3K0TA

Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
KTVITSDKAPAAIGPYSQAIKAGNTVYMSGQIPLDPSTMELVEGIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFLTDLGHFAKVNEIMGSYFSQPYPARAAIGVAALPRGAQVEMDAILVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PSPTO-PSP protein from Pseudomonas syringae pv. tomato str. DC3000 in complex with D-glucose
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Sugar binding protein
molecule keywords Endoribonuclease L-PSP, putative
total genus 27
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3k0tA00
3L7QA 3VCZA 1FNJA 2IG8A 3KJJA 3QUWA 1NQ3A 3ZP4A 1XHOA 3M1XA 3K0TA 2CVLA 2UYNA 3R0PA 3K12A 1FNKA 3ZOPA 1J7HA 3LMEA 1ONIA 3ZO8A 2DYYA 1ODEA 4NWOB 2EWCA 5HP8A 1UFYA 2CHTA 3KJKA 2CWJA 3ZP7A 2B33A 2UYNB 3I3FA 1JD1A 3GTZA 1QD9A 1XRGA 2CW4A 3MQWA 2CHSA 3V4DA 2CSLA 3M4SA 2UYKA 5HP7A 1DBFA 3I7TA 2UYPA 1UI9A 1COMA 2UYJA 1PF5A 2OTMA 3D01A 3LYBA 1QAHA 4ZK7A 1QU9A 1X25A
chains in the Genus database with same CATH superfamily
3L7QA 3VCZA 3JASA 3T80A 4FFBB 1X52A 2IQQA 3F0DA 4C82A 5KX5A 3D54A 4RHAA 1ONIA 3D00A 3Q8HA 1JN1A 1VQ7F 1SA0B 1VK3A 3K14A 2CHSA 3ERNA 1FFXA 4I55B 2OTJF 4G4VA 1SDSA 4ZHYB 4M8IA 3S03A 3JAMM 3V7EA 3RYIA 2GLZA 1TUBB 2VAWA 5J2UB 5JCOA 3R0PA 4R40B 2CZWA 3RYCA 4I4TA 3RYIB 1TUBA 1J7HA 4C81A 4BT5A 5HXUA 1KC8H 4BVQA 3MBMA 5EIBC 3E1YA 3JVHA 4G88A 3CCJF 5AVMA 3C9RA 5LP6C 4DXDA 4O4IB 1VQ4F 3NVKE 1VQPF 4DRXB 1M1KH 3KJJA 4WBNA 1IV4A 5LXTA 3HKCA 4X1YA 4X3MA 3B6NA 3VYTC 3SIVA 1ODEA 4DRXA 4NWOB 2RHLA 4WBNB 3CPWF 3CCEF 2QA4F 1XRGA 3JCMM 4BVRA 1YIJF 3HKEB 3MQWA 3VYUC 3KIZA 5BMVA 3WPWA 1DBFA 1Z5VA 1U3PA 2HS3A 3IKEA 3P0ZA 5JQGA 3HKEA 3GYQA 3JASB 1RQ7A 2HS0A 5GANK 3OONA 5KMGA 2UZHA 3O85A 1E7KA 3IEQA 3CPQA 4TZZA 3CMEF 1VQ9F 4KWEA 3FFMA 1FSZA 1KQSF 5KMGB 2GZLA 3K12A 3CC2F 3WJPA 3G71F 2FGYA 2Q1XA 5GONA 1FFXB 4I55A 2QEXF 5EZYA 5HXZA 4BT6A 4C8GA 2KG4A 2BTQB 1U43A 2R6R1 5G4VC 3F0EA 3F0GA 5J2UA 3WGJA 2ZOVA 3RYCB 3VTIC 2Z1EA 1XHOA 3RYHA 1YJ9F 2CVLA 4O2BB 3LWPC 1FNKA 4BT7A 3ZO8A 5GINC 5EO3A 3CYPB 1VQVA 5ITZB 4ZI7B 1DT9A 3RYHB 4O2BA 3CC7F 5EIBD 3LFOA 1W2BF 4I50B 3IEWA 1QVFF 5ITZA 2ZAUA 1YGYA 4G4XA 3CCLF 4EI7A 4ERHA 1COMA 4NQ3A 5LYJB 3CCSF 3WPXA 3D01A 5J2TB 3HKCB 1Q7YH 2UYJA 4ZK7A 5A2QM 5C8YB 5G4UC 5FJ4C 2W8BC 1W55A 3K0TA 5LYJA 5EYPA 3JAWA 1VQ8F 3ZOPA 4B5CA 3C9UA 5BMVB 2B33A 3RE3A 4TUYB 5EYPB 3GTZA 5JQGB 3WJQA 1RA4A 3DC2A 5IJ9A 2IAFA 1VH8A 1H7MA 2I6RA 2VGMA 3WGKA 1PXWA 2G9IA 2HP3A 4TUYA 4EI8A 5HWEA 1VQOF 3RA6A 4G4YA 4BW0B 5HY1A 1RQ2A 3RYFA 5FLXM 1K8AH 3HJWC 1QU9A 1X25A 4O4JB 2ZF8A 1VQMF 3S0WA 5GONB 1IV3A 1W5EA 3RYFB 1U3LA 3LDTA 5EZYB 2L26A 4G4ZA 4O4JA 3KJKA 1W3EX 5B8FA 3LWOC 1JD1A 3CXCF 3HAXD 3SIUA 3GHZA 3I55F 1QVGF 4LNUA 2FC3A 5LP6A 1H48A 5JCOC 1K9MH 2WALA 3VO8A 4IHJB 1GO1A 2GVIA 1W42A 5LP6B 3P4EA 4XCQA 4ZI7A 4IHJA 5EB1B 2VAMA 2OZBA 3F0FA 4I50A 4RQOA 2F9ZC 1X7PA 1YI2F 3TD3A 2RHJA 2EWCA 3VMFB 2OTLF 2CWJA 4YJ3A 2Z01A 1QD9A 3IMPA 3N2GA 2BTOA 3F6MA 1IV2A 4ZHVA 3CCVF 3HKBB 5J2TA 5JVDB 4YJ3B 3KE1A 5C8YA 5CA0B 2RB9A 3HKBA 3JAWB 2LBXA 3CCUF 3CYQA 1W5BA 3N4ZA 5CA0A 3QUWA 2LBWA 1Q8RA 3VIUA 4NUTA 4BT4A 1YQNA 1VQ5F 1S72F 3N2KA 5IJ9B 1Q86H 2VXYA 4IIJA 1CN7A 3JARB 3FD6A 3V3TA 1K73H 3N2KB 3QTYA 2ZVZA 4IIJB 4X1IB 5LA6B 2HQSC 2BO1A 4X20B 5FNVB 1U40A 2UYPA 1UI9A 3TD4A 1YJWF 3EORA 2HP0B 3VI6A 4X20A 4F6RB 4BT3A 2IG8A 1NQ3A 3DDNA 1W57A 3FBAA 1KD1H 5CB4A 3MDOA 3G4SF 4TV8B 4EB6B 4ZHQB 3JATB 1W5AA 3WXMB 2CHTA 3OBYA 4YJ2B 3LWVC 4LNUB 5CB4B 4ZOLA 4EB6A 4ZHQA 3JATA 1YHQF 2OHWA 4YJ2A 4B45A 2PHNA 4ZOLB 1OAPA 1XBIA 3WGNA 1QAHA 1ZWZA 2H6LA 4X1KA 2AIZP 1GO0A 3ZP4A 3U0OA 3UT5B 1T0AA 3VOAA 1YJNF 2JNBA 3N2GB 3IR9A 3VYSC 4X1KB 1VQNF 3FPIA 5JVDA 2HRYA 2PMPA 3N4YA 4BT2A 5IYZA 3ELCA 3M4SA 5LOVA 3NVIB 4O2AB 2UYKA 2Q1YA 2KTUA 4BVTA 5IYZB 3CCRF 3P10A 5LOVB 4EI9A 4U3JA 3PLAC 5HY4A 3NMUC 3CMAF 2QI2A 2H8EA 3JARA 3CD6F 2DYYA 5IJ0A 5HP8A 5EB0A 1XV2A 2DT4A 4X1IA 5LA6A 1GZ0A 3I3FA 5FNVA 5MN6A 2KGWA 3CC4F 5JH7B 2HP0A 5IJ0B 2AIFA 3CB2A 2ZODA 5MN5A 1TVKB 3BYQA 4F6RA 3AGKA 5HY0A 2LBTA 1YITF 3OBWA 3CCQF 1RLUA 5EWRA 5EAZA 1TVKA 3I7TA 4TV8A 2MQEA 4E6EA 5GIOC 3E22A 1JJ2F 1JFFB 5MN4A 2UYNA 2Z1FA 4BY9D 2N48A 2ZVYA 1W5FA 3VOBA 2QTPA 1W40A 1W41A 4U39A 1CLIA 3HKDB 2UYNB 3WGLA 3C9SA 3S02A 2P6YA 4B62A 3HKDA 5HP7A 2YYEA 1Q81H 4LCKA 3I56F 4C8IA 3UT5A 3HTNA 3WJRA 3LYBA 4HNAB 3S0HA 4O4HA 1FNJA 5GIPC 4C8EA 2HVYD 4X3LA 3TD5A 1W581 1NJIH 4O4HB 3ZP7A 3ESJA 5GAPK 2KTVA 1CK2A 4O2AA 1JY8A 1OFUA 2H8CA 5KX5B 1Z5WA 3M84A 2CW4A 3C9TA 1W59A 3FD5A 2CSLA 3C8LA 4U3JB 4BVSA 1GX1A 5IT9M 2HS4A 3S06A 1SA0A 2K1SA 2Z1UA 3LWQC 1PF5A 2VGNA 2V9YA 2Z1TA 3J81M 3K2XA 1Q82H 3J80M 3JAKA 3NK6A 3LMEA 2ALEA 4G4WA 5JH7A 1VQLF 1X7OA 3V7QA 4ZHWA 4I4TB 3JAKB 1N8RH 3V4DA 3G6EF 3J7AR 3JALB 2HRUA 1KNKA 5HY2A 2VAPA 3KHNA 4C4WC 1VQKF 1IPAA 2BTUA 2RHHA 3E22B 1T0KB 1JFFA 1R1MA 3JALA 1VHAA 3LWRC 4B46A 2AMTA 3MCAB 1NMUB 5CA1A 1VQ6F 3M1XA 2LCAA 1H47A 3ON1A 4O4IA 3E20B 3HWUA 3IKFA 3OW2F 1KNJA 5CA1B 1UFYA 3CG6A 5DCVA 3PAFA 3MCQA 5LXTB 4X1YB 2I6DA 4TV9A 3WGMA 3NK7A 3CCMF 3S0YA 4O4LB 1SZQA 4HNAA 1IV1A 1RLGA 2RHOA 3RA5A 1M90H 2HX0A 2R751 4FFBA 2NMUA 4TV9B 2OTMA 2YXZA 4O4LA 3QHDA 4PWTA
chains in the Genus database with same CATH topology
3L7QA 3VCZA 1FNJA 2IG8A 3KJJA 3QUWA 1NQ3A 3ZP4A 1XHOA 3M1XA 3K0TA 2CVLA 2UYNA 3R0PA 3K12A 1FNKA 3ZOPA 1J7HA 3LMEA 1ONIA 3ZO8A 2DYYA 1ODEA 4NWOB 2EWCA 5HP8A 1UFYA 2CHTA 3KJKA 2CWJA 3ZP7A 2B33A 2UYNB 3I3FA 1JD1A 3GTZA 1QD9A 1XRGA 2CW4A 3MQWA 2CHSA 3V4DA 2CSLA 3M4SA 2UYKA 5HP7A 1DBFA 3I7TA 2UYPA 1UI9A 1COMA 2UYJA 1PF5A 2OTMA 3D01A 3LYBA 1QAHA 4ZK7A 1QU9A 1X25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Q A;  3VCZ A;  1FNJ A;  2IG8 A;  3KJJ A;  3QUW A;  1NQ3 A;  3ZP4 A;  1XHO A;  3M1X A;  3K0T A;  2CVL A;  2UYN A;  3R0P A;  3K12 A;  1FNK A;  3ZOP A;  1J7H A;  3LME A;  1ONI A;  3ZO8 A;  2DYY A;  1ODE A;  4NWO B;  2EWC A;  5HP8 A;  1UFY A;  2CHT A;  3KJK A;  2CWJ A;  3ZP7 A;  2B33 A;  2UYN B;  3I3F A;  1JD1 A;  3GTZ A;  1QD9 A;  1XRG A;  2CW4 A;  3MQW A;  2CHS A;  3V4D A;  2CSL A;  3M4S A;  2UYK A;  5HP7 A;  1DBF A;  3I7T A;  2UYP A;  1UI9 A;  1COM A;  2UYJ A;  1PF5 A;  2OTM A;  3D01 A;  3LYB A;  1QAH A;  4ZK7 A;  1QU9 A;  1X25 A; 
#chains in the Genus database with same CATH topology
 3L7Q A;  3VCZ A;  3JAS A;  3T80 A;  4FFB B;  1X52 A;  2IQQ A;  3F0D A;  4C82 A;  5KX5 A;  3D54 A;  4RHA A;  1ONI A;  3D00 A;  3Q8H A;  1JN1 A;  1VQ7 F;  1SA0 B;  1VK3 A;  3K14 A;  2CHS A;  3ERN A;  1FFX A;  4I55 B;  2OTJ F;  4G4V A;  1SDS A;  4ZHY B;  4M8I A;  3S03 A;  3JAM M;  3V7E A;  3RYI A;  2GLZ A;  1TUB B;  2VAW A;  5J2U B;  5JCO A;  3R0P A;  4R40 B;  2CZW A;  3RYC A;  4I4T A;  3RYI B;  1TUB A;  1J7H A;  4C81 A;  4BT5 A;  5HXU A;  1KC8 H;  4BVQ A;  3MBM A;  5EIB C;  3E1Y A;  3JVH A;  4G88 A;  3CCJ F;  5AVM A;  3C9R A;  5LP6 C;  4DXD A;  4O4I B;  1VQ4 F;  3NVK E;  1VQP F;  4DRX B;  1M1K H;  3KJJ A;  4WBN A;  1IV4 A;  5LXT A;  3HKC A;  4X1Y A;  4X3M A;  3B6N A;  3VYT C;  3SIV A;  1ODE A;  4DRX A;  4NWO B;  2RHL A;  4WBN B;  3CPW F;  3CCE F;  2QA4 F;  1XRG A;  3JCM M;  4BVR A;  1YIJ F;  3HKE B;  3MQW A;  3VYU C;  3KIZ A;  5BMV A;  3WPW A;  1DBF A;  1Z5V A;  1U3P A;  2HS3 A;  3IKE A;  3P0Z A;  5JQG A;  3HKE A;  3GYQ A;  3JAS B;  1RQ7 A;  2HS0 A;  5GAN K;  3OON A;  5KMG A;  2UZH A;  3O85 A;  1E7K A;  3IEQ A;  3CPQ A;  4TZZ A;  3CME F;  1VQ9 F;  4KWE A;  3FFM A;  1FSZ A;  1KQS F;  5KMG B;  2GZL A;  3K12 A;  3CC2 F;  3WJP A;  3G71 F;  2FGY A;  2Q1X A;  5GON A;  1FFX B;  4I55 A;  2QEX F;  5EZY A;  5HXZ A;  4BT6 A;  4C8G A;  2KG4 A;  2BTQ B;  1U43 A;  2R6R 1;  5G4V C;  3F0E A;  3F0G A;  5J2U A;  3WGJ A;  2ZOV A;  3RYC B;  3VTI C;  2Z1E A;  1XHO A;  3RYH A;  1YJ9 F;  2CVL A;  4O2B B;  3LWP C;  1FNK A;  4BT7 A;  3ZO8 A;  5GIN C;  5EO3 A;  3CYP B;  1VQV A;  5ITZ B;  4ZI7 B;  1DT9 A;  3RYH B;  4O2B A;  3CC7 F;  5EIB D;  3LFO A;  1W2B F;  4I50 B;  3IEW A;  1QVF F;  5ITZ A;  2ZAU A;  1YGY A;  4G4X A;  3CCL F;  4EI7 A;  4ERH A;  1COM A;  4NQ3 A;  5LYJ B;  3CCS F;  3WPX A;  3D01 A;  5J2T B;  3HKC B;  1Q7Y H;  2UYJ A;  4ZK7 A;  5A2Q M;  5C8Y B;  5G4U C;  5FJ4 C;  2W8B C;  1W55 A;  3K0T A;  5LYJ A;  5EYP A;  3JAW A;  1VQ8 F;  3ZOP A;  4B5C A;  3C9U A;  5BMV B;  2B33 A;  3RE3 A;  4TUY B;  5EYP B;  3GTZ A;  5JQG B;  3WJQ A;  1RA4 A;  3DC2 A;  5IJ9 A;  2IAF A;  1VH8 A;  1H7M A;  2I6R A;  2VGM A;  3WGK A;  1PXW A;  2G9I A;  2HP3 A;  4TUY A;  4EI8 A;  5HWE A;  1VQO F;  3RA6 A;  4G4Y A;  4BW0 B;  5HY1 A;  1RQ2 A;  3RYF A;  5FLX M;  1K8A H;  3HJW C;  1QU9 A;  1X25 A;  4O4J B;  2ZF8 A;  1VQM F;  3S0W A;  5GON B;  1IV3 A;  1W5E A;  3RYF B;  1U3L A;  3LDT A;  5EZY B;  2L26 A;  4G4Z A;  4O4J A;  3KJK A;  1W3E X;  5B8F A;  3LWO C;  1JD1 A;  3CXC F;  3HAX D;  3SIU A;  3GHZ A;  3I55 F;  1QVG F;  4LNU A;  2FC3 A;  5LP6 A;  1H48 A;  5JCO C;  1K9M H;  2WAL A;  3VO8 A;  4IHJ B;  1GO1 A;  2GVI A;  1W42 A;  5LP6 B;  3P4E A;  4XCQ A;  4ZI7 A;  4IHJ A;  5EB1 B;  2VAM A;  2OZB A;  3F0F A;  4I50 A;  4RQO A;  2F9Z C;  1X7P A;  1YI2 F;  3TD3 A;  2RHJ A;  2EWC A;  3VMF B;  2OTL F;  2CWJ A;  4YJ3 A;  2Z01 A;  1QD9 A;  3IMP A;  3N2G A;  2BTO A;  3F6M A;  1IV2 A;  4ZHV A;  3CCV F;  3HKB B;  5J2T A;  5JVD B;  4YJ3 B;  3KE1 A;  5C8Y A;  5CA0 B;  2RB9 A;  3HKB A;  3JAW B;  2LBX A;  3CCU F;  3CYQ A;  1W5B A;  3N4Z A;  5CA0 A;  3QUW A;  2LBW A;  1Q8R A;  3VIU A;  4NUT A;  4BT4 A;  1YQN A;  1VQ5 F;  1S72 F;  3N2K A;  5IJ9 B;  1Q86 H;  2VXY A;  4IIJ A;  1CN7 A;  3JAR B;  3FD6 A;  3V3T A;  1K73 H;  3N2K B;  3QTY A;  2ZVZ A;  4IIJ B;  4X1I B;  5LA6 B;  2HQS C;  2BO1 A;  4X20 B;  5FNV B;  1U40 A;  2UYP A;  1UI9 A;  3TD4 A;  1YJW F;  3EOR A;  2HP0 B;  3VI6 A;  4X20 A;  4F6R B;  4BT3 A;  2IG8 A;  1NQ3 A;  3DDN A;  1W57 A;  3FBA A;  1KD1 H;  5CB4 A;  3MDO A;  3G4S F;  4TV8 B;  4EB6 B;  4ZHQ B;  3JAT B;  1W5A A;  3WXM B;  2CHT A;  3OBY A;  4YJ2 B;  3LWV C;  4LNU B;  5CB4 B;  4ZOL A;  4EB6 A;  4ZHQ A;  3JAT A;  1YHQ F;  2OHW A;  4YJ2 A;  4B45 A;  2PHN A;  4ZOL B;  1OAP A;  1XBI A;  3WGN A;  1QAH A;  1ZWZ A;  2H6L A;  4X1K A;  2AIZ P;  1GO0 A;  3ZP4 A;  3U0O A;  3UT5 B;  1T0A A;  3VOA A;  1YJN F;  2JNB A;  3N2G B;  3IR9 A;  3VYS C;  4X1K B;  1VQN F;  3FPI A;  5JVD A;  2HRY A;  2PMP A;  3N4Y A;  4BT2 A;  5IYZ A;  3ELC A;  3M4S A;  5LOV A;  3NVI B;  4O2A B;  2UYK A;  2Q1Y A;  2KTU A;  4BVT A;  5IYZ B;  3CCR F;  3P10 A;  5LOV B;  4EI9 A;  4U3J A;  3PLA C;  5HY4 A;  3NMU C;  3CMA F;  2QI2 A;  2H8E A;  3JAR A;  3CD6 F;  2DYY A;  5IJ0 A;  5HP8 A;  5EB0 A;  1XV2 A;  2DT4 A;  4X1I A;  5LA6 A;  1GZ0 A;  3I3F A;  5FNV A;  5MN6 A;  2KGW A;  3CC4 F;  5JH7 B;  2HP0 A;  5IJ0 B;  2AIF A;  3CB2 A;  2ZOD A;  5MN5 A;  1TVK B;  3BYQ A;  4F6R A;  3AGK A;  5HY0 A;  2LBT A;  1YIT F;  3OBW A;  3CCQ F;  1RLU A;  5EWR A;  5EAZ A;  1TVK A;  3I7T A;  4TV8 A;  2MQE A;  4E6E A;  5GIO C;  3E22 A;  1JJ2 F;  1JFF B;  5MN4 A;  2UYN A;  2Z1F A;  4BY9 D;  2N48 A;  2ZVY A;  1W5F A;  3VOB A;  2QTP A;  1W40 A;  1W41 A;  4U39 A;  1CLI A;  3HKD B;  2UYN B;  3WGL A;  3C9S A;  3S02 A;  2P6Y A;  4B62 A;  3HKD A;  5HP7 A;  2YYE A;  1Q81 H;  4LCK A;  3I56 F;  4C8I A;  3UT5 A;  3HTN A;  3WJR A;  3LYB A;  4HNA B;  3S0H A;  4O4H A;  1FNJ A;  5GIP C;  4C8E A;  2HVY D;  4X3L A;  3TD5 A;  1W58 1;  1NJI H;  4O4H B;  3ZP7 A;  3ESJ A;  5GAP K;  2KTV A;  1CK2 A;  4O2A A;  1JY8 A;  1OFU A;  2H8C A;  5KX5 B;  1Z5W A;  3M84 A;  2CW4 A;  3C9T A;  1W59 A;  3FD5 A;  2CSL A;  3C8L A;  4U3J B;  4BVS A;  1GX1 A;  5IT9 M;  2HS4 A;  3S06 A;  1SA0 A;  2K1S A;  2Z1U A;  3LWQ C;  1PF5 A;  2VGN A;  2V9Y A;  2Z1T A;  3J81 M;  3K2X A;  1Q82 H;  3J80 M;  3JAK A;  3NK6 A;  3LME A;  2ALE A;  4G4W A;  5JH7 A;  1VQL F;  1X7O A;  3V7Q A;  4ZHW A;  4I4T B;  3JAK B;  1N8R H;  3V4D A;  3G6E F;  3J7A R;  3JAL B;  2HRU A;  1KNK A;  5HY2 A;  2VAP A;  3KHN A;  4C4W C;  1VQK F;  1IPA A;  2BTU A;  2RHH A;  3E22 B;  1T0K B;  1JFF A;  1R1M A;  3JAL A;  1VHA A;  3LWR C;  4B46 A;  2AMT A;  3MCA B;  1NMU B;  5CA1 A;  1VQ6 F;  3M1X A;  2LCA A;  1H47 A;  3ON1 A;  4O4I A;  3E20 B;  3HWU A;  3IKF A;  3OW2 F;  1KNJ A;  5CA1 B;  1UFY A;  3CG6 A;  5DCV A;  3PAF A;  3MCQ A;  5LXT B;  4X1Y B;  2I6D A;  4TV9 A;  3WGM A;  3NK7 A;  3CCM F;  3S0Y A;  4O4L B;  1SZQ A;  4HNA A;  1IV1 A;  1RLG A;  2RHO A;  3RA5 A;  1M90 H;  2HX0 A;  2R75 1;  4FFB A;  2NMU A;  4TV9 B;  2OTM A;  2YXZ A;  4O4L A;  3QHD A;  4PWT A; 
#chains in the Genus database with same CATH homology
 3L7Q A;  3VCZ A;  1FNJ A;  2IG8 A;  3KJJ A;  3QUW A;  1NQ3 A;  3ZP4 A;  1XHO A;  3M1X A;  3K0T A;  2CVL A;  2UYN A;  3R0P A;  3K12 A;  1FNK A;  3ZOP A;  1J7H A;  3LME A;  1ONI A;  3ZO8 A;  2DYY A;  1ODE A;  4NWO B;  2EWC A;  5HP8 A;  1UFY A;  2CHT A;  3KJK A;  2CWJ A;  3ZP7 A;  2B33 A;  2UYN B;  3I3F A;  1JD1 A;  3GTZ A;  1QD9 A;  1XRG A;  2CW4 A;  3MQW A;  2CHS A;  3V4D A;  2CSL A;  3M4S A;  2UYK A;  5HP7 A;  1DBF A;  3I7T A;  2UYP A;  1UI9 A;  1COM A;  2UYJ A;  1PF5 A;  2OTM A;  3D01 A;  3LYB A;  1QAH A;  4ZK7 A;  1QU9 A;  1X25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...