3K0BA

Crystal structure of a predicted n6-adenine-specific dna methylase from listeria monocytogenes str. 4b f2365
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
384
structure length
380
Chain Sequence
SSGRENLYFQGMKSFQLVATAASGLEAIVGKEVARLGYDPKVENGKVYFEGDLSAIARANLWLRVADRVKIVVGVFKATTFDELFEKTKALPWEDYLPLDAQFPVAGKSVKSTLYSVPDCQAIVKKAIVNRVSEKYRRSGRLMETGALFKLEVSILKDEVTLTIDTSGAGLHKRGYRLAQGSAPIKETMAAALVLLTSWHPDRPFYDPVCGSGTIPIEAALIGQNIAPGFNREFVSETWDWMPKQVWADARQEAEDLANYDQPLNIIGGDIDARLIEIAKQNAVEAGLGDLITFRQLQVADFQTEDEYGVVVANPPYGERLEDEEAVRQLYREMGIVYKRMPTWSVYVLTSYELFEEVYGKKATKKRKLYRTDLYQYWGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords predicted N6-adenine-specific DNA methylase
publication title Crystal structure of a predicted N6-adenine-specific DNA methylase from Listeria monocytogenes str. 4b F2365
rcsb
source organism Listeria monocytogenes str. 4b
molecule tags Structural genomics, unknown function
total genus 119
structure length 380
sequence length 384
ec nomenclature
pdb deposition date 2009-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3k0bA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3k0bA02
3FUTA 2PXCA 1XDZA 3A25A 5DTRA 1JQ3A 3CGGA 4DM3A 3HCAA 1M0EA 4E31A 3ER8A 2IFTA 1XCJA 5HIKA 3QV2A 2Z6UA 5HZMA 4HH4A 4R8SA 1G8AA 2AN5A 2PBFA 3I53A 3BT7A 4F86A 5HIMA 4ER3A 2P8JA 3V8VA 4PCLA 3K6RA 1EAMA 2FCAA 1XCLA 2XYVA 4PWYA 5KS2A 1RJEA 2OB2A 5MHTA 2YXEA 2UYOA 5K0LA 2P41A 3B3FA 3IV6A 1NW8A 3TKAA 5HFJA 2AOUA 2AN3A 3GNLA 4KR7A 5LQKA 1EJ0A 3FYCA 3RW9A 3GXOA 5DRTA 4DF3A 1JSXA 1SQFA 1BOOA 1VP9A 3JWJA 3R0QA 1QAQA 4PYMA 5E1BA 2AOUB 3SSOA 5K0CA 1I9GA 3BGVA 3PB3A 5K0FA 3ERCA 4FGZA 1SVUA 4E2ZA 4KR9A 2P40A 2ZBPA 3LBFA 1Q0TA 3DP7A 2CMGA 3SMQA 4YV2A 2QRVA 2P7HA 4M37A 4HC4A 3DR5A 2AOWA 2ZULA 5EZSA 1NV8A 3ME5A 3PX3A 3RIEA 2AS0A 2C7PA 1G60A 4DCGA 3C3PA 3MCTA 4IWNA 5EQJB 5CVVA 3KQMA 3OZTA 1O9HA 4Y2HA 4PYLA 2PVCA 1JG1A 3G5TA 3VYWA 3OZSA 4RVHA 3FTDA 4HGYA 5HIIA 1DCTA 1L9KA 2IIPA 1R74A 4AZTA 1RI5A 1ZKDA 4V0QA 4PYJA 3E05A 3HA5A 2OPBA 5DXJA 1JTFA 3M33A 4M7RA 2OKCA 4QTUB 3TR6A 3IHTA 1KPIA 2JH8A 3B3GA 3T7TA 5DSTA 5FWAA 3UA4A 4BLUA 3G5LA 3EVBA 4UOEA 1F3LA 4GQBA 3G88A 4HSGA 2AOXA 3K0BA 2PV0A 10MHA 4BY9E 3I5UA 3TLJA 3UFBA 3EVGA 4DZRA 3BWYA 2ZFUA 4YUVA 5LQNA 4RTRA 2I9KA 1JR4A 1ZGJA 1MHTA 3R24A 3PFHA 5M5BA 2Y1WA 2IGTA 3DXXA 1X1CA 3UJCA 4P7GA 5HIJA 4CKCA 3R9XB 5DT2A 1X19A 1VQ1A 2H11A 4DMGA 4ER6A 2AR0A 5T67A 3OZRA 5BW4A 1HNNA 2Q41A 4PYQA 4E2WA 2G1PA 2IDJA 4MWZA 3EMDA 3Q87B 3HCCA 1RI1A 7MHTA 2ONYA 1R6AA 3GRVA 3A7DA 3HP7A 3KQVA 2VDVE 3G8BA 2ZIGA 3KQWA 5EMLA 1XTPA 2PWYA 3FTFA 1SUIA 3G2QA 3PVCA 3T0IA 1N7IA 5K03A 2JG3A 4HG2A 5FA5A 3KQTA 1ZQ9A 1KPGA 3KPYA 3B89A 1ORHA 3P2KA 2IH4A 2PX2A 4IV0A 1EJ6A 5FA8A 2FRXA 2BZGA 3P9NA 5K8VA 5C0OE 2YVLA 1WXXA 4QDJA 1SG9A 5DWQA 3MCZA 3P9IA 1Y8CA 4YV0A 1VL5A 4MIKA 3LCCA 4E30A 1KHHA 3G2MA 2HWKA 2ZZMA 2P1DA 3UWPA 3FPJA 2GS9A 4KW7A 4KWCA 1KXZA 2GLUA 2CKDA 1PJZA 4RTNA 4RV9A 4P7JA 5T6BA 3TFWA 3D2LA 4X60A 2UYCA 4KIFA 1VBFA 3OU7A 3FPFA 5K0BA 3OU6A 2FPOA 3DULA 3TPZA 4CTJA 1KR5A 4X63A 5EIWA 1R8YA 5K0NA 4A6DA 2QY6A 1WY7A 1NBHA 2PKWA 4OA5A 2GB4A 2PSSA 3ELUA 2G70A 3I64A 5CCBA 1YFLA 1QZZA 3DH0A 3HCEA 5EPEA 5K0JA 5KVAA 1IM8A 4LG1A 1OR8A 1JQEA 5LQAA 3OE4A 5EEGA 2IDKA 3SXJA 3GRUA 4KDCA 4M36A 4L7VA 4FR0A 3G2PA 2OYRA 3UJAA 9MHTA 4IKPA 1SKMA 3DUWA 3LKDA 3MB5A 3GJYA 4OX9Y 4OA8A 3KR2A 2NNWB 1X1BA 4O29A 3TM5A 5DM1A 4YUYA 2OO3A 3DOUA 4BLWA 3OCJA 4DKJA 4QVGA 3T7SA 3UJBA 5EKUA 3GIWA 5DRYA 4E32A 3B7PA 4EKGA 2P3OA 1DL5A 1FPQA 2EJUA 4PCAA 4EKIA 3FUVA 2PLWA 4YUXA 2NXJA 2VZ9A 3MTEA 3KQPA 3IYLW 5BXYA 5K09A 4FP9A 4GEKA 4PYKA 5JUWA 1UWVA 3DMHA 5GM2A 4DA4A 3TKYA 1P91A 3BGDA 3EVFA 5F2KA 5EMJA 5FQOA 5FHRA 1EG2A 3BXOA 2BR5A 5DX1A 1RI3A 5EIFA 3CC8A 4QPNA 3JWIA 3M6XA 3MTIA 3HTXA 5EG5A 2ZBQA 4OQDA 3KKZA 2F8LA 2HMYB 5FHQA 2BM9A 3O4FA 3NW9A 1QANA 2Z6AA 2ZSUA 1R18A 4PNEA 5DTMA 3P2EA 3G89A 2B3TA 1D2GA 4E33A 3UJ8A 4ER7A 2EG5A 1YFJA 4PIPA 3E7PA 4QQNA 1XDUA 2KW5A 3GRYA 4CXMA 3KU1A 3C6MA 3OFJA 5DM2A 1TPYA 2ERCA 4OBWA 3NWEA 1RJDA 4JXJA 4QPPA 2JH9A 2JJQA 4GF5A 2FK7A 5HEKA 4KDRA 3FUUA 4KR6A 2DULA 2G8NA 4G56A 4M38A 2QRVB 1TW2A 4BP1A 3SM3A 5LQUA 1QAOA 1V39A 3BKWA 4AZWA 5T64A 1D2CA 1YZ3A 4FT2A 4FZVA 2G72A 3FUWA 3C6KA 3M70A 3CKKA 3ELWA 2ONZA 5D1NA 5CM2Z 3EVCA 5FCDA 2NXEA 2YX1A 3GGDA 3ORHA 4F85A 3BWBA 2IPXA 3E8SA 2IBTA 1RJFA 2IH5A 3FTEA 3M4XA 4E2YA 3MAGA 1NW3A 1EIZA 5U4XA 3HA7A 3P9KA 3O31A 4PIMA 3G7UA 3G8AA 4QDKA 3A7EA 3CJQA 3P8ZA 4CKBA 5KYGA 2EJTA 2GH1A 1FJXA 3HVJA 2O57A 1JTEA 3ELDA 2Z6QA 4GBED 3THRA 3C0KA 2P35A 5EHGA 4GOMD 5IH3A 5K05A 3KPUA 4F84A 3HCBA 3HCDA 2IP2A 5BP7A 1O54A 2IH2A 4E2XA 2ZTHA 4B17A 1B42A 2WA2A 3B5IA 1AF7A 3TQSA 3EEOA 1VPTA 3TMAA 3KPJA 3HVKA 3V97A 3QOWA 2PT6A 1X1AA 5FADA 5LR6A 2ADMA 3CVOA 5HILA 1ZHFA 5CIYA 2ZCJA 5B1SA 2AN4A 2ZZKA 1L3CA 3FRHA 4FSDA 4U7TB 4BLVA 2OB1A 1NV9A 5GIOE 3PTAA 5P8WA 4R8RA 5LQJA 1NW7A 2DPMA 3VC1A 5ICGA 3NWBA 4OBXA 2YTZA 4P58A 1H1DA 1XVAA 2QYOA 3FPHA 2ZIFA 3E23A 3KPVA 3GU3A 4POOA 4AZSA 1ORIA 1YZHA 2FK8A 3AJDA 5E1DA 5GOZA 1KIAA 1G8SA 3SX0A 5KQSA 3UBTA 1P1BA 1IY9A 2E5WA 5D1HA 4RTLA 5FUBA 2R3SA 2UYHA 3P97A 3PT9A 4RVFA 1NT2A 1NW6A 4AUKA 4EMSA 2B25A 3B3JA 3AXTA 3BWMA 4RTMA 3H2BA 2NXCA 2V7EA 4IV8A 5GWXA 3SVZA 4PINA 2CL5A 3PX2A 4KVZA 3EMBA 3I9FA 4RSRA 2AVNA 3CCFA 3HVIA 5GIPE 4A6EA 3TOSA 3DMGA 2I7CA 2ZWVA 3I58A 4FT4A 3NDIA 2XYQA 2XVAA 3M6WA 4PGHA 3T7RA 5LQCA 3A26A 2BM8A 3P9CA 2B78A 2PWPA 3KR0A 2JHAA 2VP3A 2GA9A 4GOOD 2AVDA 1G55A 3MQ2A 1RI4A 4R6XA 4C08A 5CVUA 5EEHA 1ZG3A 5EZQA 3CJTA 1X1DA 4WXHA 4RVGA 3GWZA 3BUSA 3NVMB 2PX5A 5ERGB 1QAMA 2PXAA 1L3IA 2GPYA 3EVDA 5EKXA 4C4AA 1QYRA 2BH2A 4AX8A 1FBNA 2V74B 1JQDA 1JG4A 3A27A 3FYDA 4OQEA 5F2OA 1O9GA 1P39A 1M6EX 3BKXA 4FSXA 5F2NA 2ZZNA 1JG2A 2YR0A 3M6VA 5DM4A 3DTNA 2EFJA 2UYQA 4BP3A 5DLYA 2IBSA 3EGIA 2LD4A 2CMHA 3EVZA 3FZGA 3RODA 3FTCA 5DM0A 2JHPA 3M6UA 1Q0SA 3C3YA 4CKEA 2VS1A 1XJ5A 4ATNA 5DTQA 1G6Q1 2C5SA 1XXLA 3HCFA 3QOXA 2AOTA 4XUDA 1YUBA 4LWOA 5E8RA 4C06A 3TM4A 5DXAA 4MQ4A 2XYRA 2OY0A 5EOVA 5ICEA 4GC5A 5K01A 3LCVB 1BC5A 2VDUE 1INLA 2YXDA 4DQ0A 5C1IA 8MHTA 2NYUA 2OZVA 2NXNA 1U2ZA 4PYIA 1JG3A 3LBYA 4GUAA 5E9QA 2AOTB 2ESRA 3EVAA 4ISCA 2B2CA 4C07A 3GCZA 3UJDA 1R8XA 2ZW9A 3KQYA 5JR3A 3LHDA 1WS6A 2BR4A 1JSZA 4KRGA 4XUCA 3LPMA 2OXTA 3R6TA 1FP2A 1KYZA 5E2AA 2H00A 3JWHA 2I62A 4RTSA 4X1OA 1NE2A 4XCXA 2QE6A 5ICFA 4GOND 3KR9A 3GO4A 2HTEA 2HV9A 4AZVA 4E70A 2N47A 2OBFA 4ER0A 2VDWA 1NBIA 4QQKA 3UA3A 1WXWA 3LL7A 2AOVA 3O7WA 3NDJA 4CTKA 5IKMA 3PLAE 2H1RA 4V0RA 3PFGA 5E8JA 3JWGA 4EQZA 1AQIA 3BWCA 5CVJA 4HTFA 4Z2YA 5CVDA 3AY0A 3F4KA 1I4WA 5FTWA 5EMMA 5ICCA 2O07A 2YUIA 3SR4A 2FYTA 3GRRA 3GRZA 1NKVA 4C03A 4LECA 3PS9A 5FQNA 4YUWA 2HR1A 3HNRA 1VIDA 1D2HA 1N7JA 3ID6C 2GAFA 4HTFB 2I6GA 3SGLA 5C9ZA 2XVMA 3WSTA 4PGGA 3FPGA 2CWWA 1NW5A 3EGVA 3LDGA 5K0GA 3S68A 1Z3CA 2G71A 4C04A 1PRYA 4RTPA 1IXKA 3DLIA 5EGSA 5K0EA 2ZVJA 4HRAA 3LCUA 3FRIA 4DCMA 3G2OA 5HOQA 3DLCA 1F38A 2WA1A 5GM1A 1N2XA 5CVEA 1ZGAA 5FULA 5LSAA 3CBGA 1L1EA 3EEYA 3KQSA 4U7PB 1EQAA 4MTLA 2B9EA 3IEIA 3MGGA 4R05A 3TRKA 3GDHA 3EPPA 3SSMA 4CWAA 3P2IA 4P7FA 4HGZA 3ER9A 1L3BA 4FS8A 3EGEA 2Y1XA 3HA3A 2PT9A 1MJFA 3FUXA 2A14A 2QM3A 2PY6A 3BZBA 1VP3A 3UZUA 4EK9A 1YB2A 3DXZA 2NP6A 3R3HA 4YV1A 3FPEA 4PYOA 2PGXA 2P3LA 2XBMA 4RYLA 5EC8A 1HMYA 3VSEA 2O06A 3LSTA 1DUSA 3HEMA 5E2BA 1WG8A 3ANXA 2EX4A 3LDFA 1SQGA 3OU2A 4XUEA 5EVJA 2FHPA 3EVEA 3REOA 1KPHA 2O0LA 2O05A 4X41A 2YXLA 3KR1A 4KIGA 5LQRA 4K6MA 3LGAA 4NECA 4MHTA 3OPNA 2PX8A 3DMFA 1RJGA 3VC2A 1P1CA 3DXYA 1SUSA 2AZTA 2NP7A 3A4TA 3OE5A 4RTQA 3UJ6A 3ELYA 5E9JA 1UFKA 2C7QA 5KQRA 2PJDA 3NTVA 1R00A 4RX1A 4RTJA 2P7IA 3LKZA 3KHKA 1RI2A 4RTKA 4WVLA 4LWPA 1I1NA 4YMHA 5DX8A 5EMKA 3SSNA 5BW5A 4YMGA 4QTTB 1AV6A 1UIRA 1AQJA 1FP1D 3THSA 2P3QA 1VE3A 4R6WA 1BHJA 3AWIA 3HVHA 4PONA 4QVKA 5G02A 2ZBRA 3OFKA 5CUQA 3LX6A 4PYNA 1WZNA 5E1OA 5E9WA 5FWDA 2ZWAA 3X0DA 1BKYA 4C05A 5EHIA 5CD1A 3LDUA 2ZLBA 5CCXA 3HM2A 5DSXA 2YQZA 5GP1A 3BGIA 2PX4A 2C7OA 1T43A 3NJRA 3MERA 4YUZA 3UJ7A 1VLMA 4Y30A 4X61A 2ORED 2R6ZA 3L8DA 3Q7EA 3NVKI 2PXXA 3CJRA 1KYWA 4ER5A 1M6YA 4RWZA 2C7RA 5E1MA 2WK1A 3UJ9A 2K4MA 3KPWA 3LECA 2HNKA 3AXSA 1YF3A 3KQQA 3KQOA 2JHCA 3MHTA 4H0NA 5DX0A 3U81A 2ZIEA 4GC9A 5H02A 1G38A 4ZTBA 1KP9A 2BR3A 4P7KA 4RVDA 5DPMA 1XDSA 4GOLD 2UZ4A 3P71T 4RTOA 3NMUF 4EVIA 5GINE 1TW3A
chains in the Genus database with same CATH superfamily
3AL3A 2BFBB 1KP3A 4JJ8A 4LGMA 5IJ0A 3EZLA 5DTRA 1N6NA 5DW0A 1FXWA 1L7PA 2C9YA 4RNDB 1IEVA 1SXQA 1CPYA 4D79A 1PEAA 2FRDC 2GBLC 4KMSA 1RD4A 3KSAC 2DFKB 3RC2A 5DULA 3IIKA 2CJPA 2HAEA 2BFMA 3VO2A 8ADHA 4J3FA 4ER3A 4XW2A 2R96A 4PWYA 1LI7A 3LIIA 4LTDA 5J40A 3E9DA 3NNSA 2VCYA 1V3QE 2BHLA 1O5OA 3EW7A 3L8CA 2WE7A 2ZRNA 4LDZA 3HM9A 4KUEA 4DXHA 1ODTC 1UFVA 3AESA 3DBHB 1S7CA 1P18A 3STVA 2KSQA 3SG0A 4HEA1 4YAJA 1UQTA 5JS8A 1DS6A 3FYCA 4AY4A 1KOFA 4QU0A 5DRTA 2VLBA 2OOSA 5DNEA 3EFEA 5I7FA 3A1DA 1JRLA 3OEWA 4NFHA 2AOUB 2H4YA 3IPAA 5AVSA 4FFVA 3ROEA 2NZJA 3I6ZA 2PKQP 2PKCA 5AWFC 3TKLA 2P7HA 1RCUA 1SZDA 2XSZA 2AV6A 3FF4A 1TZ2A 1Z47A 1MDFA 4L73A 3O2SB 1V6AA 4REQB 1FRNA 1LSJA 1Z62A 2C04A 3FHCB 2J7KA 1NJ2A 2O1XA 2NPOA 3TQCA 3IAUA 2IXFA 4ZI5A 3UOAB 2RAUA 1IZ8A 2X8BA 3F5SA 4WIAA 1EVKA 2Q3BA 2NVUB 1YOBA 2WHYA 1P2UA 1JB1A 2LCFA 1GSIA 2Z5FA 1BGVA 2D13A 4GPBA 2CHGA 2J4CA 4CFZA 4KWTA 1PT9A 2ODTX 2WT8A 3R40A 4M7RA 5CJPA 3D7MA 1JA9A 4C5CA 3B3GA 4PGMA 3PHCA 2GJSA 1KU0A 2IZ5A 5JNSA 2FB9A 1E1RA 4ENRA 4CIDA 4MGZR 3K0BA 1JQBA 4JEUA 2YS7A 4FR2A 1C9MA 3K2EA 2ZSBA 2I99A 2JAUA 5F4BA 4DQVA 3WL6A 4BTLA 1KMHB 4D44A 1X6VA 3C5HA 1Z9BA 1CY4A 2FGKA 2J0EA 2NO7A 4ZOBA 3EDMA 5KWSA 1ZHHA 1WV0A 1Q7CA 1JKMA 3UHAA 1GNTA 2GF0A 3ANNA 4S1TA 2AR0A 3KIPA 4UU7A 5L4SA 2D5IA 2FSGA 3T5GA 4YBZA 2FPPA 1CUHA 3IVRA 1GHTA 4MWZA 5DCWA 1PG5A 1WPRA 1WIWA 3HP7A 1MX5A 1SQ5A 2AMVA 3OQIA 1JQ5A 2X1MA 3H5OA 5ALOA 5HDBB 4X65B 1M66A 4IIJA 421PA 3JV7A 4TXLA 3K0SA 2JCVA 2JIDA 4QU9A 2IH4A 3FBGA 4UBLA 3W5DA 3EOBI 1U0BB 3OIVA 3U31A 1YK1A 2CXUA 3GUHA 2BWJA 3W6UA 2CXRA 2WFLB 1Z2PX 1YR7A 1CB0A 1Y3FE 3G17A 3RO7A 4EFNA 5A6VA 5F7OA 1U7DA 4RZXA 4WN3A 5L3QA 1OI3A 5J2UB 1WA5A 4V3CA 3UAXA 2P1DA 3T9BA 4Z86A 3COSA 2I2AA 5TJ9A 3PEEA 1ZUWA 1KXZA 3QBDA 3IP9A 3P27A 3HGQA 1A2QA 5DISB 4ZAXA 4RJIA 4C29A 1U2SA 2BC9A 1Z6ZA 2H59A 4Q3OA 4N5DA 4R9NA 4WUVA 5ARBA 4RF3A 3KTOA 3LWBA 2M9MA 5AIBA 3GRAA 2FW8A 3EBOA 4BATA 4HAYA 2B8WA 2FSFA 3UPDA 1E1DA 1I3NA 2G08A 1GUDA 1SZJG 3TDNA 3QUCA 3ZBPA 1NYQA 1YMQA 1WNTA 4I3FA 5AKZA 1ZVMA 2PSSA 3T95A 3MELA 2QS9A 1DXOA 1FTNA 2DPGA 2R97A 1AK9A 1BHO1 1OIXA 3HMQA 3MMZA 5F9FA 4J1SA 1EB8A 3KO8A 1JQEA 3I0NA 3L8YA 4BO9A 1EPUA 1TMGE 2HZBA 2IDKA 4LY0A 3A6PC 4JBNA 2R6DA 1FYDA 1RM3A 4D9JA 1JEYA 1J42A 4MVJF 3NBZC 2HRCA 1RQNA 3F78A 4CNBA 4TOIA 3DBLA 4D9NA 5B12A 4LFBB 1AQLA 2X1LA 3K1AA 4O29A 2Q3LA 1LH0A 3NHSA 1EHYA 4M86A 2QAIA 4Z3KA 2GRJA 4JWTA 1DTSA 3B5EA 1RZ3A 3B1XA 5ILGA 2ZBDA 1ZGZA 3DBIA 4MLDA 4O33A 4N0EA 2XYPA 2JLYA 5IAAA 5IYZB 3C1TA 3FSGA 4QBHA 2V6GA 1QGZA 3DMHA 2ZIAA 1NVDA 3AY7A 3OHMA 4YDQA 1SBZA 4Q7KA 3A2NA 1I13A 2GGSA 2B7BA 2SCUA 4JJEA 3N2YA 4XFDA 1WF6A 1KERA 4Z4IA 1IUOA 2JCBA 2ZTVA 3HWX1 1AQNA 1U9IC 4E3ZA 1DQYA 1D2EA 2XDQB 4QARA 1ND6A 5FBLB 2IU6A 3IQGX 2I80A 4JGIA 3H99A 1GZSA 4UE2A 4YK7A 3THOA 4PQRA 4GBMA 1N7GA 3PEVA 2B3TA 2NU9A 2X8WA 4ZHQF 2OMEA 1Q50A 3LI2A 1C4OA 2X42A 4JZKA 2DU8A 4LZOA 1DZ3A 2KW5A 1SKAA 1U0FA 3HZRA 3RIXA 3O8QB 3ZW7A 3OFJA 1PJ8A 4PE5B 3PT5A 4KJXA 1GEGA 2QVYX 1BE6A 4QPPA 1NUAA 2DWUA 2UDPA 3JQFA 1B0ZA 4YCJA 2KI5A 2G9ZA 1NOJA 3SM3A 3DMNA 5B7QA 4YAUA 2I3ZA 3A4VA 1UBMS 1G7CA 3AUAA 3NH6A 1BN6A 4MGIR 5AI0A 5A4JA 1GAXA 1C7EA 2HX1A 1HDGO 2NV0A 1YZ3A 1KTIA 2VPWA 3HB0A 1GDDA 4KO2S 2IUTA 3BXGA 3WIVA 1M1UA 1ULUA 1MGOA 2W6JD 2OL4A 1CZOA 4HDAA 3UKJA 2BFWA 3NKFA 1XQ9A 2XZDA 3KKEA 3SYNA 5AVYA 3UWDA 4IRUB 5BUSA 4QJ4A 1JEQA 1Y9JA 5EFOA 1UH5A 5FO0A 3SBOA 3OOEA 4RCZA 5ALVA 1SKBA 3HA7A 3O31A 2DGDA 1PHPA 2O3SA 4Y2UA 2X4LA 5IFKA 4QA9A 2Q46A 3LVRE 4PQFA 1STOA 4PG5A 1UIMA 4OJNA 5IH3A 4I1IA 4BP9A 4QULA 5FX2A 1DV1A 3FCYA 3RR2A 1SIOA 1QLJA 4LX8A 3ZDBA 1S01A 3QBJA 1FDSA 2Z1MA 3NM6B 3ZCUA 3H13A 1P0CA 2EC5A 2JLQA 5TPWA 2QLTA 4KGZA 1NKTA 4IS3A 4EO9A 3SVTA 1KS2A 2QQGA 3O3NB 3O73A 5EZYA 4W5RA 4ACBA 3PI6A 1H1TA 1A8IA 5DN6A 1GL9B 3GFVA 3PKIA 1W9MA 1WMBA 5CU7A 3ZWOA 3PWTA 4MVCA 5B3AA 4I8DA 1PK9A 3V4VB 1NW7A 2AT1A 2PL1A 3NWBA 3EAGA 4KLNA 4MLCA 4EQ6A 2YS6A 4M1ZA 4MVJI 1QGDA 1D2MA 3V7UA 1FX0B 2R7AA 5BNZA 3RAFC 3LHSA 3U7HB 2GJ4A 2W6ID 1JNXX 2YNMA 1NAHA 2JAHA 3ZD9A 4JC5A 1YTUA 5I3CA 4A7PA 1RBZA 3KWLA 2I87A 5EIOA 5BMVF 2GEUA 1JJBA 3KJHA 3USES 2P0EA 4BBPA 4FFMA 1BE8A 1T8YA 1CETA 2FLVA 3UMGA 3B3JA 1HFEL 1TMKA 4L5BA 2GXUA 2ZGVA 3H2BA 1YQGA 2HJGA 4PV7A 4Y0AA 1ZRNA 1OFUX 2O3UA 5CLGA 5ILQA 4IFBA 2GZDA 2VUSA 4ZALA 3EMBA 4MX8A 4RSRA 4BVKA 2AVNA 1V37A 3I28A 3VU3A 2PFGA 1U8CB 2CXXA 3DMGA 3IC5A 1CUDA 1ZWLA 3I58A 5TDHA 3WZMA 2XYQA 1H2ZA 4DE5A 1Z07A 3T7RA 1ZVQA 4BV8A 4URXR 2JLZA 3OFVA 2R6JA 4MUYA 3LRXA 4OQQA 3JQ7B 4BCDA 4WOJA 3TVYA 5C46F 4LZPA 1U1IA 1RI4A 1DHTA 2I66A 5EZQA 3WWZA 2VPQA 2ZANA 2PJRA 1TYCA 4TV8A 3ZLBA 1KI6A 3ZG6A 4Q03A 1VGQA 3F9RA 3ZV4A 4JODA 4HQ6A 2VHEA 1OHHA 3IQEA 1IUNA 3U3RA 5C52B 1GSOA 4C4AA 3HKBA 1YE5A 4UM9D 1X1QA 3CLRD 2H9IA 3UCXA 2BBSA 2PFKA 2QUAA 2AQ8A 2QTBA 4R9SA 3ENKA 3IESA 2RIPA 1L5LA 2F3UA 3LF2A 4O8CA 3TS1A 5IF9A 1EYZA 2AR9A 2F1HA 1XMIA 2OILA 3M6VA 3QVLA 2WAOA 1UWLA 2CFRA 3ILXA 3ADOA 1YQDA 1EVZA 4FC7A 4LBZA 4PLTA 4RDHA 3NP9A 4ES6A 5KB3A 3V2IA 1LBSA 3IKMB 4BNVA 1S9HA 1TT5A 3OEHD 4F4HA 2DQYA 1E2KA 3PJGA 4W82A 1VOTA 4J0GA 4GI3A 3ES9A 1CY1A 1T34A 4NNJA 4X00A 3UMRA 4FDAA 3W4JA 4U6SA 3W8EA 1UFOA 2IOQA 5DXAA 6YASA 2OY0A 5TQ0A 2H48A 4WLNA 1YU9A 3PUVA 5EUBA 2HJHA 3OI7A 1QZXA 4XDZA 4K9PA 1VJ0A 3UYKA 4TLLB 5JT1A 2F1KA 3F97A 4M0DA 4LRUA 3CYFA 4OUKX 1JSZA 4XUCA 1SA0A 4N5IX 3NHBA 2CSXA 4M22A 1E2NA 3COJA 1P2DA 2A94A 4JAVC 2ZAGA 4X1OA 5I48A 4KFCA 2CLOB 3KOMA 2HV9A 2YBEA 5IK2A 2X1VA 4Z9AA 1IHUA 5KNLA 2GF2A 1CEXA 1PFYA 1SHKA 1PJLA 4LE2A 2JFHA 1N92A 3LPNA 2YDXA 1LPPA 3G02A 5TQ2A 3T3DA 3BH7A 2JKYA 4I6EA 2V9CA 3KAJA 2C0PA 3JWGA 4P4NA 2EBUA 3QY9A 4M21A 3T5AA 3BRQA 5CVDA 5EFZA 1GOTA 1SOUA 2GVDC 2AI3A 3DHVA 3VC7A 2WQZA 2RH9B 5LKRA 4WJLA 3KYDA 3EQ2A 4PFSA 4QU8A 3HXPA 3MJ4A 3W5JA 3QKRB 9GPBA 1EG7A 3DSRA 5CCDA 5LD2B 3QSYA 2I6GA 2XUPA 4LQLA 3OX1A 4MYSA 1ZMTA 2CWWA 3ZKWB 2PZEA 1PS9A 4DS3A 1Q7TA 2GZMA 5D5HA 3BILA 1UP7A 4F6RA 3ZNOA 4WNIA 1E3LA 3TD2A 3LCUA 5HOQA 4Y3UA 4XE5A 5JI3E 2VO1A 2JFGA 5CVEA 5AOAA 2BY4A 3QMVA 1JHXA 1NVVR 1Z4MA 2P4UA 1L5NA 3TB6A 2ID9A 4QYXA 4ENQA 1KETA 2WKSA 1IOZA 5TR9A 5DM60 1NJ5A 3M4NA 4S04A 3CEJA 4H3HB 7ABPA 1YB4A 2R6HA 2VNAA 3JWPA 1NRXA 3A37A 2J4FA 4XOIA 2ADOA 3WL8A 3HFGA 1CRPA 2XCQA 1FMLA 3MGAA 1PR9A 1T0PA 4D9GA 2O2GA 1O97C 3FLEA 2D5BA 4QBFA 4D0RA 2O8EB 1VP3A 2IT1A 3V2HA 3L6DA 1B14A 1U0OC 1VXOA 1KR2A 2ASVA 3JYNA 4N6GA 4ZT4A 4HN4B 3ZLTA 4M0PA 3NT4A 4R69A 2EX4A 4QPZA 1E77A 3F96A 1FK8A 5THXA 3CVUA 3FN4A 4X41A 4BRSA 5DBHX 5TNXA 2WV7A 3TOXA 4HNAA 4RSGA 2FE1A 3CGWA 1P1CA 4E1VA 4WCFA 4CGZA 3WHKA 4KSCA 1BGXT 5B53A 4QFMA 3DPIA 1T6BY 3SLGA 3VU9B 2YXBA 2B82A 1R00A 2PX6A 3LKZA 1JLLB 1GZ3A 1L4FA 3E3OA 3I6IA 4KJZA 5IM5A 1ZBDA 4MRMB 1KZYC 2B8TA 4A0FA 3GZNA 1ULSA 4K9KA 2F55A 4QTTB 1ESZA 4ZVKA 3IPLA 3WDKA 3UAGA 3EUWA 4XEUA 1V35A 5IMBA 3ZNPA 3IAS1 1ZVKA 3AVVA 1C3OB 3GLKA 5CFMA 1LX7A 2ZWAA 1JA0A 1CR1A 4Q3LA 4NTZA 3M3PA 2VQSA 2VTBB 1L4EA 2SBTA 1XZIA 3LM8A 2C7OA 6PFKA 1YCHA 2WMYA 1E3JA 4IR7A 1ZC4A 3GZJA 3REGA 1U2PA 4KLCA 4IJQA 3RSFA 1P7PA 1E0AA 1E2GA 4IY1A 2Q9AA 3EXFA 2UYGA 4QDUA 3ST7A 3WGHA 4TXHA 4JI6B 1WWKA 2OVFA 4RPGA 2UZAA 3PCTA 121PA 1M5TA 1VCMA 2B4QA 4F3CA 3BE8A 3EWAA 4EY4A 2WIFA 3G2IA 4JDPA 2JHCA 5DX0A 2R2AA 5F5LA 1GPYA 4IDAA 1G38A 4CMCA 1CKEA 1FFSA 4F5DA 1B3RA 3ILVA 1NW4A 2Q4OA 4M1EA 4TUYF 3A6ZA 4GOLD 1V9LA 3PWZA 1R8QA 3V4PB 4ZREA 4YTEA 1JEEA 2EBWA 1NMZA 1BXGA 5FT9A 1PZGA 3DP9A 3UXMA 2FPIA 3SZ3A 3OCXA 3HCAA 1FSSA 4ZQIA 4D4HA 3QU4A 2Z6UA 2G5PA 1KK0A 1DUVG 4XIJA 3OX2A 1DQSA 3OTHA 1JXMA 1OFUA 4GOKA 2B1RA 4CRWB 4Z8YA 3OC0A 2COUA 4K6FA 4PCLA 2EWVA 4TM7A 4IHQA 4TLMB 1VDMA 1DCKA 2RGRA 1UUFA 1XTQA 1RJEA 1BS1A 3EW9A 1T2NA 2YN4A 4MPTA 4ZI7F 3R6GA 4IDFA 3CB4A 1QPGA 3N76A 3UICA 4INZA 2IXAA 4UTNA 3QYPA 1ZSNA 2GI4A 4AFNA 3OHPA 4A1OA 3V7FA 1HFKA 1B2RA 3AIMA 5AJTA 2ST1A 4AQYB 2JFVA 1P8AA 4FMBB 1GRCA 3WNVA 3T3OA 4HBGA 2PHZA 3PXXA 1GTG1 4I4TA 4JVLA 4MULA 4A03A 2JJ1A 1TU3A 2XHEA 5CH8A 4EG1A 2OENG 1TVMA 4NJEA 2GK4A 2A9RA 1IPEA 1ZESA 3DR5A 2IGBA 5ALRA 1HA3A 1R5OA 3I8OA 3PQCA 3MWLA 2ZAOA 3GPDG 4M53A 4CTMA 1N3YA 3L92A 1WHSA 5D7BA 2Z2ZA 3RIEA 4ENVA 2ZVDA 3K8QA 4L5CA 4B7AA 1W1UA 2XOXA 2EL9A 3P26A 1FRVA 1E64A 1THMA 4O59O 3W0LB 2PH1A 2ZBGA 3QF7A 3GI1A 1BCSA 1JPJA 3E48A 4E7PA 4DLSA 1GG2A 4L0QA 3G5TA 4B2LA 4BLQA 1T8SA 4YQYA 4GI1A 5H3LA 4CM8A 1UZAA 2ECKA 5CVCA 5KNBD 2I33A 3LC0A 1L5KA 1L9KA 4UBKA 1R74A 2ZCVA 3AEUB 4MQBA 3D9QX 3GCWA 3OZCA 4V0QA 3ZHOA 4PYJA 2FOXA 2OMKA 3R9WA 5LOVB 4W5OA 3T7TA 3U3MA 1YGYA 3QKSA 2Q3MA 2WAYA 1TO2E 2LIVA 1UOPA 5FJJA 4BLUA 4DC1A 1ND5A 3K0CA 3L0BA 1QWSA 4OL0A 1QFMA 3IRVA 5AKIA 3W6NA 3GEHA 2PLRA 1OFVA 2YJTD 4IDQA 1LGYA 3P94A 4URYR 2UAGA 5FTJA 1Q77A 1HR0B 2FQYA 1RQLA 1VMIA 2VK1A 5EHNA 1TGYA 2VTKA 2J5QA 3RUDA 4UAUA 2VBCA 4MQ5A 4UU0A 2HADA 2IP4A 1KAOA 3VPCA 1GSHA 2IY9A 2YMQA 4YJHB 4MQEA 3YASA 3SWWA 3NBAA 4NU6A 1BHQ1 3WL5A 4FMDF 2JI4A 2Q50A 1KI8A 1VYTA 2BJVA 2FPGB 3Q85A 3OZDA 4K9MA 1SUIA 4MTCA 4DEXA 1XE3A 2PNFA 4HNVA 4B8WA 3KPYA 3B89A 5CB0A 1OC4A 3L04A 4X6YA 3AKEA 4MUNA 1MO3A 4M0EA 2PMEA 4A5OA 2BKUA 2QQ0A 3ZUGA 1IWPB 2AFIA 4QDJA 1K08A 3P9IA 1UBTS 1ZNYA 3DZJA 9LDTA 3FFWA 4G1FA 4L1KA 3SE7A 3VOAA 1CULC 1DELA 1N6LA 2X0RA 3DEZA 3EWIA 4MKXA 3G2MA 5AIAA 1EA5A 4F91B 1GZHB 1J1UA 5J5CA 2GS9A 2QAGC 2Y8EA 3L1VA 1QV9A 2G80A 3LW8A 3QUBA 2AG5A 3H8SA 3UWSA 4U2CA 5JLJA 1Q0PA 1Q1GA 3AP1A 1GYRA 1CVLA 4HNGA 4LF5B 1GFZA 2GK7A 1P0IA 3JY6A 1DBWA 2P9TA 3TFWA 2YZNA 2PM8A 2OAEA 1VC2A 3F3MA 4MAAA 2BMDA 1NVAA 3H6HA 4KIFA 4AJJA 5AW9A 2Y1EA 2ZJFA 4PNZA 4BB0A 4OQNA 1UPBA 3EULA 1XRLA 2CJXA 3HUFA 1V8ZA 4QATA 4WNCA 1R8YA 3B9QA 2C4UA 3PTZA 4MA5A 3V9AA 3D3KA 3HHEA 3ZGYA 3D7SA 4BNTA 2WJZB 2QAJA 5L3SB 1CLUA 1MIOA 2O4UX 5CCBA 3HCEA 2AX4A 3CNOA 3U3JA 4YR9A 1F9AA 1W44A 2GJAA 3P45A 4OYLA 4UTZA 3ZDQA 5BP7A 4ZARA 3TLEA 3UJAA 2W2QA 2R0QC 1A72A 2GZAA 4R1OA 4OX9Y 1GL6A 4RY8A 3VHXB 3NIFB 5JAIA 3MHPA 1VLHA 5DM1A 1YB1A 3BTUA 3JARB 2C94A 4IIVA 1DAMA 1VPDA 1EQUA 4E32A 4OGWA 2HLHA 4XYLA 2JLSA 1Y1QA 3BXHA 4B9AA 3LDAA 3VR3D 4AG6A 1ZA2A 5CA1F 3KQPA 1NPTO 4BCCA 4U8HA 1AQYA 4TPKA 1EIWA 5F2KA 1UDBA 4RLSA 3S27A 5FHRA 3WBBA 3H11A 3EMVA 1NI4B 3GJ4A 4WCFC 2Y2UA 1E9DA 2BMFA 3TK1A 3JWIA 3I2IA 2XXJA 1A7UA 1PCXA 3LUBA 4XX0B 4YMIA 3UWKA 5FUQA 4XGKA 2O4CA 4WK4B 2B94A 1I4TD 2R85A 3QEJA 3JW8A 3CRMA 3I04M 3DPSA 5IBPA 3WYNA 3ZV7A 5MN5A 3WLJA 2HCTA 2JJ2A 3HDJA 1ISIA 4PAWA 2JGNA 2AE1A 1PFUA 1ZIDA 1MJNA 2EG5A 2J6BA 1UKEA 1YJQA 4OYHA 4PIPA 3GX1A 1CJCA 3CLUC 5B4VA 3C7AA 1XNHA 3B3AA 1KEWA 3L7YA 2CVPA 4IDHA 3VKHA 1XNGA 4RQUA 3DTVD 2VP6A 1CUIA 5CR9A 2DKOA 1R5NA 4KDRA 3VJRA 4KR6A 7REQA 3GP5A 1R15A 2ZQZA 1I7PA 1VCNA 3OZGA 3V4ZA 1XZPA 4H59A 1MC5A 2I55A 4MNTA 5LU9A 4DDWA 1O96A 4W5JA 2P2CA 3ESXA 3JALA 3JQAB 3Q1KA 2C7VA 4L07A 4L72A 4QT0A 5EJIA 5JSKA 3AVTA 2FTKE 3AB2A 3C6KA 3B7GA 2BRUA 3PKZA 3KLMX 1QGUA 4WKGA 3G82C 2RD2A 2HT6A 3K0FB 3IUQA 4O25A 5SZKB 4HYTA 3WE7A 4ZANA 3KJXA 5JXGA 2EBHX 3NONA 3EVNA 4O2BB 3NT5A 3LDHA 4O2LA 4BFYA 1ZXLA 3OEED 1BCRA 2OOKA 4R2WA 2WNSA 2FZWA 4AJNA 2ZCUA 2XRZA 1ACMA 1P1FA 4V0ME 4OP2A 2EJTA 2QMOA 1ZVVA 4B84A 2GEJA 2BE7A 2MYPA 2G28A 4YLEA 3A9VA 2ZSKA 1Q6ZA 4KB5A 4LNUA 3UMJA 1WDLA 4RIHA 3FDFA 5ALLA 2HPZA 1SEPA 1SOWA 3K9GA 5KX5F 3EWSA 3EEOA 1Y6RA 3EAQA 4RDIA 3S28A 4HDRA 1OFHA 2AW3A 2VKQA 4I8IA 4JT4A 3R7DA 5F76A 1QM5A 3R6WA 3L1IA 5B1SA 4BLSA 4DXAA 4M89A 5AJWA 5HW0A 3U61B 1P0MA 1YDGA 1XQ6A 4CL8A 2HA0A 3KHUA 3QPAA 3VC1A 2BN4A 3UO8B 1S8NA 3CIOA 2P4QA 1K63A 4MV3A 5B7NA 2HQSA 2GN9A 3ZQUA 1GG9A 2F3PA 5EESA 2FR8A 1OOEA 5IH7A 3C8MA 5FOTA 4N12A 4AUEA 2EP8A 2VWQA 2GJ8A 2YN0A 3AJDA 1XEXA 1KIAA 4PG8A 3HY3A 4XDYA 1YRYE 4ETNA 5B3JC 5KKAA 3Q8LA 2EQ5A 3PV0A 2PA3A 4RE5A 3UB2A 4D3XA 2QDKA 4XJVA 2I1WA 4UM7A 3L7NA 4PZEA 1DAEA 2E55A 2OLKA 2F1OA 4RVNA 3SQMA 3U7QA 4B2PA 3LX8A 5KSWB 5LMNB 1XCMA 4YVFA 1M2JA 1FNCA 3WGQA 4A36A 2CL5A 5E7QA 3EGXB 5HCNA 4CV2A 13PKA 2IHUA 1SZPA 1W4CA 2QLMA 5LZ4A 3GVHA 4AMUA 1M75A 4K6HA 4IGIA 1Q15A 4LRXA 4CF4A 2O5CA 3DVAA 4XOUA 1ZM3A 4MGKR 3KUXA 2EHJA 2H7YA 2D8AA 2PVSA 2QE7D 2Q4TA 1E2IA 1JIIA 2RKBA 2JGEA 1I80A 3QNMA 5K2OA 2RHCA 2RH5A 3I2YX 3T5CA 2J85A 2ZI4A 3HN6A 5EJ7A 1W36C 2J3QA 4KREA 1CJBA 3H9CA 3CJTA 1H2RS 4CR8A 1D1QA 1JH8A 1Q1NA 1HPLA 4KFRA 4ZVPA 4CMBA 4LJRA 1XR3A 1JT2A 2WABA 1T4GA 1EFLA 1GL3A 1NMYA 1Y81A 1EZ4A 2I71A 4AJIA 3CURA 4TMFA 4CLOB 2BH2A 1FBNA 3FAKA 3TZBA 5I4IA 5FTNA 4WFQA 4NCJA 3WDMA 2BP7B 3IDQA 1GT91 4XXHA 3COZA 3CUVA 5C1BA 1XHEA 4KWEA 1ISFA 2L82A 3D4PA 3NC4A 4B3IA 1ID1A 3D02A 4N54A 5DM0A 4XR9A 2GKSA 4P4UA 1WBBA 2OEPA 2VHVA 3H9UA 1PZNA 5G0WA 1A9XB 1P77A 3HBLA 4AO6A 1BS9A 3WLHA 2C4WA 2XSZD 2Y27A 3EXG1 4QXMA 2WOOA 3ODPA 3ZE2B 5K01A 1UK6A 2GZ3A 1N2EA 2QZSA 2GFQA 3IV9A 3FHTA 4DV6B 4XWOA 1MA3A 1U2ZA 3GQBB 4LK3A 1YFJA 4LWQA 5FOSA 1Y4DE 1MRNA 1VE7A 1W52X 2MOKA 4MRVA 3EVAA 2YL2A 3UYLA 5COQA 4DR3B 2C3YA 3LPMA 3EXIA 5FEUA 4K9LA 1MD9A 2G7ZA 1M2VB 2VPZA 3T3EA 4J1QA 1NE2A 2ID8A 3OZUA 4WLFA 5FYDA 5CA0B 3F9CA 1MW8X 3KR9A 4UTVA 4BO3A 2V45A 3TBKA 1IDOA 4E09A 3BSYA 4OYYA 4PANA 1RYFA 1WXWA 2CFCA 3LL7A 3OQPA 5AHOA 4AS1A 3IHLA 2NZWA 4R31A 1E1RD 1FXUA 4CG3A 4N48A 4BL5A 1FDWA 3IVGA 1FC0A 3EWNA 4B40A 3BZWA 3PPWA 3ZHXA 3RWOA 1FLDA 4JOQA 4DY4A 3T8YA 4DLWA 3RT1A 1EMDA 5KSPA 1EK1A 1NJGA 1MJHA 4R7GA 3WSTA 2Q5JA 1DQRA 1KRHA 1YNSA 2XVZA 3N53A 1JUDA 4R2KA 1MO5A 5BW8A 1R3DA 2O5VA 1S6YA 4DCMA 2HF8A 2XW6A 4WD3A 2QUJA 2WA1A 2NT3A 3E3NA 4MSUA 4XYMA 3KBOA 2GYVA 3JATB 4H6PA 3WLNA 4RDXA 1EBFA 3GCDA 3HO1A 2NACA 4KQMA 1WW8A 1FU8A 3KP1A 3RVQA 3X3HA 2CHFA 5B2EA 4YIHA 1BFDA 4OEHA 1Z7EA 3C5WP 2XCUA 5AO9A 2V3VA 1LDYA 4OB7A 3V6MA 4DREA 3AP2A 3OEYA 4F96A 5K3OA 5HGXA 1FFHA 2ZT6A 1I32A 4PS0A 1JPUA 2DY1A 4DSOA 1TPZA 4CFYA 2WQ7A 3GW8A 3N8HA 3RC7A 5ECDA 5J63A 2ISQA 5DHUA 2K7ZA 5IF3A 3DL2A 4TYNA 2Q2OA 3DMDA 4IHJF 3UVEA 2CFSA 2Q21A 3KQUA 1RAAA 3LDFA 3ICWA 1TD1A 2J87A 5BSHA 2G4VA 2Z56A 3THWA 2LDBA 4GKAA 2YXLA 1SHZA 2CHVA 1R6VA 1B16A 4KIJA 3LPCA 3NWPA 2NP7A 5JTUA 3UJ6A 3MILA 3PXAA 1C9YA 4JJ7A 3C20A 3CNHA 4TV9A 1Z2NX 4ROTA 4V0LA 2QTZA 4B33A 1H22A 1PR0A 4M55A 1TMOA 4EBBA 1ORRA 4WVLA 4UEQA 5DBEX 3F49S 2I7XA 4CQLB 5C3MA 1X7GA 1MOZA 3QPCA 3GA0A 3MWFA 4LDQA 3QUAA 5AVWA 4QGBA 4Q1FA 4DIOA 5KOHA 2YN2A 3C3JA 5L40A 2X4GA 1P81A 1A27A 2PD6A 1WXQA 3QG1A 4LF8B 1FE8A 3L5OA 2OHIA 3M3HA 4OUDB 3UJ7A 2AE2A 3RU3A 1D6JA 3NIBA 2JCGA 4KK3A 1GGNA 2XWBF 4ZVTA 3EXAA 5K8TA 1M6YA 1M1NA 1TQ8A 1L1QA 3FNIA 3E03A 1KDVA 5ISMA 2BUBA 3KL2A 4RM3A 3TLMA 3WFJA 3G0CA 2WM8A 3G13A 5EIXA 3HKCB 3KQOA 4DW8A 3TNJA 1W29A 1ZIYA 3VISA 1ZEMA 1N34B 4NMWA 3OQOA 3MGKA 4J91A 4GKJB 5CYGA 2VK2A 4MV1A 1ZINA 1KRXA 1E9BA 2HWWA 4P7KA 4J7UA 5JNUA 4DDHA 1UT8A 2PMBA 4KC0A 3P71T 2VOEA 3AUFA 2AD5A 5KNDD 2WD7B 4HJRA 4QLOA 3R6DA 3HACA 1T5IA 1PJ2A 5FNVA 5JZOA 2UZ3A 1L5QA 1ISHA 2NUPB 1WU7A 2OM2A 5G1PA 2IFTA 4BAZA 4EHHA 1NQAO 1UZUA 5BOVA 4UM8B 2O8BB 3D4OA 4E1BA 2YHIA 4R8SA 4R2HA 3QVVA 1Q14A 4QQFA 1NFRA 4CKEB 1L5HB 3V8VA 3J7TA 1MP0A 3JRWA 1BEUB 1SD5A 1EAMA 5FPKA 2FZKA 4MJ7A 3O47A 4TZKA 221PA 1E7WA 2IOFK 3FCAA 5CW2A 4ZVMA 2J3IA 3NP7A 2GSWA 2RBKA 1YMVA 2QG6A 2Y0CA 2I2DA 3U4IA 1Z7WA 4QXAA 5K0LA 3QELA 1Y9EA 5JROA 1U9YA 2VJPA 4OOEA 5JRJA 3O4RA 4FMCB 1QYDA 2FNAA 1F0YA 4BTEA 2W2MA 3DBRB 2GUWA 2W58A 1TF2A 4KWIA 4ZQHA 1LBHA 2X6TA 5T57A 4MWCA 3MK31 3WBKA 1UPFA 4UTPA 1T1SA 1C7QA 4GVLA 3E82A 3FOAA 3IAFA 3KE9A 1DFIA 1IH8A 3QLUA 4YB8A 4E2ZA 2NO9A 1BTOA 1TAGA 3PJRA 4C21A 1TAQA 2PG3A 3AYZB 5CURA 1Q0UA 1XZAA 2WMDA 4CW7A 3EC7A 5C1OA 5EZSA 3O93A 1OA1A 2D54A 2OCBA 3WLLA 1D2AA 1D1TA 1E9SA 1X3LA 3NTXA 2V7TA 3SVLA 3ZI7A 1L8OA 4YAWA 5CVVA 3HGMA 1OY1A 3K15A 3KZXA 1IZ7A 4M8LA 1DEOA 2IYLD 2ROQA 2CLKB 2YW9A 1E7SA 2WT9A 3VHQA 3WTBA 4BFCA 3AB3A 4Q1VA 1UC8A 4M87A 1VKOA 3TTYA 4Z49A 5AW1A 1MBZA 4R1LA 4L4YA 5EE9A 1C3JA 1J06A 1DEAA 3W5SA 4ZK2A 4KPEC 4G4JA 4ZVQA 1ODJA 1OYYA 2OHJA 4MR9A 2XNDD 1JHZA 1VECA 1PG0A 3M33A 1SY7A 5K20A 1POXA 1HYEA 4JSYA 3D3WB 5DSTA 2GD2A 3BWEA 3G5LA 5JG7A 2AI2A 1R4NA 1T3SA 4QGGA 1Y1KE 2DUNA 3FVRA 3VBEA 5C8YF 5IVKA 3VUFA 3X1MA 5AD1A 2IYSA 4WZAA 1PSWA 2Z2JA 3RU2A 3U9SA 4LC9A 1BH6A 4DSAA 3VO8A 4NC9A 1RQRA 1YE3A 3D1LA 1PGQA 1I6LA 5EZ5A 4D4LA 3Q88A 1XSEA 2ANBA 2VZLA 2WUEA 4FBMA 5G4KA 2OV3A 4CKCA 3GJ5A 1L4UA 4IXTA 2CUZA 5T67A 2Q6TA 3ZEAA 2WHPB 3T1NA 4EKDA 1HNNA 4EMBA 3HK2A 4M0KA 4I14A 3Q87B 7MHTA 3C3KA 2ONYA 2FZ4A 4DB2A 1YVRA 2ZIGA 2DLDA 3QX8A 4FEEA 1XJ0A 1N7IA 2QBYB 3UMCA 3KVYA 5LFAA 4FYYA 3GFSA 1WE2A 1KKMA 3CWCA 4YJ3A 5FBZA 1KDOA 1S3GA 3IMFA 4MCJA 4IBOA 2ECFA 1PL6A 1MO4A 2VDRB 4FPXA 3O4IA 2IE8A 2I7DA 3BGSA 2UZIR 2CLHB 2DFLA 3X1DA 4MIKA 1EFCA 5BVHB 2OFWA 2AJTA 2KBEA 3CKYA 3EQ9A 3KOYA 2GAOA 3SXUB 3X1WA 3D8RA 3EC2A 2FJ0A 2Q49A 3RG8A 1OHHD 4I1VA 3HUUA 2BL4A 3VDXA 3OMLA 2RARA 2DOKA 3IBYA 5FP0A 3NEAA 1KMNA 2YV5A 5C80A 4FFBA 2CJWA 4K86A 1E2DA 2N0SA 3WK8A 1YB6A 3QY0A 4ZVLA 1T8WA 2HDOA 5L3RA 1VBFA 1TCAA 3OU7A 5C18A 1JMYA 1JKIA 4CFSA 4ICIA 1KR5A 2CSUA 1K5GA 2AHRA 4G4SP 2QY6A 1HYGA 4FINA 4Z2AA 1ISSA 2V55B 3MLAA 4DVGA 1GGHA 4QG3A 821PA 1BJTA 1XJWA 1OR8A 5A03A 1PJ3A 4RKRA 2PZMA 1K4KA 3AETA 1P9LA 3HADA 3SXJA 3WLKX 4JVMA 5HUJA 4L7VA 1U2QA 4BJHB 4N8DA 3ZY6A 4MUFA 2GRAA 3WGGA 2A4KA 3LXMA 3SPXA 5A3JA 1P6QA 4LJ6A 4UPDA 1UXJA 1P9RA 4NBTA 5AQEA 5HX7A 1JDZA 1P2BA 1N3LA 4IDCA 2HFJA 4BLWA 3PDCA 2OHXA 1YZKA 2ZYWX 1YS6A 3G23A 4QVGA 2AF4C 4Z7JA 4EKGA 1I24A 5MFZA 3A1CA 4HP8A 4RANA 1PWEA 1DP4A 4NKRA 4FP9A 2B0JA 3BQMB 4YP9A 2HREA 5DHQA 3ZCTA 2D3WA 2Q3DA 1NMSA 4JT2A 1CQJA 3HTXA 4QPNA 2D2XA 3TIFA 5JH7F 5EG5A 4IMPA 1JI3A 1I01A 4IMJB 3DFMA 2XECA 1WCIA 1X86B 4GP6A 5DI3A 3HDGA 3IEPA 1RYNA 2I5PO 5C34B 2QQFA 2YW2A 3ADKA 3UJHA 2P4EA 2Q0SA 2XQFA 1WCYA 3TO5A 3DFZA 5KQMA 1YDMA 1F8XA 2VDMB 1D2GA 5E6SB 4NY1A 5HJ2A 1CUBA 4MGYR 1J2JA 1XDUA 2GM5A 5EJ9A 4C4TA 2EL7A 1Z17A 1H65A 3ESCA 3L6EA 4RKYA 5HDQA 4BGUA 4E5MA 3D0KA 1D5CA 1P1HA 2RGBA 2FK7A 2WYHA 3AUKA 2B99A 3C3CA 3FUUA 4PZ9A 4TQ9A 4ZPXA 4ZQEA 4B80A 1PYGA 4OMCA 4DCOA 5JCOC 1EQ2A 1MABA 1RPJA 1KORA 1Y7IA 2Q0QA 1XC7A 4D43A 2A0XA 1PZEA 4MWDA 3PSAA 3SJAA 5DLQC 5DTEA 4BX9A 3W7AA 2EYUA 1H5QA 2HU2A 2QRJA 3UJ3X 4F6LA 5A5FA 1OASA 1ZLXA 2V54A 2SKEA 4ZKEA 1IZZA 1U1FA 1J8DA 3DDWA 4CIYA 4BB9A 4UU1A 2CNKA 3SFTA 3TIVA 3I6MA 4G1EB 2FAXA 4C6RA 3IUBA 1O5IA 1QK4A 1V96A 4YFYA 1EZ1A 1VI5A 3DOOA 3WB9A 1NYLA 2L0XA 4B6OA 4ZEWA 3VSBA 4BP8A 3DLHA 3WYFA 2QTVB 1HORA 3ZD6A 3BTVA 3I4CA 4OQPA 4D3SA 4JFAA 4ENPA 1S2OA 2AEFA 3Q6IA 3QUSA 5HM6A 4ZODA 4LJKA 3OLCX 1F4PA 3K9LA 1A97A 3TZKA 3K96A 3VV2A 4UUPA 3SIWA 4ITVA 3FCOA 3KPJA 2R7MA 1ZMRA 3MOSA 1T1EA 1X1AA 4YCCA 3WGMA 1SHUX 3HFSA 2C5EA 4QJ5A 4EG6A 1JA1A 2EF0A 3B8HA 4Q05A 1L3CA 1V5FA 2QLFA 4QFDA 2X23A 3BWDD 4IXMA 2J5KA 5A3SA 2QYTA 2OK7A 3VZRA 5A02A 4BRZA 4WESB 5E7MA 3IP1A 3BHJA 5EXSA 4XWTA 3T12A 2QMYA 4NOJA 1KJ8A 3QLUC 1VCOA 1TX4B 2GXSA 1ORWA 1U9CA 3SC3A 1IXYA 3HV0A 1O6ZA 5M29A 1IY9A 3DWIA 2O9JA 3WRXA 5K4HA 3QYJA 1Q74A 1W88B 1ARZA 3D54D 2AEJA 4TLDA 5BO5A 3PDIA 2YY6A 4ZC8A 4U7HA 2V7EA 1C9DB 4Y2TA 1CR0A 1XTIA 2Z5LA 4GLOA 4UMFA 1MEEA 2I7TA 3FTNA 1TO1E 3KSUA 2A9QA 1N6HA 4JR0A 1JWLA 1E0KA 1C1DB 1X9HA 3C24A 3GJTA 3OJEA 3RDPA 3WNQA 4C3UA 1MW9X 1CB7A 4UXIA 4ZCPA 1QHHB 2P4SA 4AY2A 4PPGA 4FB4A 3B38A 1J2RA 4NXMB 3S2SA 1AO0A 4B5LA 1DT5A 1F6DA 2DWOA 4MKRA 1EFTA 1R0SA 1CS4C 1TJ4A 2QMQA 3F73A 1HRKA 1XA4A 2PAFA 3IAHA 5CNIA 3RVJA 1RHMA 2BSXA 5KJEA 2FPWA 2PH5A 3PUXA 2Z58A 1W0JA 2ES4A 3LCRA 3TNDA 1KO1A 1QYRA 2ZUEA 2IPAB 2NSJA 3H4MA 2NU8A 1DAOA 2F64A 4WINA 4HGPA 1YR8A 4F56A 2KJQA 3KJEA 4O3FA 2BV3A 3AOEC 5F2NA 2EWMA 4J7XA 2PZJA 5DM4A 1ZM2A 1PK8A 6AT1A 4K87A 5K45A 3QENA 1PBNA 2EQBA 4UHFA 2REXB 1ORDA 2GN8A 4B3TB 3ZOZA 4KRYA 2IS6A 2XMGA 1CDZA 3LW7A 4MCIA 3RK0A 4EIWA 2JJ1D 3H0CA 3LQRA 3U3KA 3I2JA 2WV9A 1OW3B 2Q3JA 4RVOA 5EAIA 4RKFA 1C3EA 4E12A 2GPNA 2XRYA 2LCQA 4U3JB 4LHXA 2HW8A 1FVHA 4YX9A 1OLOA 4YJ2F 3OZEA 5KCMA 4N49A 2CEAA 1QQ7A 1JG3A 4B6RA 2R4TA 1L7RA 2Y66A 3JASB 3P52A 1HNWB 4JUCA 3S2YA 1VJRA 2C9BA 3DWFA 1GQSA 2B2CA 2QT1A 2EJBA 5AKGA 4G07A 2D5AA 4MVJG 4KRGA 3TFOA 5EP1A 4G63A 1AZSC 4LTNA 4XCXA 4BU1A 1FJ2A 1LW7A 3K09A 1E2EA 4UM5A 5B1EA 4WL0A 3WBJA 5BQ3A 5AI8A 1SHTX 2DZDA 2RKOA 4X44A 2RAPA 3EYWA 3HJTA 4I2VA 3VV3A 3Q2IA 2CL7X 3PJDA 4E7OA 2OPHA 2HHJA 1DJMA 4E51A 4ZCMA 2I4RA 3ZV6A 3HBAA 1H66A 2IELA 5ELLA 5J2TA 4GNKA 3JVEA 4ESVA 1DDIA 1FW6A 4V2UA 4AL4A 4ZTUB 4QNRA 1EFRD 3OBBA 3CWQA 3ICEA 3HDVA 2GD0A 3EODA 3ECSA 1JDNA 4C03A 3F6CA 4EJMA 3LD9A 3FAZA 1FIUA 3HNRA 3I4LA 3NMUF 1C3XA 1AE1A 3ID6C 1OIWA 1X13A 3TSYA 2HK7A 3DLBA 4KMMA 1NP7A 4IJUA 2FQXA 2HCFA 3E58A 4CHGA 3NHPA 4YI3A 2BKLA 1PRYA 3TDKA 4ERNA 4LDNA 2ZVJA 4S24A 3KKMA 3UKDA 2RHMA 5JXIA 1Z6GA 5JNTA 1KRWA 4JYCA 5IT9A 1UMDA 3W2IA 3RS3A 3TW0A 4YMTA 2PVPA 3PQEA 4KQJA 4FJ0A 3JU3A 4OIMA 2V6FA 3SHWA 3ZJUA 1M5UA 4XGIA 1KZHA 4YRBA 1GGJA 4F2GA 1W5SA 3LXXA 2C4VA 5T8KA 2R7KA 1EFAA 2CHUA 3IQIX 3R9XA 2FZVA 1JJ7A 4B74A 2OECA 3IAM6 4K7JA 1XN4A 4II3A 2A14A 3N0VA 4CLDA 5JZBA 5KYTA 3FWPA 4DV0B 2Y3IA 2J3HA 1XX6A 4Z4HA 1ADGA 1N77A 4WUTA 3LPLA 1GD1O 5KUTA 2VWGA 1W5EA 5EJMA 4BMSA 1VIYA 3HEMA 4HFNA 1WG8A 3D6UA 1U2GC 5EVJA 3ORSA 5GVRA 3GN2A 1TDJA 2FWPA 2Z30A 3ISTA 4NECA 4WEOA 2J0UB 2Y68A 1DJQA 3AKCA 3ABQB 3WG9A 3DOFA 4S0ZA 4OXQA 4K1LA 4RD1A 5E9JA 2M32A 5B2ZA 3WYBA 5KPJA 5TT1A 1CYDA 4JCOA 1J5PA 2PQ2A 3IJEB 3R3YA 4JJIA 1JLKA 2OAP1 2AJDA 4EF4A 3T5PA 1UOQA 3DHNA 2O2HA 1XAHA 5FUMA 1XOIA 4OFWA 2XGMA 5EMKA 3SSNA 3UC5A 1KK2A 3UB4A 1Z73A 3E15A 3IUNA 3PUZA 3LTNC 2P3QA 2I4TA 1Z33A 4B6SA 1WSWA 1KZ7B 1ADFA 5G02A 4N7BA 2PGNA 2QTRA 2ZBFA 3IE2A 2PYZA 1ZH2A 4PF1A 1A88A 1E1CA 1Y80A 3K92A 2ZBVA 3LP8A 3Q9NA 2LZ0A 3TQTA 3ZWMA 5KSYA 1KZGB 1I36A 3A3NA 3FDZA 3PR3A 4AICA 5EWJA 4BO7A 4MR8A 4YT4A 2BD0A 1QU3A 1VLMA 3PQ6A 4O63O 4X61A 2FQWA 4IIHA 1NE7A 4UUAA 3HCPA 1Y6QA 5HKAA 3NVKI 2DUJA 4YIKA 1VMDA 4G4GA 1R0YA 2JLBA 4EB0A 2BMWA 5DGXA 1G5TA 1BVRA 3FMIA 1O6FA 3HABA 2HNKA 4I66A 1R6UA 3HCWA 1U2TA 3FNHA 1H0HA 2PSEA 3FZYA 1GTSA 1KNXA 2CCKA 3DVQX 3EJWA 5CDUA 3LZ6A 2UV8A 4CIWA 5JADA 4BLOA 3RU9A 2H1SA 1XDSA 4Q5IA 1WMEA 2AJ8A 3CF4G 3ULKA 1YZVA 2FW1A 2JJ2D 3CT6A 1T1JA 3D5EA 2CXHA 3SC4A 4XD7D 4F9FA 5CG2A 1GTMA 1SCJA 5F5XA 2X4DA 4RD0A 1AZWA 1QBGA 2DBRA 4LVOA 2Y05A 4RPKA 4LZJA 2XTJA 1XCJA 3I8XA 3QV2A 5FPTA 4YRAA 4BNWA 1OIVA 2R62A 1YCFA 2HDNB 3WO0A 2NU6A 2Q8QA 3TLAA 2P8JA 2C2BA 4JLWA 1GGKA 3RRMA 3ZIUA 3TGPA 2XYVA 3HB1A 1GKLA 2AHOA 3QWIA 4MA0A 4ZIRA 3IPXA 1OZAA 2YXEA 1EK5A 1A98A 3HN7A 3K0KA 1B8NA 3NIWA 3OP4A 5DI3B 5JVDB 5I6DA 2BKVA 3GLGA 1L5RA 1KDPA 2F00A 4CMJA 3PZRA 5CDYA 4KKVA 4HATA 5JD5A 5JNRA 2DE0X 1SJ9A 1T6XA 1PD1A 3BCRA 3AGPA 1K06A 4GR5A 4AF8A 2QXUA 3BM5A 1N9GB 1BXRB 1RSZA 1V9CA 3ZHCA 1DI0A 4DIBA 1QAQA 5JANA 2WHXA 1UP6A 3VR5D 4YRNA 3F8TA 5D00A 4UUMA 1WM1A 2ICAA 3HYTA 4RK7A 3VPSA 1L5YA 3WXBA 3BRWA 2VK4A 2PJUA 3UOGA 3ZZNA 3NAMA 4QUDA 5J4KA 2W9XA 3OMWA 2Y1KA 1XTZA 5GPBA 3GJZA 4DCCA 4RIFA 3L0YA 4M6WB 6Q21A 2A3NA 1E3WA 2A0KA 3OSUA 3QKWA 4FCCA 4H17A 2QPAA 4LYYA 2PSFA 3QPBA 1L5ZA 3U3OA 4JLPA 1KO4A 1GN9A 1T5HX 2NTYC 4IVQA 2DF8A 3KUKA 1EGMB 4PS1A 3NVAA 1N6IA 3KKOA 5BV0A 1UWCA 3L1KA 4TMZA 5LM3A 1AKEA 1H0RA 3IOMA 4RH0A 4C0JA 3NGXA 1V9SA 2Q45A 2XNCA 4XI9A 1Z15A 5AVVA 3AVPA 3IHTA 5FUXA 2JH8A 4L02A 4N47A 1KQFA 2IQ5A 1IATA 3ZBUA 1HQDA 4JC8A 3ZK7A 4MGEA 1LRLA 3H5WA 3OETA 4ZC1A 3B36A 4ZEOA 1COWA 3KOUA 1LU9A 2EW2A 5CT4A 1HX7A 2DPXA 3KT6A 5I5GA 3ND5A 4U7JA 4ASUA 2WWYA 2QRQA 4Q34A 4C0BA 3GLFE 3BJMA 2Q41A 3FXAA 3L9WA 1DXYA 1N5MA 3IIJA 3KAQA 4FJ1A 5BN1A 3S40A 3SHFA 1U90A 2ZROA 1AGNA 3G8BA 1ZK0A 4AP6A 5F1PA 1Z12A 5KYXA 1F4VA 4DLUA 1Q5PA 2R8PA 4X95A 5AKLA 2PKQO 1R9MA 5TGDA 4D98A 5B4TA 5DCYA 2PX2A 2RBEA 3NRJA 2VXYA 4MQFA 4W5WA 3PUWA 3P4YA 1AS2A 1Z0FA 1IQPA 4IUYA 3TSCA 3ZGNA 2WVJA 5I7OA 3GWGA 2PUGA 2O19A 1T9DA 3Q0IA 4HB0A 5DWQA 3MCZA 3GFBA 4AIRA 2WF5A 1J2YA 5CITA 1GSAA 1YJBA 4LRTB 4QUHA 3UWOA 5CXXA 3IDFA 1P7YA 1LUAA 3UWPA 2YJNA 3GCXA 5FRDA 4KWCA 1EBUA 3TYXA 2P90A 1JJVA 2G6BA 4DYDA 3EZ9A 4MW4A 2YJZA 4LOHA 2VYNA 3KXLA 4P7JA 5IAEA 1NJ1A 4C4SA 4DAEA 1C3VA 2OCYC 3FOWA 3GLHA 3COVA 1TCBA 4Y2YA 4B79A 2H4JA 1V11A 1C50A 1D6SA 3T6KA 1W581 3GJ8A 1Z37A 1SVIA 2X40A 1NNLA 4C01A 4Q48A 4QM6A 1CZHA 4YRCA 4URWR 4R4JA 3IMGA 1IG0A 4WOBA 3FDIA 1TADA 2GXQA 2J6CA 2YV4A 3CXUA 1YJXA 2R44A 2VJYA 1PJRA 1AH2A 1NIJA 1SXIA 2CZGA 3ASZA 5JMOA 3DOIA 1E2QA 1AZTA 4A0QA 5T8KC 2N1MA 1Q2UA 2IXBA 2VF7A 1K5DA 2P9YA 3GRUA 3Q0EA 3G2PA 4JS0A 3BFJA 1RNLA 1SFRA 1UC9A 4S2UA 4WBSA 4CN8A 4E5DA 3OTQA 1GRNA 5EHZA 3DDOA 3C4QA 4MZDA 1JJAA 4MW1A 4PG7A 1K89A 1LKZA 2RJ3A 4WE3A 4MYCA 3HXKA 5DEIA 1T35A 1DBSA 3UMVA 5IJ0B 2G82A 2ZYRA 4DMLA 4GM0A 3R74A 1DKQA 1YDEA 2NXJA 2PLWA 2XBMA 4YAEA 1ECLA 2QRKA 1VE1A 1X1SA 1WXHA 4BC0A 2GNPA 5CFOA 1TNDA 1IXZA 3KUDA 5H70A 2P4HX 2ZBEA 4DBLE 1EG2A 4IQFA 4URFA 4KX5A 5EE1A 5JSZA 2IPOA 3M6XA 1CU1A 1LSSA 1RPNA 3ENWA 4PNPA 1Y5RA 2TSYB 2HU8A 2DY0A 2WPDA 3KZNA 3OIUA 4NPCA 4O0LA 5I9BA 3X2SA 1BVYF 3O8CA 1A9ZA 2R751 3SP1A 1GKYA 2HMTA 4HXGA 5DBFA 1EWRA 2YYAA 3AESB 3LT5A 3NFYA 1EHCA 4PNEA 4WA7A 5TEVA 5B3KA 3WGIA 4QLBA 3N59A 3K53A 4DWWA 4ZJZA 3QMWA 3UENA 4DR2B 4CIVA 1VL0A 2HNAA 2XCIA 3PC8C 1U7OA 1QHNA 1I6MA 1Z56C 3T7DA 1PEKE 4Q7MB 2IX3A 4QSHA 4YI5A 1J90A 3H4VA 2W0MA 5HYVA 2G8NA 3NU1A 3O3OB 3WDLA 5CFLA 2EZ8A 3K73O 1RAGA 2I54A 3NNDA 1YHYA 4JLBA 4NCHA 5AHKA 2WSIA 5FBHA 3HXMA 2O1SA 3T9CA 4OP3A 2LE0A 2BMAA 4TTQA 4NV0A 5KEIA 2EZ9A 5BN3A 2HRZA 1FZQA 3C16C 4OQLA 4A8JA 4C9BA 5FWYA 4M0MA 4G5XA 1ZGGA 3TTUA 1PYDA 3Q3HA 1FDOA 1D1PA 5KTYA 3WAGA 3IODA 1WL8A 3ZE6A 5JZ9A 4BQSA 2I2FA 2PMCA 5IWAB 1RJFA 4E5KA 5TRTA 1QGYA 3BB3A 1HNZB 3ABIA 2CCJA 3I1IA 1T36A 1CUYA 3GFOA 3MAGA 3D59A 3UATA 3KOOA 5HS4A 2A2ZA 2UVPA 4BX3A 3AUXA 1KXJA 2QL9A 4KN8A 3RYFB 3DEIA 4KQXA 3CZMA 3PE4A 4O4JF 3WK5A 1QIDA 2C54A 1RYBA 3NPMA 1N8TA 4P38A 4P53A 3O83A 3RYHB 1TUBA 2Y0DA 1P31A 1J6UA 4M9ZA 3THRA 3C0KA 1L8LA 1EP1B 3FDJA 4DRXB 1XD2B 5H3HA 1RDFA 4NAUA 3FBWA 3ONEA 2IH2A 3HCBA 2Z4SA 1PL0A 4ZOLA 3DV0A 3H2GA 4BNLA 1BJKA 1QHGA 2EHDA 4I4NA 4MHSA 2WA2A 3QQPA 3GGJA 3LP5A 2YUTA 1BWPA 2FFJA 1DX9A 2H54A 3VR0A 1XZMA 4AIIA 5LLDA 5DDIP 1E0SA 5BQXA 2NZXA 2PT6A 1YAHA 4K6GA 4AAYA 1G8MA 1V8PA 4O4LF 3DZCA 2QUHA 3WMWA 5IARA 4CDMA 1XDWA 1AUQA 2C3UA 3P19A 1TQ2A 3ZU5A 4FSDA 4UD6A 5J23A 3PDWA 5J9FA 4X8LA 5P8WA 2H4HA 2G3YA 1IIRA 2AG6A 3FCSB 1JDJA 4O0MA 4KGDA 4JQZA 3OQIB 4YAFA 1XVAA 2YYZA 2IUFA 4IIJB 3RD5A 1T13A 1N5JA 4AZSA 4N41A 1ORIA 4DNXA 2EKPA 1W48A 1W30A 2AKAB 2YBDA 2VZ8A 4JOBA 4DA9A 4CLRA 1WB9A 4LZLA 4FGLA 1EHIA 1PN3A 4LKRA 1E94E 1DFGA 1FMTA 2LPMA 4XJXA 4R8LA 3UQYS 5CG1A 4MGHA 4MZXA 3SU8A 2ZUDA 5EIEA 4MMXB 2O0HA 2ZRHA 1HTWA 5L3QB 3WAJA 3OJFA 1ZD8A 3QZUA 4K9QA 2PDAA 3NOQA 2DP4E 1MG0A 1O08A 2XQVA 3VO1A 1J8MF 4JEHA 4DY6A 1UKYA 2XV1A 3GG2A 3N86A 1B7GO 4LWZA 3WYGA 4WXYB 4HWRA 3NAGA 3USZA 4D0NA 5IW8A 5KTTA 1E9AA 2JD2A 5JEDA 4DV7B 2EDAA 2OGUA 1Z36A 3M6WA 4L22A 1ECBA 3GUVA 3OSZA 5H80A 3ZDFA 4I99A 5LXTA 2XA9A 1GZUA 4KU4A 2HC9A 3QKTA 1D0IA 4EZBA 4G81A 4FIDA 1G8GA 4YYZA 2XWPA 3CVWA 5F3WB 2VBFA 4N0MA 2XZOA 1M5RA 2ZPUA 2P9FA 3PQ2A 3BUSA 3CRNA 3HY6A 4P32A 1SUFA 4KFSA 1P9OA 3ETHA 1L3IA 2GPYA 3SEAA 1MTZA 4DPLA 1SBQA 3BAZA 4XIYA 5FOWA 4D6PA 3EZ2A 2ZUUA 3H2HA 4EGAA 3LUCA 4ZJYA 3KUUA 3DBLB 5AJXA 3EQ7A 4IIFA 4TVBA 5FPPA 3K1AB 2UYQA 3F98A 3UV7A 4BNDA 5JCPA 3FSRA 1NVFA 4A2CA 1NVGA 1QHXA 2CMHA 4RKQA 1II8B 3S2EA 2QTFA 4IDBA 3C3YA 4L28A 4QUJA 4X93A 1G6Q1 3PEFA 3QOXA 4UOQA 2WAMA 4AY6A 2O2CA 4LWOA 1KFBB 2NWQA 1FOEB 3GRKA 5EOVA 2ZR9A 3OCCA 5BPFA 1YC2A 4D0SA 1REQB 2HCJB 3IUMA 3UF0A 2SCUB 5E9QA 3W3ZB 2X5NA 4P2BA 4ZN6A 1UDAA 2FCRA 4EI7A 1PHRA 2NZUG 2AZMA 1H3NA 3IE1A 3D6NB 4FW9A 4UDNA 5IJWA 3PNSA 3CR3C 1NXOA 1W59A 5ICFA 3A1SA 3LVQE 3O75A 4ND4A 1QGED 4ESEA 3OKPA 1PR6A 2JCSA 2RHDA 4G0XA 4IUDS 4NP6A 2VJOA 2EGUA 3C87A 4EI8A 4HL6A 4Q18A 2XMPA 4Q37A 4RHCA 3RG2A 2G8LA 3UA3A 3F8SA 1FJHA 1XTRA 2DRIA 3JVUA 3O1JC 1OA0A 5E8JA 3MPOA 3BIFA 5LQDA 3JTMA 2ZM5A 2VTEA 3A9UA 3CQ9A 5EIHA 3KHSA 2PUDA 3PE6A 5FTWA 4NFYA 2RK6A 1HMPA 2IOFA 2YUIA 3BE4A 5TC4A 3KELA 2AF3C 3EDRA 1A8PA 4LECA 4TKZA 5FQNA 4OJQA 2AIRA 3RH0A 3WLRA 2V03A 2I4MA 3ZV3A 4PZYA 1T4BA 1VJ5A 2G6TA 3VKWA 3QU2A 4MVJD 4EZIA 2I91A 1Z3CA 3GOHA 5ALYA 5EGSA 4YRRA 4F4DA 1PW7A 1JEQB 4L4SA 4V1CI 3DZBA 1QHFA 1ZGAA 3WK9A 1YNOA 1T8UA 2UKDA 1NX6A 7YASA 1TVEA 3Q7QA 4Y6SA 2QGZA 3BQ9A 1P61B 3HQ4O 1M2EA 1NNI1 2B9EA 4PBSA 4R05A 3NG1A 2B9VA 3OLZA 1QF6A 2MMGA 4ZQCB 4MLPA 1Z0SA 5DZSA 4XM1A 2M6KA 3UCFA 4DPMA 4F2WA 3ER9A 1V4VA 4Q02A 2A6PA 3T3HA 1TCVA 4QZVA 4J0QA 4U5XA 3AWDA 3QXGA 3MRSA 3OJOA 5IKXA 4J4HA 3HI6A 5EZYB 1TZCA 3TINA 4M1QA 2P3LA 3VMMA 5HF8A 3D4NA 4YREA 3AI1A 2IZ1A 4Z9BA 3GNQA 3R7BA 4LJ7A 1T9GR 3NZEA 3HKEB 3EFOA 1PFKA 4J3JA 2XA1A 1JKFA 1XUOA 1RKUA 2HBZA 1T24A 1VPEA 4MCHA 2PX8A 3GOQA 4NAVA 5U1PA 3INNA 4EQ6B 2FR1A 1V7PC 4OH7A 2AGVA 3FPBA 4P7BA 2C4NA 4QEKA 1OV6A 3A4TA 3VR4A 4B6PA 1SUBA 1IXRC 3RRZA 4BKQA 5K3FA 2XMBA 3A14A 1YSCA 2J41A 1ESDA 3U7RA 2D6FA 2D62A 1PGJA 2QLLA 2O1EA 2Z3VA 3I76A 4QE3A 2X0FA 1E99A 2IPMA 2MT9A 4TTSA 5A06A 5LP1A 3LUJA 1CRQA 2OM6A 1IQRA 1KY3A 2ZJ4A 3E1GA 1MG5A 3K0HA 3MN1A 1ZDMA 4A8JC 1SWVA 1JSRA 3IBGA 2J3DA 1VL8A 5FB3A 5K3SA 1R0WA 3TQQA 1EESA 2GRUA 1FMFA 2NAFA 4FFPA 4XSGA 4UZFA 1XWWA 4RF2A 5I9TA 1EVJA 1OAOA 3LDUA 1FFGA 3NUGA 4RKWA 2I65A 3KG2A 2WWTA 4ZZ1A 4BMOB 2OLJA 2OGSA 3K4PA 4Y30A 3HU5A 4OGKA 3NTLA 1L7BA 3WLMA 4RMGA 3EIOA 3T1YB 1YF3A 4XWAA 1WXFA 4Z4FA 1KI6B 2MDTA 3INRA 1D8AA 3QX9A 3KYCA 4L27A 4WZZA 4D1YA 3ML1A 2WJ4A 3S99A 3AF1A 1LEHA 2QX9A 3L6UA 3QVXA 4IL5A 4UHHA 4JZYA 1FP7A 5FF9A 4ACAA 1FDIA 1JHOA 4DCJA 5LZ2A 4C30A 2Q1TA 2WT4A 4LSWA 4P98A 2QK4A 5HSGA 1GFWA 4RTOA 3TGWA 4GLJA 1ZAYA 4DMMA 5F23A 3ONWA 4TQGA 1UPCA 2CLIB 3IPYA 3F4BA 3ASYA 1RJ9B 2C31A 3H16A 1TT5B 2AG1A 4NMXB 2MCFA 1I7SB 2XUFA 1DQZA 2V7BA 2ZSHA 2BTQB 3BT7A 1TEHA 1QIGA 4JXXA 5T4EA 5E38A 3VPXA 4GGPA 1XCLA 4KXXA 1KYIA 3PL1A 1QIJA 4NLLA 5TQ0B 4WVFA 3EPRA 4ZAWA 2ZI6A 3L9XA 1L7NA 1HTBA 3AHIA 4KH1A 5BN5A 4G01B 4CG1A 3ZOKA 2YWRA 2X3FA 1G4HA 1L2TA 3BIOA 5JCJA 4XQEA 2Z83A 3ROXA 1WPGA 1CXZA 5MGBA 4C22A 2CNNA 2XUHA 4U0JA 5CPFA 2IV3A 4AMGA 2IPNA 1TUEA 2WD8A 4DLRA 4F4FA 3EA4A 3ETCA 2I1LA 2P11A 3F5FA 1I8TA 4M7PA 3VR6H 1U3DA 3TMYA 2Z98A 4E08A 4E11A 1QYCA 1P33A 3PQDA 1OH7A 2FLKA 5FOUA 4DRZA 3VXKA 4M46A 2PMDA 5TQ2B 4C87A 1KJIA 3FWYA 4I9NA 2AOWA 5LMUB 4LHYA 1LD3A 3U44A 1E1QA 1CZKA 4WY5A 4ISBA 1LI5A 4KPUB 3GNTA 2HQBA 4F92B 2FJPA 4Z4GA 4Q4HA 4KAFA 3RBVA 1ST3A 1WAMA 4WADA 1XI2A 3DAYA 3QXJA 1A2KC 2H63A 4RV4A 2QAGB 2XOKA 3B1YA 1QKKA 2K2QB 3OZTA 3EBLA 3HFRA 4U4AA 5K6TA 4J75A 3LYLA 3L93A 3PLRA 1YQ9A 4OFXA 3VR6A 3WYAA 3OUTA 3RS2A 4RVHA 5HA5A 3OPMA 1UKZA 3T7JA 2LGJA 3KS9A 1KGDA 4DZZA 1KQPA 4CMEA 1ZCAA 2OXFA 3L7DA 1VZ2A 3LLCA 5JYCA 2QB5A 4Z3OA 4F6RB 3S2FA 1K7XB 1KDTA 1Q0HA 4WKOA 2WP8J 2Z5VA 3L3BA 4OLHA 1MOSA 1SO8A 1VG8A 1YA8A 3G88A 5EQFA 3PICA 4TSFA 3I5UA 3EVGA 1PEYA 4YUVA 5AP9A 2I9KA 5JO0A 5JW6A 1YS4A 3GLSA 1NGSA 1KJQA 1HYBA 3QPWA 1CJVC 3VYVA 1WETA 1AUOA 1BMFD 1PF7E 4BJ6A 4EA7A 4KRFA 1X1CA 1GR1A 3ETDA 1TO6A 1YVEI 3AHDA 3IAXA 4P7GA 2LR0A 5JSUA 4G8CA 2QN9A 3AIKA 3OY2A 2VHTA 4O5OA 1VA4A 5DM70 4NBUA 3DV9A 5A71A 3UGQA 2I9PA 2JGJA 2NM0A 4D8VA 3ZTYA 2RI0A 1NUHA 1G8FA 1TKRA 1Y98A 3M1AA 4PQGA 2PKEA 2O8NA 1P0FA 2WF7A 3EPHA 4JLKA 4GLFA 1VKJA 1HWYA 2HSWA 2JVKA 1HQCA 2MYNA 3GAAA 4C4PA 1X14A 2Z43A 1JZQA 4IZ6A 3T0IA 4LSGA 3INTA 5D86A 3HL4A 1Z4LA 1VRWA 1VLVA 4HNAB 3PFCA 4PO3X 1M1YB 4CMHA 4IVNA 1O95A 2CFIA 4HADA 4MWOA 4Q6BA 4WDQA 4WCFB 3V8NA 1HT2E 3E7DA 2UZ1A 4KMRA 4V2IA 5C0OE 3SDZA 1RMTA 4MOWA 5GZ1A 3Q41A 2PD4A 4LKOA 4XQCA 2ZRFA 3MUNA 3T7EA 5IAOA 5A1JA 4IF6A 1MXHA 2E4XA 3FBTA 1KHHA 2W2LD 1HNXB 2W6MA 1Q7BA 1YB7A 3GZNB 4WCVA 2DQ4A 2QW1A 4FHEA 4MKFA 3H5TA 3RPEA 1QIFA 1WCV1 4JH0A 1L4HA 1E6KA 2ZS7A 3O8BA 2EWWA 2X8LA 3HCNA 3KQHA 2GD1O 1JIXA 5EWLB 3A2LA 4JLJA 4RPIA 5ENDA 2WLSA 4HZIA 3ICPA 3UY4A 3ZC3A 1W5BA 4GG1A 1UPTA 3IOYA 1DV2A 1Q6YA 2EU8A 3WWCA 1QIHA 3H84A 1S3SA 3KE8A 5K0BA 2CXTA 4CTJA 3RU7A 4G5FA 3RTAA 3QFSA 3P2OA 4U8GA 3W78A 5L53A 2XCRB 2QM7A 5FV7A 2G7MC 4ZVNA 1O2DA 1X8XA 3BERA 3A11A 4KNVA 3FYSA 1SH7A 3G5AA 4LPSA 1CDOA 2Q5QA 3HZHA 3ROZA 4US2R 5K0JA 4L0CA 4Y1GA 3I5XA 2CMDA 4GU5A 1EXMA 1SC1A 2GASA 1JX6A 1N2CA 3UOWA 3RVBA 1SKYB 2I76A 1LBTA 1SCKA 3L7KA 5C32A 4G24A 1DEKA 1KMMA 3KB1A 4MS1B 3ZNNA 1E92A 2JI8A 5ALZA 4UW9A 1BJRE 3LX4A 3D6AA 3M6FA 3V1KA 1BXGB 2C99A 3ZWXA 2VP4A 3MM4A 1XWFA 4N03A 2WTEA 3DDUA 4E2FA 3MXTA 2FSPA 4ALIA 2P3OA 3EC1A 2CFTA 3GMTA 4RS3A 2H1OA 5BXYA 3WGJA 3DNFA 1Y4SA 1HE2A 4DA4A 3PC3A 1UK9A 1H2AS 1VIVA 1XXHA 2QZJA 3ICCA 2YIVX 5EMJA 5J2UF 1EUQA 3COYA 3EZXA 5TQVA 3OIDA 5DX1A 1RRPA 4V02A 4UHBA 3MTIA 1QJCA 3ZLVA 4DM4A 3PZBA 2F3RA 2FEPA 1SEVA 4ND8A 3V9PA 4MB6A 1QVWA 4IO1A 5CGQB 3CTPA 5CCEA 5SY6A 2ZSUA 2PANA 4IIEA 3FUCA 4XAQA 2WHQA 3WMEA 1ZJJA 4ER7A 4MYHA 1M8FA 3OX3A 4QQNA 4G8JA 3AF4A 4NS4A 4YONB 5HCIA 4NENB 3OP1A 1XRMA 3KU1A 3S2IA 4B1FA 2DCMA 4JLAA 1Y8QB 2FLWA 2VCHA 4AJHA 2DWCA 1JALA 4I4TB 4B73A 2Q6LA 5I7RA 3NKLA 3HXOA 2J31A 4HNUA 2RGXA 4XDHA 5DBOA 2NUAA 4NJEB 4NNOA 1LLQA 4AJ4A 4JLOA 1A4UA 2R87A 3H2KA 4G1BA 4P3NA 1F2DA 4G9GA 5T64A 2J9GA 1WHSB 4P4TA 1HY3A 4MARA 3FUWA 2QNIA 1GTRA 4ZAGA 2XMRA 1T2EA 1PTJA 2D3TA 2JFPA 4FKZA 3CRQA 1C8BA 5FDFA 3M5CA 2PS9A 4NIMA 2JIBA 1R7RA 1RKXA 3A70A 4Q1BA 4PHTA 4PX2A 1XLTC 4ZYTA 3HB4X 5KQPA 3QVOA 5IYZF 4CKWA 2FSUA 4HWOA 5TF0A 1SUCA 2I6TA 5G4LA 1W85B 1MB9A 2HCRA 3KEMA 3D0OA 3QE4A 1KSHA 3TW8A 3QKSB 5KTSA 1TYAE 2D0PB 5GGY