3K0TA

Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
KTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVEGIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGSYFSQPYPARAAIGVAALPRGAQVEMDAILVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease L-PSP, putative
publication title Crystal structure of the PSPTO-PSP protein from Pseudomonas syringae pv. tomato str. DC3000 in complex with D-glucose
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Sugar binding protein
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3k0tA00
1X25A 1JD1A 1UFYA 3D01A 3M4SA 1NQ3A 2DYYA 3K12A 3QUWA 1FNJA 3V4DA 4ZK7A 2B33A 2UYKA 1COMA 2CW4A 2UYNA 1QAHA 3LYBA 3K0TA 1XHOA 2UYPA 1DBFA 3M1XA 1UI9A 1J7HA 3KJJA 1ONIA 2EWCA 2UYJA 3I7TA 1PF5A 1FNKA 2CVLA 3KJKA 5HP7A 2IG8A 2CSLA 1QU9A 3ZOPA 3ZP4A 3ZP7A 1QD9A 3ZO8A 2CHSA 3I3FA 3LMEA 3VCZA 2CWJA 3R0PA 2OTMA 1XRGA 2UYNB 3MQWA 3L7QA 1ODEA 4NWOB 3GTZA 5HP8A 2CHTA
chains in the Genus database with same CATH superfamily
4TV8A 3F0DA 3HKEB 2OHWA 3D01A 3BYQA 1T0AA 1NJIH 4ZOLB 1JFFB 2UYKA 1RQ7A 4O2BB 1W5EA 3OW2F 3P4EA 2HQSC 2R751 3O85A 4X1YA 1N8RH 3V3TA 2LBTA 5FNVB 3UT5B 3VOBA 4I4TA 3CG6A 2FGYA 1W55A 1PF5A 3LWRC 3S0YA 2IG8A 1Q86H 2AIFA 3MCAB 4X1IA 1KQSF 4BVSA 1H7MA 2UZHA 3ON1A 1ODEA 2HS4A 1IV4A 5LP6C 3Q8HA 2RHOA 3RA6A 3VO8A 5ITZB 4F6RB 2Q1XA 2YYEA 1XBIA 4O2AA 2I6DA 3CCRF 3CXCF 1R1MA 1VQ4F 2OTLF 5LOVB 5HY0A 3N4ZA 5FJ4C 5IJ9A 3SIUA 5EYPB 3T80A 1DBFA 3AGKA 3LWOC 2EWCA 1W40A 5GONB 2VAPA 3LWQC 3WGMA 1VQ6F 1VQVA 4O2BA 4RQOA 5CA1B 3PLAC 3VYUC 4EB6B 1FFXB 3S03A 5JCOC 4O4IB 3N2GB 3L7QA 2Z01A 5G4UC 5IJ0A 4FFBA 4YJ3B 5CB4B 3HKCB 3K12A 2KTUA 3NMUC 2Q1YA 1W2BF 1VHAA 3LFOA 3J81M 5MN6A 5MN5A 1T0KB 3HWUA 3CYQA 3DDNA 2HRUA 1YQNA 3WGNA 5DCVA 4IHJB 3IMPA 1W5FA 2ALEA 3WGLA 4O4HA 5ITZA 3IEQA 4ZHWA 4TUYA 2GLZA 1VQMF 1YIJF 2BTUA 5JVDA 3U0OA 4BVTA 1X25A 2Z1FA 3FBAA 3JALA 5GONA 4E6EA 2WALA 5JH7B 2QTPA 3WGKA 3HJWC 4B62A 4EB6A 2Z1TA 1M90H 1GZ0A 4HNAA 3CCSF 4X1KA 1VQ5F 2OZBA 1IPAA 3WPWA 3KJJA 3ESJA 5EWRA 5LXTA 3C9UA 3OONA 4TV8B 5HY4A 2NMUA 3CCUF 1OFUA 3ZOPA 3I3FA 4DXDA 1VQ8F 2OTMA 4B5CA 2LCAA 4O4LA 2CZWA 1JD1A 4IHJA 4X1YB 2QEXF 3S0WA 5HY1A 3J80M 1NQ3A 4I4TB 3WPXA 4WBNA 3JAWA 2UYNA 5EIBD 4X1IB 3M84A 4O4JB 2RHLA 1IV1A 5IYZA 5HXUA 3KIZA 4RHAA 1YJWF 2VXYA 3WXMB 1W5BA 3CCVF 5JH7A 3CB2A 3D00A 3PAFA 2QI2A 4ZHQA 1H48A 3IKEA 4O2AB 3ZO8A 5KX5A 2CWJA 3K2XA 4NQ3A 4BVQA 4G88A 2CHTA 3JASA 4PWTA 4LNUA 3M4SA 1CK2A 3FD5A 1SZQA 3FFMA 3CC2F 1YJ9F 1COMA 3JVHA 1Z5WA 1QAHA 2Z1UA 2ZODA 3NK7A 2I6RA 2RHHA 4NUTA 1TUBA 1UI9A 2G9IA 4R40B 5EAZA 5IJ0B 5EO3A 2UYJA 4FFBB 4YJ2A 3C9TA 1JJ2F 2BO1A 3CYPB 1VQ7F 3VCZA 3LDTA 4O4JA 5EZYB 2VAMA 3ERNA 2N48A 1Z5VA 1RQ2A 1TVKA 4NWOB 3N2KA 5HP8A 5CA0A 3JCMM 5B8FA 1RLGA 3KE1A 3G4SF 1KNKA 4O4HB 1W5AA 4TUYB 5GANK 2PMPA 1YHQF 3D54A 2HS3A 3RYHA 2HVYD 5JVDB 4BW0B 4C82A 1ONIA 1X7PA 3J7AR 3JALB 5LYJA 4I50A 5BMVA 4EI9A 2RB9A 2HP0A 4HNAB 4X1KB 1KC8H 1IV2A 4C8IA 3VI6A 5LXTB 2HX0A 1U40A 3GYQA 3VMFB 4KWEA 5EZYA 3CCEF 1Q8RA 3C9RA 1NMUB 1RLUA 4O4LB 3I7TA 3NVKE 1IV3A 2PHNA 2CSLA 1YGYA 3OBWA 1W581 4WBNB 2JNBA 3JAWB 1M1KH 2GVIA 1H47A 1VQ9F 3LWVC 2UYNB 3HKDB 4EI8A 3CD6F 2R6R1 5IYZB 3TD4A 3S06A 3RYCA 4X20A 1KD1H 3OBYA 1FNJA 3QHDA 3HAXD 1KNJA 4X3LA 3RYIB 3TD5A 4ZHQB 1Q7YH 3HTNA 5KX5B 1VQKF 2AIZP 1VK3A 2MQEA 2H6LA 3C9SA 3JASB 3G6EF 3KJKA 2QA4F 4X3MA 4LNUB 5LA6A 1Q82H 3ZP7A 4EI7A 3CMAF 3CCLF 3ELCA 1CLIA 1SDSA 3CC4F 3E20B 3F6MA 1TUBB 2ZOVA 3P10A 1JY8A 1QVFF 4YJ2B 2H8CA 3CPWF 4TZZA 5HY2A 4ZI7A 3JAKA 3IEWA 3HKDA 3K0TA 3MDOA 3FD6A 5GAPK 2UYPA 4DRXA 4G4XA 1TVKB 3N2KB 3RA5A 5CA0B 2LBWA 3JARB 3E22A 3CC7F 1ZWZA 2GZLA 1QU9A 2ZAUA 3LWPC 1QD9A 3RYIA 2BTOA 1YJNF 3S02A 3R0PA 4G4ZA 3RYFA 3F0GA 3IKFA 3B6NA 5C8YA 5GINC 3RYHB 1W41A 5G4VC 5EIBC 3QUWA 4ZK7A 3C8LA 3NK6A 5JQGA 5LYJB 4I50B 1YITF 5BMVB 1VQPF 2HP0B 3I55F 3K14A 3MCQA 1FSZA 3S0HA 4BT5A 2V9YA 4XCQA 2ZVYA 1SA0A 1E7KA 4IIJA 5J2TB 5HXZA 2VAWA 4BT7A 5LP6A 2HP3A 2H8EA 3N4YA 3JATA 3JARA 3I56F 4U3JB 4U39A 4I55A 2B33A 2KTVA 1VQLF 2HRYA 1Q81H 3NVIB 5J2UA 4ZHYB 1RA4A 4C4WC 4BY9D 2W8BC 2IQQA 3VYTC 3RYCB 4X20B 1K9MH 3ZP4A 1U43A 5EB0A 1K8AH 2BTQB 5JCOA 1U3LA 1XRGA 3MQWA 3RE3A 1OAPA 3JAMM 2KG4A 3MBMA 3QTYA 5KMGA 1VQNF 1PXWA 3P0ZA 1W3EX 3SIVA 2IAFA 5FLXM 1X52A 3GHZA 5MN4A 3VOAA 5LA6B 2CW4A 1W57A 3V7QA 4ERHA 3CCMF 3HKEA 5J2TA 2ZVZA 4G4VA 4ZOLA 5HWEA 2ZF8A 1JFFA 4U3JA 3VIUA 2P6YA 1GO0A 4ZI7B 4TV9B 3EORA 4C8GA 3JAKB 5FNVA 3GTZA 3UT5A 2VGNA 2RHJA 4DRXB 1DT9A 4C8EA 2F9ZC 2YXZA 3E1YA 3VTIC 4ZHVA 5GIOC 1YI2F 3E22B 2HS0A 3HKBB 3WGJA 4BT3A 5IT9M 2K1SA 2DT4A 3RYFB 1XHOA 1GX1A 5C8YB 3G71F 4F6RA 3DC2A 3WJPA 3IR9A 5JQGB 5LOVA 2CHSA 4B45A 5A2QM 5EYPA 1VH8A 5GIPC 1XV2A 4LCKA 4BVRA 1X7OA 3VYSC 2DYYA 3V4DA 2L26A 5CA1A 4G4WA 2AMTA 3CCJF 1K73H 3F0EA 1FFXA 4O4IA 3N2GA 3LYBA 5EB1B 4TV9A 4B46A 3CPQA 3CMEF 3FPIA 1SA0B 2Z1EA 4YJ3A 3KHNA 5CB4A 4IIJB 3M1XA 3HKCA 2OTJF 1J7HA 5LP6B 2CVLA 1JN1A 3JATB 4I55B 3HKBA 1U3PA 3LMEA 2LBXA 4M8IA 4BT2A 5J2UB 1GO1A 1UFYA 4C81A 3CCQF 2VGMA 2FC3A 3WJQA 4G4YA 2KGWA 3WJRA 3V7EA 3TD3A 1W42A 1FNKA 5HP7A 5KMGB 1VQOF 5AVMA 1S72F 1QVGF 1CN7A 4BT6A 3F0FA 4BT4A 1W59A 5IJ9B
chains in the Genus database with same CATH topology
1X25A 1JD1A 1UFYA 3D01A 3M4SA 1NQ3A 2DYYA 3K12A 3QUWA 1FNJA 3V4DA 4ZK7A 2B33A 2UYKA 1COMA 2CW4A 2UYNA 1QAHA 3LYBA 3K0TA 1XHOA 2UYPA 1DBFA 3M1XA 1UI9A 1J7HA 3KJJA 1ONIA 2EWCA 2UYJA 3I7TA 1PF5A 1FNKA 2CVLA 3KJKA 5HP7A 2IG8A 2CSLA 1QU9A 3ZOPA 3ZP4A 3ZP7A 1QD9A 3ZO8A 2CHSA 3I3FA 3LMEA 3VCZA 2CWJA 3R0PA 2OTMA 1XRGA 2UYNB 3MQWA 3L7QA 1ODEA 4NWOB 3GTZA 5HP8A 2CHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X25 A;  1JD1 A;  1UFY A;  3D01 A;  3M4S A;  1NQ3 A;  2DYY A;  3K12 A;  3QUW A;  1FNJ A;  3V4D A;  4ZK7 A;  2B33 A;  2UYK A;  1COM A;  2CW4 A;  2UYN A;  1QAH A;  3LYB A;  3K0T A;  1XHO A;  2UYP A;  1DBF A;  3M1X A;  1UI9 A;  1J7H A;  3KJJ A;  1ONI A;  2EWC A;  2UYJ A;  3I7T A;  1PF5 A;  1FNK A;  2CVL A;  3KJK A;  5HP7 A;  2IG8 A;  2CSL A;  1QU9 A;  3ZOP A;  3ZP4 A;  3ZP7 A;  1QD9 A;  3ZO8 A;  2CHS A;  3I3F A;  3LME A;  3VCZ A;  2CWJ A;  3R0P A;  2OTM A;  1XRG A;  2UYN B;  3MQW A;  3L7Q A;  1ODE A;  4NWO B;  3GTZ A;  5HP8 A;  2CHT A; 
#chains in the Genus database with same CATH topology
 4TV8 A;  3F0D A;  3HKE B;  2OHW A;  3D01 A;  3BYQ A;  1T0A A;  1NJI H;  4ZOL B;  1JFF B;  2UYK A;  1RQ7 A;  4O2B B;  1W5E A;  3OW2 F;  3P4E A;  2HQS C;  2R75 1;  3O85 A;  4X1Y A;  1N8R H;  3V3T A;  2LBT A;  5FNV B;  3UT5 B;  3VOB A;  4I4T A;  3CG6 A;  2FGY A;  1W55 A;  1PF5 A;  3LWR C;  3S0Y A;  2IG8 A;  1Q86 H;  2AIF A;  3MCA B;  4X1I A;  1KQS F;  4BVS A;  1H7M A;  2UZH A;  3ON1 A;  1ODE A;  2HS4 A;  1IV4 A;  5LP6 C;  3Q8H A;  2RHO A;  3RA6 A;  3VO8 A;  5ITZ B;  4F6R B;  2Q1X A;  2YYE A;  1XBI A;  4O2A A;  2I6D A;  3CCR F;  3CXC F;  1R1M A;  1VQ4 F;  2OTL F;  5LOV B;  5HY0 A;  3N4Z A;  5FJ4 C;  5IJ9 A;  3SIU A;  5EYP B;  3T80 A;  1DBF A;  3AGK A;  3LWO C;  2EWC A;  1W40 A;  5GON B;  2VAP A;  3LWQ C;  3WGM A;  1VQ6 F;  1VQV A;  4O2B A;  4RQO A;  5CA1 B;  3PLA C;  3VYU C;  4EB6 B;  1FFX B;  3S03 A;  5JCO C;  4O4I B;  3N2G B;  3L7Q A;  2Z01 A;  5G4U C;  5IJ0 A;  4FFB A;  4YJ3 B;  5CB4 B;  3HKC B;  3K12 A;  2KTU A;  3NMU C;  2Q1Y A;  1W2B F;  1VHA A;  3LFO A;  3J81 M;  5MN6 A;  5MN5 A;  1T0K B;  3HWU A;  3CYQ A;  3DDN A;  2HRU A;  1YQN A;  3WGN A;  5DCV A;  4IHJ B;  3IMP A;  1W5F A;  2ALE A;  3WGL A;  4O4H A;  5ITZ A;  3IEQ A;  4ZHW A;  4TUY A;  2GLZ A;  1VQM F;  1YIJ F;  2BTU A;  5JVD A;  3U0O A;  4BVT A;  1X25 A;  2Z1F A;  3FBA A;  3JAL A;  5GON A;  4E6E A;  2WAL A;  5JH7 B;  2QTP A;  3WGK A;  3HJW C;  4B62 A;  4EB6 A;  2Z1T A;  1M90 H;  1GZ0 A;  4HNA A;  3CCS F;  4X1K A;  1VQ5 F;  2OZB A;  1IPA A;  3WPW A;  3KJJ A;  3ESJ A;  5EWR A;  5LXT A;  3C9U A;  3OON A;  4TV8 B;  5HY4 A;  2NMU A;  3CCU F;  1OFU A;  3ZOP A;  3I3F A;  4DXD A;  1VQ8 F;  2OTM A;  4B5C A;  2LCA A;  4O4L A;  2CZW A;  1JD1 A;  4IHJ A;  4X1Y B;  2QEX F;  3S0W A;  5HY1 A;  3J80 M;  1NQ3 A;  4I4T B;  3WPX A;  4WBN A;  3JAW A;  2UYN A;  5EIB D;  4X1I B;  3M84 A;  4O4J B;  2RHL A;  1IV1 A;  5IYZ A;  5HXU A;  3KIZ A;  4RHA A;  1YJW F;  2VXY A;  3WXM B;  1W5B A;  3CCV F;  5JH7 A;  3CB2 A;  3D00 A;  3PAF A;  2QI2 A;  4ZHQ A;  1H48 A;  3IKE A;  4O2A B;  3ZO8 A;  5KX5 A;  2CWJ A;  3K2X A;  4NQ3 A;  4BVQ A;  4G88 A;  2CHT A;  3JAS A;  4PWT A;  4LNU A;  3M4S A;  1CK2 A;  3FD5 A;  1SZQ A;  3FFM A;  3CC2 F;  1YJ9 F;  1COM A;  3JVH A;  1Z5W A;  1QAH A;  2Z1U A;  2ZOD A;  3NK7 A;  2I6R A;  2RHH A;  4NUT A;  1TUB A;  1UI9 A;  2G9I A;  4R40 B;  5EAZ A;  5IJ0 B;  5EO3 A;  2UYJ A;  4FFB B;  4YJ2 A;  3C9T A;  1JJ2 F;  2BO1 A;  3CYP B;  1VQ7 F;  3VCZ A;  3LDT A;  4O4J A;  5EZY B;  2VAM A;  3ERN A;  2N48 A;  1Z5V A;  1RQ2 A;  1TVK A;  4NWO B;  3N2K A;  5HP8 A;  5CA0 A;  3JCM M;  5B8F A;  1RLG A;  3KE1 A;  3G4S F;  1KNK A;  4O4H B;  1W5A A;  4TUY B;  5GAN K;  2PMP A;  1YHQ F;  3D54 A;  2HS3 A;  3RYH A;  2HVY D;  5JVD B;  4BW0 B;  4C82 A;  1ONI A;  1X7P A;  3J7A R;  3JAL B;  5LYJ A;  4I50 A;  5BMV A;  4EI9 A;  2RB9 A;  2HP0 A;  4HNA B;  4X1K B;  1KC8 H;  1IV2 A;  4C8I A;  3VI6 A;  5LXT B;  2HX0 A;  1U40 A;  3GYQ A;  3VMF B;  4KWE A;  5EZY A;  3CCE F;  1Q8R A;  3C9R A;  1NMU B;  1RLU A;  4O4L B;  3I7T A;  3NVK E;  1IV3 A;  2PHN A;  2CSL A;  1YGY A;  3OBW A;  1W58 1;  4WBN B;  2JNB A;  3JAW B;  1M1K H;  2GVI A;  1H47 A;  1VQ9 F;  3LWV C;  2UYN B;  3HKD B;  4EI8 A;  3CD6 F;  2R6R 1;  5IYZ B;  3TD4 A;  3S06 A;  3RYC A;  4X20 A;  1KD1 H;  3OBY A;  1FNJ A;  3QHD A;  3HAX D;  1KNJ A;  4X3L A;  3RYI B;  3TD5 A;  4ZHQ B;  1Q7Y H;  3HTN A;  5KX5 B;  1VQK F;  2AIZ P;  1VK3 A;  2MQE A;  2H6L A;  3C9S A;  3JAS B;  3G6E F;  3KJK A;  2QA4 F;  4X3M A;  4LNU B;  5LA6 A;  1Q82 H;  3ZP7 A;  4EI7 A;  3CMA F;  3CCL F;  3ELC A;  1CLI A;  1SDS A;  3CC4 F;  3E20 B;  3F6M A;  1TUB B;  2ZOV A;  3P10 A;  1JY8 A;  1QVF F;  4YJ2 B;  2H8C A;  3CPW F;  4TZZ A;  5HY2 A;  4ZI7 A;  3JAK A;  3IEW A;  3HKD A;  3K0T A;  3MDO A;  3FD6 A;  5GAP K;  2UYP A;  4DRX A;  4G4X A;  1TVK B;  3N2K B;  3RA5 A;  5CA0 B;  2LBW A;  3JAR B;  3E22 A;  3CC7 F;  1ZWZ A;  2GZL A;  1QU9 A;  2ZAU A;  3LWP C;  1QD9 A;  3RYI A;  2BTO A;  1YJN F;  3S02 A;  3R0P A;  4G4Z A;  3RYF A;  3F0G A;  3IKF A;  3B6N A;  5C8Y A;  5GIN C;  3RYH B;  1W41 A;  5G4V C;  5EIB C;  3QUW A;  4ZK7 A;  3C8L A;  3NK6 A;  5JQG A;  5LYJ B;  4I50 B;  1YIT F;  5BMV B;  1VQP F;  2HP0 B;  3I55 F;  3K14 A;  3MCQ A;  1FSZ A;  3S0H A;  4BT5 A;  2V9Y A;  4XCQ A;  2ZVY A;  1SA0 A;  1E7K A;  4IIJ A;  5J2T B;  5HXZ A;  2VAW A;  4BT7 A;  5LP6 A;  2HP3 A;  2H8E A;  3N4Y A;  3JAT A;  3JAR A;  3I56 F;  4U3J B;  4U39 A;  4I55 A;  2B33 A;  2KTV A;  1VQL F;  2HRY A;  1Q81 H;  3NVI B;  5J2U A;  4ZHY B;  1RA4 A;  4C4W C;  4BY9 D;  2W8B C;  2IQQ A;  3VYT C;  3RYC B;  4X20 B;  1K9M H;  3ZP4 A;  1U43 A;  5EB0 A;  1K8A H;  2BTQ B;  5JCO A;  1U3L A;  1XRG A;  3MQW A;  3RE3 A;  1OAP A;  3JAM M;  2KG4 A;  3MBM A;  3QTY A;  5KMG A;  1VQN F;  1PXW A;  3P0Z A;  1W3E X;  3SIV A;  2IAF A;  5FLX M;  1X52 A;  3GHZ A;  5MN4 A;  3VOA A;  5LA6 B;  2CW4 A;  1W57 A;  3V7Q A;  4ERH A;  3CCM F;  3HKE A;  5J2T A;  2ZVZ A;  4G4V A;  4ZOL A;  5HWE A;  2ZF8 A;  1JFF A;  4U3J A;  3VIU A;  2P6Y A;  1GO0 A;  4ZI7 B;  4TV9 B;  3EOR A;  4C8G A;  3JAK B;  5FNV A;  3GTZ A;  3UT5 A;  2VGN A;  2RHJ A;  4DRX B;  1DT9 A;  4C8E A;  2F9Z C;  2YXZ A;  3E1Y A;  3VTI C;  4ZHV A;  5GIO C;  1YI2 F;  3E22 B;  2HS0 A;  3HKB B;  3WGJ A;  4BT3 A;  5IT9 M;  2K1S A;  2DT4 A;  3RYF B;  1XHO A;  1GX1 A;  5C8Y B;  3G71 F;  4F6R A;  3DC2 A;  3WJP A;  3IR9 A;  5JQG B;  5LOV A;  2CHS A;  4B45 A;  5A2Q M;  5EYP A;  1VH8 A;  5GIP C;  1XV2 A;  4LCK A;  4BVR A;  1X7O A;  3VYS C;  2DYY A;  3V4D A;  2L26 A;  5CA1 A;  4G4W A;  2AMT A;  3CCJ F;  1K73 H;  3F0E A;  1FFX A;  4O4I A;  3N2G A;  3LYB A;  5EB1 B;  4TV9 A;  4B46 A;  3CPQ A;  3CME F;  3FPI A;  1SA0 B;  2Z1E A;  4YJ3 A;  3KHN A;  5CB4 A;  4IIJ B;  3M1X A;  3HKC A;  2OTJ F;  1J7H A;  5LP6 B;  2CVL A;  1JN1 A;  3JAT B;  4I55 B;  3HKB A;  1U3P A;  3LME A;  2LBX A;  4M8I A;  4BT2 A;  5J2U B;  1GO1 A;  1UFY A;  4C81 A;  3CCQ F;  2VGM A;  2FC3 A;  3WJQ A;  4G4Y A;  2KGW A;  3WJR A;  3V7E A;  3TD3 A;  1W42 A;  1FNK A;  5HP7 A;  5KMG B;  1VQO F;  5AVM A;  1S72 F;  1QVG F;  1CN7 A;  4BT6 A;  3F0F A;  4BT4 A;  1W59 A;  5IJ9 B; 
#chains in the Genus database with same CATH homology
 1X25 A;  1JD1 A;  1UFY A;  3D01 A;  3M4S A;  1NQ3 A;  2DYY A;  3K12 A;  3QUW A;  1FNJ A;  3V4D A;  4ZK7 A;  2B33 A;  2UYK A;  1COM A;  2CW4 A;  2UYN A;  1QAH A;  3LYB A;  3K0T A;  1XHO A;  2UYP A;  1DBF A;  3M1X A;  1UI9 A;  1J7H A;  3KJJ A;  1ONI A;  2EWC A;  2UYJ A;  3I7T A;  1PF5 A;  1FNK A;  2CVL A;  3KJK A;  5HP7 A;  2IG8 A;  2CSL A;  1QU9 A;  3ZOP A;  3ZP4 A;  3ZP7 A;  1QD9 A;  3ZO8 A;  2CHS A;  3I3F A;  3LME A;  3VCZ A;  2CWJ A;  3R0P A;  2OTM A;  1XRG A;  2UYN B;  3MQW A;  3L7Q A;  1ODE A;  4NWO B;  3GTZ A;  5HP8 A;  2CHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...