3K0TA

Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
KTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVEGIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGSYFSQPYPARAAIGVAALPRGAQVEMDAILVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PSPTO-PSP protein from Pseudomonas syringae pv. tomato str. DC3000 in complex with D-glucose
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Sugar binding protein
molecule keywords Endoribonuclease L-PSP, putative
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3k0tA00
3V4DA 3ZO8A 1ONIA 2UYNA 1UI9A 2UYKA 2CVLA 1QAHA 3I7TA 3I3FA 4ZK7A 3K0TA 3MQWA 3L7QA 4NWOB 2UYJA 3KJKA 3ZP4A 2CHSA 1XHOA 3QUWA 2CW4A 1QD9A 3M4SA 1J7HA 3GTZA 2IG8A 2UYPA 1DBFA 1FNKA 3M1XA 5HP8A 2CWJA 3K12A 1NQ3A 1COMA 3KJJA 2CHTA 1FNJA 5HP7A 1PF5A 1UFYA 1ODEA 1X25A 3LMEA 2B33A 1XRGA 3ZOPA 3ZP7A 1JD1A 2OTMA 2CSLA 2EWCA 3D01A 3LYBA 3R0PA 1QU9A 3VCZA 2UYNB 2DYYA
chains in the Genus database with same CATH superfamily
3LWVC 1IV2A 5GAPK 3IMPA 2ZODA 3K0TA 5LOVB 1VQ7F 4BVQA 2Q1XA 2Z1TA 3I56F 4IHJA 3HKEB 2FC3A 3HKDB 1CLIA 3EORA 4G4ZA 1K8AH 4TUYA 3JAWB 1OFUA 3LWQC 5GONA 3N4YA 3ZOPA 4BT7A 2VXYA 2QTPA 3F0GA 4U3JA 2CSLA 3LYBA 4RQOA 1W59A 2N48A 3CCUF 1CN7A 1VQ6F 1U3PA 3JAKA 1ONIA 2QA4F 4IIJA 5G4UC 4BT4A 2CVLA 1TUBA 1QAHA 3CPQA 5ITZA 3IKFA 2ZF8A 3VMFB 3ELCA 4I50B 5HXUA 3ZP4A 3ON1A 5LYJA 3CCRF 1K9MH 4FFBB 1PXWA 3GTZA 2VAPA 2UYPA 1COMA 5JH7A 3TD3A 3CMEF 1R1MA 1ZWZA 5EWRA 1SDSA 4O2AA 5CA1B 5J2TA 5KMGB 2W8BC 3ZP7A 1RLUA 4O2AB 2IQQA 1DT9A 3CC7F 1YGYA 2QEXF 3C9TA 3S0HA 1Q8RA 3V7QA 5IJ0A 1VQ4F 2UYKA 2GZLA 5KX5B 1GO0A 3J7AR 3FD5A 3WPWA 5HY2A 3P0ZA 5GIOC 5MN4A 3QUWA 4BY9D 4X1IB 3VOAA 2F9ZC 1W42A 5C8YB 5IYZA 1VQKF 5FJ4C 2LBWA 4BVSA 1TVKB 2HP0A 1XV2A 2NMUA 2OHWA 1W57A 3HWUA 5B8FA 3R0PA 3K2XA 3IR9A 2RHOA 3LMEA 4U3JB 4TV9A 2P6YA 1JJ2F 5LXTA 1Z5WA 3RYCA 1VQPF 3GHZA 1KNKA 3WGNA 4ZHYB 1Q82H 4ZHQB 3SIUA 4IIJB 3NVKE 4TV8A 3CCSF 5C8YA 1Q81H 4WBNA 3JARB 1IV3A 5LP6B 3FFMA 3HKBB 4RHAA 3K12A 4BT3A 5HP7A 1PF5A 5KX5A 5LA6A 2RB9A 3RYHB 1GX1A 3CCMF 3C9UA 1RQ7A 1VQ5F 4ERHA 2DYYA 3CC2F 3PLAC 3HTNA 5IYZB 4X20A 5IJ9B 3MQWA 3VOBA 3MDOA 3OW2F 1W5EA 5EO3A 3JASA 4G4XA 3S03A 3RA6A 3F6MA 1YIJF 2IG8A 2HQSC 2LBTA 5HP8A 2RHJA 3UT5A 3WPXA 5EIBD 3KE1A 2VGNA 1KD1H 5EAZA 4ZHQA 4PWTA 3LDTA 5AVMA 5KMGA 1JD1A 2RHHA 1YITF 2OZBA 3HKEA 4BT2A 4G4WA 3HAXD 2UZHA 3IKEA 3LWOC 3JATB 3D00A 3S0WA 1U43A 4I4TB 4EB6B 5EZYA 1Q86H 1W41A 1SZQA 4KWEA 3HKCA 2HP3A 4BW0B 1NQ3A 3JAKB 1W581 3RYFB 3CMAF 3CB2A 3JATA 3LFOA 3N4ZA 4G4VA 3GYQA 4C81A 3E22A 4F6RA 4C8GA 1W40A 2HS0A 1W55A 1T0AA 1UI9A 4DRXB 5EB1B 3I3FA 4DRXA 4ZK7A 5EYPA 3CXCF 4NWOB 3VTIC 5HY0A 3OONA 4DXDA 3VYTC 3F0FA 2YXZA 4O4LB 2H8EA 1FNJA 1W5BA 1VQOF 1H47A 3PAFA 2LBXA 5CB4A 1CK2A 3N2KB 4O4IB 1GZ0A 3D01A 1VQVA 2PMPA 4X1KB 1VH8A 4X3LA 2HVYD 3ZO8A 4B46A 1SA0A 3V7EA 4BVRA 3FBAA 3LWRC 2R751 2UYJA 3S06A 2AIFA 3JASB 3E22B 2KTUA 3HKDA 4C8EA 4ZHVA 1M1KH 1DBFA 4HNAA 3AGKA 3VO8A 1FSZA 3UT5B 3VYSC 1U40A 3G71F 3WXMB 5J2UA 2OTMA 5A2QM 4I55A 2HS4A 3NK6A 4ZHWA 2VGMA 3FPIA 3V4DA 1VQMF 4ZI7A 5LP6A 4O4LA 4B5CA 2FGYA 1KNJA 5MN6A 1VHAA 5GANK 1X52A 3VIUA 1X7OA 3ERNA 3F0DA 1RQ2A 2KG4A 3E1YA 1KQSF 2BTQB 4X1KA 3CCLF 5EZYB 5EB0A 2L26A 2ZVZA 5ITZB 3V3TA 2K1SA 1YJNF 4LCKA 3CCJF 1X25A 4X3MA 1YJWF 5BMVB 5LOVA 1TVKA 2HP0B 3F0EA 3RYFA 3E20B 1QU9A 4ZOLB 2MQEA 2BTUA 2DT4A 3JALB 4EI8A 4BVTA 2UYNA 3M84A 1JFFA 3RYCB 3NVIB 1IPAA 1E7KA 3KJKA 4C4WC 5JQGA 3MCQA 1T0KB 1VQ8F 2HRUA 4O2BB 3C8LA 2CWJA 2VAWA 2HS3A 4ZI7B 3T80A 5IJ9A 1U3LA 4M8IA 4X1IA 1OAPA 2Z1UA 2IAFA 2UYNB 3WGLA 5HY1A 4EB6A 1X7PA 1XBIA 3B6NA 3G4SF 5GIPC 5CA0B 2Q1YA 1GO1A 4YJ3A 3J80M 3WGMA 2CHSA 4TV9B 2H6LA 3OBWA 4WBNB 5JCOC 3S0YA 5HY4A 2GVIA 2CZWA 1FFXA 3D54A 3NK7A 3CD6F 5LA6B 5LP6C 3QHDA 1K73H 3JAWA 2ZOVA 3NMUC 2OTJF 3DC2A 5GONB 3HKCB 3BYQA 2I6DA 2KTVA 4FFBA 1FFXB 3OBYA 3N2GB 1VQNF 2BO1A 1W5AA 3N2GA 4C82A 1W3EX 3MBMA 3JAMM 2JNBA 4O4IA 2QI2A 2HX0A 1RLGA 3KJJA 5LXTB 3WGJA 3LWPC 1UFYA 2GLZA 3VI6A 5BMVA 2EWCA 5J2UB 1S72F 4XCQA 3SIVA 3P4EA 3JCMM 3TD4A 5CA1A 5J2TB 2AIZP 5FNVB 1W2BF 4LNUA 1W5FA 2ALEA 1VK3A 2CW4A 3S02A 3M4SA 1QVGF 5JVDB 4B62A 4O2BA 3RE3A 2V9YA 3KHNA 2R6R1 5CA0A 3CG6A 3M1XA 3K14A 1JY8A 3KIZA 4I50A 4C8IA 2OTLF 1ODEA 2Z1FA 3RA5A 3HJWC 3DDNA 3I55F 5DCVA 3N2KA 3RYIA 4B45A 5JH7B 3CC4F 4F6RB 5IT9M 3VYUC 4O4HA 3I7TA 4O4HB 2Z01A 3L7QA 4O4JA 4EI7A 5LYJB 5JCOA 5JVDA 2WALA 1QD9A 3WJQA 1NMUB 3WGKA 2ZVYA 1IV4A 3C9RA 3JALA 3O85A 3WJPA 4G88A 4TV8B 4BT6A 1VQ9F 3CCQF 1M90H 2B33A 3CPWF 4X1YA 5CB4B 5G4VC 1N8RH 1H7MA 2ZAUA 4X1YB 4BT5A 5IJ0B 1NJIH 4LNUB 5JQGB 4I55B 4TZZA 4TUYB 3CYPB 2H8CA 3P10A 4IHJB 2I6RA 4EI9A 4R40B 2LCAA 1Z5VA 4ZOLA 5MN5A 1YHQF 1FNKA 3CYQA 2CHTA 4NQ3A 2KGWA 1JFFB 3C9SA 1H48A 3JVHA 4YJ3B 3QTYA 2AMTA 2BTOA 1Q7YH 5FLXM 3JARA 4NUTA 3IEQA 1YI2F 4YJ2B 3FD6A 1YJ9F 3VCZA 3Q8HA 2RHLA 4HNAB 2VAMA 1YQNA 4G4YA 5EYPB 3WJRA 3RYHA 4E6EA 5EIBC 4I4TA 1QVFF 3CCVF 3MCAB 4U39A 5FNVA 3RYIB 1IV1A 1XHOA 4O4JB 5HWEA 2HRYA 1J7HA 3HKBA 3ESJA 3TD5A 1TUBB 2G9IA 1KC8H 4X20B 1SA0B 2PHNA 3U0OA 2Z1EA 1VQLF 2YYEA 1XRGA 4YJ2A 3J81M 5GINC 5HXZA 3IEWA 1JN1A 3G6EF 1RA4A 3CCEF
chains in the Genus database with same CATH topology
3V4DA 3ZO8A 1ONIA 2UYNA 1UI9A 2UYKA 2CVLA 1QAHA 3I7TA 3I3FA 4ZK7A 3K0TA 3MQWA 3L7QA 4NWOB 2UYJA 3KJKA 3ZP4A 2CHSA 1XHOA 3QUWA 2CW4A 1QD9A 3M4SA 1J7HA 3GTZA 2IG8A 2UYPA 1DBFA 1FNKA 3M1XA 5HP8A 2CWJA 3K12A 1NQ3A 1COMA 3KJJA 2CHTA 1FNJA 5HP7A 1PF5A 1UFYA 1ODEA 1X25A 3LMEA 2B33A 1XRGA 3ZOPA 3ZP7A 1JD1A 2OTMA 2CSLA 2EWCA 3D01A 3LYBA 3R0PA 1QU9A 3VCZA 2UYNB 2DYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4D A;  3ZO8 A;  1ONI A;  2UYN A;  1UI9 A;  2UYK A;  2CVL A;  1QAH A;  3I7T A;  3I3F A;  4ZK7 A;  3K0T A;  3MQW A;  3L7Q A;  4NWO B;  2UYJ A;  3KJK A;  3ZP4 A;  2CHS A;  1XHO A;  3QUW A;  2CW4 A;  1QD9 A;  3M4S A;  1J7H A;  3GTZ A;  2IG8 A;  2UYP A;  1DBF A;  1FNK A;  3M1X A;  5HP8 A;  2CWJ A;  3K12 A;  1NQ3 A;  1COM A;  3KJJ A;  2CHT A;  1FNJ A;  5HP7 A;  1PF5 A;  1UFY A;  1ODE A;  1X25 A;  3LME A;  2B33 A;  1XRG A;  3ZOP A;  3ZP7 A;  1JD1 A;  2OTM A;  2CSL A;  2EWC A;  3D01 A;  3LYB A;  3R0P A;  1QU9 A;  3VCZ A;  2UYN B;  2DYY A; 
#chains in the Genus database with same CATH topology
 3LWV C;  1IV2 A;  5GAP K;  3IMP A;  2ZOD A;  3K0T A;  5LOV B;  1VQ7 F;  4BVQ A;  2Q1X A;  2Z1T A;  3I56 F;  4IHJ A;  3HKE B;  2FC3 A;  3HKD B;  1CLI A;  3EOR A;  4G4Z A;  1K8A H;  4TUY A;  3JAW B;  1OFU A;  3LWQ C;  5GON A;  3N4Y A;  3ZOP A;  4BT7 A;  2VXY A;  2QTP A;  3F0G A;  4U3J A;  2CSL A;  3LYB A;  4RQO A;  1W59 A;  2N48 A;  3CCU F;  1CN7 A;  1VQ6 F;  1U3P A;  3JAK A;  1ONI A;  2QA4 F;  4IIJ A;  5G4U C;  4BT4 A;  2CVL A;  1TUB A;  1QAH A;  3CPQ A;  5ITZ A;  3IKF A;  2ZF8 A;  3VMF B;  3ELC A;  4I50 B;  5HXU A;  3ZP4 A;  3ON1 A;  5LYJ A;  3CCR F;  1K9M H;  4FFB B;  1PXW A;  3GTZ A;  2VAP A;  2UYP A;  1COM A;  5JH7 A;  3TD3 A;  3CME F;  1R1M A;  1ZWZ A;  5EWR A;  1SDS A;  4O2A A;  5CA1 B;  5J2T A;  5KMG B;  2W8B C;  3ZP7 A;  1RLU A;  4O2A B;  2IQQ A;  1DT9 A;  3CC7 F;  1YGY A;  2QEX F;  3C9T A;  3S0H A;  1Q8R A;  3V7Q A;  5IJ0 A;  1VQ4 F;  2UYK A;  2GZL A;  5KX5 B;  1GO0 A;  3J7A R;  3FD5 A;  3WPW A;  5HY2 A;  3P0Z A;  5GIO C;  5MN4 A;  3QUW A;  4BY9 D;  4X1I B;  3VOA A;  2F9Z C;  1W42 A;  5C8Y B;  5IYZ A;  1VQK F;  5FJ4 C;  2LBW A;  4BVS A;  1TVK B;  2HP0 A;  1XV2 A;  2NMU A;  2OHW A;  1W57 A;  3HWU A;  5B8F A;  3R0P A;  3K2X A;  3IR9 A;  2RHO A;  3LME A;  4U3J B;  4TV9 A;  2P6Y A;  1JJ2 F;  5LXT A;  1Z5W A;  3RYC A;  1VQP F;  3GHZ A;  1KNK A;  3WGN A;  4ZHY B;  1Q82 H;  4ZHQ B;  3SIU A;  4IIJ B;  3NVK E;  4TV8 A;  3CCS F;  5C8Y A;  1Q81 H;  4WBN A;  3JAR B;  1IV3 A;  5LP6 B;  3FFM A;  3HKB B;  4RHA A;  3K12 A;  4BT3 A;  5HP7 A;  1PF5 A;  5KX5 A;  5LA6 A;  2RB9 A;  3RYH B;  1GX1 A;  3CCM F;  3C9U A;  1RQ7 A;  1VQ5 F;  4ERH A;  2DYY A;  3CC2 F;  3PLA C;  3HTN A;  5IYZ B;  4X20 A;  5IJ9 B;  3MQW A;  3VOB A;  3MDO A;  3OW2 F;  1W5E A;  5EO3 A;  3JAS A;  4G4X A;  3S03 A;  3RA6 A;  3F6M A;  1YIJ F;  2IG8 A;  2HQS C;  2LBT A;  5HP8 A;  2RHJ A;  3UT5 A;  3WPX A;  5EIB D;  3KE1 A;  2VGN A;  1KD1 H;  5EAZ A;  4ZHQ A;  4PWT A;  3LDT A;  5AVM A;  5KMG A;  1JD1 A;  2RHH A;  1YIT F;  2OZB A;  3HKE A;  4BT2 A;  4G4W A;  3HAX D;  2UZH A;  3IKE A;  3LWO C;  3JAT B;  3D00 A;  3S0W A;  1U43 A;  4I4T B;  4EB6 B;  5EZY A;  1Q86 H;  1W41 A;  1SZQ A;  4KWE A;  3HKC A;  2HP3 A;  4BW0 B;  1NQ3 A;  3JAK B;  1W58 1;  3RYF B;  3CMA F;  3CB2 A;  3JAT A;  3LFO A;  3N4Z A;  4G4V A;  3GYQ A;  4C81 A;  3E22 A;  4F6R A;  4C8G A;  1W40 A;  2HS0 A;  1W55 A;  1T0A A;  1UI9 A;  4DRX B;  5EB1 B;  3I3F A;  4DRX A;  4ZK7 A;  5EYP A;  3CXC F;  4NWO B;  3VTI C;  5HY0 A;  3OON A;  4DXD A;  3VYT C;  3F0F A;  2YXZ A;  4O4L B;  2H8E A;  1FNJ A;  1W5B A;  1VQO F;  1H47 A;  3PAF A;  2LBX A;  5CB4 A;  1CK2 A;  3N2K B;  4O4I B;  1GZ0 A;  3D01 A;  1VQV A;  2PMP A;  4X1K B;  1VH8 A;  4X3L A;  2HVY D;  3ZO8 A;  4B46 A;  1SA0 A;  3V7E A;  4BVR A;  3FBA A;  3LWR C;  2R75 1;  2UYJ A;  3S06 A;  2AIF A;  3JAS B;  3E22 B;  2KTU A;  3HKD A;  4C8E A;  4ZHV A;  1M1K H;  1DBF A;  4HNA A;  3AGK A;  3VO8 A;  1FSZ A;  3UT5 B;  3VYS C;  1U40 A;  3G71 F;  3WXM B;  5J2U A;  2OTM A;  5A2Q M;  4I55 A;  2HS4 A;  3NK6 A;  4ZHW A;  2VGM A;  3FPI A;  3V4D A;  1VQM F;  4ZI7 A;  5LP6 A;  4O4L A;  4B5C A;  2FGY A;  1KNJ A;  5MN6 A;  1VHA A;  5GAN K;  1X52 A;  3VIU A;  1X7O A;  3ERN A;  3F0D A;  1RQ2 A;  2KG4 A;  3E1Y A;  1KQS F;  2BTQ B;  4X1K A;  3CCL F;  5EZY B;  5EB0 A;  2L26 A;  2ZVZ A;  5ITZ B;  3V3T A;  2K1S A;  1YJN F;  4LCK A;  3CCJ F;  1X25 A;  4X3M A;  1YJW F;  5BMV B;  5LOV A;  1TVK A;  2HP0 B;  3F0E A;  3RYF A;  3E20 B;  1QU9 A;  4ZOL B;  2MQE A;  2BTU A;  2DT4 A;  3JAL B;  4EI8 A;  4BVT A;  2UYN A;  3M84 A;  1JFF A;  3RYC B;  3NVI B;  1IPA A;  1E7K A;  3KJK A;  4C4W C;  5JQG A;  3MCQ A;  1T0K B;  1VQ8 F;  2HRU A;  4O2B B;  3C8L A;  2CWJ A;  2VAW A;  2HS3 A;  4ZI7 B;  3T80 A;  5IJ9 A;  1U3L A;  4M8I A;  4X1I A;  1OAP A;  2Z1U A;  2IAF A;  2UYN B;  3WGL A;  5HY1 A;  4EB6 A;  1X7P A;  1XBI A;  3B6N A;  3G4S F;  5GIP C;  5CA0 B;  2Q1Y A;  1GO1 A;  4YJ3 A;  3J80 M;  3WGM A;  2CHS A;  4TV9 B;  2H6L A;  3OBW A;  4WBN B;  5JCO C;  3S0Y A;  5HY4 A;  2GVI A;  2CZW A;  1FFX A;  3D54 A;  3NK7 A;  3CD6 F;  5LA6 B;  5LP6 C;  3QHD A;  1K73 H;  3JAW A;  2ZOV A;  3NMU C;  2OTJ F;  3DC2 A;  5GON B;  3HKC B;  3BYQ A;  2I6D A;  2KTV A;  4FFB A;  1FFX B;  3OBY A;  3N2G B;  1VQN F;  2BO1 A;  1W5A A;  3N2G A;  4C82 A;  1W3E X;  3MBM A;  3JAM M;  2JNB A;  4O4I A;  2QI2 A;  2HX0 A;  1RLG A;  3KJJ A;  5LXT B;  3WGJ A;  3LWP C;  1UFY A;  2GLZ A;  3VI6 A;  5BMV A;  2EWC A;  5J2U B;  1S72 F;  4XCQ A;  3SIV A;  3P4E A;  3JCM M;  3TD4 A;  5CA1 A;  5J2T B;  2AIZ P;  5FNV B;  1W2B F;  4LNU A;  1W5F A;  2ALE A;  1VK3 A;  2CW4 A;  3S02 A;  3M4S A;  1QVG F;  5JVD B;  4B62 A;  4O2B A;  3RE3 A;  2V9Y A;  3KHN A;  2R6R 1;  5CA0 A;  3CG6 A;  3M1X A;  3K14 A;  1JY8 A;  3KIZ A;  4I50 A;  4C8I A;  2OTL F;  1ODE A;  2Z1F A;  3RA5 A;  3HJW C;  3DDN A;  3I55 F;  5DCV A;  3N2K A;  3RYI A;  4B45 A;  5JH7 B;  3CC4 F;  4F6R B;  5IT9 M;  3VYU C;  4O4H A;  3I7T A;  4O4H B;  2Z01 A;  3L7Q A;  4O4J A;  4EI7 A;  5LYJ B;  5JCO A;  5JVD A;  2WAL A;  1QD9 A;  3WJQ A;  1NMU B;  3WGK A;  2ZVY A;  1IV4 A;  3C9R A;  3JAL A;  3O85 A;  3WJP A;  4G88 A;  4TV8 B;  4BT6 A;  1VQ9 F;  3CCQ F;  1M90 H;  2B33 A;  3CPW F;  4X1Y A;  5CB4 B;  5G4V C;  1N8R H;  1H7M A;  2ZAU A;  4X1Y B;  4BT5 A;  5IJ0 B;  1NJI H;  4LNU B;  5JQG B;  4I55 B;  4TZZ A;  4TUY B;  3CYP B;  2H8C A;  3P10 A;  4IHJ B;  2I6R A;  4EI9 A;  4R40 B;  2LCA A;  1Z5V A;  4ZOL A;  5MN5 A;  1YHQ F;  1FNK A;  3CYQ A;  2CHT A;  4NQ3 A;  2KGW A;  1JFF B;  3C9S A;  1H48 A;  3JVH A;  4YJ3 B;  3QTY A;  2AMT A;  2BTO A;  1Q7Y H;  5FLX M;  3JAR A;  4NUT A;  3IEQ A;  1YI2 F;  4YJ2 B;  3FD6 A;  1YJ9 F;  3VCZ A;  3Q8H A;  2RHL A;  4HNA B;  2VAM A;  1YQN A;  4G4Y A;  5EYP B;  3WJR A;  3RYH A;  4E6E A;  5EIB C;  4I4T A;  1QVF F;  3CCV F;  3MCA B;  4U39 A;  5FNV A;  3RYI B;  1IV1 A;  1XHO A;  4O4J B;  5HWE A;  2HRY A;  1J7H A;  3HKB A;  3ESJ A;  3TD5 A;  1TUB B;  2G9I A;  1KC8 H;  4X20 B;  1SA0 B;  2PHN A;  3U0O A;  2Z1E A;  1VQL F;  2YYE A;  1XRG A;  4YJ2 A;  3J81 M;  5GIN C;  5HXZ A;  3IEW A;  1JN1 A;  3G6E F;  1RA4 A;  3CCE F; 
#chains in the Genus database with same CATH homology
 3V4D A;  3ZO8 A;  1ONI A;  2UYN A;  1UI9 A;  2UYK A;  2CVL A;  1QAH A;  3I7T A;  3I3F A;  4ZK7 A;  3K0T A;  3MQW A;  3L7Q A;  4NWO B;  2UYJ A;  3KJK A;  3ZP4 A;  2CHS A;  1XHO A;  3QUW A;  2CW4 A;  1QD9 A;  3M4S A;  1J7H A;  3GTZ A;  2IG8 A;  2UYP A;  1DBF A;  1FNK A;  3M1X A;  5HP8 A;  2CWJ A;  3K12 A;  1NQ3 A;  1COM A;  3KJJ A;  2CHT A;  1FNJ A;  5HP7 A;  1PF5 A;  1UFY A;  1ODE A;  1X25 A;  3LME A;  2B33 A;  1XRG A;  3ZOP A;  3ZP7 A;  1JD1 A;  2OTM A;  2CSL A;  2EWC A;  3D01 A;  3LYB A;  3R0P A;  1QU9 A;  3VCZ A;  2UYN B;  2DYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...