A;  4FFB B;  2A3Q A;  2IJJ A;  4DUZ O;  1SQP H;  1SZX A;  4TOI A;  4WFB V;  3CE2 A;  3AG1 B;  2O57 A;  4ZHQ B;  4JYA O;  3K58 A;  2RJZ A;  3ZX6 A;  1FFX B;  4YY3 O;  3CCR V;  1MG1 A;  1OCC B;  5L3D A;  4EB6 B;  2BE3 A;  4PA9 A;  2JIZ G;  1Q81 W;  1I7F A;  1K3E A;  2HFE C;  2RQ6 A;  4UCR A;  1AI6 A;  1KQS U;  1EN4 A;  2WAM A;  5LHG A;  3ZMS A;  3OR7 C;  3IGA C;  4YHH B;  4J41 A;  3SPG A;  2WWW A;  1M1K W;  4FPP A;  4J7K A;  1YSC A;  4TV9 A;  1RFY A;  3BY6 A;  3U10 A;  1MAB G;  3J7A U;  1KP2 A;  3ABK C;  5CA0 A;  1N36 O;  3T1C A;  5LXT B;  4TQF A;  4LFA B;  2ZIN A;  4X1K A;  2CH7 A;  3ZN1 A;  3FFQ A;  1VF6 C;  1P49 A;  4FLX A;  1XNR B;  4JI1 O;  4PA4 A;  2CGN A;  4DR6 B;  2L35 A;  3B2E E;  1ARO P;  1QLE B;  1KKC A;  4JPR A;  3N27 A;  5J2U B;  5GON B;  4LF9 O;  5B3S C;  5KMG B;  1XUQ A;  3JAR B;  2WSS G;  1WJZ A;  2DWE C;  2XTA A;  2JS3 A;  3SYC A;  1Q5O A;  2EJ7 A;  1SA0 A;  4QE9 A;  2QWP B;  2VWK A;  4O4I B;  4PDM A;  1GRJ A;  3G6E V;  1NH2 D;  1IXM A;  2XAS A;  5BR8 B;  1V55 C;  3RW0 A;  3D3Q A;  4LBE C;  4MVR A;  1KP3 A;  5L3C A;  1NVP D;  4DV5 O;  1N8R W;  1YTF D;  2CTP A;  1R1B A;  2A06 H;  3QO7 A;  3HKB A;  5BY1 A;  5E79 Z;  5C8Y B;  3RGB A;  1V54 C;  4L87 A;  1WA8 A;  4HBN A;  2E5L O;  2P4K A;  1KB9 F;  4KL1 A;  2ZKO A;  1XEQ A;  2F4V O;  2Q68 A;  3OUS A;  2JEU A;  3CSX A;  1YF2 A;  1M93 A;  1AVM A;  3GB7 C;  4JAU A;  3ABM B;  2QTO A;  3CRA A;  3ABK B;  3JSN A;  3OTO O;  4NXN B;  4DV0 B;  1VQ9 V;  3CD6 V;  1G4Y B;  5C93 A;  3JAW B;  5IDJ A;  1SQV H;  4IIJ B;  1EZV H;  1Q86 W;  1NZ6 A;  4X1Y B;  5GW7 A;  3OUF A;  1WB7 A;  2X7R B;  4JI3 O;  2CDY A;  3VQY A;  4RUF A;  5L3E A;  5LA6 B;  2HJD A;  5BMV A;  3S3W A;  2NNU A;  2UUB O;  2VQF O;  4BW9 A;  5B5E Z;  1JX9 A;  3CRR A;  5B3S B;  2UXN A;  4UVA A;  1SET A;  3DXR B;  1GMG A;  4LF5 B;  2GUZ A;  2JRI A;  2OWO A;  1AIL A;  5J2T A;  1Z5V A;  3APO A;  4B3T B;  2ZE7 A;  4PI0 A;  4DUY B;  5EC1 C;  4LFB O;  1VQ6 V;  3VQV A;  2WLI A;  2HR3 A;  4JI6 B;  5A9G A;  2Q0O C;  1Y76 B;  2Q7H A;  3OE7 G;  1Q6I A;  1NI8 A;  3ABL C;  3ETQ A;  3JD1 A;  4LCU C;  3OEH G;  1V54 B;  1PNL A;  5LP6 C;  4LF6 B;  2XAF A;  5A2Q N;  2GUZ B;  1URF A;  3LNN A;  1WPX A;  3T1Y O;  3CCU V;  2V4D A;  1TVK A;  4UV9 A;  3LNM B;  4GKJ O;  3BHP A;  2DN9 A;  2PYL A;  3L73 H;  3LDD A;  3ZRW A;  3T4D A;  3F7Y C;  2LJ2 A;  4TQD A;  4GCZ A;  1IXB A;  1E79 G;  1BMF G;  2EIN C;  3FKS G;  3CJH B;  2OCC B;  3D36 C;  3ZMT A;  4DXW A;  1IX9 A;  4RO2 A;  2QGN A;  1XMO B;  1ZL8 A;  1AR1 B;  3LSS A;  4RQF A;  2Q73 A;  4WFG A;  1P84 F;  4DK0 A;  2EX3 A;  1QVG U;  2R9I A;  4FZ0 A;  3A8T A;  5LP6 A;  1H2S B;  1VP7 A;  4DUZ B;  4WF9 V;  3L70 H;  1AI7 A;  5IJ9 B;  3CRC A;  3OR6 C;  3TJT A;  3E2E A;  4JYA B;  2GV9 A;  2ODM A;  3E22 B;  1AP6 A;  1SQQ H;  2JJ2 G;  2VRZ A;  4YY3 B;  4CH6 A;  2Q67 A;  1M57 B;  5BXZ A;  3WG7 B;  3JYC A;  5KAF Z;  1WAZ A;  2Y69 C;  1K8A W;  1CP9 A;  4U3J A;  4J9Y B;  2JGD A;  1RSO A;  3CWB H;  2QJ1 A;  1G1X B;  3JAK B;  3ZHR A;  3D36 A;  1R3J C;  2ETN A;  2IJI A;  3K03 A;  5LP6 B;  4UUJ C;  4QIW F;  1H2G A;  1WPB A;  4DV2 O;  1H2K A;  2EIJ B;  4O2B B;  5L3F A;  4K8Z A;  2IU0 A;  3K5L A;  4QJF B;  2IM9 A;  1K4C C;  5F2V O;  3QNE A;  4DR7 O;  5LBQ A;  3SGI A;  2XHB A;  3HKD B;  1HNZ O;  5LOV B;  4ZI7 B;  5B1O A;  4OX9 O;  4G27 B;  1N36 B;  4ZBM A;  4E2L A;  1WP8 A;  2EIN B;  1N32 O;  2XAG A;  1XIL A;  4JI1 B;  4JAA A;  5DEC A;  2YI8 A;  3ZCC A;  3ZJZ A;  2CK3 G;  2KG7 A;  2IJH A;  5KX5 A;  1P4R A;  4LF9 B;  3G80 A;  4PA6 A;  4DK1 A;  2ZR3 A;  3RBZ A;  4Z2W A;  2WLM A;  4EEQ A;  4LR3 A;  4NVP A;  4ASU G;  3T1H O;  1S5L Z;  4FM2 A;  4AQY O;  2YI9 A;  3CS5 A;  4HNA B;  5IE9 A;  4DV3 B;  3GVM A;  2ZD9 A;  2DYS C;  3ZBH A;  3GWO A;  1SQB H;  3OGC C;  4XDL A;  1DK1 A;  5IJ0 A;  4O4H A;  1GK9 A;  1GO3 F;  3IJ4 A;  2Y69 B;  4LF4 O;  2ILM A;  3N2K B;  3C3T A;  4DV5 B;  5JJN B;  1BCC H;  2N05 A;  4YIO A;  2EBO A;  3UQ8 A;  5B1N A;  1EZJ A;  1SQX H;  2BCC H;  1QCE A;  4BWA A;  2KQX A;  5KUK A;  4AHC A;  4LC1 A;  1WNS A;  3UT5 A;  4P9O A;  3KCY A;  2E5L B;  2AW9 A;  5B1A C;  2QSA A;  3VQX A;  1AI5 A;  3X2Q C;  1Q8I A;  3Q4H A;  2VQE O;  1HNX O;  3JAS B;  2F4V B;  2YIA A;  3IC9 A;  2GHY A;  1BE3 H;  1BZK A;  3K04 A;  3OMI B;  5H9C A;  3OTO B;  5TIS Z;  4NB5 A;  4YJ2 B;  2LP7 A;  2HHH O;  1WLE A;  4O4J B;  1AR5 A;  4HZ3 A;  3LSU A;  4MVQ A;  4JI3 B;  1YIJ V;  4N21 A;  2YEV B;  2VWJ A;  4B3S O;  1YJ9 V;  1Y67 A;  2UUB B;  2VQF B;  3DC5 A;  1N0J A;  3G6B A;  2EZP A;  4UVB A;  2XAH A;  3E35 A;  2WA3 A;  3SJQ C;  3EVK A;  4IHJ A;  1RM1 C;  2LO1 A;  2Q5Z A;  4DRX A;  3K3W A;  1BS3 A;  2NR5 A;  2K1E A;  1VMG A;  4CZZ A;  4MTX A;  1D5A A;  1R6T A;  4DV7 O;  3HKC A;  3FAV A;  3RYH B;  2UU9 O;  1OV9 A;  3HKE A;  2BTO A;  1VQM V;  2DYR B;  3MD0 A;  4MS2 A;  3K5O A;  2F93 B;  2FYU H;  2HP8 A;  4IT5 A;  4I4T A;  2QKS A;  4LFB B;  4MT8 A;  3IAY A;  4X1I A;  3VQW A;  4LNU A;  4GZR B;  3ZMV A;  4AI8 A;  3W7X A;  3JCZ A;  4DR5 O;  4JTC B;  5JVD A;  1NR7 A;  3CXH F;  4LWS A;  3K5M A;  5CB4 B;  3L74 H;  3C90 A;  5GTH Z;  1VQK V;  3RN4 A;  4WCE V;  4IHJ B;  4DRX B;  3T1Y B;  1VEW A;  4GKJ B;  1XHX A;  4K3A A;  1HDJ A;  4X64 O;  1JFF B;  1JR9 A;  1NQT A;  4CS3 A;  5LL6 Y;  5FNV B;  3SJC C;  2CUG A;  3CEI A;  3FX7 A;  3RYI B;  4H37 A;  3JD2 A;  1HNW O;  5IYZ A;  1EM1 A;  2YID A;  3NXS A;  2M7W A;  4X1I B;  4J7Z A;  4I0X A;  2B5U A;  3G67 A;  2JK5 C;  3ZHS A;  1BSM A;  2X0L A;  3OT7 A;  1YJW V;  1NR1 A;  3BCC H;  5EBM C;  1GN2 A;  3ASN C;  3P32 A;  4O4L A;  3OM3 B;  4TWK A;  2YIB A;  1GM8 A;  2BOB C;  4RUE A;  3E8B A;  4W4L A;  4X65 O;  3AK3 A;  1JOY A;  1I08 A;  1TUB A;  2HVK C;  5LMU O;  4I50 B;  5GTI Z;  1I5Y A;  1JMK C;  2LGW A;  1L1F A;  2HG5 C;  4JV5 O;  2DE0 X;  2YSU B;  3WU2 Z;  3CB2 A;  1ZWI C;  2BTQ A;  3S3X A;  4DV4 O;  3CRM A;  3ETE A;  3MAQ A; 
#chains in the Genus database with same CATH homology
 1SRY A;  1K73 W;  1JJ2 U;  1HWY A;  1SER A;  5IDJ A;  1MOF A;  1S72 V;  1Q86 W;  3H01 A;  1AJQ A;  1XL6 A;  5GW7 A;  3UKM A;  3OUF A;  1S0V A;  4MTF A;  4TT3 G;  2X7R B;  5EK0 A;  1W0K G;  4Z1M G;  1QBZ A;  3AG3 C;  2IJK A;  2C2A A;  4RUF A;  1THZ A;  4N23 A;  2ZXW B;  5L3E A;  3AG2 C;  4F4L A;  4CBC A;  2EIL B;  4R7C A;  2PI5 A;  2NNU A;  5IYB O;  3CCV V;  3FYE B;  3CCQ V;  5J9P C;  3CC4 V;  2HVJ C;  4YXW G;  1JX9 A;  2AHZ A;  1LNQ A;  2WLH A;  5B1B B;  3UM7 A;  5LHH A;  5B3S B;  3OW2 U;  2UXN A;  4UVA A;  3CC7 V;  1AJP A;  1SET A;  4KFM A;  2NLJ C;  1GMG A;  2OT5 A;  1RPR A;  2EIK C;  3CXC U;  4MSW C;  1VQO V;  4BW5 A;  3K08 A;  1S5H C;  3W7T A;  1EBO A;  2B1G A;  1I5X A;  4JF3 A;  2LFR A;  2QE7 G;  2DYS B;  1RPO A;  3RVZ A;  4FK5 C;  3AG1 C;  3SYP A;  1COW G;  1M56 B;  3W7U A;  3CPW U;  3M99 B;  1OCR B;  3KG2 A;  4RQE A;  5EC1 C;  1EFR G;  4MTO A;  1VQ6 V;  1OCO B;  3SYO A;  4HAM A;  1F4M A;  1F4N A;  2HR3 A;  2WLI A;  3E8F A;  4MVO A;  1OCC C;  5H6Q A;  3OE7 G;  2P6J A;  2QM8 A;  3FB8 C;  2EJR A;  3MHS C;  1PL0 A;  4JTD B;  2W6I G;  2WPD G;  3ABL C;  3JD1 A;  4LCU C;  1TUE B;  2JDI G;  1YI2 V;  5B1A B;  2WLN A;  3OEH G;  1AI4 A;  2D3O W;  1V54 B;  1PNL A;  2P90 A;  1R3I C;  3ZN0 A;  3X2Q B;  1FXK B;  2XAF A;  1W2B U;  4JAV A;  2EZO A;  1WPX A;  5CA3 A;  1E1R G;  3CCU V;  4UV9 A;  2A79 B;  3ETD A;  3LNM B;  3G71 V;  4P30 A;  2ITD C;  3E8H A;  1B6Q A;  2X6C A;  1H8H G;  2Y48 A;  1NBM G;  1ROP A;  4WFH A;  5LGU A;  2H94 A;  1FS0 G;  3LDD A;  3ZRW A;  3T4D A;  3F7Y C;  2HLD G;  1OCZ B;  4DO2 A;  2WLJ A;  4GCZ A;  1S76 D;  4PA3 A;  1NKD A;  4QPJ A;  3CCL V;  1SES A;  3K0D A;  1E79 G;  1BMF G;  1GKF A;  1DF5 A;  4GX5 A;  2EIN C;  3DTU B;  4LP8 A;  1YHQ V;  3FKS G;  4I5S A;  5CBH A;  1W0J G;  2OCC B;  3ZMT A;  4DXW A;  2DYR C;  1VQ8 V;  2X6A A;  4GX2 A;  3OFN G;  4RO2 A;  5LHI A;  5KA6 A;  3D3I A;  3AG3 B;  2P7T C;  3STL C;  2V1D A;  3E89 A;  3F7V C;  1AR1 B;  5EBL C;  3TK1 A;  3G4S V;  1K34 A;  2EIM C;  3LSS A;  4RQF A;  4WFG A;  2MK3 A;  1QLE C;  5KA5 A;  1QVG U;  2R9I A;  5L3G A;  1RM1 B;  1H8E G;  2YEV A;  3CCM V;  1BHA A;  3B8M A;  2OTJ V;  3FB6 C;  4WF9 V;  3QO8 A;  1R6K A;  2ITC C;  4R50 A;  2HJF C;  3SPI A;  1AI7 A;  2DW4 A;  3W7W A;  3OR6 C;  3E2E A;  4J9Z B;  4BAY A;  3RVY A;  4U7O A;  1YIT V;  1QVF U;  4PA7 A;  2H8P C;  2JJ2 G;  1OZ0 A;  3HB3 B;  4MVU A;  3B8N A;  1PD3 A;  2Q67 A;  4GT1 A;  5KUM A;  1M57 B;  3K06 A;  4GX0 A;  2IU3 A;  3WG7 B;  1GTO A;  3JYC A;  2Y69 C;  3E83 A;  5EBW C;  1K8A W;  1CP9 A;  4J9Y B;  1JPX A;  3K79 A;  3SYQ A;  4I9W A;  4XDK A;  4Q20 A;  3EFF K;  3D36 A;  1R3J C;  4R8C A;  4P2Z A;  2IJI A;  3K03 A;  1PNM A;  4X8A A;  3AEI A;  1KKD A;  3A0R A;  3DGE A;  4WFA V;  4MVM A;  4UUJ C;  2X6B A;  2WLL B;  3CYO A;  4QIW F;  1H2G A;  1YJN V;  1Q7Y W;  2EIJ B;  5L3F A;  2ZDI C;  3K9A A;  3HPL C;  1QR8 A;  2IU0 A;  3JD3 A;  3CME V;  4QJF B;  1K4C C;  2XOK G;  3QNE A;  1V55 B;  4WFE A;  4PEL A;  5LBQ A;  3T4Z A;  3VOU A;  1KC8 W;  2Q69 A;  3OMA B;  3SPH A;  3ABM C;  3ML0 A;  2LFS A;  4KUM A;  2JEX A;  1G8M A;  3IC7 A;  1K4D C;  5LGT A;  3B77 A;  2P67 A;  3QO5 A;  5B1O A;  3EHB B;  1ORQ C;  2XAQ A;  4G27 B;  4ZBM A;  1Y4M A;  4E2L A;  1FFT B;  2WLK A;  5E1A C;  2EIN B;  4QNH B;  2A9H A;  3ASN B;  2ZR2 A;  2XAG A;  3MHH C;  1Y66 A;  4BIU A;  2QEX V;  1R3L C;  5HFM A;  3F5W C;  3VBB A;  3ZCC A;  2Q6A A;  4X89 A;  1PNK A;  4XBF A;  3ZJZ A;  5L3B A;  1NJI W;  4KP4 A;  2CK3 G;  2EIM B;  3OAA G;  2IJH A;  2BOC C;  2EIL C;  2Z5U A;  1DTO A;  1P4R A;  3BEH A;  1MSW D;  4HYO A;  1FXH A;  3SPJ A;  4PDV A;  1F51 A;  4FMT A;  4PA6 A;  4X88 A;  5B1B C;  1Q82 W;  3FYI B;  4TSF G;  2ZR3 A;  4G2K A;  3RBZ A;  2WLM A;  4JAS A;  3FB7 C;  3ASO C;  4ASU G;  4U7N A;  2WLI B;  2ZDI A;  4FJC C;  3TET A;  1R6N A;  5CN0 A;  2ZD9 A;  2DYS C;  3JD4 A;  3SPC A;  4BIZ A;  3OMN B;  3GWO A;  3OGC C;  1M56 C;  4XDL A;  5BZB A;  1GM7 A;  2HKO A;  3SYA A;  1GK9 A;  1GO3 F;  2R9R B;  1OCR C;  1P7B A;  2Y69 B;  2OTL V;  5LGN A;  5CMU A;  3ZMU A;  4UVC A;  3ABT A;  3AG2 B;  1VQP V;  3TCU A;  1JQ0 A;  2EBO A;  2DWD C;  5B1N A;  1EZJ A;  2QM7 A;  2UXX A;  4QPK A;  3ABU A;  1QCE A;  2DQ0 A;  3WFV A;  1QLN A;  2AHY A;  1S3J A;  5KUK A;  1K5Q A;  3LDE A;  2IW5 A;  3ZRW B;  4LC1 A;  2IH1 C;  4G28 B;  4P9O A;  1AJN A;  2EIK B;  5B1A C;  5HFL A;  3STZ C;  1S77 D;  1AI5 A;  3X2Q C;  1FXK C;  2IJJ A;  1BL8 A;  4WFB V;  3OEE G;  3ZRS A;  3AG1 B;  3LSQ A;  2GHY A;  4QE7 A;  3ZRV A;  3K04 A;  1VQL V;  3OMI B;  4RAI A;  4H33 A;  2IH3 C;  1VQ7 V;  5H9C A;  3CCR V;  1ENV A;  1MG1 A;  4JGS A;  1VQ4 V;  1CEZ A;  1OCC B;  5L3D A;  1DLB A;  1DF4 A;  1K33 A;  2LP7 A;  5DM6 V;  1R3K C;  3IFX A;  1WLE A;  4MVS A;  4PA9 A;  1F23 A;  2JIZ G;  1Q81 W;  1K3E A;  2HFE C;  3PJS K;  4HZ3 A;  1AI6 A;  4PDL A;  4ZKI A;  3ZRX A;  3ABL B;  4WFF A;  1KQS U;  4MVQ A;  1YIJ V;  2OCC C;  3JD0 A;  1K5S A;  4N21 A;  2YEV B;  2WAM A;  5LHG A;  3ZMS A;  3CP1 A;  3OR7 C;  5IY5 C;  1H38 A;  3IGA C;  3K0G A;  1NH2 B;  1YJ9 V;  5FL7 G;  3W7S A;  3LUT B;  5EC2 C;  1SZT A;  3SPG A;  2WWW A;  1M1K W;  2EZP A;  4UVB A;  4FPP A;  2XAH A;  1YSC A;  3E35 A;  1NVP B;  4P9P A;  3BY6 A;  3SJQ C;  1UJW B;  1PKX A;  1BHB A;  1YTF B;  1RM1 C;  3K3W A;  1FXK A;  4R6Z A;  2XND G;  1MAB G;  3ASO B;  2K1E A;  4CZZ A;  4MTX A;  1KP2 A;  1XL4 A;  5IYD O;  3ABK C;  3AG4 C;  4JTA B;  4JYC A;  3T1C A;  1VQM V;  1KEC A;  2DYR B;  1GM9 A;  3MD0 A;  1R73 A;  4MS2 A;  3ZN1 A;  1JVM A;  3ZIA G;  2QKS A;  4MT8 A;  1VQ5 V;  3R65 A;  1M57 C;  3ZMV A;  4PA4 A;  3W7X A;  3JCZ A;  3WG7 C;  4EKW A;  4JTC B;  1NR7 A;  5H6R A;  3CCE V;  1JCH A;  2ZXW C;  1ARO P;  3FB5 C;  4GX1 A;  2F43 G;  1QLE B;  3P30 A;  3ZMZ A;  4JYB A;  2GSM B;  4UXN A;  4JPR A;  3T2M A;  5B3S C;  5CBF A;  3CMA V;  1VQK V;  2KB1 A;  3LDC A;  2WSS G;  4WCE V;  4FIP C;  3CC2 V;  2DWE C;  3I56 V;  4MTG A;  3SYC A;  4MW3 A;  5IYC O;  3E86 A;  3CCS V;  4UV8 A;  2Z3Y A;  2EIJ C;  2W0F C;  4QE9 A;  2FTK A;  2DQ3 A;  4PDM A;  2B1I A;  3G6E V;  1NH2 D;  1IXM A;  1NQT A;  2XAS A;  1V55 C;  3RW0 A;  2W6J G;  4H37 A;  2XAJ A;  3JD2 A;  4LBE C;  3E8G A;  3ETG A;  1KP3 A;  4MVR A;  1J95 A;  3NXS A;  1KD1 W;  2M7W A;  5L3C A;  2B5U A;  1OCO C;  1NVP D;  2JK5 C;  1FXV A;  1N8R W;  1YTF D;  4MW8 A;  4PDR A;  5DN6 G;  2X0L A;  3QO7 A;  1YJW V;  1NR1 A;  5EBM C;  1QR9 A;  3ASN C;  1VQN V;  3P32 A;  1M90 W;  5IY5 B;  3OM3 B;  4XDJ A;  4TWK A;  1V54 C;  2ATK C;  4L87 A;  1GM8 A;  1CPY A;  2BOB C;  4RUE A;  3E8B A;  1K92 A;  4OXS A;  1JOY A;  2Q68 A;  2JJ1 G;  3OUS A;  1K7D A;  2JEU A;  2QA4 V;  3I55 V;  2ZQM A;  2HVK C;  3GB7 C;  4JAU A;  3ABM B;  5CBG A;  3CCJ V;  1I5Y A;  2QTO A;  1K97 A;  1L1F A;  1OCZ C;  2HG5 C;  2YSU B;  2V7Q G;  2A0L A;  1E1Q G;  2WLL A;  4MVZ A;  1ZWI C;  3ABK B;  1K9M W;  3AG4 B;  1VQ9 V;  3ETE A;  3CD6 V;  1G4Y B;  2PI4 A;  1OHH G;  1M9N A;  5C93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...