3K0TA

Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'KTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVEGIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGSYFSQPYPARAAIGVAALPRGAQVEMDAILVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease L-PSP, putative
publication title Crystal structure of the PSPTO-PSP protein from Pseudomonas syringae pv. tomato str. DC3000 in complex with D-glucose
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Sugar binding protein
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3k0tA00
2OTMA 2UYKA 3QUWA 1QU9A 2CW4A 5HP8A 1J7HA 3LMEA 2UYPA 3I7TA 1XRGA 2DYYA 2UYNB 3GTZA 3KJJA 2CHTA 1COMA 1DBFA 1XHOA 2CVLA 1FNKA 3R0PA 2UYJA 3ZO8A 2CSLA 2IG8A 3M4SA 4ZK7A 1FNJA 3VCZA 1QD9A 1X25A 2UYNA 3ZP7A 1UFYA 2CWJA 3L7QA 5HP7A 3D01A 3MQWA 3K0TA 3KJKA 1QAHA 3ZP4A 3LYBA 3ZOPA 3M1XA 2CHSA 1JD1A 3K12A 1ODEA 2EWCA 1UI9A 2B33A 1PF5A 3I3FA 4NWOB 1ONIA 3V4DA 1NQ3A
chains in the Genus database with same CATH superfamily
5LP6A 4G4WA 4O4LA 2Z1UA 1YJWF 1RLUA 4BVQA 2LBXA 3JALA 2UYNB 1SZQA 1T0AA 5HWEA 1XHOA 2WALA 3IMPA 4O4HA 1U3LA 1VQ7F 1S72F 3NK7A 4C8IA 3F0DA 2HS3A 1W40A 4X1YB 2R6R1 5CA1A 2AMTA 3U0OA 4DXDA 2CHSA 5CB4A 2ALEA 1RLGA 3OBYA 1N8RH 2NMUA 3HJWC 3LWVC 4ZI7A 2Z1TA 3MBMA 5EO3A 3J7AR 1K8AH 3V7EA 1W55A 5ITZA 1YHQF 3HKCB 4X20B 4I50A 3J81M 2IAFA 5JQGA 2RHJA 3D54A 4U3JA 1W41A 3C8LA 1Q7YH 2BTOA 5EYPA 1R1MA 1KNKA 5MN4A 5IJ0B 1XV2A 1KD1H 2K1SA 3WPWA 1Q8RA 3MCAB 5GINC 2QEXF 3VYUC 1TUBB 1VQPF 3S0WA 3I3FA 5GONA 3JAKB 5IYZB 1QU9A 3HTNA 3RYFB 4ERHA 3CCVF 2IQQA 2DYYA 5J2TB 3WXMB 3G71F 3WGKA 3RYCA 3HKDB 4BW0B 5B8FA 1JFFB 2HRYA 4G4YA 4C81A 1K73H 3K0TA 4XCQA 4WBNB 4YJ2A 5BMVA 1YITF 5HY4A 4IIJA 3C9SA 2CZWA 1ONIA 4RQOA 2UYKA 3CYPB 5G4VC 3G6EF 2OTLF 2OTJF 2MQEA 2CHTA 2OZBA 3CXCF 1FFXB 1DBFA 2CVLA 2ZVZA 1M1KH 3JAWA 3P4EA 4TV9A 3CPQA 2HS0A 3E22B 3CCJF 2I6RA 3OBWA 1FSZA 1W59A 2ZVYA 5KX5B 5LP6B 5KMGA 4O4LB 3JATA 3JALB 1Q81H 3K12A 2VAMA 1VH8A 1YJNF 3I56F 4NUTA 1W57A 2HQSC 3CC7F 5HP8A 2HRUA 5EB1B 5LA6A 2RHLA 5G4UC 4ZHVA 2FGYA 1GZ0A 4BT5A 1W5AA 3FPIA 5CA1B 2ZODA 2LBWA 2RHOA 3G4SF 3F0FA 4BY9D 3WJPA 5MN5A 3CMAF 3S0YA 2HS4A 2Z1FA 3NVIB 4ZI7B 1VQ4F 1OFUA 3L7QA 4X1IA 2Z01A 4M8IA 1U40A 1KQSF 5ITZB 4FFBA 1VQOF 4I50B 5JQGB 3CCQF 5FNVA 4LNUA 3C9UA 2OHWA 4U3JB 2N48A 3VIUA 5EYPB 5EB0A 3EORA 3FD6A 2QTPA 4YJ3A 3DC2A 1GO0A 1H7MA 4C8EA 3M4SA 5HY1A 5FJ4C 2VGMA 3OONA 1JN1A 3FD5A 4KWEA 4B46A 5GONB 4ZHYB 5HXUA 2H6LA 4EB6A 1QAHA 4BT4A 4F6RA 2BTUA 2BTQB 5EZYA 1ZWZA 3RYCB 3NK6A 3CMEF 3JAMM 3E1YA 1K9MH 1Q86H 1E7KA 1OAPA 5EIBC 4NQ3A 1XRGA 2VAWA 2RB9A 4X1KA 4YJ2B 5LOVA 5BMVB 4G4XA 3ELCA 3P10A 2PHNA 4IIJB 3RA6A 3S06A 1T0KB 4C82A 3S03A 3JVHA 2VXYA 3KIZA 3D01A 5JVDB 1JJ2F 3B6NA 3HAXD 3C9TA 4NWOB 4LCKA 3JAWB 4TV9B 2QA4F 1RA4A 3Q8HA 1GO1A 3RYIB 5KMGB 1COMA 4C8GA 2RHHA 3RYHA 3JATB 5C8YA 2UYJA 4HNAA 1W5EA 2I6DA 3DDNA 4ZK7A 1FNJA 3O85A 3VCZA 2V9YA 3KE1A 5HY0A 5LA6B 3VO8A 3FFMA 3S02A 4O4IA 3VOBA 2KTVA 4E6EA 1YGYA 1JD1A 3LFOA 1H47A 4EI7A 1TVKB 3SIUA 3V4DA 4ZOLA 4TUYA 5JH7A 1VQNF 5J2UA 5GAPK 2UYPA 3CCUF 1PXWA 3BYQA 3MCQA 1IPAA 5LYJA 3PLAC 3HWUA 1W5BA 3CCRF 3MDOA 4X1IB 4I4TA 1SA0A 4ZHQA 5IT9M 3JARA 3JCMM 1JY8A 4FFBB 3ON1A 1VQKF 3VMFB 3VOAA 1VQLF 5FNVB 4LNUB 5HP7A 5MN6A 3QTYA 3NVKE 1UI9A 3N2GA 4B62A 2G9IA 2HX0A 4O4HB 1J7HA 2HP0A 4O2BA 3JASA 3TD5A 1VQMF 1YJ9F 3FBAA 3I7TA 3KJJA 1IV1A 4TV8A 3IR9A 4EB6B 1NMUB 1CN7A 1QVFF 2ZOVA 4F6RB 3TD4A 3ERNA 5EZYB 3QHDA 5CB4B 2HP3A 1DT9A 2R751 1IV4A 2UZHA 1X7OA 4C4WC 4PWTA 3MQWA 2GLZA 3T80A 1W581 2LCAA 2H8CA 3LWQC 3V3TA 5EIBD 4X1KB 3HKEA 4G4VA 1VQ5F 5LOVB 4O2AA 3QUWA 1KC8H 4X3LA 3LMEA 5EAZA 4BT2A 1Z5VA 1U43A 2AIZP 3LWOC 3UT5A 3VI6A 3J80M 1YIJF 2FC3A 3WGNA 1IV3A 1QD9A 1SDSA 2QI2A 1NJIH 2GVIA 5DCVA 3LYBA 4O4JA 3CCEF 3M1XA 5A2QM 3N2KA 5IJ9A 4U39A 3RYHB 4DRXA 2ZAUA 5C8YB 4HNAB 2Q1XA 2OTMA 3CC2F 5LXTA 1W2BF 3HKBA 2VAPA 5FLXM 3LWPC 3LWRC 3LDTA 2GZLA 4IHJA 4O4IB 1FNKA 3D00A 3SIVA 4G4ZA 4X3MA 3CCSF 3IEQA 3K14A 2Q1YA 3E20B 4ZOLB 3NMUC 2F9ZC 4TUYB 5JH7B 1RQ2A 5J2UB 5CA0A 3PAFA 5LYJB 5GIPC 3VYSC 3M84A 4BVTA 2B33A 4ZHQB 4I4TB 1SA0B 3CYQA 3JARB 1IV2A 1W42A 2H8EA 3AGKA 3VYTC 2PMPA 3CC4F 1H48A 1RQ7A 3GTZA 3WGJA 3KHNA 4I55A 3ESJA 2KG4A 3N2GB 1X25A 2UYNA 3ZP7A 5JCOC 1UFYA 2CWJA 3VTIC 2HP0B 4O2BB 3JASB 3WPXA 3CD6F 3S0HA 4TV8B 5AVMA 1YI2F 1ODEA 1YQNA 4BT7A 3OW2F 1VQ9F 3F0EA 4B5CA 1X52A 2AIFA 4X1YA 2CW4A 2YXZA 3V7QA 3WJQA 3GHZA 4EI9A 4EI8A 1XBIA 3WGMA 1W5FA 5EWRA 1X7PA 5LP6C 3HKEB 4O2AB 3HKCA 4BVSA 4X20A 2LBTA 5GIOC 3CG6A 4YJ3B 2ZF8A 3UT5B 1VQ6F 4B45A 1CK2A 1KNJA 5HXZA 3WJRA 1NQ3A 3I55F 3N4YA 3C9RA 5JVDA 5IJ0A 2P6YA 1Z5WA 3IKEA 2DT4A 4BT6A 4R40B 3RE3A 3K2XA 3N4ZA 1TUBA 3CCMF 2W8BC 3R0PA 4O4JB 2KGWA 3ZO8A 2CSLA 1VQVA 3IEWA 3JAKA 5IYZA 3CCLF 4G88A 3F0GA 3RYFA 3N2KB 5IJ9B 1M90H 4DRXB 3RYIA 1VK3A 5J2TA 5GANK 3TD3A 3HKDA 3ZP4A 3IKFA 5LXTB 1W3EX 3ZOPA 3HKBB 1JFFA 2HVYD 2Z1EA 4IHJB 1CLIA 1PF5A 3F6MA 2YYEA 2BO1A 3RA5A 5JCOA 4WBNA 4TZZA 3WGLA 4ZHWA 1TVKA 5CA0B 3CPWF 1Q82H 2JNBA 1U3PA 2IG8A 5HY2A 3CB2A 4BVRA 3P0ZA 4RHAA 1QVGF 1FFXA 2L26A 3KJKA 2KTUA 4BT3A 2VGNA 1VHAA 4I55B 2EWCA 3E22A 1VQ8F 1GX1A 3GYQA 5KX5A
chains in the Genus database with same CATH topology
2OTMA 2UYKA 3QUWA 1QU9A 2CW4A 5HP8A 1J7HA 3LMEA 2UYPA 3I7TA 1XRGA 2DYYA 2UYNB 3GTZA 3KJJA 2CHTA 1COMA 1DBFA 1XHOA 2CVLA 1FNKA 3R0PA 2UYJA 3ZO8A 2CSLA 2IG8A 3M4SA 4ZK7A 1FNJA 3VCZA 1QD9A 1X25A 2UYNA 3ZP7A 1UFYA 2CWJA 3L7QA 5HP7A 3D01A 3MQWA 3K0TA 3KJKA 1QAHA 3ZP4A 3LYBA 3ZOPA 3M1XA 2CHSA 1JD1A 3K12A 1ODEA 2EWCA 1UI9A 2B33A 1PF5A 3I3FA 4NWOB 1ONIA 3V4DA 1NQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTM A;  2UYK A;  3QUW A;  1QU9 A;  2CW4 A;  5HP8 A;  1J7H A;  3LME A;  2UYP A;  3I7T A;  1XRG A;  2DYY A;  2UYN B;  3GTZ A;  3KJJ A;  2CHT A;  1COM A;  1DBF A;  1XHO A;  2CVL A;  1FNK A;  3R0P A;  2UYJ A;  3ZO8 A;  2CSL A;  2IG8 A;  3M4S A;  4ZK7 A;  1FNJ A;  3VCZ A;  1QD9 A;  1X25 A;  2UYN A;  3ZP7 A;  1UFY A;  2CWJ A;  3L7Q A;  5HP7 A;  3D01 A;  3MQW A;  3K0T A;  3KJK A;  1QAH A;  3ZP4 A;  3LYB A;  3ZOP A;  3M1X A;  2CHS A;  1JD1 A;  3K12 A;  1ODE A;  2EWC A;  1UI9 A;  2B33 A;  1PF5 A;  3I3F A;  4NWO B;  1ONI A;  3V4D A;  1NQ3 A; 
#chains in the Genus database with same CATH topology
 5LP6 A;  4G4W A;  4O4L A;  2Z1U A;  1YJW F;  1RLU A;  4BVQ A;  2LBX A;  3JAL A;  2UYN B;  1SZQ A;  1T0A A;  5HWE A;  1XHO A;  2WAL A;  3IMP A;  4O4H A;  1U3L A;  1VQ7 F;  1S72 F;  3NK7 A;  4C8I A;  3F0D A;  2HS3 A;  1W40 A;  4X1Y B;  2R6R 1;  5CA1 A;  2AMT A;  3U0O A;  4DXD A;  2CHS A;  5CB4 A;  2ALE A;  1RLG A;  3OBY A;  1N8R H;  2NMU A;  3HJW C;  3LWV C;  4ZI7 A;  2Z1T A;  3MBM A;  5EO3 A;  3J7A R;  1K8A H;  3V7E A;  1W55 A;  5ITZ A;  1YHQ F;  3HKC B;  4X20 B;  4I50 A;  3J81 M;  2IAF A;  5JQG A;  2RHJ A;  3D54 A;  4U3J A;  1W41 A;  3C8L A;  1Q7Y H;  2BTO A;  5EYP A;  1R1M A;  1KNK A;  5MN4 A;  5IJ0 B;  1XV2 A;  1KD1 H;  2K1S A;  3WPW A;  1Q8R A;  3MCA B;  5GIN C;  2QEX F;  3VYU C;  1TUB B;  1VQP F;  3S0W A;  3I3F A;  5GON A;  3JAK B;  5IYZ B;  1QU9 A;  3HTN A;  3RYF B;  4ERH A;  3CCV F;  2IQQ A;  2DYY A;  5J2T B;  3WXM B;  3G71 F;  3WGK A;  3RYC A;  3HKD B;  4BW0 B;  5B8F A;  1JFF B;  2HRY A;  4G4Y A;  4C81 A;  1K73 H;  3K0T A;  4XCQ A;  4WBN B;  4YJ2 A;  5BMV A;  1YIT F;  5HY4 A;  4IIJ A;  3C9S A;  2CZW A;  1ONI A;  4RQO A;  2UYK A;  3CYP B;  5G4V C;  3G6E F;  2OTL F;  2OTJ F;  2MQE A;  2CHT A;  2OZB A;  3CXC F;  1FFX B;  1DBF A;  2CVL A;  2ZVZ A;  1M1K H;  3JAW A;  3P4E A;  4TV9 A;  3CPQ A;  2HS0 A;  3E22 B;  3CCJ F;  2I6R A;  3OBW A;  1FSZ A;  1W59 A;  2ZVY A;  5KX5 B;  5LP6 B;  5KMG A;  4O4L B;  3JAT A;  3JAL B;  1Q81 H;  3K12 A;  2VAM A;  1VH8 A;  1YJN F;  3I56 F;  4NUT A;  1W57 A;  2HQS C;  3CC7 F;  5HP8 A;  2HRU A;  5EB1 B;  5LA6 A;  2RHL A;  5G4U C;  4ZHV A;  2FGY A;  1GZ0 A;  4BT5 A;  1W5A A;  3FPI A;  5CA1 B;  2ZOD A;  2LBW A;  2RHO A;  3G4S F;  3F0F A;  4BY9 D;  3WJP A;  5MN5 A;  3CMA F;  3S0Y A;  2HS4 A;  2Z1F A;  3NVI B;  4ZI7 B;  1VQ4 F;  1OFU A;  3L7Q A;  4X1I A;  2Z01 A;  4M8I A;  1U40 A;  1KQS F;  5ITZ B;  4FFB A;  1VQO F;  4I50 B;  5JQG B;  3CCQ F;  5FNV A;  4LNU A;  3C9U A;  2OHW A;  4U3J B;  2N48 A;  3VIU A;  5EYP B;  5EB0 A;  3EOR A;  3FD6 A;  2QTP A;  4YJ3 A;  3DC2 A;  1GO0 A;  1H7M A;  4C8E A;  3M4S A;  5HY1 A;  5FJ4 C;  2VGM A;  3OON A;  1JN1 A;  3FD5 A;  4KWE A;  4B46 A;  5GON B;  4ZHY B;  5HXU A;  2H6L A;  4EB6 A;  1QAH A;  4BT4 A;  4F6R A;  2BTU A;  2BTQ B;  5EZY A;  1ZWZ A;  3RYC B;  3NK6 A;  3CME F;  3JAM M;  3E1Y A;  1K9M H;  1Q86 H;  1E7K A;  1OAP A;  5EIB C;  4NQ3 A;  1XRG A;  2VAW A;  2RB9 A;  4X1K A;  4YJ2 B;  5LOV A;  5BMV B;  4G4X A;  3ELC A;  3P10 A;  2PHN A;  4IIJ B;  3RA6 A;  3S06 A;  1T0K B;  4C82 A;  3S03 A;  3JVH A;  2VXY A;  3KIZ A;  3D01 A;  5JVD B;  1JJ2 F;  3B6N A;  3HAX D;  3C9T A;  4NWO B;  4LCK A;  3JAW B;  4TV9 B;  2QA4 F;  1RA4 A;  3Q8H A;  1GO1 A;  3RYI B;  5KMG B;  1COM A;  4C8G A;  2RHH A;  3RYH A;  3JAT B;  5C8Y A;  2UYJ A;  4HNA A;  1W5E A;  2I6D A;  3DDN A;  4ZK7 A;  1FNJ A;  3O85 A;  3VCZ A;  2V9Y A;  3KE1 A;  5HY0 A;  5LA6 B;  3VO8 A;  3FFM A;  3S02 A;  4O4I A;  3VOB A;  2KTV A;  4E6E A;  1YGY A;  1JD1 A;  3LFO A;  1H47 A;  4EI7 A;  1TVK B;  3SIU A;  3V4D A;  4ZOL A;  4TUY A;  5JH7 A;  1VQN F;  5J2U A;  5GAP K;  2UYP A;  3CCU F;  1PXW A;  3BYQ A;  3MCQ A;  1IPA A;  5LYJ A;  3PLA C;  3HWU A;  1W5B A;  3CCR F;  3MDO A;  4X1I B;  4I4T A;  1SA0 A;  4ZHQ A;  5IT9 M;  3JAR A;  3JCM M;  1JY8 A;  4FFB B;  3ON1 A;  1VQK F;  3VMF B;  3VOA A;  1VQL F;  5FNV B;  4LNU B;  5HP7 A;  5MN6 A;  3QTY A;  3NVK E;  1UI9 A;  3N2G A;  4B62 A;  2G9I A;  2HX0 A;  4O4H B;  1J7H A;  2HP0 A;  4O2B A;  3JAS A;  3TD5 A;  1VQM F;  1YJ9 F;  3FBA A;  3I7T A;  3KJJ A;  1IV1 A;  4TV8 A;  3IR9 A;  4EB6 B;  1NMU B;  1CN7 A;  1QVF F;  2ZOV A;  4F6R B;  3TD4 A;  3ERN A;  5EZY B;  3QHD A;  5CB4 B;  2HP3 A;  1DT9 A;  2R75 1;  1IV4 A;  2UZH A;  1X7O A;  4C4W C;  4PWT A;  3MQW A;  2GLZ A;  3T80 A;  1W58 1;  2LCA A;  2H8C A;  3LWQ C;  3V3T A;  5EIB D;  4X1K B;  3HKE A;  4G4V A;  1VQ5 F;  5LOV B;  4O2A A;  3QUW A;  1KC8 H;  4X3L A;  3LME A;  5EAZ A;  4BT2 A;  1Z5V A;  1U43 A;  2AIZ P;  3LWO C;  3UT5 A;  3VI6 A;  3J80 M;  1YIJ F;  2FC3 A;  3WGN A;  1IV3 A;  1QD9 A;  1SDS A;  2QI2 A;  1NJI H;  2GVI A;  5DCV A;  3LYB A;  4O4J A;  3CCE F;  3M1X A;  5A2Q M;  3N2K A;  5IJ9 A;  4U39 A;  3RYH B;  4DRX A;  2ZAU A;  5C8Y B;  4HNA B;  2Q1X A;  2OTM A;  3CC2 F;  5LXT A;  1W2B F;  3HKB A;  2VAP A;  5FLX M;  3LWP C;  3LWR C;  3LDT A;  2GZL A;  4IHJ A;  4O4I B;  1FNK A;  3D00 A;  3SIV A;  4G4Z A;  4X3M A;  3CCS F;  3IEQ A;  3K14 A;  2Q1Y A;  3E20 B;  4ZOL B;  3NMU C;  2F9Z C;  4TUY B;  5JH7 B;  1RQ2 A;  5J2U B;  5CA0 A;  3PAF A;  5LYJ B;  5GIP C;  3VYS C;  3M84 A;  4BVT A;  2B33 A;  4ZHQ B;  4I4T B;  1SA0 B;  3CYQ A;  3JAR B;  1IV2 A;  1W42 A;  2H8E A;  3AGK A;  3VYT C;  2PMP A;  3CC4 F;  1H48 A;  1RQ7 A;  3GTZ A;  3WGJ A;  3KHN A;  4I55 A;  3ESJ A;  2KG4 A;  3N2G B;  1X25 A;  2UYN A;  3ZP7 A;  5JCO C;  1UFY A;  2CWJ A;  3VTI C;  2HP0 B;  4O2B B;  3JAS B;  3WPX A;  3CD6 F;  3S0H A;  4TV8 B;  5AVM A;  1YI2 F;  1ODE A;  1YQN A;  4BT7 A;  3OW2 F;  1VQ9 F;  3F0E A;  4B5C A;  1X52 A;  2AIF A;  4X1Y A;  2CW4 A;  2YXZ A;  3V7Q A;  3WJQ A;  3GHZ A;  4EI9 A;  4EI8 A;  1XBI A;  3WGM A;  1W5F A;  5EWR A;  1X7P A;  5LP6 C;  3HKE B;  4O2A B;  3HKC A;  4BVS A;  4X20 A;  2LBT A;  5GIO C;  3CG6 A;  4YJ3 B;  2ZF8 A;  3UT5 B;  1VQ6 F;  4B45 A;  1CK2 A;  1KNJ A;  5HXZ A;  3WJR A;  1NQ3 A;  3I55 F;  3N4Y A;  3C9R A;  5JVD A;  5IJ0 A;  2P6Y A;  1Z5W A;  3IKE A;  2DT4 A;  4BT6 A;  4R40 B;  3RE3 A;  3K2X A;  3N4Z A;  1TUB A;  3CCM F;  2W8B C;  3R0P A;  4O4J B;  2KGW A;  3ZO8 A;  2CSL A;  1VQV A;  3IEW A;  3JAK A;  5IYZ A;  3CCL F;  4G88 A;  3F0G A;  3RYF A;  3N2K B;  5IJ9 B;  1M90 H;  4DRX B;  3RYI A;  1VK3 A;  5J2T A;  5GAN K;  3TD3 A;  3HKD A;  3ZP4 A;  3IKF A;  5LXT B;  1W3E X;  3ZOP A;  3HKB B;  1JFF A;  2HVY D;  2Z1E A;  4IHJ B;  1CLI A;  1PF5 A;  3F6M A;  2YYE A;  2BO1 A;  3RA5 A;  5JCO A;  4WBN A;  4TZZ A;  3WGL A;  4ZHW A;  1TVK A;  5CA0 B;  3CPW F;  1Q82 H;  2JNB A;  1U3P A;  2IG8 A;  5HY2 A;  3CB2 A;  4BVR A;  3P0Z A;  4RHA A;  1QVG F;  1FFX A;  2L26 A;  3KJK A;  2KTU A;  4BT3 A;  2VGN A;  1VHA A;  4I55 B;  2EWC A;  3E22 A;  1VQ8 F;  1GX1 A;  3GYQ A;  5KX5 A; 
#chains in the Genus database with same CATH homology
 2OTM A;  2UYK A;  3QUW A;  1QU9 A;  2CW4 A;  5HP8 A;  1J7H A;  3LME A;  2UYP A;  3I7T A;  1XRG A;  2DYY A;  2UYN B;  3GTZ A;  3KJJ A;  2CHT A;  1COM A;  1DBF A;  1XHO A;  2CVL A;  1FNK A;  3R0P A;  2UYJ A;  3ZO8 A;  2CSL A;  2IG8 A;  3M4S A;  4ZK7 A;  1FNJ A;  3VCZ A;  1QD9 A;  1X25 A;  2UYN A;  3ZP7 A;  1UFY A;  2CWJ A;  3L7Q A;  5HP7 A;  3D01 A;  3MQW A;  3K0T A;  3KJK A;  1QAH A;  3ZP4 A;  3LYB A;  3ZOP A;  3M1X A;  2CHS A;  1JD1 A;  3K12 A;  1ODE A;  2EWC A;  1UI9 A;  2B33 A;  1PF5 A;  3I3F A;  4NWO B;  1ONI A;  3V4D A;  1NQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...