3K0BA

Crystal structure of a predicted n6-adenine-specific dna methylase from listeria monocytogenes str. 4b f2365
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
380
Chain Sequence
SSGRENLYFQGMKSFQLVATAASGLEAIVGKEVARLGYDPKVENGKVYFEGDLSAIARANLWLRVADRVKIVVGVFKATTFDELFEKTKALPWEDYLPLDAQFPVAGKSVKSTLYSVPDCQAIVKKAIVNRVSEKYRRSGRLMETGALFKLEVSILKDEVTLTIDTSGAGLHKRGYRLAQGSAPIKETMAAALVLLTSWHPDRPFYDPVCGSGTIPIEAALIGQNIAPGFNREFVSETWDWMPKQVWADARQEAEDLANYDQPLNIIGGDIDARLIEIAKQNAVEAGLGDLITFRQLQVADFQTEDEYGVVVANPPYGERLEDEEAVRQLYREMGIVYKRMPTWSVYVLTSYELFEEVYGKKATKKRKLYRTDLYQYWGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a predicted N6-adenine-specific DNA methylase from Listeria monocytogenes str. 4b F2365
rcsb
source organism Listeria monocytogenes str. 4b
molecule tags Structural genomics, unknown function
molecule keywords predicted N6-adenine-specific DNA methylase
total genus 119
structure length 380
sequence length 384
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3k0bA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3k0bA02
2P3OA 2PXAA 5GP1A 1MHTA 2E5WA 5E2BA 1VPTA 3SSOA 3LGAA 2AOVA 4E2XA 3PX3A 3Q87B 1NKVA 4IWNA 3FYDA 3G89A 3BWMA 2IP2A 3DH0A 4HGYA 1X1DA 3UFBA 4AZVA 4CKEA 4G56A 5DTMA 2EJTA 4FGZA 4E33A 3RIEA 3A7DA 3UWPA 2UZ4A 1RJFA 1SQGA 3KQMA 3HP7A 2P41A 1RJDA 3DMHA 4P58A 1R6AA 5C1IA 1JSZA 3UJAA 2BZGA 5EMKA 3GNLA 5E1MA 1UFKA 2ZTHA 3M6XA 1G8SA 1M6YA 2NNWB 3P8ZA 1O9HA 1QAMA 3CVOA 3UJCA 1DCTA 1BHJA 2PJDA 3A7EA 2DULA 3AY0A 4RVDA 2I9KA 1X19A 3G8AA 4X61A 3KR9A 3BGIA 1M0EA 3BKXA 3PFGA 4X63A 4C08A 3FTFA 5E1DA 2OY0A 5CVUA 3SSMA 1G55A 2ZFUA 5F2OA 4GC5A 3R6TA 3LCVB 1IY9A 3MTIA 4BY9E 3WSTA 3LDUA 1L3CA 1P1BA 4KIGA 4NECA 3SXJA 4M38A 2IBTA 3GU3A 1EIZA 3FUVA 3DXXA 2CWWA 2VS1A 1Z3CA 2PSSA 5FQNA 3T7RA 4C04A 3OFKA 4OBWA 1XTPA 5CIYA 3U81A 2IH2A 5KQRA 1AQIA 4ER5A 1R00A 1VP9A 2I6GA 4DKJA 3PTAA 2ZIEA 3F4KA 2FRXA 2PT9A 1OR8A 2PX5A 2XYRA 5FCDA 4QQNA 2O57A 4FT2A 3HA5A 4RV9A 1WXWA 3MCZA 5BXYA 3OU2A 3PT9A 5ICFA 3TPZA 3FZGA 4PYMA 3O31A 2FPOA 5ICGA 4RTNA 5FA8A 3ANXA 3CC8A 2LD4A 3DLCA 3LKZA 2IFTA 3MAGA 5DM4A 3UA4A 4KVZA 3VC2A 3MGGA 3LX6A 3UJ9A 2VDUE 4EQZA 3C6MA 3IEIA 5KYGA 3EVBA 2NP6A 4E32A 2PKWA 3B3GA 5FTWA 1O54A 2OB2A 2P3QA 3MB5A 4GOOD 3VYWA 4MIKA 1R18A 3OZRA 3OZTA 3CGGA 4MWZA 5HIMA 4C05A 1YFJA 3NDIA 4WXHA 5DTQA 5E2AA 3SM3A 3G8BA 5DRTA 5DT2A 4IV8A 4DMGA 5LQUA 1P91A 3KQQA 5KQSA 3PVCA 1R8XA 5CUQA 3TM4A 4X41A 2GAFA 5K0LA 3BWBA 4C4AA 5KVAA 2IIPA 2HR1A 5F2KA 4ER0A 3A25A 2GA9A 3Q7EA 3ME5A 2GPYA 3EVZA 3HVHA 3E23A 3I64A 2PBFA 5DPMA 5FADA 2B3TA 3UJBA 1JG2A 4CXMA 4QDKA 2ESRA 1T43A 2BR5A 1EQAA 4KWCA 4RTSA 3CJRA 5GIPE 3EGEA 1NW3A 3IV6A 2AN3A 3TR6A 2GS9A 3EVEA 3FPHA 3ID6C 2ZW9A 4PONA 3NDJA 5D1NA 1JTFA 3MCTA 5CVEA 3CJQA 4QVGA 2PX8A 3R24A 1L9KA 1JG3A 3B7PA 3NTVA 5HIKA 4PIPA 1JTEA 1JQEA 4AZSA 3BT7A 2G8NA 2CKDA 1KHHA 4Y30A 1UIRA 3LPMA 3SR4A 3DR5A 3LKDA 3DLIA 1KR5A 2AN4A 3REOA 3PFHA 5BP7A 5E8JA 1X1AA 2OBFA 2AVNA 1L1EA 2P7HA 1EJ0A 3BGDA 1ZGJA 2VDVE 3GRZA 2GLUA 5EOVA 3TKAA 4EKIA 3ER9A 4CWAA 5K0GA 2CL5A 1MJFA 3MERA 5K09A 4GUAA 4HTFB 2N47A 1I4WA 2WK1A 3KQWA 3EPPA 1XDZA 3SMQA 3KKZA 1KIAA 1RJGA 2ONYA 5CVVA 5GM1A 4DM3A 3P2KA 2PWYA 2AR0A 1AF7A 4HH4A 2IBSA 1NBHA 3AXTA 2Q41A 1JSXA 5F2NA 3OPNA 4GC9A 3CCFA 4YMHA 3UZUA 2PT6A 1WZNA 3C3PA 3GGDA 3P9NA 3TRKA 3K0BA 2NXJA 3A26A 4V0RA 4YUXA 5DX1A 4KIFA 1I1NA 4QTUB 5T6BA 4OX9Y 3ERCA 4PYQA 3I53A 1DL5A 2P7IA 4R6WA 1ZGAA 1ZHFA 3C3YA 5DWQA 2QRVB 2Z6AA 3G88A 3KPUA 4UOEA 3BWYA 3I58A 3HM2A 3UJDA 2AN5A 3NJRA 1JR4A 5DLYA 3MQ2A 4MQ4A 2UYOA 5EEHA 1ZG3A 2G72A 3A27A 3KQOA 3LL7A 4HG2A 3THRA 4CTKA 3GO4A 5DTRA 4AUKA 4EVIA 4QQKA 5DM1A 5EZSA 5C0OE 3I5UA 3DMGA 4DQ0A 5GINE 3JWJA 3NWBA 4QPNA 2Z6UA 4F85A 3LSTA 2PVCA 4QDJA 4Y2HA 4P7GA 3KPWA 4KR7A 4LWOA 1N2XA 2B9EA 3DUWA 2A14A 2AZTA 4GOLD 5E9WA 5FWDA 2OYRA 1XDSA 2XBMA 3ELWA 4RTRA 2PY6A 1ZKDA 2R6ZA 5K0JA 1FJXA 2EG5A 2I7CA 1R74A 2ERCA 2NXNA 3FUXA 4FSXA 4PCLA 1D2GA 2XVMA 3GWZA 4RTJA 3KQTA 3L8DA 1JQDA 4QPPA 2OPBA 3FPFA 1X1BA 5CM2Z 2YR0A 3KQSA 1VP3A 2OKCA 1VIDA 4GEKA 4QTTB 5FQOA 3ELYA 3EVAA 4PYJA 4A6DA 1F38A 2ZBRA 2R3SA 3EVFA 3M33A 2H00A 5DX0A 1DUSA 1NW5A 4XUCA 3X0DA 1JQ3A 3BXOA 3KPYA 2P8JA 3QOWA 2YXLA 2VP3A 2ZULA 2WA1A 1FP2A 4WVLA 2OXTA 1KPIA 1U2ZA 5E1BA 4C07A 4EKGA 1SKMA 2HTEA 3GDHA 1KPGA 2O07A 1KPHA 3BZBA 2V7EA 3OCJA 3QOXA 3ORHA 3EVDA 4DF3A 3C6KA 5HIIA 1RI5A 3CKKA 4BLWA 2C7RA 2IH5A 3PLAE 4RX1A 5EG5A 5LSAA 7MHTA 1IXKA 1VE3A 5K8VA 5LQCA 2C5SA 2YXEA 4QVKA 3IYLW 2F8LA 2V74B 10MHA 3TLJA 1EAMA 3AJDA 1FPQA 2JH9A 1AQJA 4OA5A 5CD1A 5K0EA 5K0FA 1N7JA 4FS8A 5DXAA 4R8SA 4LWPA 2XYQA 3SVZA 2CMHA 1KYZA 1XCJA 1XXLA 1VBFA 5U4XA 3KPVA 4PYLA 4RTPA 3OE5A 2ZCJA 2ADMA 2G70A 2IPXA 3MTEA 3PS9A 4E70A 2YQZA 2AOTB 3OU7A 2ZSUA 5DM2A 1SVUA 5EHGA 2ORED 3FPGA 4C06A 1NE2A 4XUDA 2AOTA 4HC4A 1SG9A 3P71T 5MHTA 3NVKI 1VL5A 3SX0A 3HNRA 4PYNA 3GCZA 3O7WA 3G2QA 2BM9A 5K03A 3LCUA 4JXJA 2O06A 3M6UA 4YUZA 2UYHA 2EFJA 1WS6A 3EMBA 3T7TA 3E7PA 1EG2A 4ATNA 1ORHA 2QY6A 4PYIA 1X1CA 5ICEA 3QV2A 4H0NA 1SUSA 2JH8A 2IDJA 2PX2A 2PXCA 4YMGA 4RTOA 2H1RA 3UA3A 2C7QA 2PXXA 5E9QA 4OQEA 5IH3A 4OBXA 2ZBQA 1QZZA 1NW6A 5HILA 5K0CA 2K4MA 1G6Q1 5FHRA 4RTMA 2QYOA 1TW3A 1TW2A 2YTZA 5E1OA 4PCAA 5DSXA 5CCBA 1YB2A 4KW7A 3KR1A 2DPMA 3M6VA 2FYTA 2IGTA 3DULA 3K6RA 3V97A 4YV1A 5BW5A 2HMYB 1IM8A 4E2YA 1YZ3A 3EVGA 3B3FA 3LHDA 3DTNA 4M37A 4PINA 1F3LA 4RSRA 5DM0A 2ZLBA 2NP7A 4HGZA 3NWEA 5CCXA 4RVHA 2P1DA 3UJ7A 2HWKA 1VQ1A 5EQJB 2Z6QA 3LDFA 2BR4A 4F86A 1INLA 4AX8A 4PYOA 2JHPA 2ZWAA 5EC8A 2B2CA 3HA7A 4POOA 2UYCA 4M36A 3R0QA 4ER6A 4RTKA 2GB4A 5ERGB 1L3IA 3SGLA 4RTQA 5ICCA 4FSDA 3UJ6A 4KDRA 3KQVA 3DXYA 3HCEA 2FK8A 4FP9A 5T67A 5EIFA 3KR2A 3G5LA 4GQBA 3E05A 4FR0A 1TPYA 4BLUA 2B78A 2JHCA 3P2IA 2HNKA 3HCBA 3OU6A 4PGGA 5DRYA 3FUUA 2P3LA 3V8VA 3T0IA 3FYCA 3TQSA 4AZWA 3BUSA 4P7KA 5KS2A 5E9JA 2CMGA 3RODA 1R8YA 2YVLA 4HRAA 1BOOA 4MTLA 1Y8CA 4RWZA 3G2PA 1FBNA 2ZIGA 3OZSA 2NXEA 3EEYA 1V39A 5HZMA 1XJ5A 1YZHA 5K05A 1P39A 2O05A 3P9KA 3RW9A 3JWHA 1G38A 3HEMA 4FT4A 4CKCA 4YUYA 5JUWA 5DX8A 4RVGA 4BP3A 2ZWVA 3C0KA 5LQNA 3FRIA 4KRGA 3LCCA 5EKUA 4DZRA 2ZIFA 3JWIA 4KR6A 2FCAA 5BW4A 4EK9A 5T64A 5E8RA 3OFJA 1WXXA 4DA4A 1NW7A 1RI4A 3ER8A 2ZBPA 1XDUA 3IHTA 5DSTA 3FRHA 4P7FA 4MHTA 1XCLA 3THSA 3AWIA 4R6XA 4IKPA 4GBED 1VLMA 4ISCA 1M6EX 1D2HA 4M7RA 3BKWA 1KXZA 3B3JA 4R8RA 4YV2A 2XVAA 1NV8A 3P9IA 3GRVA 1ORIA 1RI2A 5D1HA 3GIWA 3KPJA 4HSGA 4OA8A 5EIWA 3T7SA 4EMSA 3KQPA 3ELDA 2QM3A 5K0BA 4YV0A 1H1DA 3M4XA 2XYVA 4KR9A 2UYQA 2WA2A 4A6EA 1UWVA 3HTXA 3D2LA 5JR3A 1QYRA 1QAQA 5HOQA 1HMYA 3DXZA 3GXOA 2G1PA 2QE6A 4PWYA 3LBFA 5HEKA 2B25A 4GOMD 3HCDA 3P2EA 5FULA 3TFWA 4O29A 3A4TA 2IDKA 3GRUA 1RI1A 3M70A 5GWXA 5GIOE 3FPJA 2JJQA 3I9FA 2PWPA 4AZTA 2PGXA 5M5BA 2BM8A 5G02A 4U7TB 3TMAA 3BGVA 3DOUA 1D2CA 4PNEA 2VDWA 4U7PB 3O4FA 2PV0A 5HFJA 2JHAA 5IKMA 1NBIA 1N7IA 3NMUF 1XVAA 4XCXA 3NVMB 2NXCA 1NV9A 1YFLA 4IV0A 4KDCA 3HVKA 4PGHA 3HA3A 4R05A 3KQYA 3BWCA 5B1SA 4E31A 5HIJA 3TM5A 1KYWA 5EMMA 2AOXA 4GF5A 4E2WA 3FUWA 1QAOA 3HCFA 2P40A 4E30A 1SUIA 2EJUA 2I62A 5C9ZA 3GRYA 3GJYA 4YUVA 5FA5A 4F84A 3FTCA 1BC5A 1G8AA 2C7PA 5EMJA 1WG8A 3G2MA 3PB3A 4ER3A 2KW5A 1FP1D 3EGVA 3LECA 4GOND 3KHKA 5LQAA 2C7OA 3EEOA 1I9GA 5CVJA 4L7VA 3PX2A 1EJ6A 4RTLA 3FTDA 3JWGA 4CTJA 2YUIA 5K01A 1AV6A 1QANA 5EEGA 2PX4A 2EX4A 3DMFA 4BLVA 4X1OA 1JG4A 3VC1A 4DCMA 1Q0SA 4ER7A 1KP9A 3S68A 4PIMA 4V0QA 4OQDA 2IH4A 3GRRA 4HTFA 5H02A 5LQKA 3LBYA 3AXSA 3ELUA 3KU1A 3P9CA 2O0LA 3VSEA 5LQRA 1L3BA 3G2OA 2Y1WA 5CVDA 3UJ8A 3UBTA 1BKYA 2VZ9A 2ZZMA 3TKYA 4CKBA 1WY7A 3HCAA 1YUBA 3FPEA 3EVCA 1SQFA 1O9GA 2NYUA 4E2ZA 5LR6A 5EZQA 1B42A 3HCCA 4BP1A 2GH1A 3TOSA 3EGIA 2P35A 8MHTA 5EKXA 5EVJA 2Y1XA 4B17A 3B5IA 5FUBA 4RYLA 5EHIA 3P97A 5LQJA 1G60A 5FHQA 3LDGA 2ONZA 2QRVA 4LECA 4RVFA 3KR0A 4XUEA 5EPEA 2ZZNA 2JG3A 4Z2YA 3FUTA 2HV9A 3SSNA 4C03A 2H11A 1RI3A 1ZQ9A 2AS0A 4ZTBA 3R9XB 4K6MA 1NW8A 1NT2A 2YX1A 3CJTA 3EMDA 2BH2A 9MHTA 2AVDA 1P1CA 2G71A 3M6WA 5DXJA 3NW9A 5GOZA 5K0NA 2OZVA 4PYKA 1HNNA 2FK7A 5EGSA 3CBGA 3HVIA 1YF3A 4X60A 4DCGA 4YUWA 3MHTA 3FTEA 1PRYA 3R3HA 3E8SA 2YXDA 2AOUB 5FWAA 1Q0TA 5P8WA 2OO3A 1JG1A 2AOUA 2AOWA 3H2BA 3HVJA 4LG1A 5EMLA 1RJEA 3B89A 2PLWA 3DP7A 3G5TA 4P7JA 2ZZKA 3OE4A 5GM2A 1PJZA 2BR3A 2OB1A 2ZVJA 4FZVA 3G7UA 2FHPA
chains in the Genus database with same CATH superfamily
4L5YA 3N0XA 5DHAA 1SVMA 1ICIA 3CUUA 1DC7A 2IJGX 1CRQA 2WFLA 2P2GA 4I99A 4CM8A 1WEHA 2JFXA 1MAUA 3QQPA 3QVTA 4IWNA 4JXZA 3QEJA 1AKEA 1RADA 2VSXA 2XHZA 3ONWA 3LK6A 5AJHA 5EKDA 2KMLA 1KOLA 3K9WA 2HPHA 1UBJS 1E2UA 1QYIA 2D4AA 1A5TA 1GUDA 1M2OB 2Q6KA 3MUEA 3LXMA 3PCXA 1E9FA 2C0CA 2Y1GA 3GHHA 3R3SA 4NCHA 5AUOB 5H1YA 3TLXA 3SR3A 3UJAA 1X7YB 1YZGA 5JNVA 3GNLA 3IX7A 3ASUA 1L5WA 4LJ7A 4DPMA 5DBOA 3DAHA 4L5IA 4IOLA 1M6YA 2V65A 3KOYA 4AMZA 3P8ZA 2G04A 2R2GA 3CVOA 1F8UA 3IIMA 2HXGA 4AM8A 4HAWA 3ZWCA 3G8AA 3AM3A 1Z0UA 1M0EA 2OCIA 4IDCA 1L7EA 4ZT6A 2DE0X 3A28A 1EESA 3B6IA 3TLMA 2HY7A 2P78A 3FF1A 4JEUA 5AVUA 3RUEA 3TXYA 3VX3A 3HXTA 4ZYUA 3MTIA 1TK3A 2WVAA 1II8B 2CXOA 4DNQA 4IIJA 1N4DA 1ZBDA 3MT9A 2Q4BA 4UFPA 1AG9A 1P9NA 2IK8A 1H9CA 3B7GA 3ONEA 4CEIA 5JQGA 4DKJA 3P2JA 1NHWA 4ZQFA 3PITA 1EK0A 4G65A 3Q6IA 5A2QA 3M5CA 3HJGA 4UD6A 1XDWA 2YN4A 3ZD6A 1KQFA 2RHRA 1V3UA 3TEJA 3SF0A 4JLBA 4RZIA 4UBMA 4YGYA 5D3MA 4HVLA 1MC4A 3B52X 1FOEB 1A0OA 4E21A 3U62A 1JXAA 1NXWA 1DLJA 2I6FA 2WM9B 2RH5A 3ANXA 1LFDB 3KLMX 3LUCA 2LD4A 3DLCA 3LKZA 3NIBA 5DM4A 3CZMA 1TLFA 2XT0A 3SX2A 3ABZA 4ZMSA 3BSSA 4CKYA 2E4UA 4PG6A 4AKIA 1R18A 2FR8A 2JJ8A 3IUMA 3OZRA 4U2EA 3T94A 2B7BA 1QDEA 3K92A 4RA6B 4Y9TA 3D4PA 2XB4A 2GEVA 2WM2A 4GLFA 4QXQA 1FFBA 1Z8HA 2YWDA 3HMKA 4W7SA 5DT2A 4C2BA 1FYVA 4EARA 4YAKA 1Z6YA 3KFXA 5I9LA 3ZBQA 2HRBA 3I0ZA 2ETVA 4P4SB 1SWWA 1YIDA 2BKVA 5F2KA 4P08A 4N01A 2OXFA 4C2TA 2HU7A 2ZE7A 4NMXB 4BX2A 1PS9A 1X8KA 1Z0AA 1YMVA 5D3KA 1U4NA 1Y98A 4IFTA 5DPMA 5DLDA 3KZ1E 4Y6LA 1SNYA 4C4SA 1G4HA 3PE6A 3COWA 5ALWA 1IMOA 4UM7A 2W2VA 2W43A 2V96A 5CM9C 3UWOA 4TT3A 1OHHD 3RU2A 3FCUB 4COKA 3IMGA 1U80A 4ND4A 4CT4B 1UOQA 3QNWA 1XALA 3CJQA 3IEXA 3L4KA 1IK4A 3B13B 5ALQA 1FVXA 1PJBA 2Q4OA 3NTVA 4M1WA 4X0EA 3CF0A 1T5LA 4M49A 2QPTA 3MMXA 4Y9DA 5BSMA 1JTEA 3L84A 5YASA 4EPTA 3WX0A 1OFTA 1R66A 2VQEB 4IICA 1Q83A 5IBRA 4OXQA 1FDUA 5B3KA 3KYDB 3DE5X 2AN4A 5EE3A 3E5RA 1X1AA 3GLQA 2A84A 1XDDA 1ES9A 1BTOA 4MVJD 3DOHA 3UVEA 3VZDA 2J3DA 4QELA 3SM9A 1A77A 3SJAA 5CT4A 3ZX4A 5A4MS 3H6GA 2WK1A 5AVXA 2JGAA 3PNKA 4CDRA 4LXQA 1ZITA 1ILWA 5GAJA 3FAZA 4BP8A 3B1WA 4YLYA 2VCHA 1AMUA 1GUYA 4I81A 3EXG2 1T9DA 3IV7A 1PK9A 3WR5A 5AK3A 3R9KA 2O8NA 1KKMA 3L0ZA 1PR1A 1QC5A 3CR8A 3R5SA 1YSCA 3OPNA 3ZQKA 3HR7A 5EFZA 2OK7A 2Y1OA 5BSTA 3HDGA 4C5CA 1WZNA 3P9NA 3TRKA 2VTBB 4FM9A 5A3SA 3PGLA 4JR1A 5D00A 4BO2A 1OVGA 1F0NA 4BU1A 4YUXA 3F1LA 1Z6XA 3EJ6A 3UK7A 4K9KA 1G6KA 3VRHA 3B1XA 2Q0SA 5KJ6A 3MTJA 3WKDA 1J99A 3E3MA 1JTVA 3PNYA 1VJGA 1DC6A 3B2QA 1VMAA 2QL7A 1XZGA 1HDGO 4P4GA 1WEKA 3CG4A 2VLIA 5ER9A 5C8YF 4U6NA 1LF5A 4HNQA 4FDLA 3GUUA 3VR5A 2QHXA 4CMEC 4DGQA 2PVCA 4U0KA 4P7GA 3I1YA 1JWBB 1G21B 1YB6A 2VBGA 1SU7A 1LUAA 2XCLA 3KXLA 1RP7A 1Y9EA 2ZEJA 3QKSB 4N8EA 1KEUA 4P2GA 1EH5A 2IY8A 5HKKA 1MHPA 4OHBA 2ZCUA 4RZUA 3S1AB 3CW8X 3FUXA 4MAFA 1VLHA 1ZLYA 2Y1FA 1YNOA 2H92A 2QU8A 3GWZA 5U1PA 5CB0A 5DF1A 1ABBA 3JATA 2FPGA 3CA8A 4PLWA 4S3MA 3TIXB 5AVRA 1XWFA 4U2FA 1J97A 1M1YA 1G16A 2QUZA 4FYWA 4P0TA 1PJCA 3ZHBA 5A4JA 5LP1A 4FBLA 1NRJB 2ADOA 3W1EA 1VIDA 2B7LA 4F3KA 2B36A 2YHIA 3ILVA 2V7GA 4IYJA 1E1QD 4LZPA 3MJTA 3EVAA 5FQOA 4MQLA 4YS6A 5JC8A 2ZAYA 3JXEA 4BV2A 3RGWS 2QUIA 4D45A 1P9LA 4B5LA 1ZOOA 1DJQA 1TVKA 3WL7A 1EB8A 2EQBA 1ULAA 1UBSB 4RK0A 2XB6A 3K8QA 1UZUA 2HJ9A 3QPBA 1IHUA 2K2QB 4JX9A 4AP9A 4EW6A 4Z1MD 4HNRA 4BFXA 1U7PA 5TPZD 4F5YA 5IDWA 5CXUA 5F4BA 3OCJA 4J0IA 4GXTA 2ORVA 2Z5LA 4CEJB 5D7BA 3ITNA 3LH5A 5SY4A 3IDOA 2XTNA 3PC8C 4RLQA 4EA6A 6YASA 1MMFB 1EGHA 2BSQA 3W34A 2AXQA 3GG9A 4JD5A 1G7RA 2DU8A 1IJFA 4UHBA 3EPHA 1EB9A 2OL4A 2RHWA 4TWRA 2V74B 4OOFA 1JJ7A 1X1QA 4O4LA 3WISA 1AF4A 3L46A 4OA5A 5KYTA 1J70A 2DKOA 1V37A 2RGXA 3LRTA 1PYGA 1LX6A 1QRRA 3D8RA 1C0KA 3BJZA 5U4XA 4CIBA 2WJPA 4PN7A 1C1XB 1HUQA 2PRSA 4I4LA 2EGGA 4JKOA 4LWZA 5KAMA 2Z2ZA 5WRFA 4B7UA 5CG1A 1YI8A 3AC0A 2ORED 1KBQA 7MDHA 3NRBA 4QBHA 1U1FA 3PUZA 4MR7B 4ND8B 3VH1A 2PG3A 3MF4A 4FCVA 1HZZC 2JGJA 3W06A 3ZWPA 3HUFA 1L5HA 1JDNA 3AB7A 1VIVA 1ZN9A 2O06A 4OLFA 3N6VA 1HT2E 2Q1YA 1TRKA 2J3IA 2QT0A 5J2UB 2RIPA 3LBHA 4RPIA 3ROZA 3OC6A 1YJBA 5BQXA 1H4TA 3DV9A 3PRHA 5MF6A 2HU5A 3T1YB 4ZEVA 3EBOA 5JAZA 3T1NA 3SBDA 5JDIC 3JR3A 2RC6A 3LUBA 1TJPB 4QLOA 1PNOA 2BKLA 4JUCA 4YN3A 4RTOA 2QGFA 2PLFA 3HJAA 4P4TA 4B3RB 4MVJI 3O6VA 4EHBA 5SZIA 1C2YA 3L7MA 1CQJB 4K6FA 3B85A 5IUJC 4IS3A 1F4PA 4V0OA 1V5EA 2VPZA 1Y1TA 2CXSA 1DFHA 3NUGA 2BFMA 3BOSA 2FSUA 1ZOPA 2VT7A 1WMSA 4F4IA 5BW5A 1Z22A 4GP7A 3GFPA 1GQ2A 5M7EA 1J2JA 3BREA 4A27A 2ODWA 5KDOA 5IJZA 5TQ2A 1DIAA 1K1EA 4E07A 1EFVA 1ULBA 3NWEA 1FS6A 4BVKA 4DV1B 3FG9A 4MNTA 5ALDA 1HFKA 1M1NA 1ODCA 2WJZB 3EPLA 2GJ8A 5CH8A 2OGUA 4JZYA 3CRZA 2W2LD 1WDWB 3IRUA 3LNTA 4MR8B 3ZW7A 3N2YA 3T4EA 4JBXA 4M98A 3LC2O 5ECYA 4F04A 1L9XA 1LLUA 4AYTA 5HX7A 1RPTA 3HA7A 4QBKA 3H8JA 1VL2A 1T3TA 3KT3A 4A6XA 2ONCA 4UBJA 3IR5A 4A92A 1MENA 1ND5A 2BFEB 2LVBA 2R48A 5F5XA 2ZU0C 3IR6A 4L51A 3K5IA 4DSNA 1TM4E 3BD7A 3HCEA 4PZZA 3NFYA 4G5SA 1ULSA 4QUEA 4UZSA 3H75A 3HADA 1E6KA 2PSEA 1BHSA 2QAJA 3OQNA 3N86A 2JHCA 3LC7O 1XFAA 4NBRA 5F76A 1XX6A 2QMOA 3W05A 4DRXB 4F72A 3M34A 5KU7A 1JQJC 2OCDA 2OUIA 5BT9A 4PLYA 3WMEA 4KLZA 1A2KC 1WBJB 2M6RA 4EG0A 1I3MA 2BGTA 2WABA 4YJGB 4CQLB 3B6MA 2IS1A 4TYNA 1HYGA 1W49A 1YI1A 4CUKA 4DLNA 1U8YA 4WCFC 2I4IA 5LXTF 4PZ0A 4HLUA 1RWQA 4LTDA 2VJAA 3FFBA 4CVNA 1USKA 2VAPA 3HEMA 3VHLB 3INYA 1IHXA 3IQIX 4JUBA 3RFCA 3EQ2A 1OX4B 4KEAA 2VNAA 2YQ4A 1TUBA 4FFSA 4PAGA 1MV5A 1U11A 2PXHA 4KR6A 3TIFA 4IIJB 1XF9A 2YMQA 4N49A 1J5EB 3IUPA 4F9EA 1P2SA 1A69A 2D3WA 2GZSA 4NE2A 2BPOA 1VSUA 1SG6A 1GEGA 3AF3A 4R6XA 3T3OA 3N5KA 1VLMA 1ZZGA 4PFJA 4HDQB 3DLTA 1W8IA 3BF8A 3GZNA 2VK2A 4W5JA 3RRZA 2C4WA 5K6AC 4EGCB 3GT7A 4KO4S 2X0DA 5B55A 3GRVA 1Y89A 1Z45A 5AVWA 1EEHA 3H11B 2J9FB 5K6TA 1DQZA 4ZIRA 4UMEA 3FI0A 1FU7A 1I2MA 2PYDA 4H3SA 5HFAA 1OB2A 3D2LA 4HDKA 5JR3A 1UAAA 1DUVG 3BCRA 2GPSA 3VR2D 5EJ7A 4HDKB 4OY3A 4QUJA 4XPIB 5JZBA 4AECA 2XXAB 1J56A 3BGSA 3FKSA 4YO7A 3RC3A 2WQ7A 4H7IA 1P31A 3SLKA 2R1TB 5B37A 1ZOSA 3U0VA 4DCCA 5GWXA 4NK5A 3PR3A 4MB6A 3PFIA 3SIPA 3TLCA 4Q24A 5EVCA 3KHUA 4QGSA 1XXHA 3OCYA 1WTAA 3W8DA 2WM8A 4CL0A 1W96A 1EFTA 3O8CA 4A3SA 2OR3A 4PNEA 5K2MA 4WGFA 2ZM6B 5DULA 3KJIA 4O4IF 2YMPA 3OF2A 1ZEMA 4QXAA 2AUTA 5A5VA 5HTOA 4L22A 4NOLA 5EZYA 2R00A 2NXCA 4QU5A 1HDCA 4MPTA 3RIMA 3ZBTA 1NP6A 3DLAA 2LP4Y 3OQ1A 4KQ1A 4MZXA 2QROA 2NZXA 3VO2A 4DLBA 4BN4A 2ZPAA 2GVZC 2OZKA 1H2ZA 2WJVA 4P38A 4D7AA 4YRKA 4US2R 3FUWA 3ESQA 3HEAA 5FIUA 7ADHA 4RBNA 1MQ8B 1T3SA 4AZ0A 2QG6A 3RUAA 3N74A 4IH9A 3OCWA 2KHZA 5CYPA 3AUXA 3FOEC 4M8LA 3RYIA 1E1CA 2N46A 3R77A 4F84A 5GGYA 5DCUA 1FEZA 3MINB 1DJNA 5HCIA 1K0UA 5TJHA 2GTPA 1P2FA 5NULA 1Y1SA 5ALEA 5B64A 3E7XA 5CFNA 4LC1A 3HPRA 4UASA 4YWJA 3TQCA 2CL0X 1U9CA 3STXA 1QANA 3QFSA 4HDCA 4INZA 1YRAA 2KYRA 4BASA 2PPVA 4MR7A 3OJCA 3WZMA 5IT0A 1NBAA 1BXGB 5L7YA 1XVVA 3O8QA 4JLJA 2JIDA 4HMOA 5H02A 4CDGA 1YR8A 4C0XA 4B3MB 1E1RA 4ITUA 2YZGA 3CF2A 3L8FA 4ERNA 5JYDA 1ADYA 4Q6BA 1DLIA 5I7OA 2ENUA 2V9CA 1E9CA 4BRSA 3EY9A 3HCAA 4EG6A 2FPPA 4P5PA 1OI2A 4F4HA 3SQWA 1REQB 6ABPA 4I1UA 2H9YA 4X1YA 4JXXA 1SCQA 3UUFA 2HLNA 3PU6A 4Y2XA 4FB4A 1WDKA 1OPRA 1ZGGA 3BMQA 4IQGA 4BP1A 5I51A 3FYUB 2CEKA 2BFDA 3JD4A 4NBVA 2YY7A 4YT8A 4X94A 3ZVRA 2PZAA 5BMVA 5EKXA 4L57A 1D9XA 1TMYA 2B8NA 2Y1XA 4P1ZA 2C4HA 1IRIA 3MBKA 1E3TA 3NC1C 2O2SA 4H17A 1BG6A 3C3BA 3QM1A 4V2IA 4YJFB 1DINA 2BZSA 2C2XA 4UATA 3RT9A 1RHKA 3D6FA 1KSFX 5F73A 2HV9A 5G2OA 1E2LA 4DZZA 2R1UA 2AFIE 1UPAA 3CY6A 1XEAA 3ETLA 4D41A 3D5QA 4A23A 3R9XB 821PA 2W2TA 4AJOA 4P0QB 5GOZA 4YQFA 3HP1A 5ITWA 1F5SA 3D4OA 6PFKA 4NMHA 5EGSA 3O26A 2NT4A 2REOA 2PNFA 2EARA 2OZLA 3JVIA 1PRYA 4X20A 4D80A 1AIPA 5B1HA 5BVHA 2H59A 4RE6A 2AOUA 1CB7A 4RKWA 1MVNA 1YKGA 3EZNA 3OE7D 3G5TA 4HJRA 2ZZKA 3PVSA 1EFPA 1YL5A 4MP6A 3ZZTA 2J3QA 5E6RB 4NDNE 4UU8A 3TCKA 3II6X 1SKYE 3VDRA 5F5LA 1GQOA 1WZCA 1SIOA 2MSEB 1PSZA 4AJKA 3B6KA 4Q3OA 4EG5A 1DIGA 1LPPA 2GK3A 4ND3A 4QQ8A 4U7WA 2A1TR 1IYZA 4JP8A 3I3OA 3ZWKA 1CUZA 4IHJA 1ZUWA 4MR9B 1NUHA 2QYTA 3UW1A 1W9MA 2WF5A 4FU0A 5CPFA 2Y76A 5ESDA 4CKEB 3QBVA 4W8GA 1VMDA 2VOJA 4PVDA 1O58A 4EVQA 3A7DA 4XTCS 3UAOA 4PICA 1PKEA 3HP7A 1SUEA 2FG6C 1YOBA 2I2BA 3VQTA 2CMFA 5D6NA 4EB3A 2IS6A 2FEOA 2BZGA 2FR1A 2H3HA 2HJVA 5KI6A 4L8WB 3TRJA 2YHBA 2QJWA 2HX1A 1G8SA 1ISJA 1YL7A 3UCFA 3QG5A 1YKSA 4Q1AA 2PJDA 1LWNA 2R47A 3A7EA 3REFA 2QTGA 2ZDGA 2XUPA 3MS2A 4MS1A 4M6WA 2VDPB 4D8XA 1C8BA 3MXTA 1KTVA 3NJ4A 1Z47A 1GRVA 4MWCA 1KO4A 1R6UA 1D4AA 1U04A 2B0JA 4MVJG 3SJBA 5ADUS 5F2OA 2ZFUA 2C2KA 1JAHA 1KR2A 4AFNA 2XWBF 2IEDA 3LCVB 3PXEA 2QIOA 1EXNA 3SXJA 1Z08A 3TEMA 1SCBA 2PUCA 4X6LA 1GL7A 1VGQA 4HH3C 1RJWA 3GN2A 4RANA 4EEZA 1Z3CA 2O8DA 2RHBA 1PT5A 3U37A 1GRRA 2ZATA 3ONDA 2OMKA 1ZIPA 4OBWA 3U81A 3OM9A 4R1NA 4CV3A 4KIWA 4LK3A 4YA6A 3V1UA 1I1HA 3Q3VA 1QLHA 4BE9A 5C7YA 1J2TA 2QN9A 4AKSA 1BD3A 2AIRA 5JBNA 3KEGA 1OLOA 5FEMA 2VWGA 4F6CA 2AFHA 2OV6A 1K7SN 1UMBB 5BXYA 2PA0A 2IV7A 1GNSA 4EY4A 2X8BA 3A1WA 3AJ9A 3ZJ5A 1ZSYA 1I7PA 1HA3A 2WE8A 1YO6A 3WK5A 2FB9A 3FW1A 1AURA 5IMBA 1NNI1 1KJYA 1NOJA 3OJ0A 5JANA 1CUVA 1JHDA 3DOEA 3GQBB 3H8SA 3REQA 3OI7A 1FNSA 4F2HA 4BQEA 1PVDA 2FEMA 3LC1O 2C99A 4O2RA 1T8TA 3L1UA 1PN3A 2HIGA 2WTAA 1ZH6A 4HGPA 4PO8A 5DJ5A 4DA7A 3IKTA 1E3QA 3AHDA 5E2AA 3W6NA 2C5EA 2CUZA 2H1CA 3WJ7A 1KEPA 2XUAA 2QPAA 4IJUA 2JNWA 2YXNA 2VP2A 4U7GA 1DXOA 2C9MA 4WZAA 2EATA 1XDBA 5TPWB 3ET4A 3QF7A 3GLGE 1IN7A 2CXTA 2INGX 4OTZA 4TLEA 2H29A 5BXQC 2XA2A 1J06A 3STTA 4CLHA 4R1PA 1ZUIA 1R9MA 1VLJA 4WRRA 1MG5A 1L5KA 1MW8X 2AKYA 2J9YB 3PRJA 4KK3A 3EIQA 4MYTA 4NVRA 4KN8A 4MQEB 1BH2A 1LDGA 1QZUA 3LM8A 2XZPA 3CNNA 2Z4TA 2GYVA 2HJRA 4L78A 1JQBA 4CLXA 1OIVA 1W0JD 2IQIA 2QSYA 2XEXA 1JKFA 1W36D 1H2FA 3OUUA 1OH8A 4G8CA 4YQZA 3LQ2A 4MEAA 3S0JA 1T5IA 4AZSA 3ZQJA 1SKUA 1N57A 4JSYA 1KHHA 3CN9A 1RYZA 3AU9A 2WYUA 3OE7A 2XUKA 3DLIA 1KR5A 1SUAA 3FKJA 1FF9A 2AVNA 4MYUA 1HPLA 1LLDA 1E2DA 1MEOA 2FWRA 4Y1FA 5JCXA 1OXBB 1G7CA 1UM9B 1AH2A 4RHXA 3MERA 1GZ3A 1N75A 1NPDA 4REMA 2CJWB 3BJIC 2Q9UA 2R4TA 5J47A 1VRWA 1TEVA 1UDCA 1XDZA 4TYPA 1V8DA 3N3AC 3UANA 1SKQA 5CVVA 1WP4A 4WNIA 3LVFO 4PZPA 2PWYA 3AIOA 5TGDA 3DHVA 4FNAA 1PTKA 4GX5A 1DBRA 2WWRA 5G40A 1MO2A 1IDN1 4OMCA 2GZ1A 1ULZA 1XEXB 5F4ZA 5FWNA 2Z2JA 4YAWA 1HTWA 2Y9MB 3TRIA 1G8FA 2ZIWB 4PYQA 4ZAZA 2C07A 3HR4A 1ZHFA 1RXIA 4R1SA 5DWQA 2YWFA 3PXAA 3DE4X 2VZ8A 1GUAA 1E7RA 1BMQA 5JNLA 4XWWA 4NJEA 3N9IA 4B79A 5I7EA 3VUFA 3G9XA 2NPFA 3Q3EA 4JVOA 1K7XB 2J3HA 3FFAA 3G2LA 2E1PA 1X70A 2ZIZA 4HG2A 3GLGB 3QITA 3U3RA 1NNEA 1UAGA 2PSFA 1F5NA 4Z9FA 3ZX5A 5BN3A 2WJHA 2DWQA 4FYVA 5IAKA 3ZIAA 4OHFA 3FBWA 3A2KA 3IE0A 3TBKA 2XQIA 3WDKA 1C7JA 3OPQA 3SJUA 5JASA 1UQTA 3GFTA 4MGKR 1HE1C 1VCMA 3RC7A 3J80A 1YS7A 2IZ1A 2KWIA 4B1FA 4C22A 1XDSA 3HXOA 2R8EA 1ZO8A 1N8SA 2EL9A 2O20A 3GNQA 4MO9A 1QP4A 3JATB 1A7UA 2J3EA 2YVKA 4D5EA 2OORA 1KEEA 2G4LA 1HK7A 4MMZB 1XCBA 2TMYA 2XJ4A 5BUQA 2ZVPX 1X1BA 4XD7D 5JI2E 1C8LA 1UJNA 2AMVA 2OSVA 3OSZA 3ZV4A 1V6CA 4IDHA 3R5JA 2QN6A 1LSJA 4FLMA 3WRXC 9LDBA 1BWRA 2ZBRA 3MG9A 5GJWC 1XXHB 1OLXA 1IL0A 1YT5A 1O94C 4A03A 5JYCA 4ECEA 3ICEA 3GUVA 5IVDA 4FMDF 5AM4A 4EA8A 3F3YA 3CX7A 4XRRA 1FP2A 1Y9JA 1KPIA 4LMRA 1XTQA 4UVHA 4XM0A 5BQFA 1ID8A 1A2QA 3AR8A 2P4SA 2W6OA 3C3CA 1FRFS 1VIMA 3F1KA 5IM5A 4S35A 5SZKB 4XFDA 3D6MA 4L4XA 1KZHA 1ADBA 1F2TB 1QFMA 2Q2VA 2Z5GA 4BLWA 1K7FB 2EJVA 4XJVA 1IXKA 3WLRA 5K8VA 2O9JA 4CBVA 3I9V6 4MLZA 5KNDA 2C98A 4BNNA 2GBLA 1KEVA 1M1XB 4MW1A 1IUOA 1NVAA 2QG9A 4E3ZA 2VF7A 5K0FA 3RVOA 4TV8B 5LLSA 4XEUA 1V6SA 2NZVG 1FXWA 1XKXA 1C1DA 2CGEA 2QSJA 1VBFA 4Q9KA 4Z4HA 2RFLA 4XRGA 4LWQA 3AKEA 2BKEA 4XVQA 5HPYB 2ZSUA 1HE5A 2CK3D 2TYSB 2UZ1B 1V16B 5LP6C 3U13A 4XUDA 4XE5A 4BBAA 1LBHA 2GBCA 3NHRA 4P5EA 2II6A 4R2KA 3WNDA 4ED9A 1B93A 1LBTA 1Q77A 3C14C 1ZM7A 2BSXA 3C4QA 4EUSA 4EVSA 4ZI7A 5K03A 2WNHA 4BZQA 5IKOA 2GCPA 1G8MA 5AHRA 5K4HA 1NURA 1MW9X 3GLVA 3HBAA 4MUKA 1WDMA 5AKKA 2ZJ5A 2I4MA 2WTMA 3DV0A 5IPFA 2BP7B 4JI2B 4EGSA 4KI7A 4ATNA 4MRRA 1UKYA 5CFLA 4PYIA 3DBRA 1QG6A 2E9SA 5ICEA 3REQB 3UGTA 2FMFA 3STHA 1FFYA 4YMGA 5AKHA 2ZGVA 2Y0PA 5CDSA 3ND5A 2N9UA 1FXSA 3OFNA 3QIAA 1C3OB 4TUYA 4IUCS 1QZZA 2QE7D 2G09A 3P9RA 5IC4A 2MSNA 3CPSA 4LNUB 1ZMTA 2VEDA 3EXHA 7YASA 4HAYA 2MTBA 2HJSA 3HBFA 3IPAA 3IIJA 2ECKA 1P5ZB 3KJZA 4OI1A 3W2EA 5D85A 2IYYA 3H4VA 4U7DA 1QU3A 2IHUA 1ZIDA 3DHYA 4GSKA 4RESA 5LB2A 1LS6A 2I7DA 5DBFA 3SNKA 2WUWE 5LP6F 2CN1A 1JDVA 5LA6F 2DYKA 2QMEA 1TZBA 2QYHA 3U49A 3AHEA 3T52A 2FWPA 2H85A 4NABA 1ZCZA 1GFIA 3UK1A 5CCXA 1MTZA 3UOWA 3GLRA 4BVLA 1IPFA 1XELA 5DTJA 1ISMA 4NJMA 3FWNA 4IIJF 4ACAA 1ZHOA 2ZRJA 3B60A 5JCZA 4NJMB 1CJSA 2QAGA 2ZWAA 2FW1A 1JRLA 3OX3A 3K2BA 4WDQA 1J0BA 1FXUA 3EUAA 3JALB 4JYAB 2GBGA 1U63A 2I4RA 5KSOA 1RFLA 1X15A 4GMXA 1N3LA 2M2IA 2PX3A 1UOOA 3TPCA 4CJXA 4G4SO 2QW0X 5TS3A 2XKAA 1XNQB 2BV3A 1HNWB 1ZGBA 1GV1A 2DUJA 3H19A 4NZMA 1K8XB 5K6AA 1HI9A 2HA2A 4HZIA 3FSJX 1V3VA 4RD2A 2MU1A 2X1VA 3FYCA 4J1TA 1LI7A 1KZGB 4WBNF 3OY7A 2XF2A 3TUJC 4C4OA 1FYXA 1A97A 4TZ0A 3DPIA 3BHNA 1G3UA 1OWPA 2OFPA 2YOGA 1FDWA 4INJA 4XCQA 1CF4A 4J07A 3OZSA 5FNVB 1VRCA 2WKSA 1V39A 1XZ8A 2VXOA 3WK7A 3DZHA 4EITA 4EJSC 3P0RA 3B82A 4MVJF 3C98A 4EKYA 1KS9A 1DJOA 4OGWA 5JUWA 4UHCA 2YXPX 3BILA 3BTOA 5IXJA 2ZWVA 1QO9A 3I04M 4KRGA 5LQNA 1KI9A 1XZKA 1KWKA 2PFSA 3BDVA 3E22B 3EYWA 3L8HA 3FOCA 5GONA 1L5GB 3BC1A 4DLVA 4O4JB 3UMRA 4EK9A 4EFNA 1V2HE 2IITA 1EWRA 3HE3A 4ONEA 3H84A 2PV7A 1TLTA 1QHIA 1FTYA 2V6JA 3M9WA 2Y27A 1EA5A 3MUFA 4HLQB 1JJFA 2VJLA 4XZ3A 2FJUA 3SLGA 2E4WA 1M6EX 1W48A 2LPMA 2PE5A 4KXWA 1XHLA 2A5FA 4NPHA 3DF7A 1DKNA 4Z99A 1G21A 4W1PA 1QFSA 2Q29A 1T5HX 3QXXA 3AT1A 3KVOA 3T7SA 2A57A 5FOXA 5L4LA 1RLMA 4O3MA 2PSHA 2X0EA 1FW8A 2EFDB 3ICPA 4JT8A 4OIFA 2VN8A 3N2GB 2OXRA 2IF2A 1LV7A 2POCA 4DV2B 1UBTS 5KC9A 2HBRA 1Z5VA 3GBSA 3JVVA 2A1IA 3NOQA 4GYYA 3O93A 3U9TA 2BLNA 1IAQA 4ABTA 1CHNA 3PR1A 1RHMA 1P45A 1E2PA 1JG7A 3QWAA 3X2FA 1T8SA 3GRUA 1KDZA 3UCEA 1QIJA 4DDUA 3PIIA 3SZMA 2AEMA 4ZJPA 3AQIA 2PWPA 2DKFA 4XTRA 1BJTA 1RYNA 2BMWA 2NO5A 4AW9A 2V7XA 3I2FA 3ZWDA 4RH1A 4U7TB 1JJAA 1FFDA 5LKAA 2O52A 1EUCB 3D59A 3GVPA 3QHAA 3PJRA 1KXJA 1DX4A 3SCZA 1JFLA 5JSUA 1EX6A 2HA0A 3TO5A 1QP8A 2OOSA 5ICSA 2YWCA 3BFJA 1C9EA 4MUGA 3RROA 3RD5A 3G9QA 2A88A 1A9OA 4IGKA 1VHDA 2NX2A 3NBYC 5HIJA 3UN1A 3UMVA 1YIAA 4JJZA 4BNXA 3LC0A 3W5DA 2QQEA 3AF1A 3B2EA 4E2WA 3KDSE 1JHOA 2PBRA 5BV1A 1U98A 5CVTA 2I80A 1PYOA 2ATXA 4HNHA 1CZHA 2EJUA 1N6NA 2H4JA 2I62A 2GOYA 4IJ6A 4WLUA 4LXIA 1GPYA 1WHSA 3HGQA 2QLBA 1T36A 3LPDA 2CXRA 2ZUUA 3O2NA 8ADHA 2XIQA 1FFCA 3DS8A 5EJ8A 1DCFA 4ZMRA 4AAYA 1D1PA 3AR3A 2R7NA 4CMIA 3X1JA 4B2YA 5LQAA 1AE1A 1JEYA 2H16A 4YMLA 3PX2A 3TX2A 4RTLA 1HTBA 3A4YA 2P0AA 1EZ4A 1VZ3A 2Q1TA 2RGCA 4K28A 3OF5A 4X1OA 2P11A 4DIUA 3MCUA 1HT3A 1NQXA 3BEOA 4GDFA 2PJUA 1SQ0A 3GRRA 1LSOA 3A3NA 4WOCA 3C87A 2YNMA 3O4IA 4PZLA 3R7NA 3FWHA 1L3BA 2HFJA 3M1AA 1DE0A 1RYFA 4IG9A 3E7FA 2D7JA 2IZZA 4H7FA 5A06A 3OQIA 4HLNA 3VOAA 1RRGA 4Y6OA 1T9KA 1SQFA 3IEUA 5AVYA 3E7WA 5CCDA 1NXVA 5EZQA 2FPPB 1F4LA 3ZD9A 3IP8A 3WMGA 3DQQA 4NXNB 3E5HA 5FUQA 1CSEE 1W52X 2OT3B 2ES4A 3AK4A 8MHTA 3QVGB 4KR2A 4FCCA 4HWSA 4IIEA 4MQMA 3HBNA 1QH1B 1E5QA 2NVBA 3E0XA 4B3FX 4JB0A 2V4UA 1HE4A 4QUIA 5CA1A 2ZZNA 3K73O 3ZNQA 5SY6A 2QRGA 1E7SA 2PWBA 3ROFA 1GTZA 2LKCA 5JNSA 4BJ5A 4L02A 1ENZA 1MC1A 3MWEA 1XRMA 2NU9B 1RQNA 4ZTBA 5I5EA 1UADA 1PGOA 3EMDA 3AVPA 3VGPA 5DFAA 1XLUA 1J00A 3LLVA 3BERA 4HWOA 3OZIA 5E7MA 1DBQA 2QTAA 4DLRA 2J8ZA 1CY0A 4I1OA 4A1OA 1RP1A 3UGJA 5G4KB 4A73A 2GKSA 1N0WA 1KP3A 2GO1A 3HYRA 2HMAA 3M0EA 3QMPA 4ZXFA 3RASA 2MSKA 4QYXA 1QCDA 1SA0B 2VQ6A 2Z8YA 3DDSA 1EVEA 4HFJA 2OB1A 3UMCA 4PANA 3BD6A 5EYPA 5HS4A 2QTFA 2DTEA 3HCNA 3ZI0A 2OBNA 5DI9A 1ONPA 4H7PA 1NVDA 2EW2A 5E2BA 4CR8A 2QU7A 2WIFA 2AG5A 3WYDA 2VPIA 1NUTA 4W7IA 3U4GA 1PNRA 2Q27A 4EPVA 5HJ7A 4QM7A 1OI3A 4TKVA 1KIMA 4JVLA 3N2KA 1JR3E 1UPCA 2GHQA 2WE7A 1OLSA 4H1HA 2C0PA 4H27A 2B7CA 2AGVA 4P2BA 3VSCA 2J0EA 1CULC 4RVUA 2Z6VA 1JHVA 1PGJA 4N9QA 4CMEA 3VHRA 2I1WA 3PZBA 4R8LA 1X74A 1RJFA 3AVWA 3UK2A 1RJDA 5I8WA 1ORVA 2EZ8A 1LBEA 2PQ0A 1JP7A 1A2OA 4CEHB 2WHXA 2ZTHA 4H3HB 4XX1A 1DCKA 2VQ3A 4E5UA 3Q6NA 1MX5A 4TTIA 3UJCA 4EUFA 1XZNA 1BHJA 4RIFA 2JFNA 2VO1A 2Y99A 4NV3A 3CZAA 3KR9A 1FYDA 5FTMA 1C1YA 2ATCA 4A0QA 3U40A 3PFGA 3R09A 2P5YA 3K71B 1PG0A 3L7YA 4LE0A 5ALSA 1NL3A 1CQIA 1XCMA 4WGGA 2V6IA 1P0IA 2IUTA 2WDZA 3N6RA 3ORSA 5AK0A 3ZIDA 4B4OA 1CYEA 1AUPA 4MUYA 4PSUA 4TS1A 4W9MC 3SU8A 4EF6A 1KDPA 1NVVQ 1EIZA 1OOEA 3FUVA 4KJXA 4O2AA 4QQFA 5FQNA 2FDCA 1HFJA 2Q8NA 3LX4A 2W6NA 3ZH9B 4HYEA 4C2UA 1YUNA 5B7NA 4U1RA 1FMJA 1SAYA 3O94A 1WXWA 2JGDB 1NJ5A 3FCCA 3I8OA 4RIGA 4C7MA 2BI8A 1P6UA 3I73A 3JTEA 3PT9A 3BIFA 4OAOA 4OGGA 4YI3A 2IXGA 5DYIA 4KPUB 3GLUA 4B7ZA 1RWXA 4BX0A 5ICGA 4NOMA 1Z36A 4P80A 3V7WA 1TZCA 4X24A 3RKUA 3OT5A 4G63A 1WZEA 5KYYA 3MTDA 2PZMA 1FNDA 1QQ7A 3IEIA 3QLUA 4O5AA 3EGXB 2KBFA 3F67A 4XPIA 4Q02A 5EIXA 4D0NA 4GOOD 3EGXA 1NMQA 2A86A 5DLQC 3T9AA 4AG3A 4JI1B 4EBBA 2ATIA 4YDSA 4ALKA 1YOVB 4RUKA 4G2NA 5DTIA 3DLHA 2VDLB 4ZYVA 2RGEA 1CF2O 2XDAA 4D79A 1Z5NA 3ROGA 3JAMA 4I4CA 1EUCA 1PD0A 2GCGA 5K0LA 3V7NA 3WRWA 3H9GA 5BSVA 2R44A 4PHCA 1X8LA 1X2BA 3AY7A 2B3TA 3NOOA 4CXMA 1K5PA 3J81k 2ESRA 3LPNA 4LQDA 4A10A 3FSRA 2PL9A 1L4EA 2VNSA 2G0NA 1E8NA 5GIPE 1P77A 3TVYA 2X5KO 4MZDA 2WQZA 4BMOB 5FOTA 4S0XA 1J49A 1ORRA 3NG1A 3QF4A 2JCYA 2H48A 5HGXA 4Q6WA 2Q4TA 3AEKB 3O92A 2MINA 4C4YA 4EL5A 5JAMA 1KS2A 1R7RA 2DZDA 2ZBUA 4OQMA 1D9ZA 3TH5A 1JILA 9MHTA 1Q7TA 4XD2A 2OD7A 2IUYA 3KYDA 1G8HA 2PZEA 1UIRA 2DQ4A 1I7SB 1WMBA 4JFAA 3FNRA 3A6ZA 4K6KA 3OZFA 3SIRA 2JHFA 3BH0A 4M76B 5EOVA 3IVRA 3OZDA 4EW2A 3HUDA 1D6NA 1EE2A 3TK1A 1K5DA 5CT9A 1WCWA 2CL5A 1OCEA 4JB3A 2BISA 3FNQA 4YRTA 2GKOA 3LP8A 2MSDB 3ROMA 1PV2A 2ZB4A 4X3OA 4NEHB 3UICA 3VAZA 4DDHA 1JAZA 3H1TA 4BPBA 1GAXA 5GM1A 2W42A 2XKJE 2BGGA 3KELA 2I4NA 5JSHA 3ZU2A 1L4FA 1D4OA 4DXAA 4ALLA 4KR0A 2FFQA 3LVRE 3UWDA 3WLQA 3UMBA 1XQWA 2P8SA 4FZJA 4D2IA 1Q57A 1XCPA 5LBIA 3V34A 4TZ6A 3E9ZA 5A0VA 4QTUB 4TKLA 2V59A 4K9OA 1S8NA 4R6WA 3VNRA 3I62A 3OM8A 3KE8A 1BKSB 1ZWLA 2VK1A 4L8GA 1ST2A 4QIHA 3TAHA 4FC7A 3ZU4A 1VKZA 4HGOA 3HM2A 1FQKA 3BF7A 3W90A 5IDQA 1WLYA 3OFVA 3V4OA 3ZLJA 1JLLA 2PT7A 1A8QA 1CHDA 2VNHA 5CLLA 4YMSA 5H9WA 4AUKA 4K6HA 1TDJA 1UAYA 4QQKA 5C7IO 3CUTA 3JWJA 4TTVA 1A04A 4B4UA 1M8GA 1XNHA 3O9VA 2VWHA 4EPWA 2DC1A 4BDSA 4JQCA 2OYRA 4DCPA 1PT9A 2OV2A 3PNOA 4PZEA 1E2HA 1N3IA 2Z04A 1EFPB 2Z4RA 3ELWA 4MIYA 1O8BA 4W5OA 1P1RA 1FJXA 4NXMB 3OZWA 2HCTA 4Q0MA 4B8WA 5CFRA 3K6SB 3SF8B 4CNBA 2XVMA 4FNGA 4WE3A 2I6UA 1WDLA 3L0BA 2QJOA 3UAXA 3D1VA 4N8DA 3FPFA 2IW1A 1FUEA 4M46A 4XIIA 1MTOA 4BNFA 4MDFA 4KXUA 4Q4DA 4EH1A 2XNSA 4RE5A 1JNXX 3ZHXA 1SZDA 2ID7A 1LDMA 1MCZA 1KYXA 4ZVLA 5HG0A 1Q1BA 4XQ9A 1GTRA 3X0DA 1NG1A 3OLCX 1D1TA 1K92A 1QS0B 2P8JA 3QPDA 2NU7A 3DOCA 4GPAA 1F0KA 2ETXA 4OSEA 4WOBA 2HSDA 4H15A 2GZMA 4OXXA 4C3OB 4PG7A 1WCV1 4BAGA 1R8SA 4KGXA 4W1QA 1B0AA 4Y9RA 1CNMA 5BQOA 3EVDA 1E3DA 1QVZA 2QNBA 1GCUA 4H60A 2HJHA 3SDSA 4FWBA 3SQLA 4FGWA 3AFOA 1QRUA 1QMPA 2DPYA 1GAWA 2I91A 5KTKA 3ECAA 1GN8A 1U5BA 1K6MA 2JD1A 3DMTA 1CEYA 3PXXA 1EVZA 2IEIA 2GN6A 3IYLW 5IBCA 5ITZB 2AJCA 1ST3A 3Q40A 3EZLA 2ZJZA 1MPXA 3SX4A 2PL3A 1V11B 4ZCTA 1A7JA 3M3PA 1IY2A 3KKMA 4RLSA 1XFDA 4Z4FA 2VPWA 1Z18A 1IN1A 3H2SA 2Y68A 1RAEA 3TUIC 1XCJA 3HY3A 2GN4A 4O2BF 1S7GA 5C1BA 5MGBA 2PZLA 4YRFA 4G0ZA 1C3VA 2IPXA 3MGCA 5CLIA 2XUFA 3UK0A 1JI3A 2FXVA 4TGLA 2JPDA 1NE2A 2RI1A 3UV7A 4HC4A 1F2DA 1NY6A 3SX0A 4R1MA 1Y4DE 1UMBA 1TZJA 5J2TB 1S2LA 1HYHA 3KL2A 4JOBA 1DDOA 1P0PA 2J3JA 4YUZA 1U9ZA 2ZWMA 3MQFA 1Z2PX 4E1AA 4DV7B 2A58A 4UVGA 3T9BA 2FWMX 4FZ3A 4MLDA 1BS1A 1QVRA 2H2IA 3I42A 1Q74A 4E5PA 3TQOA 4XAQA 2MR5A 2FX2A 2ZRHA 4FR5A 2WG2A 5IKPA 1HNXB 2EYUA 4CL8A 1WXIA 4TXMA 4PX9A 3M5WA 3V9AA 3D6AA 3RJ9A 3O4HA 1QH9A 2ZBQA 2XDWA 2N0SA 1RIFA 2GBPA 2PGOA 2JCVA 1P9WA 1G6Q1 3GXBA 1EU1A 2OHOA 1ENOA 3OIDA 3WGVA 1PZGA 1A8SA 2FP3A 3HHEA 3KR1A 4L07A 3M6VA 3NKLA 4WXYB 3WJ2A 1P5FA 2R1VB 3OMWA 2CXHA 3RS0A 4BKQA 4M9CA 1BS2A 3WYAA 4BFLA 3B70A 4TX1A 1FB5A 3TVIA 1WZ2A 3IURA 4PLCA 4RSRA 3R1IA 4WZBE 3RADC 4HGZA 2QLLA 1QFJA 4FYYA 4RORA 4Y1GA 2VCEA 3HDQA 3X1ZA 2F62A 3WHIA 4EQ6B 1LK5A 2JK0A 3RQSA 4O4JF 4A0HA 1EDZA 3EDMA 3MELA 4RQBA 2QAGB 4WY2A 3DUFA 2PWAA 2XAUA 3G7NA 2CZGA 3LUFA 1A27A 4F2PA 2HDNB 4YCMA 5JY6A 1ZMOA 5I4KA 1ODKA 2HBZA 1S9DA 5KHOC 1FUUA 3JY6A 4YP5A 1PBTA 3HXLA 5BR1A 3R0QA 3SBOA 5LZ4A 3WGIA 4DA9A 1WW8A 4KQEA 3FMIA 3T3GA 2VTVA 2E3JA 1SQSA 1A3CA 1IOZA 3DR3A 4AKTA 2VLBA 2R4QA 1C41A 1XCOA 3KFLA 5F1OA 1ZI9A 2V5AA 5SICE 3BH7A 1H6BA 1VRVA 1OLSB 3R8XA 1FDIA 5EIFA 4F71A 1CR6A 5FPYA 5ALLA 4L0DA 3AHFA 1F8YA 4YJ3B 3V8VA 1X7WB 2H5LA 5AHWA 3MWJA 3M7IA 1A8UA 3H8VA 2AMYA 5I4BA 2B99A 2YVLA 2OAEA 2ATEA 2F1JA 2JH3A 3HRIA 4B31A 4IIXA 3HL0A 5IYZA 4Q7JB 1PT7A 1J90A 3GT4A 4LY3A 1Q12A 1PYDA 2EEZA 4GM4A 3E3OA 5DE3A 5A4AA 5EA2A 3BN3A 2O05A 3UKJA 5CVCA 1VSTA 1BHO1 1Y3AA 4B8YA 3MNFA 5AKJA 4YUYA 5KTOA 2OHJA 2P5SA 1UQRA 4FLFA 2GHRA 2CVOA 2XADA 1KH2A 1EHCA 3LOUA 4UOZA 5KO2A 3P7MA 2QV7A 1K97A 1XHFA 4P93A 2IOQA 1WXXA 4F93B 4KO3S 2VJOA 5EMNA 3GLHE 4KXLA 1XDUA 1TQHA 1KO8A 1ZUHA 2WD9A 3FRHA 1U65A 2HHCA 3JQAD 2B92A 4V3BA 2NAFA 3AWIA 5L3ZA 2I3BA 3LY9A 4WADA 5G53C 3DLPX 4OBBA 5REQB 4BO5A 5E4TA 1YS4A 1XC7A 4PG4A 4TVOA 1L4LA 1MRNA 1VLVA 2OFOA 2FPSA 2NZ2A 2IPMA 3I4CA 1FQJA 1OIWA 1ORIA 2WAXA 2KLBA 5EP3A 3UK6A 5I9NA 5JT1A 4GM0A 1JPJA 5JYBA 1BDJA 2BDEA 3WNQA 1M0SA 1PFYA 1XEFA 2BBSA 5TX7A 3RLIA 4KR9A 2BEVA 2G9RA 2QQGA 1E9AA 2WA2A 3FTPA 2R8ZA 1D8AA 3GAZA 2R8PA 3K05A 4XQ0A 2QZSA 2VHVA 1KYTA 2ZUTA 2Y3IA 1A9RA 2P62A 4FFBB 2QE6A 5KYYB 1W9HA 2C9BA 3ROPA 2IDMA 2RGGA 5EXTA 4KE6A 1BCSB 3BE6A 4S1VA 4HUJA 3CIFA 4AY2A 2IE0A 1G9TA 1MOZA 3S3TA 1NSFA 2FN9A 1LNQA 1B1AA 1T6ZA 1VPEA 4HQLA 4RQTA 4ZDIA 1N33B 4WKPA 1NKTA 3ER6A 4RCZA 5G02A 3HNOA 4Z4IA 1X1RA 2QD2A 4KMRA 3TMAA 1A96A 1RWKA 2OQIA 1KP2A 2W5UA 1TM3E 5EUBA 1CDOA 4U7PB 3SHVA 5B3LA 1V5WA 2ZYSA 5EE9A 5FBKA 3TZEA 4YAOA 4N03A 4QNRA 3WBJA 2IVZA 2J6HA 5C2JB 1O7JA 4JV5B 1E1DA 3OEYA 5UKDA 4XVCA 3A04A 3OEHA 1Q21A 2QSZA 5KYNA 3P9XA 1G2PA 1LF0A 2VJYA 3AFGA 3M6AA 4R81A 4R05A 5ECGC 5FYQA 4KUGA 1KYWA 1U3FA 2GXSA 4AS1A 4LJYA 2FQXA 2AOXA 5DEOA 3LD9A 5EZYF 3AFHA 3E9RA 4ZP1A 4PLGA 4Y9SA 5ETJA 1HGXA 2ZYUX 4TMVA 1HDXA 3BFKA 1R6BX 1G5IA 5ILOA 3M1IA 3OZAA 1P19A 4QDZA 3BRCA 4G4GA 2QP4A 3TCXB 1WG8A 3V9PA 4ZYLA 1CQPA 3QFTA 3KSRA 3KD2A 2WVGA 4M9QA 1GZHB 4NI5A 4US1R 5EMHA 1QK3A 3Q8KA 4AY6A 4ZOCA 3WK8A 1C1XA 3Q3GE 3ZHVA 2X9LA 5T3YA 3ESRA 3R7WB 3RSGA 4CKWB 2XMSA 1F7VA 1DWPA 4JGGA 1Q0SA 2BHTA 4MWTA 4BUJA 4AMGA 3FIUA 1AA9A 3QTLA 4Z86A 3FH0A 1YQWA 4TYMA 5FXMA 5CHYA 1C4OA 1NJ8A 3K9QO 1SUBA 2QAGC 4L0CA 5A3RA 1O96A 3PDIA 5CVDA 2DR0A 4QVIA 2FE1A 1WL8A 2F00A 2QN3A 1G63A 1PL7A 1TCAA 4IL5A 4KQGA 4CKBB 4AKHA 4CKBA 2EWWA 2FZKA 2J3KA 1WD7A 1TRHA 1N5RA 4L3WA 5ANRB 5IDVA 2GCIA 1GZ4A 5KYUA 4CETA 4WFKA 3QSYA 4QG3A 2P4EA 3RS2A 2JGMA 1B42A 3IQHX 4ZJUA 4O1IA 4DXHA 3WWEA 3EGIA 3KTDA 3WLHA 4TWIA 3DF9A 5LZ2A 1CZNA 3H05A 2VNJA 4QBGB 3AMVA 4M7PA 4PZAA 5EWJA 3U4MA 3FMFA 4XUEA 3B1VA 2QRVA 4MGHA 1ZMRA 3HXQA 3FJYA 3AZQA 3V2HA 2FV8A 1WUHS 2FUG1 3ABIA 8OHMA 3H1GA 2GK6A 5AKLA 2QB5A 4ZU6X 2ZUSA 3HO1A 2CZQA 2G71A 1IJKA 1QHGA 1QX3A 2XX3A 3H9JA 3NW9A 1XMJA 2MSCB 2O23A 5DO9A 5A0FA 4QKQA 3GJRA 2R6DA 4N41A 1AKQA 2K87A 3NHYA 3ZDYB 2G88A 2GMWA 3EG9B 2QLJA 3R23A 4PFKA 1G5FA 2AMLA 5CYOA 4D02A 2B8WA 3AFMA 1EXVA 3KKEA 3ZCSA 3FTNA 2YZ2A 3HA2A 2LXNA 3SQDA 5E6UA 4O4HF 3U1TA 2P3OA 1LQ2A 3CEJA 4KMMA 3TOXA 1VPTA 4NH4A 4GR9A 3ZKWB 2AOVA 4HQKA 1AS0A 1Z5UA 3ILHA 4E2XA 3FB4A 2AZXA 3IS3A 5BMOA 2JVIA 2TRSB 4CTOA 3L40A 4AJLA 4CKZA 2IKSA 3NH6A 4B0PA 4WBNB 4CM9D 1I4EB 3JCZA 1X9IA 2O1XA 3K2EA 1C9DB 4OSOA 4EHLA 3UWPA 1H5QA 3WBFA 4P58A 1IONA 3F6PA 4YP0A 4K9DA 2YW2A 3SEAA 1KVSA 5A9SB 4W8HA 4C7VA 3P9PA 1CR2A 1SUPA 2IC5A 5A9SA 5CB6A 3I12A 4GXRA 5JMTA 3PTLA 2OUKA 3E8XA 3GLFE 3DEKA 2DULA 3UXEA 3VR6A 4BWFB 2HBQA 1QHYA 3KEFA 5P21A 3IKVA 1OLUA 4HB2A 4K26A 3VOTA 1LX7A 2CMKA 1H3EA 2IU6A 3EXFA 4JYCA 3LNCA 3GFGA 2MYPA 3SSMA 1SU6A 3HN6A 1QU2A 3Q0TA 1TUBB 1P3DA 3FDIA 4IRMA 4CI0B 5GONB 3D8NA 3W3AA 2JK1A 1K7YA 1I10A 1KK2A 5GONF 3GU3A 5SY9A 5CNMA 3VGJA 1W19A 5G4KA 1P6QA 3CPHA 4C04A 4RMHA 3W7BA 3CRRA 2IH2A 3IQZA 1KQOA 1X92A 2FPIB 2FA9A 3SLRA 1OV6A 3IMEA 4MW7A 4JGBA 3HYTA 4BRWA 1ZZEA 1GPDG 3GF4A 1TZ2A 3OX1A 3QBTA 3QU4A 5BSWA 5HF5A 3TTUA 2BKAA 1JHYA 2J9GA 1SZJG 3TR5A 1VMEA 2CVFA 2BZ0A 3FZGA 4PYMA 1Q3KA 2GXQA 4LMPA 3KZNA 5FUWA 1IJBA 1HFEL 4EVRA 3DOFA 1SKAA 4D4LA 5CB4A 5J2TF 1Z37A 4N5NA 1TYAE 2ZJ3A 3QEMA 4F9FA 3UA4A 4G36A 3MGGA 1RXYA 3C6MA 3L6BA 3RE1A 5AIBA 3CPJB 3KT6A 2CLFB 1EFCA 1RMTA 4GT1A 1RHRA 3PUXA 2NT3A 3HYCA 4IEIA 4QXPA 2UKDA 2DWPA 2QVCA 3SM3A 3RHSA 1B7GO 1OH7A 2DBYA 3A3PA 4IV8A 1BVHA 4P98A 1G2IA 1TKRA 2A92A 5JZOA 5K3OA 1Q15A 4IIVA 3RBXA 1GEEA 1WCXA 1QGUA 4FEEA 3W6PA 5I7UA 2WKPA 3JQBC 4GYWA 2PQ2A 1H2EA 5IJ9B 4C0WA 2O8FA 1ZC4A 2N42A 3HVHA 4B74A 3E61A 2IW3A 4DLPA 1TQ6A 2R79A 4D9BA 2ZRCA 3OIGA 4EHIA 3CJRA 5IJ0A 2Q6IA 3PQ4A 5I9SA 2M6SA 1GU7A 1Y3IA 2P4QA 4JJAA 2GRUA 1GTSA 2J5BA 1Z5OA 2RG1A 3FM9A 4LCEA 3ZLTA 5KOJA 1L4KA 4JBLA 3OTIA 1EKXA 1ODTC 1P2BA 4C7BA 2O3QA 2JGFA 4ECAA 2WMOB 4RENA 4I6GA 1IQPA 3F47A 3VH4A 5C5IA 1Z17A 5IF9A 2BGWA 3HACA 4PIPA 3BT7A 3A6KA 3JPYA 4A8JA 4HDRA 4RD4A 5B30A 1NTRA 2NVWA 4K0KB 3OD1A 4P86A 3FZEA 3GBPA 3KYIB 4OFXA 4Q34A 2DUUA 4XM1A 5K01A 1APBA 3TAXA 2VDKB 2QQ0A 3GRZA 5CIWA 9ABPA 3TVTA 1VE9A 3DQPA 4FFDA 2XYHA 4CWAA 3U4HA 1R0LA 3R6LA 1X7DA 2I34A 4GUAA 4OYLA 4P81A 4YQYA 2AFIB 2D4HA 1GZUA 2ICAA 2PK3A 3GLIB 2JLYA 4H4DA 1EHYA 4RYDA 3ND9A 5HMLA 3GLSA 1TOAA 4HNVA 1W30A 3ZOZA 1R6TA 1SVSA 3I09A 4HH4A 3I9LA 3ZWXA 3ZJVA 2R6R1 1OJLA 3GUYA 4GC9A 4OLAA 1J1IA 2VAXA 3CNEA 1D1SA 3FSGA 4OK3A 1E98A 5AVQA 3KSZO 4V1CI 1RHQA 1DC3A 1ND6A 2VSFA 1SXJD 1ZJ5A 4V0SA 2XB9A 3KSUA 2X86A 4ZV7A 4LXUA 2JJ2D 3CPEA 2WVJA 3QRWA 1Y5NA 4E14A 3ANNA 1VTKA 5CA1B 4CF6A 2PNJA 5CPBA 1KFEB 3ABQB 3DDHA 4JP3A 5KHAA 5LYYA 3H5TA 5FOUA 1YU9A 5KJCA 1U2GA 2DEUA 3U4CA 5D8DA 3NMUF 3CLHA 4RZ2A 1QCYA 3BQ9A 5REQA 1PNTA 5DM1A 4E1BA 2D7CA 3NWBA 2FP4B 1ILEA 1R4NB 2WSSA 5MFPA 4KLCA 4UM9B 2Q2OA 2GFHA 3KIPA 4GGOA 4PV7A 1F2UA 2JLQA 2Q1XA 2J9FA 2DVMA 2A14A 3QUCA 3VMFA 3MRVA 4TKZA 2A33A 3CTPA 3HDVA 5JAUA 2V0CA 1UBNA 2FSVA 1G3MA 4GKJB 1HQCA 4Q1VA 5JS6A 3KXIA 3RU7A 2IYOA 2AZMA 1Y1QA 2EP5A 2I76A 1BMTA 1MU0A 2YJNA 3FTQA 2FOLA 5B53A 4LHXA 1EZ1A 5AESA 3RJZA 2V4MA 1MORA 1FJHA 2NTEA 4W9NC 1UBKS 2PMEA 4URYR 1XZJA 4D9NA 1JE1A 3RVNA 3A32A 4ODIA 2W90A 4J0HA 3RANA 4UDYX 3EVFA 3VC3A 3ADDA 4AXBA 4LZWA 3G17A 4XUCA 3C6XA 5I01A 2GFIA 3KPYA 4PXSA 1Z63A 2ZBGA 2F9FA 3IBGA 3OZGA 3C1OA 5DNUA 3BZBA 3KZMA 4EUEA 3OJFA 5EIOA 1JFFA 2VF2A 2E4YA 4XGNA 1CC1S 2PMKA 2FJPA 3HLKA 4JN6B 4HDSA 5DI3B 1WCIA 4MUBA 3OTOB 3NU1A 1WCIB 4EFKA 1QIHA 2WFZA 1GGJA 1I6LA 4RJJA 3PNMA 1XBTA 5GGXA 3PWSA 3F5QA 1WNFA 1FRNA 1XO1A 2F8LA 2H0RA 2PSJA 3BD8A 2O8VA 4G84A 3EDOA 1AQJA 1LXCA 1X80A 1QYVA 2X8WA 4ZOBA 5JADA 3DC2A 3F6BX 4NNOA 3GZ4A 4MYSA 4ZO8A 1CZOA 2FSSA 2NUTA 1U0TA 4LRYA 3E27A 3OE5A 4DSUA 1GADO 1A71A 3TBFA 2V3WA 2JRCA 3TS1A 4E70A 2DUNA 3EASA 5C80A 5GPBA 1H66A 2ZYAA 1AQYA 3DL0A 4CIXA 3PHJA 5GZ1A 1NP7A 3ETDA 3GCZA 3O7WA 4HLCA 4E03A 4L4YA 2IOYA 4HK4A 4KACA 4ND5A 2BFCA 2H4WA 3GGSA 1K4MA 1PTJC 2NM0A 5D2CA 1H6CA 2DR3A 3IV9A 3QWIA 1IVYA 5DM60 3T7TA 1IQ0A 2LE0A 4E94A 3CX3A 1UP4A 4RFLA 3T12A 3ITDA 4CF4A 1X1CA 5JMPA 3FMPB 5JNUA 4DM4A 3INTA 3S5JA 4YPVA 3CVVA 2FRDA 3HDTA 2C7QA 4JASB 3E82A 5E7QA 4J6EA 1DC5A 5HILA 2QTLA 1XQYA 1TPZA 4EB0A 3GPIA 4MI1A 4NYMR 2QYOA 3OQHA 3OFSA 4PPGA 1M73E 5IJAA 2QMHA 4BWYA 2WPDA 4LBYA 3RC9A 1Y3CE 2G67A 4R2IA 1N9GB 1ZESA 1IM8A 2YWBA 1XQVA 1N0UA 4FQ8A 5DNEA 5LDGA 2F43B 3DTVD 4PR0A 1D6MA 4WUVA 3RFTA 3WLOA 3QA3E 4KIJA 3W8FA 5M2QA 4W5QA 4OFBA 3DZIA 2ZSKA 3KYCA 3UUWA 1A9YA 1RLJA 2FHSA 2GWHA 2JLSA 4ZXPA 3R6GA 2B3DA 5EP4A 3R4CA 5KYKA 4HGQA 1VJ1A 2ZT5A 4F86A 1INLA 1PVVA 3RJTA 1R6VA 4EHJA 5HQJA 2ZRGA 3A6JA 3O2JA 2QTZA 1ECFA 1ZISA 4D57A 1P33A 4N0PA 1I8TA 1TCUA 3QYJA 4M36A 5J5VA 2WIKA 5ERGB 1TO6A 1XAGA 5KOIA 3RJMA 3ECSA 3PENA 2HUNA 4G5FA 2BEJA 4MRAA 1E7MA 1MGPA 2XCQA 2VHXA 3K1AB 4OPMA 5ECWA 3PGMA 1T6YA 1VGVA 2LDBA 1AM4D 2R00C 3GD5A 3KR2A 4N82A 3E05A 4N1AA 4PTZA 4WSOA 4Y2UA 3TPFA 3ZVKA 3EJWA 2OWEA 4PGGA 2UYYA 2P3LA 2ZVDA 1T1JA 1DRUA 1FTGA 1RKUA 3KVVA 3SZOA 3PSAA 5KJ1A 1P4RA 1GIAA 3LTNC 1R8YA 2CUTA 1YRQA 4GLBA 1LKZA 3C8DA 2FAXA 3RVJA 1KWGA 3NS7A 5JJCA 1FBNA 2O50A 2BBOA 2JJ2A 3AKDA 2ZR8A 3CN7A 3FWPA 4MV7A 3NO4A 1Z38A 2WD7B 3MCWA 4OUDB 5EL0A 4LMBA 5JWHA 2AZDA 2A4MA 5HZHA 3M4NA 1KFBB 2G5PA 3OMXA 2R65A 5DBIA 2MWMA 4KOAA 3G0CA 4BEVA 4KQXA 4TMXA 4X91A 4Q3CA 4ENQA 5KYWA 4LAFA 2R4UA 3JQAB 4NQRA 2GHIA 2B1JA 5CXQA 1M2GA 1M2WA 1UBOS 3B5EA 1S01A 1KKUA 1DP4A 4EWLA 4K5QA 1NW7A 1NBME 3LE8A 4LKRA 1UM8A 5DSTA 1MQAA 4XH9B 3PJDA 3MWYW 1P74A 4P83A 4WPGA 1DDIA 1YVDA 3MGKA 4LE2A 2NSHA 1ZAKA 1JHXA 3N70A 3V7UA 4ZV9A 1LJ8A 5B7GA 5AVJA 1PHRA 3LT0A 5AVVA 1N2CA 1RI2A 4DHEA 1X1EA 3ND7A 3U6BA 2AHRA 2C2WA 3ELDA 2VHEA 3JSXA 1QDLB 4YV0A 1UFVA 5G1OA 4L9SA 2EP7A 2GNAA 1TB4A 4LDQA 5E0KB 3TOCA 5FWYB 3GV0A 4Z3DA 3AIMA 3RLFA 3QEMB 4R3WA 1S1MA 4PWYA 2J7KA 3H5IA 3LBFA 2R1TA 1Z62A 5B7QA 2A94A 4CW7A 4EGFA 1TFUA 3K5HA 5JAPA 1KAEA 2QPOA 3VBEA 3KB8A 4AO8A 5A5EA 1Y3HA 2BM8A 3EQ9A 2GM3A 2JI8A 4QEDA 2CNOA 3OA0A 4IOJA 5FBRB 1ZVVA 1D5CA 4IDEA 5AUQA 2AKEA 4U2CA 3LW8A 1UMDA 4X84A 1XTZA 2HF9A 4BNUA 5JU6A 5D6OA 1CIJA 1K98A 1Y7PA 4JSTA 2WKQA 3AF4A 3MTBA 1C1HA 1FTQA 2R8RA 3EXEA 5ECDA 2ZYVX 4LDRA 5GJCA 3RHZA 1C30B 4KLNA 4JITA 2WSIA 1JVSA 4Y6QA 3OICA 4L9RA 1YAJA 1H4QA 2X5XA 1CQZA 2GXUA 4N0DA 3RO7A 3ZBPA 4AKGA 4LRSB 4CMGA 1BKDR 2D5LA 4XSVA 3K70D 1EK5A 1F9EA 1ML4A 1OWOA 2I6QA 2Y9PB 3QJYA 4M0CA 2E5LB 1DJLA 1JAYA 2QBYA 4CCYB 4DADA 2MINB 1TX4B 3FTCA 4J91A 4O4LB 1RXVA 1E79D 2AJTA 3I04A 5KVSA 3ZVMA 1ZVJA 1PUXA 3E9MA 3OURA 3GT0A 1DUIA 1OSNA 1SHJA 3G9ZA 1UP6A 4LXXA 4M99A 3RC1A 3K0HA 1EJ6A 2Q5EA 1E2KA 3GLTA 2BEWA 4HXGA 4MXDA 2AR7A 4KDEA 2YUTA 2A78A 1B2LA 3K0KA 4JR0A 4OJKA 3C5VA 4P82A 4C89A 4XFJA 5MHTA 2NZWA 4I1PA 3AP3A 2CV2A 2VPTA 1FDSA 4FMDB 2CF6A 5BSFA 2NO6A 1ZNZA 3H6HA 1ZM9A 4KQMA 1YJ8A 1DT3A 2ON6A 4J3FA 4ME6A 1Y1KE 4R7TA 1G3IA 5AM0A 1N4AA 3W2IA 4AJJA 4AZ3B 1SC3A 4ZN6A 3D0RA 4DBVO 3G2OA 1M7GA 5JYEA 2XF8A 3R7SA 1R64A 1KYVA 3OQIB 3PDIB 2FG5A 4YO8A 1LW6E 3CW2A 4I46A 3NB0A 4MKHA 2QTWB 4CRWB 4URHA 3C1NA 3TSCA 4D3XA 4IDBA 4X7BA 5KVVA 2UUBB 3EIEA 4Z2AA 1LH0A 3SMVA 3RT7A 4A36A 4F4CA 4ZVUA 2P35A 3WDSA 4WXMA 2Z1NA 4PC1A 1NULA 5KWSA 5EHIA 3H9QA 5EQTA 4Y6RA 2VK8A 1P9OA 3ADKA 4O33A 3X1DA 4BJ1A 4LBZA 1G59A 3B2NA 2O4UX 3BSYA 2H2FA 1D8TA 1ZQ9A 5BW8A 3VR0A 2C04A 2JFBA 4G24A 1YGPA 4NG5A 2CBGA 1WBBA 4K9NA 2IUUA 3F9CA 4Y18A 3WMWA 3E9QA 4JI4B 3EGOA 5EP1A 1Q0QA 1ZK3A 1H2WA 1HNNA 1KARA 1SHZA 4JNKA 4PYKA 4YAJA 1HY3A 4YUWA 3FGZA 5BSHA 3R3HA 2X8JB 3ISVA 3NNDA 5FWAA 4KO8A 1RAHA 5K3BA 2WSMA 3NWOA 2CY0A 3TKAA 4IQFA 1RJEA 3PDCA 1N6IA 3WGLA 3T5TA 1B14A 4A15A 3B1JA 3TNYA 3PDHA 2Q28A 2YICA 3KHSA 4NFSA 2JARA 1N34B 3WNZA 1IK6A 5I7HA 3G6KA 1YS6A 4P4LA 3K70B 1YNSA 1JH8A 4M0PA 2W6IA 3IILA 3IDFA 2XGOA 1VIYA 5JS1A 4BB9A 1JXOA 2D1FA 2PU7A 1IB6A 4D9JA 3PQFA 4RDIA 4G2TA 4RPCA 2O7VA 3WL3A 1M9NA 1QCCA 1USVA 2K6GA 4DC1A 1Z4JA 4CTNA 4EJFA 4L4UA 3A4NA 4G8DA 3JS5A 1IZ0A 4U6QA 1JSZA 4ETIA 5EMKA 2WINI 2W8BB 2WIBA 4C4PA 4HDOB 1C80A 2RHTA 1XEWX 3UGKA 1M2VB 1WETA 4QLBA 1Q1EA 2BJHA 2HSJA 3N7UA 3RTGA 4UAGA 4N3BA 3FGPA 4G5GA 1ZLXA 4NBKA 1SC9A 1U5BB 1X77A 2PAAA 4J7AA 1DO2A 2HMUA 3VNSA 3ZHZA 1UKCA 3BRSA 4CIDA 1R4MB 1BN7A 3OQOA 3ZY4A 3ILSA 4CMHA 5IRCD 1B00A 2HA3A 1W4ZA 4DMRA 4BY9E 1A5AB 1O5TA 5FI1B 2HK6A 3HBLA 3X1WA 1H9AA 4AROA 4B6GA 1OF1A 3SY8A 2O4CA 4S0ZA 4X45A 2JDID 1R0WA 1OXTA 2QX4A 1JU4A 3K15A 2KSQA 4FDAA 2XLBA 2F1IA 2YZ7A 5LBUA 2OECA 2Q4EA 4QJ5A 4PZCA 4FYKA 4CM6A 5MFZA 1P1HA 3V42A 2UZ1A 4YPFA 1R0XA 1HOTA 3EHDA 3UT0A 4FT2A 3HA5A 4RV9A 4I5EA 5DYTA 3KE9A 4JOQA 4DMFA 4EG4A 3Q11A 5KB3A 3TPZA 2I1LA 1Q2XA 4V0KA 4F6LA 2WWVD 3NTUA 3NVDA 1J33A 3F6EX 4EYSA 1HH4A 3IL2A 5KOYA 2W58A 1KDYA 2CLOB 4D9FA 2TECE 3OPMA 3FCAA 3JYLA 1Q0PA 5ISMA 1UODA 1U7UA 4UXJA 2EP8A 5CH3A 4F06A 5BSKA 1HSOA 4Q7EA 2BD0A 2W22A 5F51A 5J5AA 3AR4A 1VJDA 3HUUA 3KQQA 3OIUA 3CG0A 4GD3Q 4URWR 4WH0A 3RYHB 1O3YA 1CLUA 2O8FB 1N0HA 2ZSEA 1E99A 3R9WA 5I5GA 3AHIA 4WZAB 1RT9A 1JJBA 3CKMA 4WLFA 1NJ2A 4CGYA 1WZUA 2QX9A 1S2DA 3T5BA 3EOBI 3KD3A 4IVRA 2CD9A 1B1CA 4Y0NA 3B1ZA 3BAFA 1XJ0A 2J5RA 2QTVA 4NCKA 2XCUA 4C5AA 4J9UE 1KYYA 2XQJA 3WGGA 1I3LA 2I6XA 4MKFA 3UATA 1EFRA 5IVKA 1A4RA 1H4VB 1UJ4A 2JIOA 1WHSB 1NQUA 3R24A 1CTQA 3V8EA 3ROEA 3T3PB 1MT0A 4EHKA 3DKKA 5HIKA 2RH4A 3ABOB 5IT5A 4MI6A 2QN2A 3IPYA 2XCTB 1C7FA 1LS1A 1KRHA 1XRLA 1PFKA 2QXUA 1NYTA 2R60A 2Y1EA 4TZTA 4Y30A 5T3UA 3ZWQA 4DLZA 1J2RA 1QVVA 3UC5A 4RCYA 4GPD1 2OBFA 3KS9A 5K3FB 4F4DA 4FFNA 3BGDA 1PS0A 2JCSA 2GLUA 2XGJA 3BB4A 5C8ZA 4IH1A 1RBQA 1MEEA 4F9GA 2IKQA 4G1VA 4M2LA 5CX4A 4OQFA 4UXHA 3AVTA 2P68A 2N47A 4Y1EA 2ANBA 1O6FA 1KZ4A 3KKZA 4M9XA 4C0SA 1RKVA 3SEFA 4JLVA 2ZWOA 4TVBA 4BJ6A 2IBSA 1MN6A 1NN5A 1ECCA 2Q41A 2OV3A 3WL6A 3CCFA 1T1IA 1AY0A 3OPXA 4FOTA 4HS4A 4RKYA 4WK0B 4LCBA 5JDIA 2X19A 1JEOA 4DSZA 1XEXA 1WVGA 1RWBA 4J29A 2FVXA 4BNZA 3H5AA 5KWVA 2J7PA 1J9EA 3QELB 3C1MA 3AEXA 3V4PB 4B09A 1E5XA 3BH6A 2OE2A 2AEEA 4YJFA 2LKDA 5IT9A 3N0VA 3K8OE 4LPKA 1CVIA 4RHFA 1SD1A 3SZ3A 3JZDA 3QI2A