3K0BA

Crystal structure of a predicted n6-adenine-specific dna methylase from listeria monocytogenes str. 4b f2365
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
380
Chain Sequence
b'SSGRENLYFQGMKSFQLVATAASGLEAIVGKEVARLGYDPKVENGKVYFEGDLSAIARANLWLRVADRVKIVVGVFKATTFDELFEKTKALPWEDYLPLDAQFPVAGKSVKSTLYSVPDCQAIVKKAIVNRVSEKYRRSGRLMETGALFKLEVSILKDEVTLTIDTSGAGLHKRGYRLAQGSAPIKETMAAALVLLTSWHPDRPFYDPVCGSGTIPIEAALIGQNIAPGFNREFVSETWDWMPKQVWADARQEAEDLANYDQPLNIIGGDIDARLIEIAKQNAVEAGLGDLITFRQLQVADFQTEDEYGVVVANPPYGERLEDEEAVRQLYREMGIVYKRMPTWSVYVLTSYELFEEVYGKKATKKRKLYRTDLYQYWGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords predicted N6-adenine-specific DNA methylase
publication title Crystal structure of a predicted N6-adenine-specific DNA methylase from Listeria monocytogenes str. 4b F2365
rcsb
source organism Listeria monocytogenes str. 4b
molecule tags Structural genomics, unknown function
total genus 119
structure length 380
sequence length 384
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3k0bA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3k0bA02
4KRGA 1KXZA 3GCZA 3EMBA 5LSAA 4LWPA 5LQRA 1G60A 2ERCA 2XYVA 3BGVA 4M38A 2YR0A 4PCAA 1BC5A 4MWZA 2BR5A 2BM8A 4EKGA 4CXMA 5DRTA 4IWNA 4Z2YA 3QV2A 2PXAA 2G70A 3LBFA 1SG9A 3UJDA 1YB2A 3P9KA 5GIOE 4E70A 1YZHA 2IIPA 2GA9A 3LKZA 4U7TB 3T7SA 1MJFA 5CCXA 2NP6A 5DX8A 2IBTA 2AVNA 2OXTA 3KR2A 3QOWA 3A4TA 3V97A 2P3LA 3BWMA 2ONYA 3O31A 4WVLA 2OPBA 1JQ3A 3AJDA 4HG2A 1JSXA 4KR6A 1M6YA 1ZHFA 3ELUA 2LD4A 3LCVB 7MHTA 3VSEA 5EHIA 4MIKA 3EVFA 1R18A 1SKMA 2XYQA 4FR0A 3EVDA 2B9EA 5T64A 5HZMA 4PYMA 5K8VA 4AUKA 3A25A 3HVIA 5HIIA 5CM2Z 3PLAE 3A26A 3FRHA 4OA5A 2OYRA 3RODA 2AOUB 3HNRA 2XBMA 5GOZA 3FPJA 4F85A 3FUXA 5E9JA 5FUBA 3KQYA 2PX4A 4R8SA 2FCAA 3BWBA 3MTIA 3HA3A 3CCFA 4PYLA 4PWYA 5E1OA 3O7WA 3FZGA 4YUZA 5H02A 5C9ZA 4RX1A 3SMQA 3TKAA 1RJDA 2ZCJA 4FSDA 2FK7A 2N47A 3UJ6A 5CD1A 1OR8A 2ORED 4ER7A 8MHTA 4HGYA 5DM2A 3UBTA 2PX5A 1RI3A 4QTUB 4QTTB 2PY6A 3CVOA 2Z6UA 4KR9A 3NJRA 5C0OE 2I62A 4KDCA 3HA5A 4PYQA 3LECA 5KYGA 1U2ZA 3HCBA 3KR1A 3NDJA 3S68A 1DCTA 3LKDA 3EVEA 4QQKA 5FTWA 4QVGA 4RTKA 2PT9A 4X63A 3T7RA 2OBFA 5EC8A 5G02A 5EKXA 5JUWA 3CBGA 4DF3A 4LECA 5C1IA 2IH4A 4E31A 3OZSA 4MTLA 4IV8A 2PKWA 2YX1A 3CJQA 3GXOA 3KQTA 4ER5A 3P8ZA 3FTEA 1F3LA 1EG2A 2B3TA 4EK9A 2AOXA 3OE5A 4PIPA 2BM9A 2NXNA 1RI5A 3HCDA 2P8JA 2AR0A 3GIWA 3UWPA 1Q0SA 2FPOA 3EGVA 3OCJA 4R6WA 2YXLA 3DOUA 3UJCA 1RJFA 2PT6A 5LR6A 2XYRA 4M37A 3JWHA 5BW5A 3DLIA 4KVZA 1FJXA 4CTKA 5D1NA 3A27A 4QPNA 3B3FA 5EKUA 1IM8A 2PLWA 3JWJA 5E1MA 3LCCA 4E2XA 3LDUA 5DPMA 1FP1D 5LQNA 3HTXA 4GUAA 2VS1A 2CMGA 3MGGA 1XTPA 5EQJB 4GC9A 4CKBA 3EMDA 3MCTA 3OE4A 1P1BA 3M6XA 1D2HA 5E8JA 2IBSA 2H11A 3FYDA 3TQSA 3TLJA 1EIZA 5EZQA 1VBFA 2PV0A 3PX2A 2NP7A 2WA2A 2WA1A 2AOVA 2IDJA 3HM2A 5EMLA 3R24A 4IV0A 4B17A 4F86A 4OBXA 1FPQA 4GC5A 4YV0A 4NECA 3HVKA 2Z6QA 5MHTA 4OQEA 4DKJA 5CVVA 5EEHA 2GH1A 3UA3A 5K0JA 3KQMA 2NNWB 5DX1A 2AOWA 3ELYA 2AOUA 2YXEA 1P1CA 1TPYA 4RTLA 3FUWA 2PGXA 1HNNA 2CMHA 4RTMA 4M7RA 5EMMA 9MHTA 3R9XB 3I9FA 2G8NA 3I58A 3OPNA 4ER3A 5BP7A 3ELDA 3THRA 2JHPA 2OZVA 3HCAA 4V0QA 5FULA 4PYIA 3SGLA 3G8AA 3AY0A 4R05A 5CVJA 5HIMA 1Z3CA 1KR5A 2O05A 3TPZA 2ZBQA 1VP3A 3GGDA 3R6TA 1O9HA 3P71T 2CWWA 3UA4A 3EVBA 4H0NA 2AVDA 1NW8A 2DULA 1NT2A 2G71A 3O4FA 1ZKDA 3LPMA 4FT4A 3E05A 3KPJA 3TOSA 4DZRA 3HCEA 4R6XA 1R8YA 4E2ZA 3GDHA 1KPGA 3PS9A 3SSMA 4GOOD 2ZWVA 1NV9A 3FTCA 2BZGA 1NE2A 1X1BA 2FHPA 3GWZA 5U4XA 5K01A 4RTNA 5EEGA 3LCUA 2EX4A 4C05A 1WXWA 1BKYA 2DPMA 1WY7A 1QZZA 4CKCA 3HCFA 2ZFUA 3G5TA 3FUVA 5EGSA 2FRXA 3EGEA 4XCXA 3DP7A 3VC1A 3H2BA 1JR4A 5GIPE 3CKKA 2VDVE 1P39A 2I6GA 1SUSA 1VIDA 4X60A 3FTFA 2IDKA 2GPYA 2IPXA 2YXDA 5HOQA 1MHTA 1EQAA 2FYTA 3KR9A 2OY0A 2ZIEA 3P9CA 4DCGA 4R8RA 1KP9A 4FT2A 1N7IA 1M6EX 4ZTBA 5P8WA 2P35A 3LSTA 2GAFA 1RJGA 1DUSA 3G2QA 3LGAA 4FS8A 1G8SA 3OU7A 4PCLA 5DM1A 3UJ8A 3KU1A 4POOA 2ZZNA 1QANA 4X61A 3FPGA 1L3CA 2GLUA 3CJTA 3REOA 1FP2A 3F4KA 3GU3A 1QAMA 5EPEA 1F38A 5EZSA 5K0EA 4EKIA 3B3GA 1I9GA 3IHTA 1NV8A 4X1OA 2UYQA 2ZULA 5K09A 5FA8A 2IFTA 2BR3A 1ORIA 2P40A 4YMHA 5EHGA 5EIWA 1R6AA 1JG2A 2AZTA 3G2MA 3MQ2A 4KIGA 4L7VA 5E2BA 5DTQA 5HILA 3PTAA 1XXLA 4IKPA 4DCMA 1ORHA 2E5WA 2QYOA 5E1DA 2JH8A 5F2KA 2ZZMA 5DLYA 2B78A 3KPYA 4C08A 5CVUA 5M5BA 1SQFA 2GS9A 4KIFA 5HIKA 3RIEA 5K03A 4P7JA 3SX0A 3SR4A 4BP3A 5K0CA 4BY9E 3P9NA 1INLA 3AWIA 3C3PA 4CWAA 3DXZA 3OZTA 5DX0A 3HVHA 4RVDA 4A6DA 3EEYA 4RTJA 3E8SA 1JQDA 4KW7A 2O0LA 5EG5A 1SQGA 1KYWA 3HEMA 2ZLBA 4CKEA 1JG3A 3E7PA 1BHJA 4QDJA 3IYLW 5GINE 2JG3A 3BWYA 2A14A 1I4WA 2HTEA 5EMKA 3ERCA 2CL5A 2Z6AA 1PRYA 3KQWA 3THSA 2JHCA 2C7OA 1G55A 3D2LA 3M4XA 3SVZA 3TFWA 1VE3A 1M0EA 4C07A 2I9KA 3ER8A 3P2EA 3NDIA 3P2KA 1YFLA 2VZ9A 4KDRA 3P9IA 1YFJA 3UJ7A 4YV2A 4WXHA 5K0LA 1SUIA 5CCBA 1XCJA 3C0KA 3UJBA 4P7FA 1JG4A 2PX8A 3TM5A 1WG8A 3KQQA 4FP9A 3PFHA 2P7IA 4GOMD 1AF7A 3Q87B 4E30A 3MHTA 3G5LA 2Y1XA 1L9KA 5T67A 3KQPA 2JH9A 4YUWA 4C06A 4M36A 5LQCA 2HMYB 3SSOA 5FWAA 4A6EA 5IH3A 1RJEA 2ZW9A 1X1CA 3AXTA 3G88A 5ICFA 1Y8CA 2OKCA 3BKWA 2UYHA 5DXAA 4PINA 3UZUA 4GOND 3EVZA 3HP7A 4RVHA 3NMUF 1WXXA 2P7HA 1DL5A 3UJAA 2PXXA 2AN3A 1O9GA 2CKDA 2NYUA 1ZGJA 2AS0A 2OO3A 3FPEA 5DTMA 3EEOA 4EQZA 2H1RA 2ZBPA 3BGIA 3DTNA 3HCCA 1YUBA 1NW3A 2HR1A 2JJQA 5DTRA 5FWDA 3GRUA 3KQVA 4OQDA 4G56A 2VDUE 2HWKA 4AX8A 2ZIFA 3TRKA 1NW5A 2QY6A 3LX6A 5EMJA 5EIFA 4FSXA 3NVMB 4DMGA 5ERGB 2PWPA 3I64A 1TW2A 4AZVA 4DQ0A 4AZSA 4PIMA 4E2WA 1N2XA 3ANXA 3FPFA 5T6BA 2QE6A 3GRRA 3JWGA 3U81A 3NVKI 4QPPA 1D2GA 5DXJA 5LQJA 2XVAA 1G6Q1 1UWVA 3AXSA 1XJ5A 1L3IA 2GB4A 4BLUA 3A7DA 3A7EA 4KR7A 3CJRA 1RI1A 4KWCA 5ICCA 3DMGA 3DXXA 2NXEA 3KKZA 2F8LA 1T43A 2P3QA 3MTEA 3OU6A 5F2NA 3GJYA 1NW7A 4E33A 5D1HA 2PJDA 3JWIA 3M6VA 2AN5A 5GWXA 4C03A 2B25A 2C7RA 2PXCA 5HIJA 4Y2HA 4EMSA 1X19A 3DR5A 3GRVA 3M6WA 1EJ0A 1QAOA 5HFJA 3DMFA 3SM3A 1AV6A 2KW5A 4P7GA 3G2PA 3RW9A 1O54A 1KHHA 3ELWA 5CIYA 4C4AA 4DM3A 1AQIA 1X1DA 2FK8A 2NXJA 2ZZKA 2IH5A 5DSTA 1JQEA 3OU2A 2PVCA 2V7EA 4P7KA 4GEKA 4CTJA 2ESRA 3M70A 5LQKA 4RTQA 4OX9Y 3L8DA 2AOTB 3FTDA 4X41A 3LDFA 3KQSA 3HVJA 2YTZA 4HC4A 4HSGA 1B42A 2O57A 3BUSA 5EOVA 5LQUA 5EVJA 3ER9A 3KPVA 4MHTA 3ME5A 1AQJA 2HNKA 3V8VA 5CUQA 3IEIA 4YUXA 4OBWA 4ATNA 4PYNA 4BLVA 2O06A 4GQBA 3SXJA 1WZNA 1JTFA 3DULA 4YUYA 5DWQA 2QRVB 5BXYA 3NWEA 2XVMA 1TW3A 5BW4A 2QM3A 2NXCA 3GNLA 3GRYA 3LDGA 1YZ3A 3M6UA 3Q7EA 4PGGA 3PB3A 4YMGA 2PSSA 4UOEA 3R3HA 3BKXA 5E2AA 2BR4A 1BOOA 4ER6A 3T0IA 3DMHA 2UZ4A 5B1SA 4LWOA 3T7TA 1R00A 2V74B 5FADA 4MQ4A 2ZSUA 3LHDA 2C7PA 1XDZA 3M33A 1KPHA 1N7JA 5DSXA 1VL5A 2HV9A 1UFKA 4LG1A 5DM0A 3FUUA 5GM1A 2H00A 3PX3A 3EPPA 1KYZA 2I7CA 3B3JA 3DLCA 4GF5A 5K0FA 1QYRA 3GO4A 3BWCA 3UFBA 3MERA 2C7QA 1I1NA 3TM4A 1HMYA 3EVCA 4PONA 3EGIA 3CC8A 3SSNA 3TKYA 1FBNA 1VPTA 3X0DA 4HTFB 1EAMA 1R74A 2P3OA 2EJUA 1XDSA 3KR0A 1JTEA 5HEKA 3NTVA 3R0QA 4AZTA 4Y30A 2Q41A 2VDWA 5K0GA 3ORHA 2PX2A 1XDUA 3OFJA 3DH0A 2AN4A 2ONZA 3CGGA 4PNEA 3OFKA 3K6RA 3NW9A 4RTPA 4JXJA 5KQRA 2R6ZA 5E9WA 5KVAA 5ICEA 2EG5A 2OB1A 4GOLD 2ADMA 4RVFA 5FHRA 5IKMA 3TMAA 3MB5A 5LQAA 3KPWA 1KIAA 1VQ1A 4RWZA 2ZWAA 4QDKA 5FA5A 4EVIA 5K05A 1XVAA 3G8BA 4AZWA 1H1DA 1VP9A 4ER0A 2BH2A 3B89A 5E9QA 2PWYA 3FYCA 1UIRA 1JSZA 5FHQA 2G72A 3DXYA 4GBED 4HRAA 5E8RA 4O29A 2YVLA 3EVGA 3VYWA 4E32A 1JG1A 1D2CA 5E1BA 4E2YA 5K0NA 3KQOA 4XUEA 1Q0TA 3WSTA 2IGTA 3MCZA 1G8AA 3NWBA 3PVCA 2OB2A 3C3YA 3PFGA 5CVEA 5DM4A 3VC2A 1RI2A 5JR3A 3IV6A 2AOTA 3EVAA 4PYJA 4P58A 4C04A 1X1AA 1R8XA 3BZBA 1ZGAA 3BT7A 3G2OA 4HH4A 3C6KA 2UYCA 2R3SA 3P2IA 1YF3A 3QOXA 5FCDA 4RTOA 2WK1A 1ZG3A 4OA8A 2G1PA 4PGHA 1VLMA 2EJTA 3FUTA 3KHKA 5GM2A 3I5UA 1EJ6A 3MAGA 2EFJA 3G7UA 1V39A 2QRVA 2PBFA 4RVGA 2Y1WA 4DA4A 2ZBRA 3ID6C 1SVUA 2YUIA 5FQOA 2IP2A 1IY9A 2B2CA 1WS6A 4V0RA 5CVDA 4BP1A 4BLWA 4RTRA 2VP3A 3KPUA 1L3BA 5DRYA 5DT2A 3UJ9A 3K0BA 2UYOA 3E23A 1XCLA 2K4MA 4HGZA 3TR6A 2JHAA 4QVKA 1KPIA 3BXOA 2IH2A 3C6MA 3DUWA 4PYKA 1L1EA 1QAQA 4PYOA 1ZQ9A 1P91A 1PJZA 2ZTHA 4RSRA 4XUDA 5KQSA 5FQNA 2O07A 4RTSA 2ZIGA 3PT9A 4YV1A 5GP1A 1G38A 4XUCA 1NW6A 3HA7A 3OZRA 3I53A 1NKVA 3LBYA 4RYLA 4U7PB 3P97A 3GRZA 3FPHA 2YQZA 3B7PA 3LL7A 4RV9A 1NBIA 1IXKA 4FGZA 2ZVJA 4QQNA 2C5SA 3BGDA 3B5IA 3G89A 5F2OA 4K6MA 4F84A 5KS2A 2P41A 4YUVA 4ISCA 4HTFA 1NBHA 5K0BA 1RI4A 4FZVA 10MHA 3FRIA 2P1DA 5ICGA
chains in the Genus database with same CATH superfamily
2ZB8A 1T5LA 3GQVA 1P1KA 1D7OA 3HBFA 4RJJA 5LSAA 2IDMA 4D9CA 4LJLA 4RMNA 1W85A 2NSLA 1KOFA 3IGFA 2RI0A 3F6SA 1AUQA 1TTQB 4PCAA 4PNPA 3KSAC 3TECE 4LJSA 4F5DA 1OH8A 4CXMA 2HK7A 1HZZA 5AVVA 3QWHA 5AJWA 1CEXA 3H5IA 4FWIB 3M2TA 2D6FA 4UQPA 1T26A 2BUAA 4CF5A 1W1IA 3TSCA 5LN1A 4YMWA 1KJIA 2CV2A 3JASA 2FKNA 2QTGA 4QUJA 2P3LA 1QG2A 3P0IA 4TKUB 4CLXA 3PNSA 1ZHFA 1AK9A 1BN7A 5BWLA 2FLWA 4NCKA 3AETB 3G1TA 5ALYA 4BHTA 5K8VA 2FJUA 3SVTA 3QPVA 4ARBA 3PLAE 2HF7A 2K7FA 1T9KA 2PA0A 1RIFA 1O8BA 1U3CA 2DPYA 3LL4A 2IYVA 3OEWA 4HYYA 5HMLA 2ECQA 3ENKA 4W5WA 4D6XA 4FNAA 5H70A 5JY1A 4LVNA 3KZNA 5F12A 1NBMA 3GJ3A 4RSGA 3DBHB 3DEZA 1SPXA 2YY6A 1IU9A 2GAOA 5EI5A 1QX4A 4MUJA 5JWRA 3OEED 3IPLA 1AGRA 5C9ZA 3HDTA 2AG1A 2ZK7A 1CUXA 3I9KA 1M34E 4J3JA 3GFQA 3RQSA 2XHEA 3GJ8A 3M6MD 1U6KA 4BUJA 2VVTA 3H4MA 3PUHA 3PSAA 3RC3A 1H2EA 3G5MA 5HDQA 3E0QA 3KFLA 4IIUA 4GPZA 1EXVA 5BURA 4M1TA 5LU9A 1N3YA 4IO1A 2Y1EA 4RL6A 5CJJA 5C0OE 3KVOA 3JQ8A 2IEAA 3AU9A 3HA5A 4C2AA 2RHWA 4KGXA 3WADA 3I09A 3KR1A 4IR7A 1P5FA 3IIJA 4QQKA 2DGDA 2JRCA 1YR2A 1D4OA 2DQZA 4ZHQF 3CNEA 2VDMB 1GQYA 2XGMA 4JNCA 1U9CA 1XP5A 3GUUA 2Q3BA 3L6RA 4JBXA 2Q2WA 3I2HA 1JG7A 2FEAA 4X8OA 5LBUA 4BV9A 1EG2A 5T5QA 4KFSA 1EH5A 2HXYA 4YR9A 4XLTA 4DGSA 1GVNB 3N0RA 4CTMA 1Z5WA 2YWCA 1J09A 1DLJA 1PFVA 1XEWY 2QNBA 4JUCA 5ICSA 5FXMA 4EP1A 4ZDJA 3Q8MA 1ZGBA 2DH5A 3BQ9A 3QUCA 1T0BA 1EWTA 1MAUA 2WHXA 4M37A 3MT9A 4MSUA 4DW8A 1Y6GA 1LSOA 3DLIA 3BXXA 4JX9A 4KVZA 1E98A 2X0IA 1BDBA 4WT7A 1DTWA 2OUIA 3W6OA 3LRXA 4E2XA 1AUVA 3DE2X 3HBAA 1W88A 3G13A 3QA3E 1J25A 1ODFA 2JANA 4GUAA 1A8HA 4FONA 1U8XX 2QTBA 5KWVA 1PHPA 2W6MA 4AULA 1K7YA 1TZJA 1CQWA 1KQ3A 1LDEA 3ZD6A 3I2GA 5A4FS 1YE8A 1K08A 2NPIA 4HDKA 4P81A 3HDVA 2YMLA 2XSZD 4ZI3A 4KR3A 4KPGA 2OD7A 3N2NA 3PX2A 1JKJA 2ZJ3A 4JJEA 2A1UA 2VXOA 2VTBA 4YRQA 1VFPA 2FCRA 1VDMA 3GV0A 3H18A 1PLLA 4S3MA 5CTJA 3ECSA 1YNOA 2P2DA 4ZODA 3T9AA 3R3XA 3STYA 4J16A 1E1YA 3BWDD 1WXEA 3X1XA 3ZBUA 3SJBA 3RT1A 1S2MA 2GH1A 4PS1A 4EF6A 1I7LA 1SBIA 1UT8A 2NYRA 4G5GA 4KXXA 1AGNA 1XVVA 1P1JA 1WM1A 3SOZA 2IX3A 1MP0A 4PY2A 2Q3HA 3SZMA 4G67A 1DAEA 3LNTA 2LVBA 3MGAA 1Q0HA 3CFYA 2ZPAA 4I1SA 2VRCD 3WRWA 1NMQA 3TKLA 1HT2E 1LPSA 1JFVA 3ZUPA 1LPNA 1Y1SA 1JEQA 1ZOLA 3H65A 2GBCA 1GFZA 4MS1A 4DLTA 5AM0A 3TQTA 1YMVA 1R5NA 2P77A 3BZWA 3OQVA 4KI7A 3PE6A 2R47A 2ZEJA 5MGNA 1YVUA 3P71T 5AW8A 4TT3D 1IDN1 3Q2OA 4F2GA 2KJQA 1NW8A 3EQ2A 3N86A 1NVVQ 5A3SA 1YZLA 1D2RA 1W94A 3AYXB 5TQVA 1Y98A 3LT1A 3HCEA 4R6XA 2XR1A 2BEWA 4FJ2A 2OCBA 1Y9ZA 3LTNC 3P0HA 1NV9A 3GGSA 3LPCA 5K3CA 1A72A 1P3JA 2FEWB 3AM3A 4CL8A 3THWA 4F4IA 2RHBA 4JLDA 2WUEA 3HPRA 4AC9A 4WKCA 1MC5A 1CETA 1ZBDA 2D1RA 3EXEB 3C3JA 3WGQA 1DAGA 1NQOA 4IIVA 3ZXUB 4XM2A 3IL2A 2H1WA 3IT3A 2RB5A 3R0JA 2ZM6B 2XDWA 3FG9A 3CKKA 1L5HB 4XM0A 2JI9A 3AERA 4QE3A 3RK4A 3WGKA 1XZDA 2FUG1 4E3WA 1B16A 5LZ5A 3RM3A 1GU0A 3UGTA 1U11A 2C2GA 3MJVA 3B2NA 1B43A 2HJHA 4IUCS 2YV5A 4NJEB 5BN1A 3KVYA 2QX8A 3EWAA 4DB4A 5P8WA 3AF0A 3RYCB 1U9YA 5AJVB 1YB4A 4FS8A 5DM1A 4ETMA 1RPZA 1WB6A 5AJUA 1EUDB 3L8CA 5DBGA 1N4AA 1QANA 1SKBA 4UZEA 1E61A 4PRLA 3U48A 1YI8A 2E48A 3T3PB 1QAMA 1T5SA 1PIWA 4FR2A 4DVJA 2GYVA 4HWSA 4X1OA 2FOXA 1JH9A 2ZETA 3HRHA 4PTZA 4AZ3B 4ANFA 4BE7B 3I9LA 2HA7A 1GA6A 4MZDA 5EIWA 2G9UA 3DTVD 3V8RA 2EARA 3L9WA 2E5WA 4N5HX 2KE5A 2DR3A 1NF9A 2DHCA 2VCEA 3FMOB 5B1EA 4MUAA 3KPYA 4RBNA 2XB6A 1FNBA 2ZYTX 2NG1A 3AR9A 4ZEWA 4EFLA 1LW7A 3RO7A 4AN1A 5LKAA 3HK2A 3U3DA 4Y2UA 3TNYA 2O2XA 2W2MA 1TQHA 1GCAA 5HFAA 4BP8A 1P0QA 4RE5A 3RSFA 3KFXA 1TIBA 3UUGA 3HEMA 4FJ0A 5TLSA 3NUZA 4ZAZA 1RADA 3AT1A 4X6YA 4EL5A 3KAQA 1KQFA 4QDJA 1IJFA 4PX2A 5MGBA 5AI8A 3I62A 2W71A 1JEYB 2V7VA 4QT0A 2OD2A 5JS7A 1DHTA 3BIFA 3WMWA 5C8VA 1GY8A 1ZD3A 4ZKDA 4BO8A 5JHHB 1L4EA 4IM7A 3FPKA 2PCJA 1U0LA 1I94B 4JBLA 4XQ9A 5JNRA 4O02B 2IXFA 1MQ9A 2X7XA 2FGKA 1H6BA 1EFVB 2QLLA 1TM7E 3MLAA 8GPBA 5CCBA 1JR3A 3QW4B 2QB5A 2W37A 3OG9A 2UUCB 1WG8A 3KKOA 3NORA 2I7DA 2PTGA 3PG5A 3KQPA 2DJIA 8LDHA 3ZU5A 2I55A 4PIVA 2F9LA 2HMYB 5ALJA 3RC2A 3H2SA 3NOXA 3MINA 4I5FA 3QVLA 1T9HA 5CLQA 4S0XA 1U3DA 4PC3A 4LE2A 4M3NA 4RVHA 5I7SA 3S40A 2HC9A 2H4XA 2P5YA 2PNJA 1ZSVA 2IUSA 4FI3C 5BT8A 2Z6VA 1Q20A 1WD5A 2FZGA 3JYHA 3P4YA 1R9GA 2PD6A 3EF3A 4WTOA 2Q9UA 2ZU6A 5ALPA 1W6UA 4I3HA 1WKBA 4LHVA 4S0ZA 1N8KA 3U40A 1DUIA 1N32B 1HEUA 4AS2A 2RK6A 4RCZA 4FEGA 1ZM2A 1XOIA 1HKUA 4A03A 1QRAA 2PL5A 4HQNA 4YLEA 4Q4HB 1YU9A 2YOHA 1HL7A 1SRQA 3REQA 3JRXA 4M0UA 1OGJA 1M6NA 2H92A 2AV6A 1IMOA 2J85A 1V8OA 5EIFA 5JO9A 1X9GA 1AVTA 3E84A 2BKEA 2BRUA 4X45A 3L05A 2VTKA 1QP7A 2Z2ZA 4DXHA 1D5WA 1R4NA 1TEVA 4UOZA 1XEFA 2GAAA 3DCIA 4X7BA 4I1YA 4MVJF 3ZWQA 1RP7A 4P2BA 2J9ZB 4RSHA 1L6IA 1G3QA 1OXUA 1WO8A 2C4NA 4ZQGA 3SE0A 1EHCA 2W6PA 5AJZA 3O21A 5DHTA 4CFZA 1KEKA 4Y2XA 5ICCA 2AZMA 3G8CA 3JYNA 4ZQIA 3KLMX 3Q7RA 1UANA 2HEGA 3CTMA 5BSGA 1F7UA 2OYSA 2Z57A 4WOKA 2AN5A 4DEVA 2AI1A 2H08A 2OBMA 1IZYA 3GUHA 3V42A 3HLYA 1MGPA 4LF4B 1E0SA 1Z6YA 2YWBA 4J4BA 2BKUA 5HFJA 1PK8A 5KTTA 1U8TA 3FCXA 1DBWA 1T5DX 3G2PA 3GUVA 1S9HA 4DM3A 2ZZKA 5CLIA 1ZIXA 3UJPA 3GJ0A 3DE1X 5LC1A 4B71A 3L92A 2PVCA 2V7EA 4GI3A 4KKVA 1KDZA 2VDPB 4J1NA 5BSFA 4WAUA 1L5KA 1D0VA 1HSOA 2XX3A 4S12A 3E6AA 1TQ4A 4EYEA 1A9OA 3USZA 4EAQA 1I4TD 4XVCA 2DTXA 2VHXA 3DT6A 1SG0A 3FNEA 5L51A 2PJUA 3AR3A 3H5VA 1EINA 4JGBA 2RHHA 3AFGA 3GWGA 5D86A 3H5LA 4NICA 1WXDA 4E4YA 3P26A 4KSYA 3ISJA 4I50F 1VCNA 5JCOA 2QT0A 3C1TA 4NBUA 5JWHA 1YS6A 1R8SA 4FOLA 5L6MB 1KS9A 1E2LA 1XMVA 5DLEA 3RS8A 3ROMA 1ZU5A 3K0SA 4C0AC 1H9BA 3PB3A 1XKQA 1ESDA 3KE9A 3W4JA 3DMHA 4C6RA 3PC2A 2O2IA 4R5MA 2ZSUA 5FH9A 5HCNA 3FZQA 4LBYA 1N1GA 4GZLA 4V2UA 3WDSA 3ZEAA 3BXZA 1RQNA 5GM1A 3I2KA 3U7JA 3VH3A 4D2IA 2PUHA 3T61A 1G2QA 3GJ4A 3ND6A 2P5SA 4L4XA 4JASB 3QLJA 5ECYA 3GAMA 3LX8A 4ZQHA 1QYRA 3W3AH 2JFYA 4L50A 5IT5A 3TFOA 3LRPA 4NRDA 1RHRA 3EFOA 4CCYA 1YC2A 2AQKA 2QL6A 5GZ6A 3SNKA 4RLFA 2CL7X 4GEGA 1ZXBA 2GAJA 2OV6A 3B38A 1Q50A 4JA0A 3UJ3X 4J76A 2PKQO 3OFJA 1MCZA 1Q74A 4HADA 4HS9A 3O4JA 4PNEA 1BFKA 4IX9A 3OTQA 2TYSB 2O3UA 1POXA 2GXSA 2J0QA 3JQRA 5KTMA 2B35A 1WBDA 1SXJE 1VZ3A 2ADMA 2GJ9A 2YFYA 1FDOA 3IQZA 3NBAA 1SMKA 4EB8A 4ZK6A 3T1VA 5EMNA 3AR8A 5K05A 1V2GA 1LFAA 5FOTA 3U37A 4JEMA 1FMCA 3V8BA 3SMVA 4DQVA 2HF8A 3MS4A 4L8VA 5CITA 1UWLA 5KOJB 2NWQA 1N25A 2W4MA 4CG1A 1BMTA 4MVJH 2XWSA 1VG0B 2RHLA 4C43A 2VF4X 3D1JA 5FNVA 1ZQ1A 2MTBA 2YVLA 4LV8B 3DAYA 3MUFA 1ZC3A 4I50A 2Z9CA 2GZHA 2OTCA 4RZHA 4DCVA 3K0HA 4N0EA 1RU3A 2DFNA 2PTHA 2W5UA 3PVCA 4BFVA 1SHUX 1IK6A 2OB2A 5GVRA 3V2IA 1BHQ1 3P9PA 2GRJA 2JLQA 3IB6A 2I87A 4QOSA 4OXYA 3JZMA 2FPPB 4MKGA 3ZHSA 5KJCA 3IR5A 1LQTA 2WW8A 3NM4A 3W1WA 2UUBB 1E5LA 2G25A 3ZHUA 1JLHA 1SA0A 1J06A 3OZCA 2OHJA 3OUUA 3TW8A 1DI0A 2JFVA 3GJTA 1S2LA 2MWMA 2CC2A 2GQ0A 4PLWA 4RD0A 5TRTA 2NX2A 4GBMA 3EIQA 5ALRA 3NYQA 2QJWA 4IEEA 1OSNA 3OFSA 4PU0A 4F4JA 3K0AA 1SB9A 3K1AA 4RA6B 1MXFA 4XXHA 1ISFA 1Q0UA 2DVMA 3ID6C 1NUUA 3C48A 5U1PA 2V8BA 3IEVA 1PSWA 1IY9A 3GELA 1W4CA 2ZJ4A 3DQQA 3K5WA 4O1MA 4J3NA 3WB1A 1YA4A 4R2JA 3ZQ6A 4AB1A 4QVKA 5CX1B 3BF7A 2O54A 3VR6A 1L2TA 4JL6A 2HAEA 4CIVA 3B9RA 1NC1A 1XHEA 5D5HA 5LD2C 4C78A 3SVLA 3TOVA 4XKJA 1U1DA 3LCJA 3OFVA 4B7XA 1PZMA 3C3DA 3I42A 4MWOA 3I53A 4NFSA 1T2EA 1UFQA 4R7GA 3UB2A 4Q48A 1DIAA 1VKRA 2D13A 4U2KA 2NUBA 2G09A 3A6LA 4LMRA 4EI2A 4WLEA 1Q57A 5CDYA 1WSAA 2AFRA 4K6MA 3RSSA 3ZOKA 1RHQA 1X7XB 4FCTA 1EFLA 3MMSA 1DRJA 1FE8A 2XMSA 3CV3A 4EARA 4U7DA 1QIMA 2H2GA 4QPDA 4RK4A 4UPVA 2GWHA 2B5VA 4G0QA 1DMSA 3GCDA 2F1JA 1LS6A 3I45A 3UUFA 4ZAWA 4AKEA 2JLBA 3O2QB 1NGSA 3GVPA 3M2PA 4ZMSA 4W5QA 2P2GA 1BC5A 3CRW1 3M1IA 3HDYA 1WNTA 3FI9A 4EUFA 1V26A 4WKGA 1GVHA 2P5TB 3K9BA 4R68A 1QV7A 1TCCA 1DKPA 2HHJA 1D1TA 2B69A 3PJDA 5KU1A 3WO1A 3OCVA 3EGXB 2ZE7A 3GZ4A 4FYIA 3OQMA 4O2BB 1D2EA 1NI4B 4R8LA 2WPDA 1WUIS 4RF4A 3RREA 2BHSA 4TRRA 4FHFA 2BCEA 4AJNA 2PG3A 2F00A 5FPKA 2YMMA 5F23A 7MHTA 1NZJA 1RDFA 3VR5A 3LVFO 1P7CA 1YOVA 1I5RA 1PU2A 4FR0A 1J2TA 4RD1A 1LRLA 3EC1A 3RWBA 5HZMA 2QVCA 3OJFA 1Y6JA 3HVIA 5F5NA 4ARZB 4BJ3A 3O8BA 3A14A 5GOZA 1B6GA 1XNHA 3MF4A 1C3VA 3NHWA 3U4QB 3FUXA 4AMGA 4QNRA 1Z39A 3EJWA 2DQSA 3QW2A 3ZV5A 4DJJA 4R8SA 4H1HA 3E81A 3BWBA 2VF7A 4M8IA 4YVFA 1TC1A 4IRUB 3TVDA 3FOEC 3EJ6A 5K4HA 1SBZA 3HBMA 4M22A 2CV0A 3F96A 3NHKA 1ZXLA 2P4QA 1NQAO 2BE9A 3MYRA 4JJ7A 4UCFA 2QIOA 3E7DA 3KLOA 1I2CA 2WWYA 1P8AA 2XCOA 5EIXA 5BYJA 2EIHA 2V7XA 1R64A 4POAA 4RK0A 2FWPA 3CVOA 2E2WA 5DP1A 1T0HB 4WVFA 1QBGA 1N5RA 3A58B 1U80A 1Z2EA 2A8YA 2EZUA 2QG9A 2ZE8A 1OE0A 1E6MA 1L5OA 4NOKA 2HQRA 4DV5B 4KDCA 2VPWA 4MQBA 3ITNA 3N7UA 2GO7A 3NAQA 4R81A 2BISA 3CUEF 1XP8A 1I14A 3NANA 2JF0A 2E5LB 3K3PA 1PGQA 4XWWA 3IVCA 4AYTA 3JZAA 2V1XA 4M0DA 1RWQA 1GPMA 4C3OB 3QKSA 4MGZR 1V37A 4HNRA 4BYMA 3QU5A 3CJQA 4NYIQ 2E49A 1S8OA 3DVAB 3C20A 2JA2A 4NOJA 5EL0A 1KOLA 5BQ5A 1H0RA 3DUFB 4TTTS 1SXIA 5H3CA 1W5SA 1SUPA 2Q2QA 1NBWB 5KREA 1VLVA 3O95A 3UJCA 2PT6A 2IP1A 9ATCA 4TTSA 5BMVB 2AMFA 4GMGA 4OQZA 5AW1A 5BW5A 4CMAA 4HPWA 4K9MA 2HQSA 5AUNB 5JBIA 3KTDA 4KYIB 4YRBA 5JAMA 4FHCA 1M2VB 2XF8A 4Q0MA 4FOTA 1JFSA 3R20A 2D0PB 2JBWA 5KYWB 3OPVA 1ZR4A 2ZQZA 5EQJB 1UZAA 3EMDA 5EUQB 4JKOA 1P1BA 1VE1A 4ISBA 1W7AA 2XBUA 1Q19A 2Q3LA 3WRYA 2CEAA 2YIJA 2IY7A 5TQ2B 1Z33A 2V9ZA 1JNXX 4MEJA 1GPYA 3GUYA 3E48A 5CAEB 3R41A 1MVLA 1BKSB 5KOIA 5EMLA 1JR3D 1Y5RA 4GZ5A 1JE0A 4CCSA 4CUZA 2ZJ8A 2HLPA 1O1YA 1BS2A 1SQ6A 4MA4A 3GUCA 5CVVA 1S3FA 2DUWA 2AOWA 4E6PA 5HP4A 4JWTA 2YXEA 2OBXA 3C7KA 1I4DD 1KFCB 2ZYUX 3GVXA 1P73A 1Z36A 2WILA 1KYVA 4NDNE 2K2QB 3R7SA 2GPNA 1L5VA 3M82A 5EMMA 9MHTA 3BB1A 3ZS9A 1CR2A 1BXRB 3HCOA 1JGTA 4L9RA 2FHSA 2Z4SA 4HLCA 3RWMB 1GNQA 3U61B 2XNKA 4B35A 3SGLA 3KB6A 3GLHB 4WOJA 1CS0B 2JFWA 2OHOA 3PDWA 4FYYA 4M7PA 5B2EA 3R44A 2BHNA 2VK4A 1WE2A 3EBPA 2HT6A 2ZYIA 1O9HA 2XWQA 4WXEA 5GQSA 1ESMA 2ARKA 2CUZA 2MCFA 1K7XB 1U8EA 2FRVA 3EZ7A 3IQHX 3M34A 3FMGA 1G8JA 3LPMA 4DZRA 1NR1A 5C8DA 1XJ0A 1F8UA 3WHLA 1YJQA 2C54A 3ZH9B 2G80A 1PZEA 4JEUA 1N6RA 4UMEA 5CA1F 4GOJA 3MSXA 4OQLA 1MR3F 5BR8B 5DNDA 4C7VA 4ADSG 3KEGA 4ARUA 3NNNA 1N6OA 3R3ZA 2GTHA 1ODKA 1TMKA 2FFBA 4X7MA 4DTIA 3GPLA 3GJ6A 2BFDB 5TQJA 2R5NA 4KRXA 3A04A 2JLZA 1E2FA 5IBRA 5BR4A 5FUMA 1U65A 3I9V1 1DHRA 4PSVA 3DS8A 4ICIA 1AKMA 3VC1A 4AMBA 1NJ5A 3COWA 3P4XA 3VUEA 4FMCF 2BTOA 2IL1A 2PQ0A 2LBPA 2Q0SA 1XU4A 4IQ8A 2WZCA 2AX3A 2JGRA 2YXDA 3TOZA 2GBPA 4PQYA 1GNRA 4OHVA 1EJBA 2HQ1A 1M8JA 2BGIA 2QUHA 5LQDA 3RSQA 2SKEA 1QS0A 3HB7A 2OV8A 1GTJ1 2ZRLA 3NBMA 2PZJA 1YWGO 2VK1A 5KOHA 2F7SA 1SU4A 2OL4A 2J5BA 3DYIA 2J41A 2ZRDA 2JCSA 1FP4B 1E18A 3DC7A 4XGKA 3U39A 1FFXB 3OCYA 3SI7A 5JADA 3TD9A 3K6SB 2FW8A 1MJGA 3IHTA 1N6IA 1UP7A 3QOFA 2J4DA 2JVKA 4MYCA 5K09A 5FA8A 3FNRA 3T34A 5KWJA 5DYIA 1A4XA 1UF9A 2OHXA 4G0UA 5K3SA 2ZRIA 1O94D 3GR6A 2BI7A 2OPHA 3D5TA 4BDSA 1OU0A 4Y0AA 4G9EA 3LXUX 4M86A 2A0KA 2WHYA 4N6NA 4FDTA 4UPDA 3TLCA 1ZW1A 3UV7A 5JW6A 1A9TA 4EQ6A 3B51X 3LBHA 1IUOA 2Y0CA 4BYGA 5HIKA 3WFIA 4OXKA 1E3WA 2A84A 3KHTA 4NYMR 2NZUG 3Q5DA 1C29B 4D0LB 1EX9A 4KVAA 5A2GA 3VSCA 2O2EA 4KHZA 1HYGA 1KXJA 1NXXA 2FEXA 4KI0A 2OXRA 4OATA 3A1WA 1ZGGA 3JQ9C 2MYNA 3TTVA 5CA1A 1XJWA 2H4YA 2P4UA 3JQPA 4M9XA 5TPZA 1OFHA 1PFUA 2XEDA 5T57A 3RTAA 5LUAA 3FNIA 1YQEA 4OI1A 2PGNA 2R6JA 3IA7A 5FL3A 5LMCA 2O7QA 1QH8A 3AF3A 3CZPA 3DO8A 4DJAA 5JD6A 2JLAA 3IAXA 3OKCA 1PFYA 1YJXA 3IEUA 4ND8B 4F2DA 3LY7A 3LM8A 3DLTA 1X8KA 3HL4A 4H6VA 2BFWA 7GPBA 4JB3A 4KUEA 2IHZA 3IP9A 4JELA 3ZHRA 4F7DA 4WXHA 4DARA 2CSXA 2LR0A 1P4AA 5BOVA 1Y9EA 3I1IA 5HBRA 1AZLA 1S96A 3GOQA 4FP9A 4P1ZA 4AT1A 1UMCA 2HA2A 2J9RA 4ZAVA 4EL0A 4HPXB 3G2JA 4QXPA 3MHTA 4X92A 4RD4A 2XNHA 5BSEA 1MC1A 2D4AA 3KZXA 1IQUA 3UUWA 1KVUA 1BQEA 4N5NA 2FU5C 2J32A 3CVVA 4ZCMA 1JU3A 4OKNA 5DXAA 4HRXA 1FVXA 3DZHA 3EA5A 3QTTA 1WXXA 1QXSA 3STXA 2CFSA 1MQSA 2WI8A 1UXHA 3JQQA 4RKRA 3JTMA 1NJ1A 2GZRA 5DTMA 3FZNA 3VNBA 2BFCB 2QN2A 4FHGA 1DMRA 2BGLA 3AZOA 2CNNA 5BWBA 5JAUA 3DWGA 2WJZB 2DPHA 4CLHA 1GTZA 3JQAA 3PNPA 4BQNA 4YRIA 2BWJA 2Y6VA 3QXCA 2ZSJA 1CG6A 2GF9A 3MOGA 3VYTB 4F9TA 3KBOA 4X95A 4PG4A 1CUJA 1YRAA 1W2GA 2HWKA 2VUHB 3H4IA 5HF8A 3KSBC 1LFDB 5DYNA 3A05A 4U0KA 5DHSA 5FPYA 3H0KA 3L7JA 4F2WA 1FSPA 1NYQA 3OWXA 6ABPA 3HO6A 1ZEJA 5K3AA 1RJ9B 1C1DB 3GRRA 2I0FA 4O4HB 1J8FA 3LLCA 3ROZA 4YMUA 3UMMA 4HN9A 1L8LA 5F7XA 3IBFA 2CUKA 3WYEA 3COSA 1R10A 3N0TA 2UVPB 1GEEA 2X9GA 1CJKC 1UP6A 2GEDA 1TAHA 2R65A 2XIQA 2Y99A 3QUBA 1JQ5A 4UE2A 3F3MA 3P9XA 1UJCA 1JIQA 4XFDA 4E5MA 4G5FA 3MQFA 3IDQA 1ISIA 4GLJA 3MGBA 4DFDA 1YFKA 2C8KA 2FPLA 3K30A 1N8NA 4HX5A 3NOOA 3RSHA 3ZWAA 3VR6D 5C8XA 1W25A 2PGAA 4J3FA 4QX6A 4MVWA 3G0HA 3NG1A 3OZDA 4KSCA 4F38A 1Z06A 1MV5A 1SOVA 3OQJA 1XZFA 2FZ4A 1R8QA 4GEKA 3DDHA 2A5FA 1Z8DA 2Q21A 3RG8A 1OAOC 2VJNA 4OX9Y 4EW1A 3FR7A 2EFCB 1RPAA 2XGGA 3CO5A 5AKGA 3OC0A 2XI4A 5IYZB 3PYXA 1KMHB 2L82A 2XLCA 2F3PA 2YTZA 3BCHA 3R23A 7YASA 5JHGB 3R7DA 4D25A 4GPTA 3ME5A 5TV2A 1DCKA 3I12A 2GJ4A 4RJTA 4Z1OA 1GUDA 3EXAA 1ULSA 4GYJA 4UHKA 3W9SA 3QE0A 1JTFA 2IWHA 5C2JB 2NGRA 3FDIA 2QKYA 4DRXB 2VATA 1I30A 1CKEA 1YOBA 3OO1A 3RYHB 2RHOA 3NHLA 3S3TA 3F73A 4PFKA 3GNLA 4QO8A 3L6OO 4Q4CA 2DKFA 3CEPB 1X0VA 1H0HA 4UOQA 1W4ZA 1KO8A 2AB0A 3ANYB 5CH5A 2C2HA 4HQ0A 2AFHA 2J59A 3ODGA 1NVXQ 4IF6A 4ND5A 3H5NA 1OHHD 5JTUA 3BAFA 1E66A 1TZCA 1VL5A 3WLOA 1OFTA 2VZEA 3B1FA 2R7NA 5AVJA 3VR1A 4YJHB 4DV4B 2FZEA 1MRSA 2NACA 3JD4A 4LI0A 1UUFA 1A9QA 1XQYA 3ZQJA 2ZB7A 2EBFX 3FMVA 2V6JA 3ZLTA 4AP9A 3LT5A 5K0FA 1U63A 1PZFA 2R11A 3VR5D 3EA0A 3ZDXB 4BO2A 4OHOA 1G7CA 3WGUA 1Z6TA 1XL1A 1UBOS 1QFSA 2D59A 1OAAA 1QIIA 2G1JA 1FBNA 4GGMX 4REQB 4ZICA 2QAGA 2QLJA 1KJYA 1LK7A 4OXXA 3X0DA 3AVQA 5F9MA 4D0SA 4IO0A 4NCBA 1R9NA 1WXHA 2ADFA 3KKLA 2WDZA 3M4NA 4L85A 3ZTTA 4PV7A 4PX9A 1VI6A 2AN4A 3JTEA 4V1CA 2X2OA 2H2FA 3JSAA 5FFNA 1QHHA 1LWOA 1H05A 2QD1A 3N2GB 4V0LA 1SEPA 1K6JA 1Y7HA 3GRKA 4BMYA 3OF2A 4ZJPA 3C8MA 1JAYA 2P4HX 2AFIB 4HAXA 1XGKA 3GT4A 1FFAA 3TQQA 4B45A 2RHGB 1CQIB 4R9UC 3T3IA 5REQA 2H06A 1V71A 4EG6A 1TVEA 3QXHA 4CEJA 2QX6A 3L8MA 3W05A 2CFCA 4EG7A 1RWPA 4QNNA 5K3FA 5ILGA 2B94A 3O0DA 3A1UA 3CUTA 5AWFC 1T5TA 2YXBA 3OO0A 2PMDA 3LTEA 5TE9A 3LIIA 1SRRA 2WQZA 4KLRA 4PSAA 3TNLA 3X1DA 4N76A 1DE0A 5E1BA 1AX9A 3N39C 1FUYB 3U3OA 2IGTA 2Z6AA 4NE2A 4S1VA 4QUAA 4YRKA 1G7RA 2BAGA 1RAIA 1RI2A 4C01A 2RKBA 4CQLB 2P9JA 2J7PD 4UVGA 2Q4RA 2WABA 4KK3A 3QX8A 5G53C 1R8XA 3FTQA 1VYUA 4YS6A 4M1SA 1NQUA 1YBAA 2BFFB 4KK4A 5FV7A 1G5IA 1YIDA 1Z07A 5F21A 1I0LA 3WG9A 4OSOA 4EYOA 3UENA 4HGQA 3UWDA 4C7JA 4HBZA 1YZKA 4FMDB 3P2MA 1KE2A 3JY6A 2QRVA 1UM8A 4I4TB 3K2IA 3T15A 3Q9UA 4JITA 1EFUA 4Z7OB 3B48A 4MXDA 1I51A 3BVPA 3O8OB 1PZHA 2J9FA 2YJ6A 3VMMA 3PNQA 1A71A 2BEKA 1JZQA 1QOQB 1F5NA 1YIAA 1T8WA 2Q5OA 3CZCA 1SU8A 3OLYA 3K0BA 1TVKA 3D7NA 4KFUA 4LZOA 4LZNA 1GTG1 4MW6A 3WHIA 3Q3IA 4BFWA 1UM9B 2XXJA 2NO4A 4C7BA 4XYLA 2UXBB 1Y8ZA 1XZLA 4MVYA 1GAQA 3AM5A 4PYOA 1P91A 2PS0A 1VE7A 3WGGA 2C9OA 4ALLA 2BC9A 4R8MA 3DFMA 2FSVC 2H2DA 5EZYB 4H1UA 5E6SB 5JJLA 2IEZA 2RGUA 4G41A 4IP0A 5LA6A 1QCDA 4EY5A 4XZ3A 2WVGA 4PPQA 1GQSA 2JBAA 2X8AA 2HV8A 2JRLA 3B7PA 2FR1A 3D0QA 4IH4A 4QGGA 2QENA 1FFEA 3PVSA 4QQNA 3T1NA 2AZ4A 3U7FB 3AMVA 1W30A 4OX9B 3I0NA 1XZ8A 3KB8A 1WA5A 4GL2A 1N57A 2P1DA 4KRGA 4J0HA 3RSOA 4R41A 1ZOSA 4LZZA 3EMBA 3SG0A 4DAEA 3AIKA 4P0PB 2JIOA 2REXB 4RAQA 1FOEB 4ZVLA 1EK1A 3BGVA 2Z4RA 4NU5A 4LRUA 3T6KA 1KSFX 3PXDA 4R8KA 1S8NA 1KI6A 1UODA 3B7GA 1EAYA 5DRTA 3SIWA 4YAIA 1JXQA 1KH2A 4OP3A 3M89A 3RNOA 4M4SA 2PR2A 5C7LO 1MJFA 4OQ4A 2FG5A 3MGKA 3ORYA 4RZQA 2OE2A 2ORWA 4CMKA 4YIKA 1E7RA 5BQFA 4IAOA 1JQ3A 1Y6RA 3BGWA 4D74A 5DNEA 1XF1A 5CB0A 5LYJA 2C31A 3EVDA 1OC2A 4WFJA 2WWVD 1A9SA 1P1HA 3W5UA 3PQ4A 2IHKA 4PYMA 4BO6A 1ZRMA 3O84A 5TIIA 4NC9A 1TE2A 3OOWA 2AOUB 4QU9A 3WRXA 2ATVA 1IN8A 1H0KA 3IPYA 3KB1A 4FHZA 4MRMB 2RH5A 4J6EA 4OBEA 1JA9A 3DAGA 3MTIA 1GGJA 3WISA 1DEOA 4WN9A 1BMDA 4H6PA 4L7QA 4M99A 2YIVX 3DBRB 3LLUA 4MKRA 3BE6A 1A82A 1VB3A 4FFBB 9LDTA 2AH5A 4OQNA 3PE3A 3LC7O 3OP1A 4QFMA 4KO4S 2FPWA 4YJ3A 4DBVO 3D64A 2XA1A 2G6BA 2BGJA 1JHYA 1PT5A 3ZWBA 1N1EA 3HYCA 1ABEA 3EUAA 1V8ZA 4G3XA 4MRRA 2D7CA 4TMFA 3U44B 1O58A 4QSMA 3DDSA 2Z6UA 1JU9A 1NVAA 4XWGA 2GESA 1NMEA 4CHGA 4ZVUA 4KN5A 4JFAA 5AXCA 4DLAA 4BO5A 1ZMRA 3ZCTA 3HXOA 1BA2A 3HJGA 3CXRA 1SHTX 1QDUA 3TNJA 1ZAYA 4F2PA 2VP4A 2R96A 4NVRA 3UO8B 2P4SA 3NBQA 1B6RA 2EEZA 1MB9A 2WU0A 4WNAA 1GARA 3FGZA 5JLAA 4WCDA 2B7BA 4RADA 3N8GA 3OX2A 4XIGS 1B0PA 2H7XA 2CLMB 1KHTA 3PWTA 2ZT6A 3C1UA 3EMVA 3GLHE 4PC2A 4RPIA 2NZJA 3DWIA 2DWPA 1YQUA 2EKBA 3HG7A 4MARA 4BBPA 1QP4A 4MYUA 2J0UB 2ZIZA 1ZEMA 1ZUHA 4TS9A 4DDVA 4M54A 4NNJA 3ZC3A 5AKYA 3J81A 3VO8A 2XYRA 3DO5A 1TJYA 2AD1A 1CD5A 4RNCA 4KPYA 3QKTA 4MW5A 2F1HA 4MWSA 3SBEA 4ERXA 2X5KO 4YXWA 4G5RA 1R4ZA 2G36A 2F64A 2X5JO 4NDZA 5D1NA 3SEQA 1VG8A 4JUBA 5LQNA 2RGAA 1K4KA 2PMBA 3VDNB 4EA9A 4MGEA 5BQOA 4O1HA 5ADUS 2HLHA 1G17A 3WE7A 4O8ZA 3EODA 2LZ0A 1QHXA 1NRIA 3FR8A 1CRLA 4FN5A 2XDQB 4JFRA 1U4OA 4QUKA 3RHTA 1Y1TA 3KKKA 4U2BA 3D5EA 3MILA 1NMZA 1SUBA 3OAAD 1P77A 4LQCA 4MA0A 1GAJA 2IDJA 3LBIA 5I8ZA 3EG5A 3X3HA 5JCZA 3WAGA 4YRDA 3EEFA 3WLRA 3D3JA 3CLSC 4QYIB 5FI3A 4MDHA 2YW9A 4RABA 1EG7A 4L3OA 4FKMA 3UA3A 3KQMA 4MWDA 1T5IA 4LF6B 3E9ZA 3OCUA 1GYPA 1H6CA 4NPAA 5HE9A 4DWJA 2FDCA 2EFDB 5BRNA 3QKRA 5FEUA 4Q6WA 5EFZA 4B3TB 4FZ5A 2ZS9A 1EUDA 4WWHA 3JPYA 1Q11A 2HSWA 3KOMA 1I01A 2ZSDA 1N5JA 3IQEA 2YOGA 3PD7A 4NZ9A 3AUXA 2GK7A 2HQBA 4PCUA 3DOFA 1S7CA 2Q8QA 3VNAA 2IRWA 4CIAA 2JC3A 3N5CA 4TN5A 3H86A 3LUKA 4O4JB 3P0EA 5CB4B 5FBKA 3G7SA 3WXMA 1NIJA 3HFJA 5BXQC 3TCKA 3LUAA 5ERYA 5CBPA 2CWWA 1J2YA 4D79A 4ZEVA 5KMGB 2H1CA 1YDEA 2AJLI 2VPQA 3CIOA 1Y4AE 2FRDC 4B44A 1O08A 4FMPA 1I9CA 1P61B 4BNKA 2PH5A 3ZWCA 2O19A 5IVPA 1VHDA 3NFRA 2IS4A 1Z7GA 1LKZA 1UBSB 1QUEA 1FNMA 3CX7A 3FTCA 1GDHA 2BZGA 2JJ8A 2WJWA 3HCPA 3K8QA 4I3FA 4WKOA 1A1VA 1GQ2A 2HTFA 4XQCA 3DL2A 4OM8A 1MNQA 3LP6A 1MENA 3E2MA 2O0JA 2QRPA 1YXMA 1NVDA 2TMGA 2CJPA 2VPYA 4PVCA 5T3YA 3RJMA 4DDMA 2YQ5A 5DISB 4IDAA 3LSYA 4ZYVA 3KYJB 4WZAA 1A7AA 1WB5A 3OSUA 3OPXA 3DP7A 3SHWA 3K32A 2IXTA 2XKBA 3GDFA 4GG1A 3NGMA 5GIPE 2JG3A 2PYDA 4HDSA 1P39A 2IYYA 3FSGA 4GR5A 4J1SA 3SR3A 1LF0A 5BV7A 5IDXA 2OUKA 5ALDA 4ZCTA 1E5TA 3P1JA 5EKSA 5CRIA 2YICA 1J2EA 4DLYA 3DWFA 2QUAA 5IKPA 2ZE6A 3RIMA 1U0BB 1CJCA 5AVSA 3B2EA 4HP8A 2P65A 3A11A 4JP2A 4YIHA 2B8TA 3QVGB 3CZ5A 5JNSA 1RJGA 4U4AA 1EFVA 4F56A 3F46A 4I9FA 4NXMB 1ESEA 1FVFA 3UJ8A 1AHHA 3B9BA 3KEQA 3ZGYA 2JFGA 1UBJS 1XMPA 1Y6QA 3CONA 3ECAA 5FPPA 2Z8YA 1KKLA 2OFFA 2B83A 1WWKA 3K0CA 1XT6A 4EHJA 3LPLA 2OMKA 4KITB 3TR5A 4IYRA 5A5GA 1S9DA 2Z43A 1BD3A 4FE3A 5KSPA 2WAXA 3FYSA 3JSXA 4XVRA 4KVFA 4RC9A 3WQBA 3JQBA 3O26A 2CHEA 3Q0IA 1QQ5A 3EY4A 2WV7A 1GYRA 3L02A 3F6PA 1TK3A 2CLIB 3SEAA 3UMGA 3A2MA 4K9RA 2Z8XA 3ZY5A 1CR0A 4P7JA 1C0KA 4ACBA 4C29A 1MD9A 4CIBA 1NKTA 3VISA 1E7MA 3ROTA 2C29D 5LMUB 1FFDA 1HF3A 1GPJA 1WABA 4HNSA 4UBOA 2Y0PA 2LGJA 3EGWA 4Q4HA 3EEYA 4G65A 5ESXA 4E2FA 1NT4A 1A8PA 2I2XB 3RVDA 5B5SA 3EPJA 4WE3A 2JJ2A 1RXIA 2LTAA 3B1WA 3IIEA 3U3ZA 2IZ6A 3FFBA 2XMBA 4MV3A 5EQTA 4I5GA 1R6XA 1CVRA 5JEEA 3A3OA 5CDTA 3E82A 5ITZB 4O4LB 2JHCA 5KYNA 4I3GA 1II8A 4BN4A 2BFMA 3CW9A 4YAKA 1M0EA 2FDXA 5FOVA 1UDCA 1WCIB 2ISCA 3NDIA 3P2KA 3C39A 3U7EB 5D85A 2LPMA 5JMTA 2VP0A 2LCIA 3GH1A 4EHBA 1PZNA 3ROFA 3L1VA 1R6UA 2RC5A 4TV8A 1GLGA 1P60A 2NUAB 1EFTA 1GPKA 3NDPA 4DYHA 1Y1PA 3A1EA 1GRRA 1C7EA 1RRPA 2J3MA 3IUMA 4ZT2A 2BTEA 1X74A 1F0KA 5DLDA 2O3SA 1ZR2A 4KRFA 1AH2A 1RJEA 4RVCA 5FPQA 3MQ4A 4IDFA 1LX6A 4G25A 5JCPA 2PJZA 4DLVA 3O2SB 3FHOA 1T4CB 4UZSA 3UT6A 4DGQA 1KP2A 4ENQA 4ENRA 2F43B 3GFGA 2JFPA 4QSHA 2PV7A 1N2GA 4DNQA 4XPIB 4BFSA 3PXUA 3RFTA 1XU9A 3IQIX 4AKSA 1PSDA 1AGPA 2H1RA 1JR2A 4V0SA 3CS3A 4NIMA 3WVNA 2B30A 4I1VA 2YYZA 2HOQA 2I33A 4E11A 3WL6A 5JZ9A 4MDFA 5FWDA 1D8TA 4V38A 2OAEA 3I04A 5EYPB 3QVUA 1H66A 1RWVA 1MOZA 3JYOA 2ORIA 4PTLA 4NQRA 1VXRA 4KN8A 1AZTA 3J7TA 1XKTA 4HAIA 4W9MC 3EXHB 1HLFA 3VFDA 4EX7A 3TK1A 1N2CB 4RFSB 3T5PA 1L7NA 2WT4A 1SKAA 5LZ2A 1NLFA 1HFJA 1G6Q1 1GIAA 3N28A 3NOQA 4CIXA 4JYPA 3VSAA 4DIOA 1XJ5A 4L4YA 3A7DA 3N8NA 4UHCA 4PSCA 5DFAA 1RHJA 3ZBTA 5KAPA 4F3KA 5JZSA 3DXXA 3RAPR 2JLXA 3HKCB 1E2BA 4ZI7A 4Q93A 3LXXA 5EP3A 2Z04A 5GWXA 2ZCVA 3JALB 3PD0A 3AM1A 3GUZA 3C2QA 1CULC 2ZUVA 3ZVKA 4DJDC 5L3QA 4V24A 3H5WA 3UK7A 2I4RA 2ZREA 4Y2JA 5FLXA 3DMFA 4TTQA 1OX5A 3QVJA 1KJWA 1LSUA 2I76A 1O96A 5HRUA 3OFNA 2UZ1B 4BPBA 3ICCA 1BX3A 2VUIB 4LNHA 2ZRJA 1MPTA 4TQUS 3Q9NA 2Y68A 4ZRMA 5K99A 3KT3A 4RLSA 1ENYA 4CGYA 4CUKA 5JJCA 2BW0A 5LQKA 4E15A 2D0DA 2HZ7A 2V0GA 3L8DA 4RPKA 3UB3A 2C84A 3VVLA 1NN1A 5C3MA 3S1AB 1ZAKA 2A59A 2ZSFA 3O83A 4OJQA 4LHEA 1ZO8A 3IELA 2AFIE 5E0KB 2EFGA 5HS6A 1NR7A 5CUQA 4DSAA 4YUXA 1Z4MA 2FX3A 1GUBA 3ORRA 3BQMB 3I1JA 4BLVA 3I9NA 2O06A 4YP1A 2FA9A 4MYHA 2R5WA 1GGNA 4LRXA 3Q40A 4F3TA 3D2CA 1W5AA 3IBTA 3OMWA 3GLGB 1ZKMA 2MINA 3K8YA 3O94A 4PM4A 5HQTA 2HKIA 4I4LA 3R3SA 4E08A 1MW8X 3G7NA 1TGYA 4H59A 1E6KA 3DZDA 3ICVA 4TMVA 1JDTA 2PH1A 3UGKA 4DOMA 2I78A 5FADA 5H1YA 4EX6A 1T5OA 4IWXA 5EE3A 5CLGA 3I23A 4BZPA 1RABA 2FPPA 1L4KA 4XVUA 1IBLB 5HQ3A 3T94A 4O2BF 4ACAA 2H7YA 3EPPA 1BWSA 2ZUUA 4RH1A 1T13A 4CQJA 4BGVA 3LFUA 4BATA 1V16B 4JZYA 4FOSA 4DA0A 3ZQUA 1MEEA 1QMPA 1WHTB 3V00A 1LPBB 2AKYA 1XXHA 1YJBA 3EG9A 3QLVA 3ZR4B 5A1TA 1T5HX 2FSPA 5C8ZA 3G2HA 1AA6A 2BVNA 4DSZA 4XYGA 2X8JA 1ZUNA 3SZ3A 3UIEA 1JT2A 4HTFB 4QBIA 3AVUA 1IBRA 1Z6GA 1QBKC 2QRHA 3IV9A 4HDMB 3KSDO 4F4FA 3ZTYA 2H9IA 5LP6C 1T2UA 3SOPA 2R48A 2PX2A 5AVOA 4MEBA 5CX1A 5T8KC 5C1DA 8AT1A 2A6PA 3FBTA 3BJMA 3UKDA 1JNYA 4WACA 4EABA 4RSMA 2PZ8A 4LOHA 4Y1RB 3C5CA 4WJZA 3WIBA 3D3WB 5CDUA 2ZRGA 3KPWA 2ZWAA 1U98A 3F4BA 3GA5A 2QUKA 4QDKA 3UUEA 4CR6A 1M7GA 4Q3OA 3H2KA 2WWFA 2OBYA 2EERA 1GNLA 3H04A 2GPTA 3KOWA 2P0EA 4HRAA 3DL0A 2O1WA 3GZJA 4NK4A 3KDAA 4E5UA 4Y8VA 3H1AA 3V7NA 1E59A 3H8JA 1UADA 3MWDA 4QDZA 3RTCA 5CFPA 5JR3A 3FPAA 3BILA 3HU3A 2GA8A 1KI7A 4BVGA 2VRNA 4OUDB 3PFIA 5CFQA 1FDSA 1ADBA 3G2OA 3C6KA 4FB4A 4A10A 5LU8A 4MB2A 5AIBA 1BG6A 1HDEA 3F97A 4OYYA 3FOZA 1OOEA 1O95D 2FWAA 5ELMA 2DT8A 3EARA 2GHIA 4TL8A 1VPEA 3NHYA 5FL7A 3W8DA 2HEIA 4IHAA 4DCUA 2VDKB 5D3MA 3TLKA 1VOTA 3DOHA 4X1IB 4O2BA 3TQOA 5BMVF 1N75A 2Q6VA 4BIMA 4YCJA 5AUQA 3MWEB 3NPAA 3R3JA 4FNOA 4NYJQ 4WUTA 2W83A 2AW3A 2B2CA 1G291 4LGYA 2IEDA 4P35A 4IZIA 4TWJA 2EQAA 1J23A 3DDZX 4WASA 4Z9XA 1ZN7A 2QSZA 2VC2B 4HGZA 3SHTA 3TR6A 5IKOA 5AESA 4D8XA 4ARZA 5IC4A 5I7RA 2A0FA 1IVNA 1DNPA 2CUTA 1ACMA 1COZA 2I4NA 1E5VA 1R66A 3AZPA 4D8WA 3QFSA 3PITA 3IEMA 3UHPA 1IOVA 3HA7A 4YRPA 4LDNA 1GO2A 2EGUA 4IFEA 1P9WA 3RIGA 1EM6A 3DM9B 4O1IA 1KU0A 3GMDA 2JH3A 1X2BA 2JIPA 2B1JA 1JLLA 1P72A 4MV4A 3SHVA 2AK3A 4R31A 1NNLA 1ZLYA 4BMDA 1NBIA 1Z0AA 3CRQA 5C1OA 6GPBA 5B1DA 2KHZA 2PVSA 1JLRA 4MV8A 1H8HD 4CKWB 1MOQA 4E5PA 5T4BA 5I9TA 5SYAA 4Z49A 2NV2B 1Q14A 3KZKA 2IU6A 1DOAA 2IKSA 1Z5NA 4N47A 3HXMA 5AOBA 3SC6A 4UUOA 2FB9A 2RIPA 3H4VA 4XI9A 3AC0A 4Y0NA 3RBVA 4HWRA 3CR3C 4V0ME 3PWZA 3AEUA 4H2DA 1TNDA 3TEMA 4P6VF 4MHOA 5AW2A 1IUKA 1M73E 4WCFC 1FQKA 4DA8A 3OCCA 4Y6LA 1Z83A 2MT9A 2R85A 5F52A 2VNIA 1KYQA 2GM4A 3OTIA 2B4KA 3CUYA 1N0IA 1VIMA 2RAPA 2B9VA 3EDCA 4L57A 3UJDA 2IIPA 2UXDB 1Z7EA 1TCVA 2PL9A 5CCXA 1H2BA 2I66A 5D7BA 5BSMA 2PEYA 3ZVNA 3PA6A 5J4KA 4W1PA 1LDGA 3I76A 1FB5A 1K63A 1F6WA 3A4LA 3BSFA 4PX5A 3WX0A 3PQDA 2BM1A 2EATA 2QE7D 1Q7CA 5LZ8A 3H7IA 3VZPA 4PEVA 3TXAA 4D9HA 1R2QA 1W8IA 2COUA 1ZK1A 2H1LA 3DMYA 5BMVA 3OCWA 1Q0LA 3A25A 3GT3A 1FDRA 4RU1A 2IV3A 3KVNA 4HRYA 4GX0A 1M2VA 2P9CA 2Y9MB 2EWMA 4P3YA 1F3OA 2YNMC 1WXIA 3BRWA 3MD0A 1J6UA 1BCRB 4K46A 3RC1A 3A4MA 3I9JA 4YBRA 5KYWA 3JRWA 2O2JA 3HA3A 2JGNA 2ZB3A 4PYLA 3F0TA 3ASVA 1U7WA 5E1OA 5EQDA 2YHIB 3FKSA 2B8WA 1NVMB 1NQ5A 3FF4A 4A6PA 1CQXA 4K1XA 3CH4B 1XQ9A 3IAFA 1J21A 2YJZA 4Q7JB 1BXKA 2VT2A 4R1NA 3HWWA 5TB5A 1V5WA 4NNOA 3ABIA 4ZO8A 3T5MA 1Z17A 4JU8A 5F1YA 3VPFA 5DM2A 1X3SA 4G9BA 4IS2A 1YR9A 3E5HA 5DLQC 2PX5A 4YAGA 3D3NA 1YIOA 4U5QA 4RO0A 2C07A 3E53A 2BTQA 2ZTUA 1DT5A 4U2GA 1I4OA 2D5CA 4YYZA 2WHQA 5K6AA 3PHCA 4PBTA 4UTRA 3CPEA 2XRFA 2CD7A 1ADJA 4P34A 2RI6A 3COZA 2RJOA 4RTKA 2GBFA 3DDCA 1OW3B 4JJIA 4YECA 1X8XA 4XDGA 3L7BA 2C59A 1NLZA 1TUGA 3BXGA 3OZSA 4G5YA 2ZUCA 1RLJA 3WQHA 3U9SA 2E1PA 1IY2A 1YACA 5IRCD 4OKSA 4P5EA 4Q03A 4ZMRA 1GZ3A 4X20B 2D74A 3L4KA 3K1ZA 4WLFA 5E95A 4N6OA 3REGA 3TG2A 3PC8C 5B57C 2XYHA 3TCXB 1ESZA 3T0FA 1MO4A 1UKEA 2AJ8A 4BMPB 4TL7A 2VOJA 4MW4A 1CZKA 4O0MA 2JJ2D 2FPGB 3JCZA 2ZJFA 1RZ3A 2ZJ0A 3QE3A 3V80A 4F8YA 2J07A 3HHPA 5DPMA 5KQMA 3MOIA 1PAUA 3OIGA 2ETVA 4Q4AA 2PKEA 5G40A 6YASA 4P4NA 2HJSA 2K6GA 4Q3AA 2Q7DA 2QBYA 1JX6A 2VHJA 2JAQA 1YHYA 4HUTA 4FFNA 1AO0A 4YP0A 4Y6GB 1ZN2A 2X0NA 1U02A 1Y63A 1YRLA 2R00A 1GAWA 1UR5A 2VBCA 4QTUB 4OHZA 1FXWF 1E9BA 1ZN8A 2BBSA 2FOIA 4QFDA 1UPXA 4IV0A 4YMVA 1FPQA 1Y3AA 3UK6A 1LBIA 2XKAA 4Y2PA 4D3ZA 3ROGA 4ENTA 3TS1A 1LBHA 3WKDA 4KQXA 2F9MA 2PO7A 3MYYA 1P1CA 4M60A 1T1SA 5FWYB 4Q4JA 1VLLA 4Q9LA 2H0AA 4TQ9A 1MDBA 4LCBA 1RMYA 2OAQ1 4UAUA 3CT4A 1DV2A 1E2KA 4HFJA 1YI0A 2IX9A 1V4VA 5DCLA 4BVHA 2OZVA 1GZ5A 2GMWA 4CKEB 4U9HS 4W82A 1M72A 2FW9A 2OQRA 2QPOA 3L0SA 4JBIA 1ILWA 3AUFA 3MG9A 1G9XA 3IKLA 4QFCA 3KX2A 1Y5NA 4EIWA 4ZCSA 2GM9A 3EZ2A 4KXMA 1IOWA 1DG1G 4Y9UA 1RYMA 3CSDA 3EZLA 3FHLA 2WFZA 3PC7A 1L7MA 4WFQA 5KNBH 3T8YA 3TQIA 3KJIA 1NXQA 4YY3B 2DULA 5CT8A 2EC5A 3A4IA 3DC2A 1GLNA 2C83A 1OUMA 4YRNA 1V5GA 1ONOA 3GG2A 4OQQA 4AY2A 2CL6X 2NO1A 3E9DA 1ESCA 1KO1A 1KPGA 4YDRA 4B83A 4TTAA 1X1BA 4Z9YA 4MUBA 5GMOA 3GMTA 3LXMA 4RTNA 4ZVOA 3AI3A 3EK2A 1WXWA 4ITRC 2DPMA 4O4HF 4Y18A 4A4DA 4CBVA 5JAPA 3NDRA 4YONB 2WVAA 3IPXA 4FDLA 1VSTA 4XCXA 2HFJA 5BNIA 5JXGA 1XC7A 2G1UA 4K0RA 4N3BA 4P3XA 2RGBA 4D3SA 3PHJA 2Z3WA 1AU9A 4OJYA 1NN3A 1HQCA 1N2JA 3SAJA 1JFFA 1XZEA 4A7PA 2F2TA 2ATXA 1Q6YA 3ZI0A 1DKLA 1NI3A 3HH8A 2X4DA 3BEOA 2H4ZA 4XDHA 3HY6A 1RCFA 4BVBA 1E69A 4ZT6A 4GKKB 3TOXA 3DJYA 4R9RA 5DM70 4PW0A 1GM5A 3OFND 1F0PA 2CZQA 3VMFA 1UT6A 4E6EA 2E9SA 3C41J 4H0CA 1DWOA 1J9GA 1F4PA 2G08A 2QW1A 3QRWA 3MVEA 2OSVA 3TZ6A 1TKAA 4F91B 2GK4A 1T2FA 2NO7A 1R16A 1U5BB 5IYZF 4KJZA 5CFRA 1KC1A 4U39A 1RXWA 1M8GA 2K5UA 4JC8A 3QUQA 1P4GA 2RGGA 4K3UA 4F11A 2BR3A 1NUQA 1GEGA 3UNXA 4BNFA 3AINA 3L7DA 4IGAA 4Z51A 3GCGA 4A8HA 5BUCA 4V0NA 4W5TA 3PQ3A 4P98A 2CDBA 4PN3A 4BMXA 3LXRA 2CVHA 3L0ZA 1CQJA 2QMYA 3E7WA 1MV8A 2WF8A 1KKUA 4PICA 5K0CA 4FBLA 4IIYA 3D8TA 1KZGB 3STVA 4F8EA 1HMPA 3X1ZA 3ZQKA 1C7RA 2O1EA 2COKA 1QYVA 2W2PA 5IWAB 3WJ7A 4JLWA 1MAAA 2WJHA 2R1VB 4EFDA 4F9GA 3IH5A 3AR5A 5B4TA 1ECFA 1T8PA 3E7PA 4RESA 3UYKA 3VZRA 3ICEA 1ZIPA 1YS1X 4BNYA 4O2RA 1VKZA 1ATZA 1N2CE 3BWYA 2EDCA 1C1DA 1I4WA 4UAGA 2J6IA 3DYVA 4JROA 3SDZA 1NXPA 2SICE 2C7GA 5JATA 5JYDA 1OI2A 3AKZA 1TZMA 3U62A 1RRCA 2EF0A 1G55A 3X1WA 1OBOA 5JNUA 3VYUB 1IZ9A 1QRTA 1VE3A 4DREA 3V48A 3KD3A 4RD2A 1ZVPA 1TA0A 4BAGA 2TRSB 1A96A 1XPUA 1YVPA 3U49A 1UBKS 3UMYA 2QZZA 2XTJA 5CXQA 4P7FA 3QIVA 3JQGB 4KZPA 3VYVA 1FRZA 1B8NA 3GC6A 4E30A 4Z4HA 2GZAA 3JQFA 2IV2X 3T5BA 1QJCA 1AK2A 3HNPA 3UHOA 2ZB4A 4G5HA 3AAWA 4ZAXA 3U3KA 1PKXA 1Y8CA 1JE1A 1GKKA 3UZUA 3DO6A 5AKLA 1C9KA 3PEYA 1AV7A 1KOJA 1UFRA 3DW1X 3DKKA 3FI0A 2PXXA 2Y1GA 2W2LA 3MTJA 3RIHA 2AHOA 1QQ6A 5I45A 1FTNA 1T9DA 2NU7B 4KOEC 1Z6ZA 1SBTA 1BJKA 1L4FA 1MH1A 1N6HA 1P74A 1IFXA 1UKCA 1MN6A 3BGSA 4UCXA 3MWGA 4EQZA 1X7YB 4FYXA 3RRZA 4BB0A 2O4CA 2O9JA 2QRMA 2ZAOA 1R8JA 4O8CA 1QVWA 3FMFA 2PU7A 4D6YA 3GRUA 3KQVA 4DRXA 1NULA 1F06A 2Z9DA 3PEUA 3A0RB 3GLGE 2NZ2A 1GHTA 1OD6A 1JH8A 2EYQA 1F12A 2MSCB 4ND1A 3RYHA 3X44A 4TYNA 4TYWA 3TLAA 1GDTA 3UOWA 4EVSA 1EUCB 3AEQA 2D8AA 2FN8A 3I3OA 1OROA 3PDHA 4GX5A 3U81A 3WGIA 3HRKA 5I9BA 3L8GA 2Y2UA 2OWEA 1DIOB 1U3FA 3T95A 1HZJA 5FPSA 4MS3B 3A7EA 5TF4A 1DC8A 1O5IA 2DF8A 2QUIA 4I4TF 4BNTA 1KI4A 2AN9A 3VO2A 2P3QA 4UTVA 4G4GA 1A7JA 1IY0A 2ASEA 3E1KA 1M33A 2HMFA 4ZT4A 4FQ7A 1VXOA 1JHAA 1YMUA 4Q3DA 5L3RA 5JDIA 5K8UA 5KO2A 2W2QA 3ZDYB 5BRAA 3THYA 1YU6A 2GVZC 3GZNA 3VI3B 1R6DA 4G2NA 4REQA 1LTHR 1KHHA 2YOFA 3RLIA 1QIHA 1VPDA 2I99A 3WWDA 2G5PA 2NXJA 4MP8A 3Q9LA 1AMOA 4B3GA 1RM4A 1YDWA 5B4UA 1KEPA 4YCMA 4EY4A 1Y37A 4EYSA 2P3SA 5HF9A 1J5EB 2ZBGA 2ZJOA 3BDAA 3PPIA 3PPYA 4MWGA 1KC3A 3GLUA 3DT8A 4RLHA 4FXOA 4RZ2A 4UPEA 1JKFA 4NFYA 2PUAA 1DIGA 3Q11A 3N2GA 3OM0A 2OGSA 3SD7A 3JRNA 4JLSA 1DDOA 5DGIA 1FDIA 1W6RA 3KPVA 2L19A 1R12A 4G97A 4QJ4A 2BZSA 3H1GA 4MR9B 3OZEA 4UVEA 4ZO4A 5LLSA 1OLXB 1CQIA 1ORDA 1NKSA 2XZOA 4AYXA 4GQBA 1D4AA 1KVRA 3AIIA 2CNDA 3R5SA 1ZZEA 1WCWA 4HLUA 3CNLA 4M55A 3MJCA 4QLBA 1AGYA 5BVGB 1I7QB 1W29A 4DIBA 3S2IA 1L4NA 2PUJA 3G0IA 4Y2RA 3PGKA 5BW4A 4OI0A 3WIUA 4XFKA 3TJMA 2G7ZA 4GS5A 2IZ7A 4BQPA 3CLRD 1YZGA 2QM8A 5A62A 2VKQA 4W9NA 1HQKA 4N8DA 1F51E 3KBBA 2YRXA 4P31A 1RSZA 4TUYB 4X6UA 3T5CA 3MLEA 3UVEA 4CM6A 4CQLA 3SKYA 1ULUA 4D8VA 3M33A 2W58A 5DSXA 3IDZA 3QIAA 5DM0A 5EJEA 2YZ2A 3SFVA 1V1RB 2AMLA 3DOEA 3UWSA 1KYZA 2BFFA 1R0CA 3IUEA 1QIGA 4XYBA 4ARVA 1GQFA 1Z4KA 1DAHA 4KFTA 3NM6B 2AEJA 1YJ8A 3TTXA 4YP5A 2FR8C 3MERA 3KSZO 4YWHA 4B3JA 3CC8A 3ZXSA 3KTFA 4WBSA 2BMFA 2C1ZA 1UBEA 1VA5A 1BYUA 3QYFA 4TMXA 1NLYA 5ER9A 5U9CA 4JMLA 3IMKA 4NMLA 2TSYB 2IYPA 1EAMA 1LBQA 4HYEA 2P3OA 2CLSA 2RG7A 3BICA 3HLTA 3LY5A 3MJDA 4FYWA 1EB8A 3AF1A 1SZPA 3TLEA 3V8PA 1YQDA 4AZTA 4GMXA 2GHTA 4OXRA 1T25A 2ANBA 4YHHB 5GADl 1TUEA 3EIXA 3FKSD 4D99A 3CGGA 2VHVA 5AM4A 1YL6A 2YWEA 5DTEA 4BNVA 3V7UA 5JT1A 5FHRA 5EZYA 1TTTA 1GKLA 1FVHA 2DBZA 3KWFA 4JOQA 4NU8X 2YQ4A 3M9LA 4WOPA 5DMHA 1YQTA 3KXIA 1U2DC 4BBAA 1M8PA 5AJYA 3E9RA 1XEAA 2GT1A 2KBEA 4YPFA 3RVMA 1VGQA 2PNFA 2JGEA 2EKQA 3HKEA 4GP6A 3VYWA 1UZNA 5CHEA 1XZQA 1ODSA 5JMOA 1IHPA 2X8WA 3WSTA 2EWWA 1YJCA 2P9ZA 3IBYA 4PLVA 3HCWA 5ENVA 3RRFA 3BL6A 4CRWB 2R86A 4LC0A 4PYJA 3FJOA 4DC0A 4HVCA 3BZBA 1CUEA 4ZXFA 3SZGA 2V98A 4S05A 1MJHA 3C70A 1ZG3A 1ZM9A 2VCYA 4MUXA 5HF5A 3OJWA 4HWKA 1T4BA 1UPBA 1G6OA 3EZXA 2Q6KA 3IAAA 4M7OA 3NS7A 1S2IA 2IE0A 3D1LA 4GQAA 4PF1A 4RZSA 4UXJA 4WXPA 2PWBA 2REQA 4NJMA 5ENDA 4ZVKA 4QYSA 3SIPA 3OIYA 2PBFA 5FUYA 4HR7A 3T9DA 2XDYA 2BSQA 5F51A 3VNQA 2R7AA 1GL6A 1N0VC 3GGPA 3HP1A 3R7FA 4JXZA 4FE7A 1PFGA 2YVUA 3FSJX 3R0VA 1WS6A 1ENZA 4V0RA 4BP1A 3ORQA 1FBTA 1KBZA 3UJ9A 1IOZA 1GLVA 1WMEA 1YZYA 1TD9A 4V1CI 2ZIAA 2GJKA 4AJ4A 1PDVA 2P4EA 2A92A 2FWBA 2XRZA 4RTSA 1E0DA 1LBEA 4EGFA 3NHMA 4WH0A 1L5FA 4MRMA 3BBLA 4MWCA 3WK4A 2H1FA 2C0CA 1DPGA 5L3ZA 1NJ8A 2ZTMA 1QV9A 5IJWA 1GG5A 2NVBA 3CNQS 3GFRA 4TWRA 2R6DA 2N1MA 2FJ0A 1TRHA 3AOGA 5FLYA 4FFBA 5CYPA 3AJ9A 1CNFA 3C3KA 4J2HA 3B5IA 4LISA 3E9EA 1AGXA 3OJEA 3CLTC 2P41A 2WPNA 2WIDA 3IRVA 4HNQA 4K40A 2ASVA 1U2EA 4L6IA 4B9AA 4P36A 5JH7B 1EFPB 3U44A 2VYNA 1X1SA 3DHVA 1Y5IA 4ZQCB 3ZZ1A 4INPA 3NTXA 3ZE7A 2FZVA 1L7XA 4M38A 1PE0A 1QRDA 3MD9A 4IG9A 3VR2A 2PRJA 2R2GA 3IBSA 4FINA 3WYFA 4O4JF 5CB4F 2AE1A 3LBFA 4RETA 3ROQA 5CG1A 3O8RA 4YJ2B 2WSSA 4A0RA 1GQOA 1U6JA 4L9SA 3ZE0B 1UZMA 3C1AA 4BV8A 3V2HA 5CM8B 5CYOA 3I4LA 3JVVA 2RSLA 3A4TA 5KJ1A 1BA3A 2ZXUA 3R8CA 3W34A 2VQDA 2OGZA 1KS2A 3C8ZA 3D6UA 4EELA 3OCXA 4MVCA 2Y67A 3CUSA 3HADA 2PO5A 3IX7A 1KAGA 2DQKA 3JXEA 3WNVA 1JBEA 1QK4A 1R18A 3AHCA 4GL4A 5CGQB 3WWPA 2B1RA 2RIRA 2PGJA 4MJLA 1IN4A 1JA1A 5EUCA 3RFCA 4Z99A 5KSZA 4IH1A 1VBNA 4LY0A 3UMFA 3GBSA 1PW7A 1JDUA 4FIDA 4YP6A 1WL8A 1K8XB 4CMIB 2PLAA 1FSGA 1G8KA 1MEOA 2ZPTX 1C9MA 1U3WA 3WLTA 3GOHA 2YMPA 1JVBA 5DK6A 4ID3A 3O2JA 1VKOA 2FGJA 2CF5A 5JOQA 1RMTA 3PNLA 5IAOA 2C03A 3CEJA 1WV0A 1XRPA 3PIRA 4UVDA 4ZDWA 2NU8B 3MFYA 1TF2A 1K3UB 2C3UA 2ZRCA 3EPRA 1BE6A 3LT0A 1COWA 5ELLA 1OX4B 3UBTA 4W7SA 2QV7A 1D7AA 2W2OA 3LI2A 1PV2A 2PY6A 1UINA 4JJFA 1HWYA 2Z2XA 1FUUA 3MWYW 1T3SA 5FBWB 5CR9A 2GLTA 2VYVA 1QFZA 1L1FA 1ZPDA 2CXQA 4ZVSA 3AVYA 2FG6C 2QNRA 1NVTA 1SCJA 2ZJYA 4CFYA 1BHO1 5AW4A 4XCQA 4JVLA 3AEKB 4JHLA 5HFNA 4N5MA 3CPJB 1CXZA 2YYYA 3QG5A 2IH2A 1GNTA 4EJSB 2VNKA 4JLVA 4LC1A 3ZD8A 4L4UA 2V7PA 2BM9A 2HHAA 3CUKA 5JZOA 5CB4A 3LU1A 2HBQA 4P54A 2DZDA 4I1RA 5DI3A 1PV1A 5BQPA 3OCJA 2C04A 4DDHA 3CH7A 3RE1A 1OIVA 3WRVA 4I2VA 1XTKA 2MR5A 3H9QA 3JYLA 3FIUA 1NAIA 2A5LA 3TFQA 3V1TC 3N8DA 4MQFB 1P1RA 3EGDB 1F8GA 1YRBA 4HWPA 5EKUA 3ZXXA 2WKPA 1XVTA 4WY5A 1U0RA 1IM5A 1O03A 1XA3A 1BEUB 1TVCA 4L28A 5HK8A 4L51A 4AP5A 4UE6A 1HT0A 2PH7A 4OYHA 3M6XA 4DL9A 4O4LF 2GBIA 3T5TA 4QNMA 3N05A 4TKMA 3KU4A 3S6JA 1UJ4A 5FO0A 4DQDA 5JPDA 3U7HB 1H69A 3ANSA 1A97A 2WA2A 2PCLA 2AFVA 2NP7A 4H3SA 4QTXA 4E0BA 4MH0R 1YGPA 3ONDA 1V8FA 2CHUA 2AYYA 3OVMA 2VCHA 3ED5A 4QEZA 2C9BA 2BCJQ 3T38A 3ZX4A 4DR2B 1W0JA 2GYYA 4B32A 2RD2A 1YV9A 2GBLC 1A9ZA 3PE4A 4RHFA 1VDZA 5COBA 5HBGA 1B8OA 2Q29A 3QVGA 1E1MA 3EIUA 4ZPXA 3VU9A 1IBCA 2ST1A 1A76A 4OGFA 1JXAA 5DYTA 4C0JA 2Q4EA 3QEBZ 2FI1A 1IUPA 2G8NA 3Q7PA 4TQGA 2WOJA 4G8DA 4WA7A 1DAIA 4FZJA 1OZAA 2XA9A 1MX5A 1W0KD 3M7IA 1AMNA 1M6HA 4R0MA 4NP6A 4BB9A 2Y8EA 3U2QA 1MEJA 2XUPA 5EZ6B 4BQEA 1IZ7A 1KJZA 1R5OA 4EPWA 1VP3A 3NBKA 4RNDB 4J2TA 4GM4A 3PYMA 2TS1A 4WECA 3VDQA 4H0NA 3ZPXA 4LF9B 3O4FA 1N77A 1AA9A 1MB2A 4L0MA 2HF9A 5ITSA 2IC5A 4HT3B 4XEHA 2K7ZA 3PUXA 4O0LA 1OFUA 4BC1A 2FPIB 3AL3A 1ISSA 1RPJA 2E7ZA 3R5HA 4IZHA 3UQYS 2ILTA 4D45A 1N2SA 1V45E 2E0IA 4Y6OA 3MIIA 4Y6SA 4BKMA 5IZ4A 4N5LA 1QF9A 2ZBVA 1BHSA 4X6XA 3BQNB 5JAOA 2EVWX 3TINA 2GM3A 3H83A 1JHQA 4MYTA 1E7YA 2QDKA 3EYAA 5ITZA 2GPYA 3ESRA 3L43A 1ND6A 4RK5A 5B12A 4P4LA 4DV2B 3TBFA 1E94E 1G98A 2O8FA 3A1VA 4FT2A 4HB0A 4E4TA 1JB1A 1H6DA 1M6EX 5JQGB 1ACJA 3ISVA 3PR3A 1VHWA 4YBZA 5TX7A 1N78A 4WKPA 1E1RA 1HYBA 1Z4IA 4JC5A 5A3JA 4JS0A 3GPIA 4MOWA 4MVJG 4E07A 1V8DA 1GPWB 2IYTA 2NUAA 2JFOA 3AR4A 5IUKC 1Z2CA 2OC9A 1ECLA <