3K0XA

Crystal structure of telomere capping protein ten1 from saccharomyces pombe
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
SAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
molecule keywords Protein Ten1
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12658 Ten1 Telomere capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k0xA00
1TWCH 4HIOA 3HOZH 4X62Q 4C3JH 3M85A 5ELNA 1X54A 5IWAQ 3HOWH 3CCUA 3RZOH 3CCQA 4P74A 3OW2A 4B3SL 3CPFA 4B3RL 4P72A 1LM0A 1X3FA 3GDEA 1L1OA 2IHEA 3NBHB 2OWOA 2D0PA 3IRBA 5JJIA 5M3MG 4PZ6A 3RR5A 1L1OC 1G291 2RCNA 4DUZQ 1PH4A 1X56A 3J81c 5C44G 4AQYL 2WAQE 1QVFA 1QUQB 2A8VA 4JV5L 3KJPA 1QUQA 1BBWA 1J5EQ 2BA1A 4DV6L 3CCLA 3UDIA 1EFWA 4A3LG 5IP7G 1YJWA 1BVSA 2E8GA 4B3SQ 4A3BH 4KHPQ 4WJ3M 4TQUS 2HQLA 3KF6B 4P75A 4B3TL 4Y52H 1UWVA 2I5LX 4LF7Q 4X66L 4A76A 1KL9A 4A3EH 4AH6A 1DGSA 4KI0A 1N36L 1XNRL 1JT8A 1YJNA 2E2IH 3TREA 4OWWB 2R7ZG 1MKHA 4C2MH 4GNXB 3GTPH 1LUZA 4JI8Q 1XNQQ 3PO3G 2K5VA 4LFCQ 2N49A 4PMWA 1E24A 3H15A 1K0RA 3J81i 1C9OA 2GVBA 1VQGA 1X3GA 1GVPA 1U0LA 3FKIG 4PZ7A 5DLQE 5GQOA 5IP9G 1YJ9A 1K8AC 4LFBQ 2MQHA 4XIGS 1VQJA 1WYDA 4DUYQ 1IBKQ 1YI2A 1Z9FA 4OONA 2CCZA 3K7AH 3RLNA 4AYBG 2ZJRA 1Q81C 4OWXB 1YEZA 4JI1Q 3RLOA 3TEHB 4OX9Q 4DR6Q 1KXLA 1A62A 4NB3A 1AE2A 5M3FH 1NBWA 1NMGA 5GROA 4DR5Q 1LTLA 1VQ7A 5IT9c 2F4VQ 2UXBL 4AYBE 1AH9A 4A3KH 1VQ5A 2Q2TA 1G6PA 1EWIA 3S17H 5IYCH 3JC66 4JI1L 2K4KA 1V1QA 2ZJQA 3CC4A 4GOPB 2H5XA 2ID0A 3BZCA 2K50A 3DM3A 4DR3L 4YWLA 1VQOA 4JI0L 1QVGA 5AJ3L 3L2PA 3KOJA 1GM5A 2E5LQ 5HGQA 1WOCA 3L0OA 4JC0A 3TQYA 3GO5A 4LFAL 1CKNB 3HKZE 1HZCA 3L7ZC 4JI4Q 4PZ8A 1VQIA 3AFPA 2JE6I 5M3FG 2MO0A 1JJ2A 4GN5A 1JE5A 4LF7L 4R4OA 1A0IA 1NJIC 3I4MH 3HOVG 4HJ8A 4A4IA 2R6GA 5C0XG 4JI7L 2KCMA 5JEAJ 2R7DA 1PH1A 3M3YH 4HJ9A 4BBRG 4X66Q 1U5KA 4L5SA 2HIVA 1HNXQ 2GVAA 1V9PA 2UXCL 4J15A 1Q7YC 2IT1A 3AQQA 4Y7NH 2N78A 4GS3A 4DV6Q 1MJEA 4LF5Q 3M4OH 3J7ZC 1B70B 2MFIA 1VQKA 1BKBA 2PMZE 2ZTDA 3CCEA 4GLXA 1Q46A 2NVQH 3E9HA 3J7A5 3JAMc 1X3EA 4NXML 4OXPA 1MIUA 3GTJH 2R7ZH 4BXXH 3KYHC 2UUAL 1SN8A 2CFMA 2WAQG 4LF6L 3S1MH 1FJGQ 3BU2A 4TVAB 5GAEC 3H0GG 4IO9A 3HOUG 3PO3H 2ZTCA 4JOIC 4JI6L 1VQPA 3CCVA 1IXRA 3PUZA 2LXKA 3HOZG 4QIWE 3PIOA 2C35B 4LUZA 3FKIH 5IP9H 1G51A 3OTOQ 4BY1H 3HFZB 3HOWG 1GKHA 1SR3A 1VQFA 4DV5Q 4DR6L 3KDFA 2PI2E 3NELA 2VL6A 1T9HA 1WCMH 5C0XI 1XPRA 1FJGL 4A3DG 5BR8L 4IFDG 1HNWL 4GKKQ 4RMFA 4DV0Q 5GAHC 1YITA 3HKZG 2IX0A 4DV4Q 2N8NA 3I55A 4B3ML 3H0GH 2KHIA 3JAMi 2Y0SE 4JBKA 3KF8B 1L2FA 4APVA 4DAMA 4A3LH 1A8VA 3I7FA 5IP7H 1HNXL 4IJHA 4JOIA 1N33Q 3S1NH 3W1GA 3I2ZA 1X65A 5IWAL 2JEAI 4GN4B 4GKKL 3D0FA 3EN2A 2OQ0A 4R4IA 4BY1G 3HOXH 3A5UA 3K8AA 4JBJA 4JI3L 1OXXK 4QL5A 3CMAA 2KBNA 1M1KC 4DV7L 4OWTB 1S40A 4NXMQ 4A3JH 1N36Q 2BH8A 4A3GG 3CPWA 4GNXA 4LF4Q 3AFQA 1IL2A 2NVTH 2PQAA 4LF5L 1Q1EA 2IHFA 4JG2A 3DLLA 4DR7Q 3UDXA 3B6YA 4DPGA 1CSQA 5LMNL 2ALYB 1KC8C 2UUBQ 4JYAL 2OQKA 2K52A 2I0QA 4BBSH 2VQFL 2VUMG 2CWAA 4JI2L 4LWCA 4X65Q 3K0XA 3CCMA 2FXQA 1C7YA 4A3IH 4EQ5A 1D8LA 1QVCA 4R1JA 1E3PA 1K73C 1IBLQ 1VQCA 4UP9A 4PG3A 2DUDA 1CKNA 1IBML 2UXBQ 1Y14B 1PH2A 2UU9L 3FHWA 4BXXG 4A3FH 4A3GH 2KCTA 3J81j 2RHQB 4YY3L 2VNUD 2N3SA 1W2BA 3HOUH 5LMUL 4A93H 4X62L 1Q86C 1OXVA 1L0WA 3E0EA 4YWKA 3J80i 1NTGA 1VQEA 1NE3A 3BZKA 1I94Q 2VUMH 4IPCA 2LXJA 4LFAQ 5JJLA 4X6AH 3CW2C 4O0AA 5IE8A 2NZOA 5AJ3Q 1PH6A 4OX9L 2EQSA 1TWGH 2NN6I 2AHOB 3S24A 3WWVA 4L5RC 4HIKA 3EIVA 3F8TA 4JI7Q 1VQ8A 2NN6G 4LF8Q 4QY7A 1K9MC 2L15A 1NY4A 1AE3A 4R4CA 5LMNQ 5IY0A 3CC2A 4UY8C 1YHBA 4B3TQ 3W1BA 3G4SA 5H1SE 4A93G 2OTLA 2B63H 1LYLA 3ER0A 1TWHH 2OCEA 4BBRH 4DV2L 2V1CC 3G71A 4DV4L 1PHJA 4UP7A 1IZ6A 1H95A 1IBLL 2PI2A 2K14A 3PGZA 1YIJA 5EAYA 1XMOL 4DV3Q 3VDYA 3PO2G 1UE5A 4NXNQ 4UPAA 2RF4A 3E9IA 2IX1A 3STBD 2VQFQ 2R93H 1VQHA 1OTCA 2UUCL 1OXSC 1VQAA 2CQOA 4YY3Q 1PH9A 1EOVA 4IPHA 4YHHQ 2UU9Q 2UXDQ 4IOCA 2OTJA 3OTOL 1GO3E 1HR0W 4YHHL 4X64Q 4GOPC 2RHSB 1IBMQ 3NENA 4IFDI 1N34Q 3CP0A 3I56A 5BR8Q 4LF9L 3A0JA 4MZ9A 2YTVA 4YWMA 2E2JH 5C0XJ 1B8AA 2ASBA 1O7IA 3I4NH 2R92H 3HKSA 5IYDH 4DKAC 4DV5L 2KHJA 3S14H 4A3DH 1YHAA 4A75A 1ASYA 1WI5A 1I50H 1P16A 1Y1VH 4GNXC 2R93G 4GLVB 4DK6C 4DR2L 4A3FG 1FVIA 1B7YB 3RLFA 2VQEL 2YYZA 1HNZQ 3PUWA 1HNWQ 2AWNA 1PFSA 3PUYA 3STBC 4HJ7A 2JA5G 4DUZL 1VQBA 2WB1E 1I6HH 1J6QA 1VCIA 2DGYA 1PV4A 3GTOH 3S2DH 2EIFA 3ULJA 3I4NG 4A3JG 1A63A 4GN3B 3ULPA 1XPOA 4KHPL 3A5ZB 4KHZA 3Q8DA 4GLAC 2ES2A 5J3BA 1XJVA 1N32L 1YVCA 1EUJA 1I5FA 2Z6KC 4NXNL 4C3HH 3UE1A 1NMFA 2JJQA 2VY3A 3F2DA 4QGUA 2K5NA 4BBSG 3UDFA 4O2DA 3U58A 2D0OA 3FP9A 2QA4A 1N34L 1KRSA 2MO1A 3M7NA 4JBWA 4A3IG 1RL2A 4QQBX 1TXYA 2R7FA 2WFWA 4FDBA 4YCWA 3PO2H 3KJOA 3F2CA 4YCVA 1EQQA 4P71A 4JI6Q 4GKJL 2B29A 3U4VA 2E2HH 2Z0SA 2I5HA 3S1RH 1JMCA 1EIFA 1WFQA 3M4QA 4WJ4A 4RG1A 2JA9A 1I3QH 1SFOH 5E7NA 1CKOA 1KRTA 1Y1WH 1XTDA 4DR5L 4DAYB 4QJFA 2JQOA 1PH8A 5M5XH 2EXDA 5LMNW 2A19A 5FLXc 4LUOA 2AMCB 3HOXG 2HT1A 1UE6A 1XPUA 4A3CH 3TRZA 1S72A 4JI3Q 2ZJPA 4DR1L 1N8RC 4LW1A 1K3RA 5IYDG 3ICEA 4GOPA 4YCUA 1XMQL 3TS2A 2A1AA 1K8GA 3H3VH 2VZAA 2QEXA 1VQ6A 3KFUA 3UDGA 1TWFH 2CWPA 4IFDJ 4B3MQ 1KAWA 2BH2A 1FGUA 2F4VL 1R9TH 2JEBI 3KLWA 3UE0A 2JA6G 2QGQA 1SMXA 3HOYG 2WP8J 4P73A 3RZDH 1BBUA 1J5EL 2B63G 3RNUA 1FL0A 1UE7A 3T1YQ 2JA5H 3PV0A 4BA2I 1CKMA 1SRUA 2YV5A 4BA1I 1QZHA 1CSPA 2LSSA 1SLJA 2JK8A 3GD7A 2YTXA 2YU9H 2ZM6L 3GTGH 3F2BA 3GTMH 1PH3A 4NPSA 5C44H 4H02A 3S15H 4LFCL 1Q82C 5JJKA 3S2HH 3CC7A 1QZGA 2K5HA 5FLMG 3GTQH 2UUAQ 4LF6Q 2HIXA 2WB1G 3RN5A 4DUYL 1IBKL 1EYGA 4ALPA 4K0KL 4L5QA 2VW9A 4OO1G 5FJ8H 3KF6A 4XTCS 2B3GA 1XMQQ 4HIDA 1KD1C 5IYBG 1KIXA 3CCSA 2CKZB 1M90C 2R92G 2I5MX 3J80c 5GAGC 5GADC 3CF5A 3T1HQ 2PNHA 3PSIA 1TWAH 1VQDA 4BY7G 1VQMA 3I4OA 1Y1VG 1E7ZA 1X55A 3CMEA 2JA8G 3CQZH 1RIPA 1PYSB 4DR4Q 1Q1BA 4AQYQ 1PH5A 2F3IA 3K81C 4IPGA 1KHIA 4A3MG 1HZBA 4JBMA 3LGJA 5FLMH 3G6EA 1Y1WG 1HR0L 3K80C 3U4ZA 2VQEQ 1HNZL 3S16H 1X9NA 4DV1Q 3RN2A 5M3MH 1YNXA 4DR3Q 1N33L 4DV1L 1HJPA 2NVXH 2Y0SG 1Z47A 4L5TA 4JI5L 5C4XH 5IYBH 2AKWB 1PA6A 3SGIA 2ZM6Q 3U50C 5C3EG 3W5OA 3BJUA 1HR0Q 4DV3L 2ATWA 2NZHA 4R4QA 5JEAG 2XGTA 2YTYA 4MTNA 2JA8H 3PCOB 4POGA 4A3BG 5C4JH 3NEMA 2JA6H 1XMOQ 3HOYH 2KENA 2Q2IA 4A3MH 1VS0A 1JB7A 2F52A 5HY6A 2UXCQ 3MXNB 2MNAA 4X64L 2PQAB 4KLKA 1E22A 1PYBA 1HZAA 3ERSX 1SE8A 4IPDA 4DNIA 3MEFA 1KQSA 2UXDL 4AIMA 1EIYB 3K7UC 2UUCQ 1UEBA 1N9WA 5C4XG 3PF4A 4R4TA 4DR4L 1K83H 4LUVA 3PUVA 3I4MG 5M5YH 3AEVA 3OYYA 4HIMA 3G48A 3M4PA 5M5WH 3T1HL 4EX5A 4DR2Q 3ULLA 2XTIA 3AYHB 1I94L 2AWOA 1ASZA 2JA7H 1HH2P 3EBEA 3PIPA 1X6OA 1VQ9A 1VQNA 4K0KQ 2HHHL 1PH7A 3TS0A 4LF8L 3D31A 4DK3C 1V43A 5LMUQ 4DR1Q 4GKJQ 4JI4L 1EQRA 1SROA 4JCVE 3GTKH 1MJCA 1VQ4A 3KDFB 2E5LL 4BY7H 4A3KG 4LF9Q 2VS1A 2IY5B 5IYCG 4JI0Q 1L1OB 1C0AA 4JV5Q 2GN5A 1P8LA 3ZJYC 3GTLH 1IYJB 1UE1A 2HHHQ 2K75A 3CD6A 4IOAA 1YZ6A 3CXCA 1W3SA 1JJGA 1JJCB 4A3EG 1OXUA 4JI5Q 4UP8A 2Z6KA 4JYAQ 1WCMG 3T1YL 4B3RQ 1HZ9A 4LNQA 4POFA 3F1ZA 1YBYA 3H3VI 1OXTA 1XNQL 1CUKA 4DV7Q 1PVOA 1E1TA 4C3IH 5C3EH 1E1OA 4DV2Q 3HOVH 4HJAA 2Q2UA 4MNOA 1XNRQ 1Q12A 1Q8KA 3CAMA 3PUXA 1YHQA 2Q2HA 2NVYH 2BA0A 4X65L 4JI2Q 2JA7G 3S1QH 5K36G 1N32Q 1GD7A 2D62A 2UUBL 2ZTEA 3PF5A 4OO1I 4A3CG 3CCJA 4LFBL 3CCRA 1WJJA 5FJ8G 4DR7L 4JI8L 4ME3A 4LF4L 1D7QA 5ELOA 4HJ5A 4DV0L 1VQLA 4IJLA 3A74A 1S3OA 3M9BA
chains in the Genus database with same CATH superfamily
3LWUA 4DNRB 5ELNA 3HOWH 2PZTA 3OW2A 4J6HA 2IHEA 3NBHB 5JJIA 2D0PA 3IRBA 1G291 2RCNA 1EEFD 3BYTB 5I9OA 5A2QL 3J81c 2EY6A 1WTHA 1QUQB 4RGMA 1CT1D 1J5EQ 3S15B 3VYUA 1A2TA 1EFWA 1PZID 4B3SQ 2PYKA 4WJ3M 3RD4A 3X3NA 1N36L 4RKBA 4AH6A 4KI0A 1YJNA 2E2IH 1KDCA 1EEID 4CHTB 1E2WA 3HOXB 2N49A 4PMWA 1C9OA 2GVBA 1VQGA 1X3GA 2ICEC 4PZ7A 5GQOA 3T51B 4BBRB 1YJ9A 2WKDA 1QJOA 1IBKQ 1Z9FA 1Q81C 1YEZA 3RLOA 2QW7A 3FVQA 1RTOA 4NB3A 1RKNA 2I46A 1U4RA 4MN3A 5I9PA 4A3KH 4A3IB 3JAML 4DGZA 5IYCH 4K2KA 1LTTD 4C3IB 2K50A 4HAEA 4DR3L 3MAQA 1SSOA 1MSHA 4KKSA 1QVGA 4JC0A 3HKZE 3L7ZC 2JE6I 3S17B 2B2VA 4KD3A 3HOVG 2GA4B 3MXNA 4FXGC 5M3MB 1BDOA 2RSOA 1V9PA 3M4OH 3J7ZC 3SK6A 3E9HA 2TMPA 4NXML 3URYA 2UUAL 1SN8A 1EZ8A 1SXTA 4IO9A 3TMEA 3M3YB 4ABNA 1STAA 4JI6L 1VQPA 2C35B 1KTKA 1G51A 3OTOQ 4Z9CB 1B50A 2VXWA 5JPNC 1R9TB 1SR3A 4FF2A 3KDFA 3NELA 5D3DA 3GTJB 4OELB 1FJGL 4HSVA 4NW2A 5FO7B 1WTPA 2RVLA 5GAHC 1YITA 4ZK9B 2IX0A 4FNFA 3I55A 3H0GH 1SJED 4PMBA 5IP7H 1O80A 1N33Q 2JEAI 3D0FA 2KCCA 3HOXH 3A5UA 2L4NA 4JI3L 1VDZA 2CVRA 4KD4A 2KBNA 4OWTB 4RHSA 2BH8A 3CU7A 5CBAE 1ENCA 4DAYA 3UDXA 3B6YA 1KC8C 2F0OA 4BBSH 5KYLA 4C3JB 2VQFL 2A68D 4LWCA 3K0XA 4FVMA 4A3IH 1B1ZA 1K73C 4K6DA 1QWYA 2UXBQ 1CKNA 5CV5A 1NAPA 1PH2A 3E3XA 3J81j 3HOUH 1GUGA 4KV6A 1SNDA 1OXVA 2MGSA 5EGTA 1VQEA 4EQOA 3BZKA 1I94Q 4IPCA 2SNMA 2L55A 2PW5A 4X6AH 4O0AA 1DD2A 1A15A 3I70A 3U9OA 4HIKA 3W2DA 1HTLD 4DXFA 4QY7A 3CQZB 1K9MC 5LMNQ 3VYTA 1AE3A 2ICIA 4R4CA 4OEMB 4UY8C 4IUNA 1UNSA 3VR6A 2Y0SB 4A93G 2B63H 2OCEA 4UP7A 1H95A 4X3SA 2PI2A 3NP8A 2RF4A 3E9IA 5LHY1 2G9HD 4XYOA 4MTKA 4YHHQ 2UU9Q 4CKEA 4IOCA 3SXHA 3NENA 1GUNA 1N34Q 3CP0A 4KY7A 2YTVA 4YWMA 5C0XJ 3H0GB 2ASBA 3D8GA 1AFPA 3NK9A 2CHBD 1LV9A 1U9RA 3BG3A 4GNXC 1Y1VH 4R8IA 4DK6C 2LKVA 4A3FG 4Q0FA 1CA5A 3I8ZA 1NNXA 1HRJA 3RLFA 5M5WB 3PUYA 2JA5G 2DY8A 2F0JA 4B9XA 2AUJD 3GTOH 3ULJA 4BS9A 3J7AV 2CW0C 1A63A 4Q5VA 3ULPA 4KHZA 1EQTA 1S5FD 2NTTA 3L9AX 3H3VC 5J3BA 1XJVA 1TR5A 2K28A 2A5HA 1I5FA 3Q24A 4C3HH 1NMFA 2VY3A 2D0OA 1TS2A 1KRSA 2MO1A 3IKJA 1T5EA 4JBWA 1RL2A 4QQBX 1I4QA 1K28A 1TXYA 2O2LD 3Q0AA 3O13A 4B08A 2Z0SA 4K2LA 5DNFA 1WTQA 4WJ4A 4RG1A 1NSNS 1JWSD 3CKIB 5C3XA 3Q22A 1SFOH 1CKOA 4DR5L 2JSOA 4DAYB 4QJFA 2EXDA 5CMDA 5FLXc 1G6ZA 4HCEA 2HT1A 5TSSA 4DR1L 1FNVA 2K1BA 1HA5A 2VZAA 2QEXA 1VQ6A 2K05A 4O42A 4KKTA 4IFDJ 2AUKA 2KA7A 4B3MQ 1STBA 2BCOA 5E3FA 1H9SA 4ZAIA 1SNQA 1I4HA 3EA6A 1ICWA 5KNCA 3I73A 5FO8B 1C48A 3K59A 1CKMA 1QZHA 3GD7A 2ZM6L 5BN4A 2K5DA 3C3LA 2QKIC 2EPBA 4H02A 4A3FB 4UAIA 5JJKA 1PDQA 2HCIA 3RUZA 2HIXA 2JA5B 2I07B 2WB1G 3MA2B 2WB1B 1IBKL 2VUMB 2D2CC 4L5QA 3VR5A 2VW9A 5FJ8H 3R2IA 2CKZB 5GADC 1VQDA 4BY7G 1VQMA 1LTAD 1PZKD 3JAME 1PYSB 4DR4Q 1KABA 1Q1BA 2KEDA 4C3JG 1KHIA 4A3MG 4KKUA 1FD7D 4JBMA 3ND8A 2NUCA 1O78A 4J8QA 1X9NA 3RN2A 5M3MH 1HJPA 5F2DA 1D5MC 4L5TA 4JI5L 5IGCA 5CYUA 5IT9E 1PA6A 3W5OA 3BJUA 2AQ3B 2ATWA 1A6XA 1K8OA 4N9PA 2JA8H 4A3BG 5C4JH 1XMOQ 2E2DC 3HOYH 5K36H 3A8JE 4A3MH 1VS0A 1JB7A 4LAAA 4QUCA 3MXNB 1JOQA 1CQVA 4X64L 1H9MA 1EU3A 1H9KA 1AZPA 5EQ0A 1PYBA 1HZAA 3ERSX 4DNIA 2Z1CA 2R92B 1LTSD 3K7UC 1N9WA 4RGOS 4LUVA 3MFGA 2IW3A 3PUVA 1E0BA 2TSSA 3LNNA 3G48A 3M4PA 4RWSC 3T1HL 1MD2D 2Z4IA 4C1NI 4DR2Q 3FPPA 1ASZA 1Q90A 2XN9C 4JI4L 1SROA 3S1MB 2F0UA 3GTKH 1VQ4A 1QNKA 2VS1A 2IY5B 4MHEA 5ELDA 1L1OB 3QIAA 1G2SA 2KCNA 1UE1A 2HHHQ 3CXCA 1JJCB 4JI5Q 4UP8A 2Z6KA 4LNQA 4POFA 1GUTA 3A8IE 3F1ZA 3K58A 4H7BA 1XNQL 1K8MA 2E2HB 1FYCA 3A56A 4OIKA 3FRPB 3HP3A 1UEAB 2ZXRA 1Q8KA 3S2DB 1U4LA 1DM0B 2N55A 3I72A 1HFGA 2LMCB 2ZTEA 1CA6A 2DY7A 4A3CG 4LFBL 2CW0D 4DR7L 4A3JB 2B2UA 1IKMA 3AMUA 5ELOA 1MSGA 5C4ZA 3HOZH 4X62Q 2RCFA 4OHJA 3TP7A 4F87A 1X54A 2CQAA 5IWAQ 4KN7C 3CCUA 3CCQA 4P74A 1PFBA 2XWJB 4B3RL 2L9HA 3MVVA 4P72A 3M4YA 1L1OA 3MXUA 3S1RB 2OWOA 5M3MG 2EY2A 4CDFC 4PZ6A 4A3MB 1L1OC 4DUZQ 3BYYB 1X56A 3NPPA 1SYBA 3NHHA 5C44G 4HMIA 4R8NA 4AQYL 2A8VA 3KJPA 1PTOF 5M5XB 2PQEA 5KYIA 4DV6L 3D3RA 3CCLA 4KHPQ 1EY0A 1DYQA 3KF6B 3QO2A 3QG1A 2I5LX 4X66L 1KL9A 5IIFA 1B44D 1DGSA 3G7LA 1XNRL 1MKHA 4C2MH 4GNXB 4JI8Q 4DAVA 3IAYA 3FEWX 2WKCA 4LFCQ 1SE3A 1C4QA 3J81i 1U0LA 5DLQE 2MQHA 3PMFA 1VQJA 5JAVA 1J8IA 4JI1Q 3TEHB 2NWGA 4OX9Q 4WORA 1AE2A 1NMGA 2F4VQ 4DR5Q 1LTLA 5E4XA 3C46A 2UXBL 4AYBE 1VQ5A 1G6PA 1SYDA 1EWIA 3S17H 3K57A 4JI1L 2K4KA 3DHQA 4GOPB 3BZCA 1CFMA 4YWLA 1VQOA 4JI0L 1GM5A 3KOJA 5HGQA 1R4PB 1CKNB 1HZCA 3L3OC 4PZ8A 3AFPA 4XQJA 5IGGA 4LF7L 1A0IA 4A4IA 5C5LA 3M3YH 1B9NA 4HJ9A 4BBRG 3S16B 1U5KA 5CV7A 1HCZA 4DF7A 4Y7NH 1L0XB 4DV6Q 4LF5Q 1ZYRC 3HOZB 1VQKA 1JE4A 2PMZE 4GLXA 4V0BA 1Q46A 5CV9A 5L37A 1DZ1A 2NZ1D 4H0LC 3GTJH 4BXXH 2WAQG 1STHA 1CK1A 2F0SA 3PO3H 4ME5A 4RAUC 4XXEA 3DEOA 4QIWE 3HOZG 3PQIA 3DEPA 1BCPF 1NR4A 2QF7A 1GKHA 4DV5Q 5JVH3 1XPRA 1T9HA 3KUPA 4A3DG 1SBBB 4GKKQ 4QIWB 3HKZG 4DV4Q 4B3ML 1PTOD 4NMZA 3JAMi 2Y0SE 2F0LA 3KF8B 4APVA 5ISRA 3I7FA 4IJHA 5IGDA 4GN4B 4GKKL 3EN2A 4BBSB 1EYAA 4JBJA 1OXXK 2G9DA 1G8ZD 4DV7L 1S40A 3MC0B 3E6ZX 5LL6S 1HUMA 3CPWA 4LF4Q 2E76C 2JXMB 1IL2A 2IHFA 4JG2A 3S1NB 1Y8NB 4DPGA 1CSQA 1I6VC 1I6HB 5LMNL 4TRDA 2ALYB 3HOUB 1S5CD 3SK8A 2FXQA 1BOSA 2K33A 1II3A 1D8LA 1QVCA 1WD0A 4N9TA 2KCTA 2VNUD 4IURA 2Z9HA 4X62L 1L0WA 3E0EA 1NTGA 1NE3A 2B63B 2AQ1B 2LXJA 2PZUA 5D3IB 4ZKBB 5JJLA 3CW2C 1D1IA 1I3QB 1TWGH 2B39A 1AN8A 4L5RC 3F8TA 1VQ8A 5CC4A 1TY2A 3CC2A 1YHBA 4MIUA 1HQRD 2EY1A 1BQQT 3Q6SA 1RD9D 2PCFB 4BBRH 1IHZA 2L12A 4DV2L 4DV4L 1IBLL 3PO3B 1DONA 3PGZA 1YIJA 5EJWA 4HEDA 1UE5A 1E2ZA 2LFNA 2IX1A 3EFXD 1OXSC 2UXDQ 2A69D 2IX3A 1Y1VB 1HR0W 1LT6D 4GOPC 1WTRA 3SR1A 5KNBA 3SHLA 1IBMQ 1I4RA 3I56A 3WDNA 3A0JA 2DN8A 3H09A 2B2TA 3J80E 2XRSD 5IYDH 4DV5L 4G57A 4A3DH 4KJOA 4A75A 1I4GA 5CGKA 1ASYA 4PQXA 1WI5A 1P16A 4GLVB 3OSOA 1CHPD 4I65A 1FVIA 1HNWQ 2AWNA 2BDOA 1PFMA 1WD1A 1RTNA 1VQBA 2IWHA 1I6HH 4B9WA 3S2DH 1V1PB 4C56C 3I4NG 3TBIB 4GN3B 1XPOA 1WTVA 4KHPL 3SDZA 2NN6H 1N32L 2Z6KC 3TDQA 4ILWA 4NXNL 2WAQB 3UE1A 3NE5B 2K5NA 3AB9A 5C5MA 2RDFA 3M7NA 1Y8PB 4CBVA 4XQQA 1B9MA 2E74C 1TY0A 3KJOA 4YCVA 4OL7A 3T4AC 4JI6Q 5C4HA 1CTMA 5LL6X 3S1RH 2HCCA 5EKLA 1WFQA 1I3QH 5C3WA 1UAPA 4RCNA 1KRTA 2P5ZX 3LX0A 4IUPA 3S1QB 5M5XH 1Y8OB 1F2MA 2D9UA 3HOXG 4I7AA 1UE6A 1WTOA 1S72A 3DM1A 1N8RC 3DMUA 1K3RA 5M5YB 4YCUA 1F2YA 3TS2A 2A1AA 3HZXA 3H3VH 2OT2A 1SYEA 3KFUA 5D65A 1WTXA 1TWFH 1JB3A 3A55A 1FGUA 2F4VL 2MP1A 4DAPA 2JEBI 3UE0A 2WP8J 1BBUA 1EY6A 1STGA 3WOEA 2JA5H 1GUWA 1SRUA 1VF5C 2FFKB 1SLJA 2MJ8A 1RHPA 4FF1A 1HUNA 5C44H 4LFCL 1Q82C 3ND9A 5EKKA 5FLMG 3NTIA 2UUAQ 4GZYC 2F0QA 1PRTC 4K0KL 1SMYC 2F0EA 5CORA 1XMQQ 3CCSA 3J80c 5GAGC 3CF5A 2K6AA 2NVYB 3T1HQ 3I4OA 1X55A 3CQZH 2FMCA 3LGJA 4L63B 2PW7A 5FLMH 4KK7A 3K80C 2B2TC 2VQEQ 3HOYB 1LABA 3S16H 4DV1Q 2PO4A 4A3GB 1N33L 5IT9L 4DV1L 1Z47A 5C4XH 3CRKC 3MHBA 2A69C 3U50C 1D6EC 1YNJC 1F9RA 5JEAG 2KUMA 2HUGA 2YTYA 3KBXA 2HDMA 4POGA 1E2VA 1A3UA 4N8X1 2M9VA 2Q2IA 2PPBC 2MNAA 1XXGA 4KLKA 2MPMA 4RHRA 1W6KA 4IPDA 3MEFA 4AIMA 2Z8LA 5C4XG 3PF4A 3FDTA 1K83H 2RDHA 3GTKB 4DU9A 5M5YH 3OYYA 5C0XH 1J9OA 1PTOC 5M5WH 1EOTA 1JQYD 3V96A 4EX5A 1FNUA 3AYHB 4ZQ3A 3EBEA 2QILA 1Z6HA 4FXKC 3VA7A 1JCKB 3D31A 3LWEA 4JCVE 4BY7H 4LF9Q 4KY6A 4HN7A 5IYCG 3NBHA 3TZUA 4JV5Q 3MTSA 5C44B 2SEBD 1IYJB 3T13A 4A3EG 2L5TA 1U4PA 2K03A 4B3RQ 1XX8A 1YBYA 4F8MA 4J1MA 1CQFA 2A6HC 4CKBA 3H3VI 2B2VC 3A7LA 4ZLTF 1LT3D 1E1TA 4M1UB 4DV2Q 2EJFC 3HOVH 4OIJA 5I2XA 3OHXC 1XNRQ 1Q12A 3GTLB 2Q2HA 2NVYH 4FO2A 3M7GA 4JI2Q 1N32Q 4FYDA 3K5LA 2UUBL 3BVZA 4HMJA 1RJTA 4DNTB 3CCRA 1WJJA 1BNZA 1S4ZA 2C5CA 3G6JB 4QCLA 4KMUC 3QR8A 2PZWA 4DV0L 1VQLA 3I90A 2DJFC 1XTCD 3A74A 1MGSA 1TWGB 3CD6A 3M9BA 2F0PA 3C2PA 3M85A 3SEBA 4ZUJA 4PMCA 4B3SL 5FOBB 5ELEA 1LM0A 1X3FA 4XT1B 1TQOA 4N8FA 5C6AA 4CJ1B 1PH4A 1QVFA 2WAQE 4C2MB 5EPJA 1BBWA 2BA1A 1HXYD 5IODA 1IYUA 3UDIA 4A3LG 5IP7G 2E8GA 1NUCA 2HQLA 3RMHA 4B3TL 1JWMD 1DOKA 1PRTF 4Y52H 4LF7Q 5CV8A 4ZUIA 5FLXE 4A76A 3TREA 3R8BA 5T1IA 3GTPH 2KVMA 1LUZA 1XNQQ 3PO3G 2H4OA 3FKIG 2C9OA 4JVZA 5KIXA 4LFBQ 4X3TA 1TKWB 1Q3LA 4A3EB 1YI2A 2CCZA 2L11A 2F03A 3TP5A 4OWXB 3N52A 1JR0D 4ODGA 1VF7A 3D4WA 1BR9A 1NBWA 5GROA 1D7QA 1VQ7A 2Q2TA 3GP7A 2ZJQA 2JYOA 5C4JB 2H5XA 2ID0A 3DM3A 1HA6A 5AFWA 1LTGD 4Y7NB 3S14B 2MHVA 2E5LQ 1WOCA 2NBFA 3MXPA 4A93B 1STEA 3GO5A 4CDDC 4JI4Q 1VQIA 1EY7A 1CHQD 2MO0A 2K04A 2OXPA 4C1NK 1JE5A 1JJ2A 1HTPA 4R4OA 3I4MH 1ZXTA 3FPUB 1DJRD 4HJ8A 2KCMA 5JEAJ 2R7DA 1WVLA 1PH1A 5J39A 4X66Q 1AZQA 2HIVA 1AW7A 4J15A 1Q7YC 2IT1A 1EFID 3AQQA 4GS3A 1LLRD 1QE6A 2MUYA 1GUSA 1O7ZA 5CBEE 1B70B 3K5OA 1BKBA 2ZTDA 5T1GA 3CCEA 2NVQH 1X3EA 2R7ZH 3KYHC 4LF6L 2CFMA 2K5QA 2F1MA 3S1MH 4UHVA 1FJGQ 3H0GG 2ZTCA 2J0TD 4QMGA 1DXMA 3PUZA 2LXKA 3C1EA 3GV6A 2EYMA 5IGBA 1F9PA 4G7HC 3PIOA 2JN4A 4LUZA 5IP9H 4BY1H 2R93B 2E75C 2BOSA 3HOWG 4ULLA 2O4XA 1VQFA 2PI2E 1O7LA 2A68C 5BR8L 4IFDG 1HNWL 4U68A 5E1FA 1EU4A 4KN4C 2K5WA 1L2FA 4A3LH 3S1NH 1HNXL 3NQTA 1DOMA 1X65A 5IWAL 5BN5A 2X69A 1I50B 4R4IA 4BY1G 3NQIA 2FMMA 2F3VA 1M1KC 3CRLC 1FNWA 5KNDA 4A3JH 3BDOA 4A3GG 4GNXA 2EYOA 3D6CA 1SYGA 3AFQA 2NVTH 4LF5L 1Q1EA 3NTKA 3DLLA 4DR7Q 4CGYB 1JC7A 1SNCA 1K3BC 1MBYA 1D5ZC 2OQKA 3OOCA 4JI2L 4X65Q 1M8AA 3CCMA 3I91A 1C7YA 1ML0D 3WOFA 4EQ5A 2EYLA 1V1OA 1E3PA 1IBLQ 1IW7D 3UI2A 2A6HD 2DUDA 1IBML 3S9WA 4K5XA 1Y14B 5FLXL 2M2LA 2UU9L 4BXXG 3BDLA 4A3GH 2EVBA 3NXWA 1W2BA 5LMUL 5C4XB 3GTQB 4A93H 1Q86C 5ELFA 5I2YA 1D1KA 3V2TA 2IPKD 3A54A 1PRTB 4LFAQ 1B3QA 1NCVA 5IE8A 4ZYSA 3VA5A 2A73B 4OX9L 2EE1A 3WWVA 2BDNA 2F4IA 4DA2A 4JI7Q 2NN6G 2L15A 4CJ0B 4B3TQ 2OTLA 4F7XA 1LYLA 1TWHH 3ER0A 4XDXA 1S5ED 1PHJA 1IZ6A 2SNSA 1QNUA 2K14A 1F9SA 4DV3Q 4LJZC 3VDYA 2O5JC 4NXNQ 4I7ZC 1IL8A 3STBD 4BY1B 2R93H 2XRQD 2F0IA 4DXGA 2UUCL 1Z7TA 1VQAA 1CZWA 4H13C 4YY3Q 3RZDB 1PH9A 4G7OC 1EOVA 4IPHA 3OMGA 2OTJA 4IALA 2RHSB 4IFDI 1ESRA 2YU9B 5BR8Q 1OO9B 4LF9L 1ILPA 2CH4A 2NB0A 2E2JH 5EPLA 1B8AA 1O7IA 2O5IC 3DWAA 4BWGB 1B53A 2KHJA 4KTAA 1SNPA 2A74C 1I50H 2BE5D 4E6IA 2R93G 1EZ6A 1B7YB 2VQEL 5ELCA 1EIGA 2V4DA 1PTOB 1T5XD 1PFSA 1V8QA 1ESFA 3HOVB 4HJ7A 1TWAB 3ERQA 2WB1E 1J6QA 5M3FB 1EY4A 2DGYA 1PV4A 2EIFA 2J4XA 4K8JA 1F2LA 1F9QA 3MXGA 3KK7A 4A3JG 3DXJC 2K7VA 4WFN3 3Q8DA 4GLAC 1JOOA 1YVCA 1EUJA 3T56B 5DM73 3BVMA 3VR4A 4QGUA 4NDXA 4BBSG 4O2DA 3FP9A 1N34L 3OIQA 1EL0A 3H6MA 4A3IG 2B2YC 3QJYA 2WV6D 4FDBA 3PO2H 2DNCA 4P71A 4GKJL 1PYWD 2EDGA 3U4VA 2I5HA 3Q23A 3HGBA 1JMCA 1EIFA 2EYJA 3M4QA 2JA9A 1EIHA 4K5WA 5EPKA 1SYCA 4KHVA 1TWFB 2RKSA 2JQOA 1ICFB 2HDLA 5LMNW 4LUOA 3TRZA 3IFTA 4JI3Q 5D14A 4EGVA 5IYDG 1L0YB 4GOPA 1XMQL 4NP5A 1NR2A 3E0JA 3HS0C 3FKIB 3ONAB 3UDGA 3A8KE 2EXZA 4G7ZC 1GHJA 1F77A 2XSCA 4RCOA 3KLWA 5I4DA 4P73A 3RZDH 1S5DD 1J5EL 1WCMB 2B63G 3RNUA 1UE7A 3BVGA 4OO1H 2BE5C 1D5XC 2KOLA 4BA1I 2WINB 2JK8A 2JP1A 4KY5A 2YU9H 2B2WA 1TVXA 1SJHD 1JWUD 1PH3A 3GTMH 2EYHA 1MI2A 2KQ3A 1BCPD 5BN3A 2E2JB 4XQNA 5COYA 3I4LA 3S15H 4EQNA 2WACA 3N6RA 4PNYA 4K5VA 2K5HA 3RN5A 1DOLA 5IOCA 2K01A 4HSPA 3NSWA 2IJ0A 1H9SB 4L6TB 4OO1G 2ZXOA 3KF6A 1KD1C 2B3GA 5IYBG 1M90C 2PNHA 1TWAH 3S2HB 1ET6A 3HG9A 1Y1VG 1ENAA 2JA8G 3MWYW 2RQXA 4AQYQ 2F3IA 3K81C 4IPGA 1GUOA 1HZBA 3G6EA 3SK4A 1Y1WG 2H1EA 1HR0L 1BUVT 2LS01 3U4ZA 1HNZL 1ENFA 3EROA 3K0YA 5IYBH 1SYFA 4WJWA 1QCBD 3HKZB 2ZM6Q 4C3IG 3TN2A 5C3EG 1HR0Q 3EQLC 2NZHA 3PIP3 3PO2B 3PCOB 4C3HG 1O7YA 3NEMA 2JA6H 2ZXPA 2KENA 2F52A 1HQMC 2UXCQ 3R3OA 2NVXB 1KQSA 1KLGD 2UXDL 4RGTA 2CH4W 4A3DB 1PFNA 1EY5A 1SEBD 2F0VA 2F0WA 2UUCQ 1UEBA 3F2UA 1BBXC 4HR7B 3I4MG 4BY7B 3P20A 1HFNA 1U4MA 4NKLA 3NBIA 4QF4A 3ULLA 1LTRD 2XTIA 1I94L 5IGEA 3GV3A 4K0KQ 2HHHL 1PH7A 3TS0A 2EY5A 2RSNA 4LF8L 2LY7A 1V43A 3K6OA 5LMUQ 1GJXA 1EQRA 2DJGC 2B8GA 3KDFB 1SMYD 2F0DA 4JI0Q 3A7AB 4L8JA 3GTLH 1QILA 4IOAA 3ZYYX 1W3SA 1EQVA 3T1YL 1UUPA 1HZ9A 3D6WA 5A35A 2PNRC 1IW7C 4U673 1E1OA 1SNMA 2Q2UA 4MNOA 3VYRA 4HCSA 1YHQA 1LACA 4X65L 2DNEA 2JA7G 3S1QH 1GD7A 4CDCC 1KLUD 4OO1I 5FJ8G 4G4KA 1EYCA 4UDUC 4JI8L 4ME3A 5HURA 4LF4L 2X6GA 4HJ5A 1HHVA 4IJLA 3H91A 4FF4A 5JOBA 1S3OA 5G3LD 1EYDA 1TWCH 4HIOA 1LTID 4IN3A 4C3JH 1G2TA 2NTSA 1A3VA 5CV6A 3P7JA 3RZOH 1VMPA 2EYFA 4RH6A 3CPFA 3VR3A 3GDEA 1TWHB 4JPBW 1STYA 1PLFA 3RR5A 3EJIA 1WTWA 4JV5L 2FINB 1QUQA 4P2CB 3GTPB 3NUCA 1Q8IA 3HOWB 1ZKOA 1YJWA 1BVSA 4A3BH 4OGQC 5HGTA 2B2WC 4LK1C 4TQUS 4P75A 2F0FA 4IQZA 1UWVA 2KEEA 5J22A 4A3EH 1JT8A 3KLSX 3QB3A 4OWWB 2R7ZG 3X3MA 1KDAA 4WRDA 4FXDA 4RGNA 4FF3A 3SK5A 1X32A 2K5VA 3EVQA 1E24A 3H15A 1K0RA 2XNAC 5IP9G 3JAMc 1GVPA 4TSSA 1K8AC 1LT5D 2F0GA 4XIGS 5FKAC 1WYDA 3GTGB 4DUYQ 4OONA 3K7AH 3RLNA 3R2TA 3OWEB 3MFYA 5CR3A 4AYBG 2ZJRA 4DR6Q 1KXLA 1A62A 5M3FH 2AQ2B 1AH9A 4ZCKA 5IT9c 1JOKA 5JEAH 5JVG3 3JC66 4M8AA 1JORA 1ET9A 1V1QA 3QOJA 3CC4A 1ZEQX 1B2TA 1DCZA 1RF2D 3PIO3 5AJ3L 1GXDC 3SE0A 3L2PA 4EVOA 4ZKCB 2M00A 3L0OA 3TQYA 4LFAL 4A3KB 5M3FG 2R7ZB 3IFDA 4GN5A 1K83B 1NJIC 1KNAA 5C0XG 2R6GA 4JI7L 4L5SA 1H9JA 2F0HA 2D5DA 1HNXQ 2GVAA 2UXCL 2JA7H 1MJEA 2N78A 2SOBA 1QG7A 1MHWC 4CJ2C 1TWCB 3QOLA 2MFIA 3J7A5 1SNOA 3RZOB 4OXPA 1MIUA 3BU2A 4TVAB 3TSSA 5GAEC 3HOUG 4X3UA 4JOIC 3CCVA 1IXRA 4IUTA 1HPCA 3CHBD 2N88A 2QCPX 5ELBA 3FKIH 3HFZB 2SDFA 3J81E 1EY9A 1SAPA 2A6EC 3IL8A 1XYIA 1KNEA 2EJGC 2Z4HA 2KJXA 5G3LF 2B8FA 4DR6L 1JICA 2VL6A 1WCMH 5E4WC 5C0XI 4A3BB 4ZRZA 1ONLA 3DWPA 4QUFA 1SE2A 4K14A 1S5BD 4RMFA 4DV0Q 1IKLA 2N8NA 3GTMB 2KHIA 1ZYRD 4DFAA 4JBKA 4DAMA 1A8VA 5EKIA 4JOIA 3W1GA 3I2ZA 5DEHA 2OQ0A 3K8AA 4QL5A 3CMAA 4NXMQ 1VMCA 1N36Q 2L0CA 3K7AB 2PQAA 3J7YW 3DUZA 1TS5A 2QDLA 2UUBQ 2F0TA 3SVMA 4JYAL 2K52A 2I0QA 2VB2X 1BXTA 2CWAA 2VUMG 2KHSA 1YNNC 4R1JA 4DN4M 1D2BA 1VQCA 4UP9A 4XT3B 4PG3A 3FHWA 4A3FH 2RHQB 4YY3L 2N3SA 1H9RA 5M9OA 2QDBA 4IZ8A 4YWKA 3J80i 2VUMH 3J80L 3TP8A 4YIJA 2JA6B 3NWSA 1AP0A 1GOZA 4IUQA 2NZOA 5AJ3Q 1PH6A 2EQSA 2NN6I 2AHOB 3S24A 3KF8A 2JA7B 3EIVA 4IFDH 4LF8Q 1CM9A 3OIPA 2X6LA 1NY4A 4O1NA 5IY0A 2A6ED 3MZ5A 2RDGA 5FO9B 3W1BA 3G4SA 5H1SE 3T16A 1M4VA 2V1CC 2Q8TA 1KDBA 3G71A 2HQEA 5EAYA 1XMOL 3PO2G 2K32A 4LMQD 4UPAA 2VQFQ 3P75A 1VQHA 3GQBA 1G91A 1OTCA 3HEJA 2IL8A 2CQOA 2B2YA 1QB5D 4JK1C 2XVSA 3OTOL 4FP5D 1LO5D 1GO3E 1V1PA 2L1BA 2RBMA 4X64Q 4YHHL 2F0KA 3OPOA 3HRZC 3KBGA 2EOTA 2EJMA 1TU2B 2Q8RE 4MZ9A 2Z6BA 3VR2A 3BS1A 5K5PA 3I4NH 2R92H 3HKSA 4DKAC 2QEJC 4XYQA 3S14H 1YHAA 5CV4A 2HD3A 4K6LA 3E5SA 4DR2L 2B2UC 1X3PA 3I4MB 1HNZQ 1PZJD 2YYZA 3PUWA 1C8CA 3STBC 5J1ZA 4DUZL 3BDCA 4V190 2R61A 1VCIA 3W3AA 2XIWA 3K5NA 2NVQB 1KAAA 3A5ZB 3C1FA 1PXUA 3R93A 2ES2A 1W6JA 3NWTA 1EWHA 3K5MA 3T53B 2JJQA 3F2DA 3UDFA 3U58A 1TIID 2QA4A 1TS4A 1K0SA 2KECA 2R7FA 2WFWA 4YCWA 1R4QB 2PMZB 3F2CA 1EQQA 4X3KA 1X3QA 2B29A 1A3TA 2E2HH 2RA4A 4RA8A 1EY8A 3M4OB 5E7NA 3ITPA 1Y69U 1Y1WH 5DAUA 1XTDA 1PH8A 4DK1A 3DWQA 2NYZD 2OF1A 1RDPD 2A19A 5DM63 2AMCB 1XPUA 3J7AF 4A3CH 2ZJPA 4LW1A 3ICEA 1PRTD 1K8GA 2WIIB 4TKOB 1ILQA 1XWEA 2Q8IB 1LTBD 1SFOB 4R9WA 2NVTB 2CWPA 1SDFA 1KAWA 1FR3A 4RKLA 2BH2A 1R9TH 2JA6G 2QGQA 1SMXA 3HOYG 2F0MA 2XWBB 1YNND 1FL0A 1TT2A 3T1YQ 3VYSA 3PV0A 4BA2I 3H94A 2YV5A 1CSPA 2LSSA 3V05A 3I3CA 2YTXA 3GTGH 3F2BA 2R3ZA 4F88A 4NPSA 1RODA 3I4NB 4JW0A 3S2HH 3CC7A 1QZGA 3U9SA 3GTQH 3AU7A 4LF6Q 1YNJD 4KJNA 4DK0A 4DUYL 1IYVA 1EYGA 4ALPA 1FGBD 5C3EB 5I6YA 2F0NA 4XTCS 1KIXA 2R92G 4HIDA 1EWCA 2I5MX 4RFBA 4CKCA 4EQPA 1AEXA 3TP6A 3PSIA 1GHKA 1E7ZA 3NTHA 5KRUA 1LT4D 3CMEA 1RIPA 5EBDA 1I4XA 1PH5A 5FK9C 1YNXA 3MEHA 4DR3Q 1CI3M 1QOHA 2NVXH 3QWNA 2Y0SG 2AKWB 3SGIA 4DV3L 4R4QA 3OW7A 4PV1C 1RCVD 2XGTA 3KLSA 4MTNA 3OWFA 5KEEA 4IUUA 5HY6A 2FJ2A 1BCPB 2PQAB 1F2ZA 5EBCA 1E22A 1SE8A 4AYBB 1Y1WB 1EIYB 4IUVA 2FHTA 2JA8B 4R4TA 4DR4L 4S3SA 3TZDA 3AEVA 4HIMA 2OEOA 1SE4A 2E2IB 1PTOH 1TS3A 2EYPA 2AWOA 4ID6A 1BCPC 1HH2P 3PIPA 1VQ9A 1X6OA 4K8IA 1VQNA 5JPMC 4DK3C 4DR1Q 4GKJQ 4QB4A 1MJCA 2E5LL 4A3KG 3FMCA 1CZGA 5JJZA 5A2QE 1C0AA 4HTHA 2GN5A 3KLRA 5KGUA 1P8LA 1PMRA 3ZJYC 2K75A 1YZ6A 1JJGA 3P1HA 3D4RA 1OXUA 1B4OA 4JYAQ 1WCMG 1OXTA 1STNA 1CUKA 2VB3X 4CDEC 4DV7Q 1PVOA 4C3IH 5C3EH 5IGFA 5NUCA 4HJAA 3OMCA 3CAMA 3PUXA 2EZVA 2G5DA 3GTOB 2BA0A 3BZDB 2F3WA 5K36G 2D62A 1B3AA 5I6WA 2J7ZA 3PF5A 1A2UA 2ENBA 3CCJA 1BF4A 3D4DA 1I4PA 2ZT9C 4C3HB 1BO0A 4H44C 3J81L
chains in the Genus database with same CATH topology
1TWCH 4HIOA 3HOZH 4X62Q 4C3JH 3M85A 5ELNA 1X54A 5IWAQ 3HOWH 3CCUA 3RZOH 3CCQA 4P74A 3OW2A 4B3SL 3CPFA 4B3RL 4P72A 1LM0A 1X3FA 3GDEA 1L1OA 2IHEA 3NBHB 2OWOA 2D0PA 3IRBA 5JJIA 5M3MG 4PZ6A 3RR5A 1L1OC 1G291 2RCNA 4DUZQ 1PH4A 1X56A 3J81c 5C44G 4AQYL 2WAQE 1QVFA 1QUQB 2A8VA 4JV5L 3KJPA 1QUQA 1BBWA 1J5EQ 2BA1A 4DV6L 3CCLA 3UDIA 1EFWA 4A3LG 5IP7G 1YJWA 1BVSA 2E8GA 4B3SQ 4A3BH 4KHPQ 4WJ3M 4TQUS 2HQLA 3KF6B 4P75A 4B3TL 4Y52H 1UWVA 2I5LX 4LF7Q 4X66L 4A76A 1KL9A 4A3EH 4AH6A 1DGSA 4KI0A 1N36L 1XNRL 1JT8A 1YJNA 2E2IH 3TREA 4OWWB 2R7ZG 1MKHA 4C2MH 4GNXB 3GTPH 1LUZA 4JI8Q 1XNQQ 3PO3G 2K5VA 4LFCQ 2N49A 4PMWA 1E24A 3H15A 1K0RA 3J81i 1C9OA 2GVBA 1VQGA 1X3GA 1GVPA 1U0LA 3FKIG 4PZ7A 5DLQE 5GQOA 5IP9G 1YJ9A 1K8AC 4LFBQ 2MQHA 4XIGS 1VQJA 1WYDA 4DUYQ 1IBKQ 1YI2A 1Z9FA 4OONA 2CCZA 3K7AH 3RLNA 4AYBG 2ZJRA 1Q81C 4OWXB 1YEZA 4JI1Q 3RLOA 3TEHB 4OX9Q 4DR6Q 1KXLA 1A62A 4NB3A 1AE2A 5M3FH 1NBWA 1NMGA 5GROA 4DR5Q 1LTLA 1VQ7A 5IT9c 2F4VQ 2UXBL 4AYBE 1AH9A 4A3KH 1VQ5A 2Q2TA 1G6PA 1EWIA 3S17H 5IYCH 3JC66 4JI1L 2K4KA 1V1QA 2ZJQA 3CC4A 4GOPB 2H5XA 2ID0A 3BZCA 2K50A 3DM3A 4DR3L 4YWLA 1VQOA 4JI0L 1QVGA 5AJ3L 3L2PA 3KOJA 1GM5A 2E5LQ 5HGQA 1WOCA 3L0OA 4JC0A 3TQYA 3GO5A 4LFAL 1CKNB 3HKZE 1HZCA 3L7ZC 4JI4Q 4PZ8A 1VQIA 3AFPA 2JE6I 5M3FG 2MO0A 1JJ2A 4GN5A 1JE5A 4LF7L 4R4OA 1A0IA 1NJIC 3I4MH 3HOVG 4HJ8A 4A4IA 2R6GA 5C0XG 4JI7L 2KCMA 5JEAJ 2R7DA 1PH1A 3M3YH 4HJ9A 4BBRG 4X66Q 1U5KA 4L5SA 2HIVA 1HNXQ 2GVAA 1V9PA 2UXCL 4J15A 1Q7YC 2IT1A 3AQQA 4Y7NH 2N78A 4GS3A 4DV6Q 1MJEA 4LF5Q 3M4OH 3J7ZC 1B70B 2MFIA 1VQKA 1BKBA 2PMZE 2ZTDA 3CCEA 4GLXA 1Q46A 2NVQH 3E9HA 3J7A5 3JAMc 1X3EA 4NXML 4OXPA 1MIUA 3GTJH 2R7ZH 4BXXH 3KYHC 2UUAL 1SN8A 2CFMA 2WAQG 4LF6L 3S1MH 1FJGQ 3BU2A 4TVAB 5GAEC 3H0GG 4IO9A 3HOUG 3PO3H 2ZTCA 4JOIC 4JI6L 1VQPA 3CCVA 1IXRA 3PUZA 2LXKA 3HOZG 4QIWE 3PIOA 2C35B 4LUZA 3FKIH 5IP9H 1G51A 3OTOQ 4BY1H 3HFZB 3HOWG 1GKHA 1SR3A 1VQFA 4DV5Q 4DR6L 3KDFA 2PI2E 3NELA 2VL6A 1T9HA 1WCMH 5C0XI 1XPRA 1FJGL 4A3DG 5BR8L 4IFDG 1HNWL 4GKKQ 4RMFA 4DV0Q 5GAHC 1YITA 3HKZG 2IX0A 4DV4Q 2N8NA 3I55A 4B3ML 3H0GH 2KHIA 3JAMi 2Y0SE 4JBKA 3KF8B 1L2FA 4APVA 4DAMA 4A3LH 1A8VA 3I7FA 5IP7H 1HNXL 4IJHA 4JOIA 1N33Q 3S1NH 3W1GA 3I2ZA 1X65A 5IWAL 2JEAI 4GN4B 4GKKL 3D0FA 3EN2A 2OQ0A 4R4IA 4BY1G 3HOXH 3A5UA 3K8AA 4JBJA 4JI3L 1OXXK 4QL5A 3CMAA 2KBNA 1M1KC 4DV7L 4OWTB 1S40A 4NXMQ 4A3JH 1N36Q 2BH8A 4A3GG 3CPWA 4GNXA 4LF4Q 3AFQA 1IL2A 2NVTH 2PQAA 4LF5L 1Q1EA 2IHFA 4JG2A 3DLLA 4DR7Q 3UDXA 3B6YA 4DPGA 1CSQA 5LMNL 2ALYB 1KC8C 2UUBQ 4JYAL 2OQKA 2K52A 2I0QA 4BBSH 2VQFL 2VUMG 2CWAA 4JI2L 4LWCA 4X65Q 3K0XA 3CCMA 2FXQA 1C7YA 4A3IH 4EQ5A 1D8LA 1QVCA 4R1JA 1E3PA 1K73C 1IBLQ 1VQCA 4UP9A 4PG3A 2DUDA 1CKNA 1IBML 2UXBQ 1Y14B 1PH2A 2UU9L 3FHWA 4BXXG 4A3FH 4A3GH 2KCTA 3J81j 2RHQB 4YY3L 2VNUD 2N3SA 1W2BA 3HOUH 5LMUL 4A93H 4X62L 1Q86C 1OXVA 1L0WA 3E0EA 4YWKA 3J80i 1NTGA 1VQEA 1NE3A 3BZKA 1I94Q 2VUMH 4IPCA 2LXJA 4LFAQ 5JJLA 4X6AH 3CW2C 4O0AA 5IE8A 2NZOA 5AJ3Q 1PH6A 4OX9L 2EQSA 1TWGH 2NN6I 2AHOB 3S24A 3WWVA 4L5RC 4HIKA 3EIVA 3F8TA 4JI7Q 1VQ8A 2NN6G 4LF8Q 4QY7A 1K9MC 2L15A 1NY4A 1AE3A 4R4CA 5LMNQ 5IY0A 3CC2A 4UY8C 1YHBA 4B3TQ 3W1BA 3G4SA 5H1SE 4A93G 2OTLA 2B63H 1LYLA 3ER0A 1TWHH 2OCEA 4BBRH 4DV2L 2V1CC 3G71A 4DV4L 1PHJA 4UP7A 1IZ6A 1H95A 1IBLL 2PI2A 2K14A 3PGZA 1YIJA 5EAYA 1XMOL 4DV3Q 3VDYA 3PO2G 1UE5A 4NXNQ 4UPAA 2RF4A 3E9IA 2IX1A 3STBD 2VQFQ 2R93H 1VQHA 1OTCA 2UUCL 1OXSC 1VQAA 2CQOA 4YY3Q 1PH9A 1EOVA 4IPHA 4YHHQ 2UU9Q 2UXDQ 4IOCA 2OTJA 3OTOL 1GO3E 1HR0W 4YHHL 4X64Q 4GOPC 2RHSB 1IBMQ 3NENA 4IFDI 1N34Q 3CP0A 3I56A 5BR8Q 4LF9L 3A0JA 4MZ9A 2YTVA 4YWMA 2E2JH 5C0XJ 1B8AA 2ASBA 1O7IA 3I4NH 2R92H 3HKSA 5IYDH 4DKAC 4DV5L 2KHJA 3S14H 4A3DH 1YHAA 4A75A 1ASYA 1WI5A 1I50H 1P16A 1Y1VH 4GNXC 2R93G 4GLVB 4DK6C 4DR2L 4A3FG 1FVIA 1B7YB 3RLFA 2VQEL 2YYZA 1HNZQ 3PUWA 1HNWQ 2AWNA 1PFSA 3PUYA 3STBC 4HJ7A 2JA5G 4DUZL 1VQBA 2WB1E 1I6HH 1J6QA 1VCIA 2DGYA 1PV4A 3GTOH 3S2DH 2EIFA 3ULJA 3I4NG 4A3JG 1A63A 4GN3B 3ULPA 1XPOA 4KHPL 3A5ZB 4KHZA 3Q8DA 4GLAC 2ES2A 5J3BA 1XJVA 1N32L 1YVCA 1EUJA 1I5FA 2Z6KC 4NXNL 4C3HH 3UE1A 1NMFA 2JJQA 2VY3A 3F2DA 4QGUA 2K5NA 4BBSG 3UDFA 4O2DA 3U58A 2D0OA 3FP9A 2QA4A 1N34L 1KRSA 2MO1A 3M7NA 4JBWA 4A3IG 1RL2A 4QQBX 1TXYA 2R7FA 2WFWA 4FDBA 4YCWA 3PO2H 3KJOA 3F2CA 4YCVA 1EQQA 4P71A 4JI6Q 4GKJL 2B29A 3U4VA 2E2HH 2Z0SA 2I5HA 3S1RH 1JMCA 1EIFA 1WFQA 3M4QA 4WJ4A 4RG1A 2JA9A 1I3QH 1SFOH 5E7NA 1CKOA 1KRTA 1Y1WH 1XTDA 4DR5L 4DAYB 4QJFA 2JQOA 1PH8A 5M5XH 2EXDA 5LMNW 2A19A 5FLXc 4LUOA 2AMCB 3HOXG 2HT1A 1UE6A 1XPUA 4A3CH 3TRZA 1S72A 4JI3Q 2ZJPA 4DR1L 1N8RC 4LW1A 1K3RA 5IYDG 3ICEA 4GOPA 4YCUA 1XMQL 3TS2A 2A1AA 1K8GA 3H3VH 2VZAA 2QEXA 1VQ6A 3KFUA 3UDGA 1TWFH 2CWPA 4IFDJ 4B3MQ 1KAWA 2BH2A 1FGUA 2F4VL 1R9TH 2JEBI 3KLWA 3UE0A 2JA6G 2QGQA 1SMXA 3HOYG 2WP8J 4P73A 3RZDH 1BBUA 1J5EL 2B63G 3RNUA 1FL0A 1UE7A 3T1YQ 2JA5H 3PV0A 4BA2I 1CKMA 1SRUA 2YV5A 4BA1I 1QZHA 1CSPA 2LSSA 1SLJA 2JK8A 3GD7A 2YTXA 2YU9H 2ZM6L 3GTGH 3F2BA 3GTMH 1PH3A 4NPSA 5C44H 4H02A 3S15H 4LFCL 1Q82C 5JJKA 3S2HH 3CC7A 1QZGA 2K5HA 5FLMG 3GTQH 2UUAQ 4LF6Q 2HIXA 2WB1G 3RN5A 4DUYL 1IBKL 1EYGA 4ALPA 4K0KL 4L5QA 2VW9A 4OO1G 5FJ8H 3KF6A 4XTCS 2B3GA 1XMQQ 4HIDA 1KD1C 5IYBG 1KIXA 3CCSA 2CKZB 1M90C 2R92G 2I5MX 3J80c 5GAGC 5GADC 3CF5A 3T1HQ 2PNHA 3PSIA 1TWAH 1VQDA 4BY7G 1VQMA 3I4OA 1Y1VG 1E7ZA 1X55A 3CMEA 2JA8G 3CQZH 1RIPA 1PYSB 4DR4Q 1Q1BA 4AQYQ 1PH5A 2F3IA 3K81C 4IPGA 1KHIA 4A3MG 1HZBA 4JBMA 3LGJA 5FLMH 3G6EA 1Y1WG 1HR0L 3K80C 3U4ZA 2VQEQ 1HNZL 3S16H 1X9NA 4DV1Q 3RN2A 5M3MH 1YNXA 4DR3Q 1N33L 4DV1L 1HJPA 2NVXH 2Y0SG 1Z47A 4L5TA 4JI5L 5C4XH 5IYBH 2AKWB 1PA6A 3SGIA 2ZM6Q 3U50C 5C3EG 3W5OA 3BJUA 1HR0Q 4DV3L 2ATWA 2NZHA 4R4QA 5JEAG 2XGTA 2YTYA 4MTNA 2JA8H 3PCOB 4POGA 4A3BG 5C4JH 3NEMA 2JA6H 1XMOQ 3HOYH 2KENA 2Q2IA 4A3MH 1VS0A 1JB7A 2F52A 5HY6A 2UXCQ 3MXNB 2MNAA 4X64L 2PQAB 4KLKA 1E22A 1PYBA 1HZAA 3ERSX 1SE8A 4IPDA 4DNIA 3MEFA 1KQSA 2UXDL 4AIMA 1EIYB 3K7UC 2UUCQ 1UEBA 1N9WA 5C4XG 3PF4A 4R4TA 4DR4L 1K83H 4LUVA 3PUVA 3I4MG 5M5YH 3AEVA 3OYYA 4HIMA 3G48A 3M4PA 5M5WH 3T1HL 4EX5A 4DR2Q 3ULLA 2XTIA 3AYHB 1I94L 2AWOA 1ASZA 2JA7H 1HH2P 3EBEA 3PIPA 1X6OA 1VQ9A 1VQNA 4K0KQ 2HHHL 1PH7A 3TS0A 4LF8L 3D31A 4DK3C 1V43A 5LMUQ 4DR1Q 4GKJQ 4JI4L 1EQRA 1SROA 4JCVE 3GTKH 1MJCA 1VQ4A 3KDFB 2E5LL 4BY7H 4A3KG 4LF9Q 2VS1A 2IY5B 5IYCG 4JI0Q 1L1OB 1C0AA 4JV5Q 2GN5A 1P8LA 3ZJYC 3GTLH 1IYJB 1UE1A 2HHHQ 2K75A 3CD6A 4IOAA 1YZ6A 3CXCA 1W3SA 1JJGA 1JJCB 4A3EG 1OXUA 4JI5Q 4UP8A 2Z6KA 4JYAQ 1WCMG 3T1YL 4B3RQ 1HZ9A 4LNQA 4POFA 3F1ZA 1YBYA 3H3VI 1OXTA 1XNQL 1CUKA 4DV7Q 1PVOA 1E1TA 4C3IH 5C3EH 1E1OA 4DV2Q 3HOVH 4HJAA 2Q2UA 4MNOA 1XNRQ 1Q12A 1Q8KA 3CAMA 3PUXA 1YHQA 2Q2HA 2NVYH 2BA0A 4X65L 4JI2Q 2JA7G 3S1QH 5K36G 1N32Q 1GD7A 2D62A 2UUBL 2ZTEA 3PF5A 4OO1I 4A3CG 3CCJA 4LFBL 3CCRA 1WJJA 5FJ8G 4DR7L 4JI8L 4ME3A 4LF4L 1D7QA 5ELOA 4HJ5A 4DV0L 1VQLA 4IJLA 3A74A 1S3OA 3M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC H;  4HIO A;  3HOZ H;  4X62 Q;  4C3J H;  3M85 A;  5ELN A;  1X54 A;  5IWA Q;  3HOW H;  3CCU A;  3RZO H;  3CCQ A;  4P74 A;  3OW2 A;  4B3S L;  3CPF A;  4B3R L;  4P72 A;  1LM0 A;  1X3F A;  3GDE A;  1L1O A;  2IHE A;  3NBH B;  2OWO A;  2D0P A;  3IRB A;  5JJI A;  5M3M G;  4PZ6 A;  3RR5 A;  1L1O C;  1G29 1;  2RCN A;  4DUZ Q;  1PH4 A;  1X56 A;  3J81 c;  5C44 G;  4AQY L;  2WAQ E;  1QVF A;  1QUQ B;  2A8V A;  4JV5 L;  3KJP A;  1QUQ A;  1BBW A;  1J5E Q;  2BA1 A;  4DV6 L;  3CCL A;  3UDI A;  1EFW A;  4A3L G;  5IP7 G;  1YJW A;  1BVS A;  2E8G A;  4B3S Q;  4A3B H;  4KHP Q;  4WJ3 M;  4TQU S;  2HQL A;  3KF6 B;  4P75 A;  4B3T L;  4Y52 H;  1UWV A;  2I5L X;  4LF7 Q;  4X66 L;  4A76 A;  1KL9 A;  4A3E H;  4AH6 A;  1DGS A;  4KI0 A;  1N36 L;  1XNR L;  1JT8 A;  1YJN A;  2E2I H;  3TRE A;  4OWW B;  2R7Z G;  1MKH A;  4C2M H;  4GNX B;  3GTP H;  1LUZ A;  4JI8 Q;  1XNQ Q;  3PO3 G;  2K5V A;  4LFC Q;  2N49 A;  4PMW A;  1E24 A;  3H15 A;  1K0R A;  3J81 i;  1C9O A;  2GVB A;  1VQG A;  1X3G A;  1GVP A;  1U0L A;  3FKI G;  4PZ7 A;  5DLQ E;  5GQO A;  5IP9 G;  1YJ9 A;  1K8A C;  4LFB Q;  2MQH A;  4XIG S;  1VQJ A;  1WYD A;  4DUY Q;  1IBK Q;  1YI2 A;  1Z9F A;  4OON A;  2CCZ A;  3K7A H;  3RLN A;  4AYB G;  2ZJR A;  1Q81 C;  4OWX B;  1YEZ A;  4JI1 Q;  3RLO A;  3TEH B;  4OX9 Q;  4DR6 Q;  1KXL A;  1A62 A;  4NB3 A;  1AE2 A;  5M3F H;  1NBW A;  1NMG A;  5GRO A;  4DR5 Q;  1LTL A;  1VQ7 A;  5IT9 c;  2F4V Q;  2UXB L;  4AYB E;  1AH9 A;  4A3K H;  1VQ5 A;  2Q2T A;  1G6P A;  1EWI A;  3S17 H;  5IYC H;  3JC6 6;  4JI1 L;  2K4K A;  1V1Q A;  2ZJQ A;  3CC4 A;  4GOP B;  2H5X A;  2ID0 A;  3BZC A;  2K50 A;  3DM3 A;  4DR3 L;  4YWL A;  1VQO A;  4JI0 L;  1QVG A;  5AJ3 L;  3L2P A;  3KOJ A;  1GM5 A;  2E5L Q;  5HGQ A;  1WOC A;  3L0O A;  4JC0 A;  3TQY A;  3GO5 A;  4LFA L;  1CKN B;  3HKZ E;  1HZC A;  3L7Z C;  4JI4 Q;  4PZ8 A;  1VQI A;  3AFP A;  2JE6 I;  5M3F G;  2MO0 A;  1JJ2 A;  4GN5 A;  1JE5 A;  4LF7 L;  4R4O A;  1A0I A;  1NJI C;  3I4M H;  3HOV G;  4HJ8 A;  4A4I A;  2R6G A;  5C0X G;  4JI7 L;  2KCM A;  5JEA J;  2R7D A;  1PH1 A;  3M3Y H;  4HJ9 A;  4BBR G;  4X66 Q;  1U5K A;  4L5S A;  2HIV A;  1HNX Q;  2GVA A;  1V9P A;  2UXC L;  4J15 A;  1Q7Y C;  2IT1 A;  3AQQ A;  4Y7N H;  2N78 A;  4GS3 A;  4DV6 Q;  1MJE A;  4LF5 Q;  3M4O H;  3J7Z C;  1B70 B;  2MFI A;  1VQK A;  1BKB A;  2PMZ E;  2ZTD A;  3CCE A;  4GLX A;  1Q46 A;  2NVQ H;  3E9H A;  3J7A 5;  3JAM c;  1X3E A;  4NXM L;  4OXP A;  1MIU A;  3GTJ H;  2R7Z H;  4BXX H;  3KYH C;  2UUA L;  1SN8 A;  2CFM A;  2WAQ G;  4LF6 L;  3S1M H;  1FJG Q;  3BU2 A;  4TVA B;  5GAE C;  3H0G G;  4IO9 A;  3HOU G;  3PO3 H;  2ZTC A;  4JOI C;  4JI6 L;  1VQP A;  3CCV A;  1IXR A;  3PUZ A;  2LXK A;  3HOZ G;  4QIW E;  3PIO A;  2C35 B;  4LUZ A;  3FKI H;  5IP9 H;  1G51 A;  3OTO Q;  4BY1 H;  3HFZ B;  3HOW G;  1GKH A;  1SR3 A;  1VQF A;  4DV5 Q;  4DR6 L;  3KDF A;  2PI2 E;  3NEL A;  2VL6 A;  1T9H A;  1WCM H;  5C0X I;  1XPR A;  1FJG L;  4A3D G;  5BR8 L;  4IFD G;  1HNW L;  4GKK Q;  4RMF A;  4DV0 Q;  5GAH C;  1YIT A;  3HKZ G;  2IX0 A;  4DV4 Q;  2N8N A;  3I55 A;  4B3M L;  3H0G H;  2KHI A;  3JAM i;  2Y0S E;  4JBK A;  3KF8 B;  1L2F A;  4APV A;  4DAM A;  4A3L H;  1A8V A;  3I7F A;  5IP7 H;  1HNX L;  4IJH A;  4JOI A;  1N33 Q;  3S1N H;  3W1G A;  3I2Z A;  1X65 A;  5IWA L;  2JEA I;  4GN4 B;  4GKK L;  3D0F A;  3EN2 A;  2OQ0 A;  4R4I A;  4BY1 G;  3HOX H;  3A5U A;  3K8A A;  4JBJ A;  4JI3 L;  1OXX K;  4QL5 A;  3CMA A;  2KBN A;  1M1K C;  4DV7 L;  4OWT B;  1S40 A;  4NXM Q;  4A3J H;  1N36 Q;  2BH8 A;  4A3G G;  3CPW A;  4GNX A;  4LF4 Q;  3AFQ A;  1IL2 A;  2NVT H;  2PQA A;  4LF5 L;  1Q1E A;  2IHF A;  4JG2 A;  3DLL A;  4DR7 Q;  3UDX A;  3B6Y A;  4DPG A;  1CSQ A;  5LMN L;  2ALY B;  1KC8 C;  2UUB Q;  4JYA L;  2OQK A;  2K52 A;  2I0Q A;  4BBS H;  2VQF L;  2VUM G;  2CWA A;  4JI2 L;  4LWC A;  4X65 Q;  3K0X A;  3CCM A;  2FXQ A;  1C7Y A;  4A3I H;  4EQ5 A;  1D8L A;  1QVC A;  4R1J A;  1E3P A;  1K73 C;  1IBL Q;  1VQC A;  4UP9 A;  4PG3 A;  2DUD A;  1CKN A;  1IBM L;  2UXB Q;  1Y14 B;  1PH2 A;  2UU9 L;  3FHW A;  4BXX G;  4A3F H;  4A3G H;  2KCT A;  3J81 j;  2RHQ B;  4YY3 L;  2VNU D;  2N3S A;  1W2B A;  3HOU H;  5LMU L;  4A93 H;  4X62 L;  1Q86 C;  1OXV A;  1L0W A;  3E0E A;  4YWK A;  3J80 i;  1NTG A;  1VQE A;  1NE3 A;  3BZK A;  1I94 Q;  2VUM H;  4IPC A;  2LXJ A;  4LFA Q;  5JJL A;  4X6A H;  3CW2 C;  4O0A A;  5IE8 A;  2NZO A;  5AJ3 Q;  1PH6 A;  4OX9 L;  2EQS A;  1TWG H;  2NN6 I;  2AHO B;  3S24 A;  3WWV A;  4L5R C;  4HIK A;  3EIV A;  3F8T A;  4JI7 Q;  1VQ8 A;  2NN6 G;  4LF8 Q;  4QY7 A;  1K9M C;  2L15 A;  1NY4 A;  1AE3 A;  4R4C A;  5LMN Q;  5IY0 A;  3CC2 A;  4UY8 C;  1YHB A;  4B3T Q;  3W1B A;  3G4S A;  5H1S E;  4A93 G;  2OTL A;  2B63 H;  1LYL A;  3ER0 A;  1TWH H;  2OCE A;  4BBR H;  4DV2 L;  2V1C C;  3G71 A;  4DV4 L;  1PHJ A;  4UP7 A;  1IZ6 A;  1H95 A;  1IBL L;  2PI2 A;  2K14 A;  3PGZ A;  1YIJ A;  5EAY A;  1XMO L;  4DV3 Q;  3VDY A;  3PO2 G;  1UE5 A;  4NXN Q;  4UPA A;  2RF4 A;  3E9I A;  2IX1 A;  3STB D;  2VQF Q;  2R93 H;  1VQH A;  1OTC A;  2UUC L;  1OXS C;  1VQA A;  2CQO A;  4YY3 Q;  1PH9 A;  1EOV A;  4IPH A;  4YHH Q;  2UU9 Q;  2UXD Q;  4IOC A;  2OTJ A;  3OTO L;  1GO3 E;  1HR0 W;  4YHH L;  4X64 Q;  4GOP C;  2RHS B;  1IBM Q;  3NEN A;  4IFD I;  1N34 Q;  3CP0 A;  3I56 A;  5BR8 Q;  4LF9 L;  3A0J A;  4MZ9 A;  2YTV A;  4YWM A;  2E2J H;  5C0X J;  1B8A A;  2ASB A;  1O7I A;  3I4N H;  2R92 H;  3HKS A;  5IYD H;  4DKA C;  4DV5 L;  2KHJ A;  3S14 H;  4A3D H;  1YHA A;  4A75 A;  1ASY A;  1WI5 A;  1I50 H;  1P16 A;  1Y1V H;  4GNX C;  2R93 G;  4GLV B;  4DK6 C;  4DR2 L;  4A3F G;  1FVI A;  1B7Y B;  3RLF A;  2VQE L;  2YYZ A;  1HNZ Q;  3PUW A;  1HNW Q;  2AWN A;  1PFS A;  3PUY A;  3STB C;  4HJ7 A;  2JA5 G;  4DUZ L;  1VQB A;  2WB1 E;  1I6H H;  1J6Q A;  1VCI A;  2DGY A;  1PV4 A;  3GTO H;  3S2D H;  2EIF A;  3ULJ A;  3I4N G;  4A3J G;  1A63 A;  4GN3 B;  3ULP A;  1XPO A;  4KHP L;  3A5Z B;  4KHZ A;  3Q8D A;  4GLA C;  2ES2 A;  5J3B A;  1XJV A;  1N32 L;  1YVC A;  1EUJ A;  1I5F A;  2Z6K C;  4NXN L;  4C3H H;  3UE1 A;  1NMF A;  2JJQ A;  2VY3 A;  3F2D A;  4QGU A;  2K5N A;  4BBS G;  3UDF A;  4O2D A;  3U58 A;  2D0O A;  3FP9 A;  2QA4 A;  1N34 L;  1KRS A;  2MO1 A;  3M7N A;  4JBW A;  4A3I G;  1RL2 A;  4QQB X;  1TXY A;  2R7F A;  2WFW A;  4FDB A;  4YCW A;  3PO2 H;  3KJO A;  3F2C A;  4YCV A;  1EQQ A;  4P71 A;  4JI6 Q;  4GKJ L;  2B29 A;  3U4V A;  2E2H H;  2Z0S A;  2I5H A;  3S1R H;  1JMC A;  1EIF A;  1WFQ A;  3M4Q A;  4WJ4 A;  4RG1 A;  2JA9 A;  1I3Q H;  1SFO H;  5E7N A;  1CKO A;  1KRT A;  1Y1W H;  1XTD A;  4DR5 L;  4DAY B;  4QJF A;  2JQO A;  1PH8 A;  5M5X H;  2EXD A;  5LMN W;  2A19 A;  5FLX c;  4LUO A;  2AMC B;  3HOX G;  2HT1 A;  1UE6 A;  1XPU A;  4A3C H;  3TRZ A;  1S72 A;  4JI3 Q;  2ZJP A;  4DR1 L;  1N8R C;  4LW1 A;  1K3R A;  5IYD G;  3ICE A;  4GOP A;  4YCU A;  1XMQ L;  3TS2 A;  2A1A A;  1K8G A;  3H3V H;  2VZA A;  2QEX A;  1VQ6 A;  3KFU A;  3UDG A;  1TWF H;  2CWP A;  4IFD J;  4B3M Q;  1KAW A;  2BH2 A;  1FGU A;  2F4V L;  1R9T H;  2JEB I;  3KLW A;  3UE0 A;  2JA6 G;  2QGQ A;  1SMX A;  3HOY G;  2WP8 J;  4P73 A;  3RZD H;  1BBU A;  1J5E L;  2B63 G;  3RNU A;  1FL0 A;  1UE7 A;  3T1Y Q;  2JA5 H;  3PV0 A;  4BA2 I;  1CKM A;  1SRU A;  2YV5 A;  4BA1 I;  1QZH A;  1CSP A;  2LSS A;  1SLJ A;  2JK8 A;  3GD7 A;  2YTX A;  2YU9 H;  2ZM6 L;  3GTG H;  3F2B A;  3GTM H;  1PH3 A;  4NPS A;  5C44 H;  4H02 A;  3S15 H;  4LFC L;  1Q82 C;  5JJK A;  3S2H H;  3CC7 A;  1QZG A;  2K5H A;  5FLM G;  3GTQ H;  2UUA Q;  4LF6 Q;  2HIX A;  2WB1 G;  3RN5 A;  4DUY L;  1IBK L;  1EYG A;  4ALP A;  4K0K L;  4L5Q A;  2VW9 A;  4OO1 G;  5FJ8 H;  3KF6 A;  4XTC S;  2B3G A;  1XMQ Q;  4HID A;  1KD1 C;  5IYB G;  1KIX A;  3CCS A;  2CKZ B;  1M90 C;  2R92 G;  2I5M X;  3J80 c;  5GAG C;  5GAD C;  3CF5 A;  3T1H Q;  2PNH A;  3PSI A;  1TWA H;  1VQD A;  4BY7 G;  1VQM A;  3I4O A;  1Y1V G;  1E7Z A;  1X55 A;  3CME A;  2JA8 G;  3CQZ H;  1RIP A;  1PYS B;  4DR4 Q;  1Q1B A;  4AQY Q;  1PH5 A;  2F3I A;  3K81 C;  4IPG A;  1KHI A;  4A3M G;  1HZB A;  4JBM A;  3LGJ A;  5FLM H;  3G6E A;  1Y1W G;  1HR0 L;  3K80 C;  3U4Z A;  2VQE Q;  1HNZ L;  3S16 H;  1X9N A;  4DV1 Q;  3RN2 A;  5M3M H;  1YNX A;  4DR3 Q;  1N33 L;  4DV1 L;  1HJP A;  2NVX H;  2Y0S G;  1Z47 A;  4L5T A;  4JI5 L;  5C4X H;  5IYB H;  2AKW B;  1PA6 A;  3SGI A;  2ZM6 Q;  3U50 C;  5C3E G;  3W5O A;  3BJU A;  1HR0 Q;  4DV3 L;  2ATW A;  2NZH A;  4R4Q A;  5JEA G;  2XGT A;  2YTY A;  4MTN A;  2JA8 H;  3PCO B;  4POG A;  4A3B G;  5C4J H;  3NEM A;  2JA6 H;  1XMO Q;  3HOY H;  2KEN A;  2Q2I A;  4A3M H;  1VS0 A;  1JB7 A;  2F52 A;  5HY6 A;  2UXC Q;  3MXN B;  2MNA A;  4X64 L;  2PQA B;  4KLK A;  1E22 A;  1PYB A;  1HZA A;  3ERS X;  1SE8 A;  4IPD A;  4DNI A;  3MEF A;  1KQS A;  2UXD L;  4AIM A;  1EIY B;  3K7U C;  2UUC Q;  1UEB A;  1N9W A;  5C4X G;  3PF4 A;  4R4T A;  4DR4 L;  1K83 H;  4LUV A;  3PUV A;  3I4M G;  5M5Y H;  3AEV A;  3OYY A;  4HIM A;  3G48 A;  3M4P A;  5M5W H;  3T1H L;  4EX5 A;  4DR2 Q;  3ULL A;  2XTI A;  3AYH B;  1I94 L;  2AWO A;  1ASZ A;  2JA7 H;  1HH2 P;  3EBE A;  3PIP A;  1X6O A;  1VQ9 A;  1VQN A;  4K0K Q;  2HHH L;  1PH7 A;  3TS0 A;  4LF8 L;  3D31 A;  4DK3 C;  1V43 A;  5LMU Q;  4DR1 Q;  4GKJ Q;  4JI4 L;  1EQR A;  1SRO A;  4JCV E;  3GTK H;  1MJC A;  1VQ4 A;  3KDF B;  2E5L L;  4BY7 H;  4A3K G;  4LF9 Q;  2VS1 A;  2IY5 B;  5IYC G;  4JI0 Q;  1L1O B;  1C0A A;  4JV5 Q;  2GN5 A;  1P8L A;  3ZJY C;  3GTL H;  1IYJ B;  1UE1 A;  2HHH Q;  2K75 A;  3CD6 A;  4IOA A;  1YZ6 A;  3CXC A;  1W3S A;  1JJG A;  1JJC B;  4A3E G;  1OXU A;  4JI5 Q;  4UP8 A;  2Z6K A;  4JYA Q;  1WCM G;  3T1Y L;  4B3R Q;  1HZ9 A;  4LNQ A;  4POF A;  3F1Z A;  1YBY A;  3H3V I;  1OXT A;  1XNQ L;  1CUK A;  4DV7 Q;  1PVO A;  1E1T A;  4C3I H;  5C3E H;  1E1O A;  4DV2 Q;  3HOV H;  4HJA A;  2Q2U A;  4MNO A;  1XNR Q;  1Q12 A;  1Q8K A;  3CAM A;  3PUX A;  1YHQ A;  2Q2H A;  2NVY H;  2BA0 A;  4X65 L;  4JI2 Q;  2JA7 G;  3S1Q H;  5K36 G;  1N32 Q;  1GD7 A;  2D62 A;  2UUB L;  2ZTE A;  3PF5 A;  4OO1 I;  4A3C G;  3CCJ A;  4LFB L;  3CCR A;  1WJJ A;  5FJ8 G;  4DR7 L;  4JI8 L;  4ME3 A;  4LF4 L;  1D7Q A;  5ELO A;  4HJ5 A;  4DV0 L;  1VQL A;  4IJL A;  3A74 A;  1S3O A;  3M9B A; 
#chains in the Genus database with same CATH topology
 3LWU A;  4DNR B;  5ELN A;  3HOW H;  2PZT A;  3OW2 A;  4J6H A;  2IHE A;  3NBH B;  5JJI A;  2D0P A;  3IRB A;  1G29 1;  2RCN A;  1EEF D;  3BYT B;  5I9O A;  5A2Q L;  3J81 c;  2EY6 A;  1WTH A;  1QUQ B;  4RGM A;  1CT1 D;  1J5E Q;  3S15 B;  3VYU A;  1A2T A;  1EFW A;  1PZI D;  4B3S Q;  2PYK A;  4WJ3 M;  3RD4 A;  3X3N A;  1N36 L;  4RKB A;  4AH6 A;  4KI0 A;  1YJN A;  2E2I H;  1KDC A;  1EEI D;  4CHT B;  1E2W A;  3HOX B;  2N49 A;  4PMW A;  1C9O A;  2GVB A;  1VQG A;  1X3G A;  2ICE C;  4PZ7 A;  5GQO A;  3T51 B;  4BBR B;  1YJ9 A;  2WKD A;  1QJO A;  1IBK Q;  1Z9F A;  1Q81 C;  1YEZ A;  3RLO A;  2QW7 A;  3FVQ A;  1RTO A;  4NB3 A;  1RKN A;  2I46 A;  1U4R A;  4MN3 A;  5I9P A;  4A3K H;  4A3I B;  3JAM L;  4DGZ A;  5IYC H;  4K2K A;  1LTT D;  4C3I B;  2K50 A;  4HAE A;  4DR3 L;  3MAQ A;  1SSO A;  1MSH A;  4KKS A;  1QVG A;  4JC0 A;  3HKZ E;  3L7Z C;  2JE6 I;  3S17 B;  2B2V A;  4KD3 A;  3HOV G;  2GA4 B;  3MXN A;  4FXG C;  5M3M B;  1BDO A;  2RSO A;  1V9P A;  3M4O H;  3J7Z C;  3SK6 A;  3E9H A;  2TMP A;  4NXM L;  3URY A;  2UUA L;  1SN8 A;  1EZ8 A;  1SXT A;  4IO9 A;  3TME A;  3M3Y B;  4ABN A;  1STA A;  4JI6 L;  1VQP A;  2C35 B;  1KTK A;  1G51 A;  3OTO Q;  4Z9C B;  1B50 A;  2VXW A;  5JPN C;  1R9T B;  1SR3 A;  4FF2 A;  3KDF A;  3NEL A;  5D3D A;  3GTJ B;  4OEL B;  1FJG L;  4HSV A;  4NW2 A;  5FO7 B;  1WTP A;  2RVL A;  5GAH C;  1YIT A;  4ZK9 B;  2IX0 A;  4FNF A;  3I55 A;  3H0G H;  1SJE D;  4PMB A;  5IP7 H;  1O80 A;  1N33 Q;  2JEA I;  3D0F A;  2KCC A;  3HOX H;  3A5U A;  2L4N A;  4JI3 L;  1VDZ A;  2CVR A;  4KD4 A;  2KBN A;  4OWT B;  4RHS A;  2BH8 A;  3CU7 A;  5CBA E;  1ENC A;  4DAY A;  3UDX A;  3B6Y A;  1KC8 C;  2F0O A;  4BBS H;  5KYL A;  4C3J B;  2VQF L;  2A68 D;  4LWC A;  3K0X A;  4FVM A;  4A3I H;  1B1Z A;  1K73 C;  4K6D A;  1QWY A;  2UXB Q;  1CKN A;  5CV5 A;  1NAP A;  1PH2 A;  3E3X A;  3J81 j;  3HOU H;  1GUG A;  4KV6 A;  1SND A;  1OXV A;  2MGS A;  5EGT A;  1VQE A;  4EQO A;  3BZK A;  1I94 Q;  4IPC A;  2SNM A;  2L55 A;  2PW5 A;  4X6A H;  4O0A A;  1DD2 A;  1A15 A;  3I70 A;  3U9O A;  4HIK A;  3W2D A;  1HTL D;  4DXF A;  4QY7 A;  3CQZ B;  1K9M C;  5LMN Q;  3VYT A;  1AE3 A;  2ICI A;  4R4C A;  4OEM B;  4UY8 C;  4IUN A;  1UNS A;  3VR6 A;  2Y0S B;  4A93 G;  2B63 H;  2OCE A;  4UP7 A;  1H95 A;  4X3S A;  2PI2 A;  3NP8 A;  2RF4 A;  3E9I A;  5LHY 1;  2G9H D;  4XYO A;  4MTK A;  4YHH Q;  2UU9 Q;  4CKE A;  4IOC A;  3SXH A;  3NEN A;  1GUN A;  1N34 Q;  3CP0 A;  4KY7 A;  2YTV A;  4YWM A;  5C0X J;  3H0G B;  2ASB A;  3D8G A;  1AFP A;  3NK9 A;  2CHB D;  1LV9 A;  1U9R A;  3BG3 A;  4GNX C;  1Y1V H;  4R8I A;  4DK6 C;  2LKV A;  4A3F G;  4Q0F A;  1CA5 A;  3I8Z A;  1NNX A;  1HRJ A;  3RLF A;  5M5W B;  3PUY A;  2JA5 G;  2DY8 A;  2F0J A;  4B9X A;  2AUJ D;  3GTO H;  3ULJ A;  4BS9 A;  3J7A V;  2CW0 C;  1A63 A;  4Q5V A;  3ULP A;  4KHZ A;  1EQT A;  1S5F D;  2NTT A;  3L9A X;  3H3V C;  5J3B A;  1XJV A;  1TR5 A;  2K28 A;  2A5H A;  1I5F A;  3Q24 A;  4C3H H;  1NMF A;  2VY3 A;  2D0O A;  1TS2 A;  1KRS A;  2MO1 A;  3IKJ A;  1T5E A;  4JBW A;  1RL2 A;  4QQB X;  1I4Q A;  1K28 A;  1TXY A;  2O2L D;  3Q0A A;  3O13 A;  4B08 A;  2Z0S A;  4K2L A;  5DNF A;  1WTQ A;  4WJ4 A;  4RG1 A;  1NSN S;  1JWS D;  3CKI B;  5C3X A;  3Q22 A;  1SFO H;  1CKO A;  4DR5 L;  2JSO A;  4DAY B;  4QJF A;  2EXD A;  5CMD A;  5FLX c;  1G6Z A;  4HCE A;  2HT1 A;  5TSS A;  4DR1 L;  1FNV A;  2K1B A;  1HA5 A;  2VZA A;  2QEX A;  1VQ6 A;  2K05 A;  4O42 A;  4KKT A;  4IFD J;  2AUK A;  2KA7 A;  4B3M Q;  1STB A;  2BCO A;  5E3F A;  1H9S A;  4ZAI A;  1SNQ A;  1I4H A;  3EA6 A;  1ICW A;  5KNC A;  3I73 A;  5FO8 B;  1C48 A;  3K59 A;  1CKM A;  1QZH A;  3GD7 A;  2ZM6 L;  5BN4 A;  2K5D A;  3C3L A;  2QKI C;  2EPB A;  4H02 A;  4A3F B;  4UAI A;  5JJK A;  1PDQ A;  2HCI A;  3RUZ A;  2HIX A;  2JA5 B;  2I07 B;  2WB1 G;  3MA2 B;  2WB1 B;  1IBK L;  2VUM B;  2D2C C;  4L5Q A;  3VR5 A;  2VW9 A;  5FJ8 H;  3R2I A;  2CKZ B;  5GAD C;  1VQD A;  4BY7 G;  1VQM A;  1LTA D;  1PZK D;  3JAM E;  1PYS B;  4DR4 Q;  1KAB A;  1Q1B A;  2KED A;  4C3J G;  1KHI A;  4A3M G;  4KKU A;  1FD7 D;  4JBM A;  3ND8 A;  2NUC A;  1O78 A;  4J8Q A;  1X9N A;  3RN2 A;  5M3M H;  1HJP A;  5F2D A;  1D5M C;  4L5T A;  4JI5 L;  5IGC A;  5CYU A;  5IT9 E;  1PA6 A;  3W5O A;  3BJU A;  2AQ3 B;  2ATW A;  1A6X A;  1K8O A;  4N9P A;  2JA8 H;  4A3B G;  5C4J H;  1XMO Q;  2E2D C;  3HOY H;  5K36 H;  3A8J E;  4A3M H;  1VS0 A;  1JB7 A;  4LAA A;  4QUC A;  3MXN B;  1JOQ A;  1CQV A;  4X64 L;  1H9M A;  1EU3 A;  1H9K A;  1AZP A;  5EQ0 A;  1PYB A;  1HZA A;  3ERS X;  4DNI A;  2Z1C A;  2R92 B;  1LTS D;  3K7U C;  1N9W A;  4RGO S;  4LUV A;  3MFG A;  2IW3 A;  3PUV A;  1E0B A;  2TSS A;  3LNN A;  3G48 A;  3M4P A;  4RWS C;  3T1H L;  1MD2 D;  2Z4I A;  4C1N I;  4DR2 Q;  3FPP A;  1ASZ A;  1Q90 A;  2XN9 C;  4JI4 L;  1SRO A;  3S1M B;  2F0U A;  3GTK H;  1VQ4 A;  1QNK A;  2VS1 A;  2IY5 B;  4MHE A;  5ELD A;  1L1O B;  3QIA A;  1G2S A;  2KCN A;  1UE1 A;  2HHH Q;  3CXC A;  1JJC B;  4JI5 Q;  4UP8 A;  2Z6K A;  4LNQ A;  4POF A;  1GUT A;  3A8I E;  3F1Z A;  3K58 A;  4H7B A;  1XNQ L;  1K8M A;  2E2H B;  1FYC A;  3A56 A;  4OIK A;  3FRP B;  3HP3 A;  1UEA B;  2ZXR A;  1Q8K A;  3S2D B;  1U4L A;  1DM0 B;  2N55 A;  3I72 A;  1HFG A;  2LMC B;  2ZTE A;  1CA6 A;  2DY7 A;  4A3C G;  4LFB L;  2CW0 D;  4DR7 L;  4A3J B;  2B2U A;  1IKM A;  3AMU A;  5ELO A;  1MSG A;  5C4Z A;  3HOZ H;  4X62 Q;  2RCF A;  4OHJ A;  3TP7 A;  4F87 A;  1X54 A;  2CQA A;  5IWA Q;  4KN7 C;  3CCU A;  3CCQ A;  4P74 A;  1PFB A;  2XWJ B;  4B3R L;  2L9H A;  3MVV A;  4P72 A;  3M4Y A;  1L1O A;  3MXU A;  3S1R B;  2OWO A;  5M3M G;  2EY2 A;  4CDF C;  4PZ6 A;  4A3M B;  1L1O C;  4DUZ Q;  3BYY B;  1X56 A;  3NPP A;  1SYB A;  3NHH A;  5C44 G;  4HMI A;  4R8N A;  4AQY L;  2A8V A;  3KJP A;  1PTO F;  5M5X B;  2PQE A;  5KYI A;  4DV6 L;  3D3R A;  3CCL A;  4KHP Q;  1EY0 A;  1DYQ A;  3KF6 B;  3QO2 A;  3QG1 A;  2I5L X;  4X66 L;  1KL9 A;  5IIF A;  1B44 D;  1DGS A;  3G7L A;  1XNR L;  1MKH A;  4C2M H;  4GNX B;  4JI8 Q;  4DAV A;  3IAY A;  3FEW X;  2WKC A;  4LFC Q;  1SE3 A;  1C4Q A;  3J81 i;  1U0L A;  5DLQ E;  2MQH A;  3PMF A;  1VQJ A;  5JAV A;  1J8I A;  4JI1 Q;  3TEH B;  2NWG A;  4OX9 Q;  4WOR A;  1AE2 A;  1NMG A;  2F4V Q;  4DR5 Q;  1LTL A;  5E4X A;  3C46 A;  2UXB L;  4AYB E;  1VQ5 A;  1G6P A;  1SYD A;  1EWI A;  3S17 H;  3K57 A;  4JI1 L;  2K4K A;  3DHQ A;  4GOP B;  3BZC A;  1CFM A;  4YWL A;  1VQO A;  4JI0 L;  1GM5 A;  3KOJ A;  5HGQ A;  1R4P B;  1CKN B;  1HZC A;  3L3O C;  4PZ8 A;  3AFP A;  4XQJ A;  5IGG A;  4LF7 L;  1A0I A;  4A4I A;  5C5L A;  3M3Y H;  1B9N A;  4HJ9 A;  4BBR G;  3S16 B;  1U5K A;  5CV7 A;  1HCZ A;  4DF7 A;  4Y7N H;  1L0X B;  4DV6 Q;  4LF5 Q;  1ZYR C;  3HOZ B;  1VQK A;  1JE4 A;  2PMZ E;  4GLX A;  4V0B A;  1Q46 A;  5CV9 A;  5L37 A;  1DZ1 A;  2NZ1 D;  4H0L C;  3GTJ H;  4BXX H;  2WAQ G;  1STH A;  1CK1 A;  2F0S A;  3PO3 H;  4ME5 A;  4RAU C;  4XXE A;  3DEO A;  4QIW E;  3HOZ G;  3PQI A;  3DEP A;  1BCP F;  1NR4 A;  2QF7 A;  1GKH A;  4DV5 Q;  5JVH 3;  1XPR A;  1T9H A;  3KUP A;  4A3D G;  1SBB B;  4GKK Q;  4QIW B;  3HKZ G;  4DV4 Q;  4B3M L;  1PTO D;  4NMZ A;  3JAM i;  2Y0S E;  2F0L A;  3KF8 B;  4APV A;  5ISR A;  3I7F A;  4IJH A;  5IGD A;  4GN4 B;  4GKK L;  3EN2 A;  4BBS B;  1EYA A;  4JBJ A;  1OXX K;  2G9D A;  1G8Z D;  4DV7 L;  1S40 A;  3MC0 B;  3E6Z X;  5LL6 S;  1HUM A;  3CPW A;  4LF4 Q;  2E76 C;  2JXM B;  1IL2 A;  2IHF A;  4JG2 A;  3S1N B;  1Y8N B;  4DPG A;  1CSQ A;  1I6V C;  1I6H B;  5LMN L;  4TRD A;  2ALY B;  3HOU B;  1S5C D;  3SK8 A;  2FXQ A;  1BOS A;  2K33 A;  1II3 A;  1D8L A;  1QVC A;  1WD0 A;  4N9T A;  2KCT A;  2VNU D;  4IUR A;  2Z9H A;  4X62 L;  1L0W A;  3E0E A;  1NTG A;  1NE3 A;  2B63 B;  2AQ1 B;  2LXJ A;  2PZU A;  5D3I B;  4ZKB B;  5JJL A;  3CW2 C;  1D1I A;  1I3Q B;  1TWG H;  2B39 A;  1AN8 A;  4L5R C;  3F8T A;  1VQ8 A;  5CC4 A;  1TY2 A;  3CC2 A;  1YHB A;  4MIU A;  1HQR D;  2EY1 A;  1BQQ T;  3Q6S A;  1RD9 D;  2PCF B;  4BBR H;  1IHZ A;  2L12 A;  4DV2 L;  4DV4 L;  1IBL L;  3PO3 B;  1DON A;  3PGZ A;  1YIJ A;  5EJW A;  4HED A;  1UE5 A;  1E2Z A;  2LFN A;  2IX1 A;  3EFX D;  1OXS C;  2UXD Q;  2A69 D;  2IX3 A;  1Y1V B;  1HR0 W;  1LT6 D;  4GOP C;  1WTR A;  3SR1 A;  5KNB A;  3SHL A;  1IBM Q;  1I4R A;  3I56 A;  3WDN A;  3A0J A;  2DN8 A;  3H09 A;  2B2T A;  3J80 E;  2XRS D;  5IYD H;  4DV5 L;  4G57 A;  4A3D H;  4KJO A;  4A75 A;  1I4G A;  5CGK A;  1ASY A;  4PQX A;  1WI5 A;  1P16 A;  4GLV B;  3OSO A;  1CHP D;  4I65 A;  1FVI A;  1HNW Q;  2AWN A;  2BDO A;  1PFM A;  1WD1 A;  1RTN A;  1VQB A;  2IWH A;  1I6H H;  4B9W A;  3S2D H;  1V1P B;  4C56 C;  3I4N G;  3TBI B;  4GN3 B;  1XPO A;  1WTV A;  4KHP L;  3SDZ A;  2NN6 H;  1N32 L;  2Z6K C;  3TDQ A;  4ILW A;  4NXN L;  2WAQ B;  3UE1 A;  3NE5 B;  2K5N A;  3AB9 A;  5C5M A;  2RDF A;  3M7N A;  1Y8P B;  4CBV A;  4XQQ A;  1B9M A;  2E74 C;  1TY0 A;  3KJO A;  4YCV A;  4OL7 A;  3T4A C;  4JI6 Q;  5C4H A;  1CTM A;  5LL6 X;  3S1R H;  2HCC A;  5EKL A;  1WFQ A;  1I3Q H;  5C3W A;  1UAP A;  4RCN A;  1KRT A;  2P5Z X;  3LX0 A;  4IUP A;  3S1Q B;  5M5X H;  1Y8O B;  1F2M A;  2D9U A;  3HOX G;  4I7A A;  1UE6 A;  1WTO A;  1S72 A;  3DM1 A;  1N8R C;  3DMU A;  1K3R A;  5M5Y B;  4YCU A;  1F2Y A;  3TS2 A;  2A1A A;  3HZX A;  3H3V H;  2OT2 A;  1SYE A;  3KFU A;  5D65 A;  1WTX A;  1TWF H;  1JB3 A;  3A55 A;  1FGU A;  2F4V L;  2MP1 A;  4DAP A;  2JEB I;  3UE0 A;  2WP8 J;  1BBU A;  1EY6 A;  1STG A;  3WOE A;  2JA5 H;  1GUW A;  1SRU A;  1VF5 C;  2FFK B;  1SLJ A;  2MJ8 A;  1RHP A;  4FF1 A;  1HUN A;  5C44 H;  4LFC L;  1Q82 C;  3ND9 A;  5EKK A;  5FLM G;  3NTI A;  2UUA Q;  4GZY C;  2F0Q A;  1PRT C;  4K0K L;  1SMY C;  2F0E A;  5COR A;  1XMQ Q;  3CCS A;  3J80 c;  5GAG C;  3CF5 A;  2K6A A;  2NVY B;  3T1H Q;  3I4O A;  1X55 A;  3CQZ H;  2FMC A;  3LGJ A;  4L63 B;  2PW7 A;  5FLM H;  4KK7 A;  3K80 C;  2B2T C;  2VQE Q;  3HOY B;  1LAB A;  3S16 H;  4DV1 Q;  2PO4 A;  4A3G B;  1N33 L;  5IT9 L;  4DV1 L;  1Z47 A;  5C4X H;  3CRK C;  3MHB A;  2A69 C;  3U50 C;  1D6E C;  1YNJ C;  1F9R A;  5JEA G;  2KUM A;  2HUG A;  2YTY A;  3KBX A;  2HDM A;  4POG A;  1E2V A;  1A3U A;  4N8X 1;  2M9V A;  2Q2I A;  2PPB C;  2MNA A;  1XXG A;  4KLK A;  2MPM A;  4RHR A;  1W6K A;  4IPD A;  3MEF A;  4AIM A;  2Z8L A;  5C4X G;  3PF4 A;  3FDT A;  1K83 H;  2RDH A;  3GTK B;  4DU9 A;  5M5Y H;  3OYY A;  5C0X H;  1J9O A;  1PTO C;  5M5W H;  1EOT A;  1JQY D;  3V96 A;  4EX5 A;  1FNU A;  3AYH B;  4ZQ3 A;  3EBE A;  2QIL A;  1Z6H A;  4FXK C;  3VA7 A;  1JCK B;  3D31 A;  3LWE A;  4JCV E;  4BY7 H;  4LF9 Q;  4KY6 A;  4HN7 A;  5IYC G;  3NBH A;  3TZU A;  4JV5 Q;  3MTS A;  5C44 B;  2SEB D;  1IYJ B;  3T13 A;  4A3E G;  2L5T A;  1U4P A;  2K03 A;  4B3R Q;  1XX8 A;  1YBY A;  4F8M A;  4J1M A;  1CQF A;  2A6H C;  4CKB A;  3H3V I;  2B2V C;  3A7L A;  4ZLT F;  1LT3 D;  1E1T A;  4M1U B;  4DV2 Q;  2EJF C;  3HOV H;  4OIJ A;  5I2X A;  3OHX C;  1XNR Q;  1Q12 A;  3GTL B;  2Q2H A;  2NVY H;  4FO2 A;  3M7G A;  4JI2 Q;  1N32 Q;  4FYD A;  3K5L A;  2UUB L;  3BVZ A;  4HMJ A;  1RJT A;  4DNT B;  3CCR A;  1WJJ A;  1BNZ A;  1S4Z A;  2C5C A;  3G6J B;  4QCL A;  4KMU C;  3QR8 A;  2PZW A;  4DV0 L;  1VQL A;  3I90 A;  2DJF C;  1XTC D;  3A74 A;  1MGS A;  1TWG B;  3CD6 A;  3M9B A;  2F0P A;  3C2P A;  3M85 A;  3SEB A;  4ZUJ A;  4PMC A;  4B3S L;  5FOB B;  5ELE A;  1LM0 A;  1X3F A;  4XT1 B;  1TQO A;  4N8F A;  5C6A A;  4CJ1 B;  1PH4 A;  1QVF A;  2WAQ E;  4C2M B;  5EPJ A;  1BBW A;  2BA1 A;  1HXY D;  5IOD A;  1IYU A;  3UDI A;  4A3L G;  5IP7 G;  2E8G A;  1NUC A;  2HQL A;  3RMH A;  4B3T L;  1JWM D;  1DOK A;  1PRT F;  4Y52 H;  4LF7 Q;  5CV8 A;  4ZUI A;  5FLX E;  4A76 A;  3TRE A;  3R8B A;  5T1I A;  3GTP H;  2KVM A;  1LUZ A;  1XNQ Q;  3PO3 G;  2H4O A;  3FKI G;  2C9O A;  4JVZ A;  5KIX A;  4LFB Q;  4X3T A;  1TKW B;  1Q3L A;  4A3E B;  1YI2 A;  2CCZ A;  2L11 A;  2F03 A;  3TP5 A;  4OWX B;  3N52 A;  1JR0 D;  4ODG A;  1VF7 A;  3D4W A;  1BR9 A;  1NBW A;  5GRO A;  1D7Q A;  1VQ7 A;  2Q2T A;  3GP7 A;  2ZJQ A;  2JYO A;  5C4J B;  2H5X A;  2ID0 A;  3DM3 A;  1HA6 A;  5AFW A;  1LTG D;  4Y7N B;  3S14 B;  2MHV A;  2E5L Q;  1WOC A;  2NBF A;  3MXP A;  4A93 B;  1STE A;  3GO5 A;  4CDD C;  4JI4 Q;  1VQI A;  1EY7 A;  1CHQ D;  2MO0 A;  2K04 A;  2OXP A;  4C1N K;  1JE5 A;  1JJ2 A;  1HTP A;  4R4O A;  3I4M H;  1ZXT A;  3FPU B;  1DJR D;  4HJ8 A;  2KCM A;  5JEA J;  2R7D A;  1WVL A;  1PH1 A;  5J39 A;  4X66 Q;  1AZQ A;  2HIV A;  1AW7 A;  4J15 A;  1Q7Y C;  2IT1 A;  1EFI D;  3AQQ A;  4GS3 A;  1LLR D;  1QE6 A;  2MUY A;  1GUS A;  1O7Z A;  5CBE E;  1B70 B;  3K5O A;  1BKB A;  2ZTD A;  5T1G A;  3CCE A;  2NVQ H;  1X3E A;  2R7Z H;  3KYH C;  4LF6 L;  2CFM A;  2K5Q A;  2F1M A;  3S1M H;  4UHV A;  1FJG Q;  3H0G G;  2ZTC A;  2J0T D;  4QMG A;  1DXM A;  3PUZ A;  2LXK A;  3C1E A;  3GV6 A;  2EYM A;  5IGB A;  1F9P A;  4G7H C;  3PIO A;  2JN4 A;  4LUZ A;  5IP9 H;  4BY1 H;  2R93 B;  2E75 C;  2BOS A;  3HOW G;  4ULL A;  2O4X A;  1VQF A;  2PI2 E;  1O7L A;  2A68 C;  5BR8 L;  4IFD G;  1HNW L;  4U68 A;  5E1F A;  1EU4 A;  4KN4 C;  2K5W A;  1L2F A;  4A3L H;  3S1N H;  1HNX L;  3NQT A;  1DOM A;  1X65 A;  5IWA L;  5BN5 A;  2X69 A;  1I50 B;  4R4I A;  4BY1 G;  3NQI A;  2FMM A;  2F3V A;  1M1K C;  3CRL C;  1FNW A;  5KND A;  4A3J H;  3BDO A;  4A3G G;  4GNX A;  2EYO A;  3D6C A;  1SYG A;  3AFQ A;  2NVT H;  4LF5 L;  1Q1E A;  3NTK A;  3DLL A;  4DR7 Q;  4CGY B;  1JC7 A;  1SNC A;  1K3B C;  1MBY A;  1D5Z C;  2OQK A;  3OOC A;  4JI2 L;  4X65 Q;  1M8A A;  3CCM A;  3I91 A;  1C7Y A;  1ML0 D;  3WOF A;  4EQ5 A;  2EYL A;  1V1O A;  1E3P A;  1IBL Q;  1IW7 D;  3UI2 A;  2A6H D;  2DUD A;  1IBM L;  3S9W A;  4K5X A;  1Y14 B;  5FLX L;  2M2L A;  2UU9 L;  4BXX G;  3BDL A;  4A3G H;  2EVB A;  3NXW A;  1W2B A;  5LMU L;  5C4X B;  3GTQ B;  4A93 H;  1Q86 C;  5ELF A;  5I2Y A;  1D1K A;  3V2T A;  2IPK D;  3A54 A;  1PRT B;  4LFA Q;  1B3Q A;  1NCV A;  5IE8 A;  4ZYS A;  3VA5 A;  2A73 B;  4OX9 L;  2EE1 A;  3WWV A;  2BDN A;  2F4I A;  4DA2 A;  4JI7 Q;  2NN6 G;  2L15 A;  4CJ0 B;  4B3T Q;  2OTL A;  4F7X A;  1LYL A;  1TWH H;  3ER0 A;  4XDX A;  1S5E D;  1PHJ A;  1IZ6 A;  2SNS A;  1QNU A;  2K14 A;  1F9S A;  4DV3 Q;  4LJZ C;  3VDY A;  2O5J C;  4NXN Q;  4I7Z C;  1IL8 A;  3STB D;  4BY1 B;  2R93 H;  2XRQ D;  2F0I A;  4DXG A;  2UUC L;  1Z7T A;  1VQA A;  1CZW A;  4H13 C;  4YY3 Q;  3RZD B;  1PH9 A;  4G7O C;  1EOV A;  4IPH A;  3OMG A;  2OTJ A;  4IAL A;  2RHS B;  4IFD I;  1ESR A;  2YU9 B;  5BR8 Q;  1OO9 B;  4LF9 L;  1ILP A;  2CH4 A;  2NB0 A;  2E2J H;  5EPL A;  1B8A A;  1O7I A;  2O5I C;  3DWA A;  4BWG B;  1B53 A;  2KHJ A;  4KTA A;  1SNP A;  2A74 C;  1I50 H;  2BE5 D;  4E6I A;  2R93 G;  1EZ6 A;  1B7Y B;  2VQE L;  5ELC A;  1EIG A;  2V4D A;  1PTO B;  1T5X D;  1PFS A;  1V8Q A;  1ESF A;  3HOV B;  4HJ7 A;  1TWA B;  3ERQ A;  2WB1 E;  1J6Q A;  5M3F B;  1EY4 A;  2DGY A;  1PV4 A;  2EIF A;  2J4X A;  4K8J A;  1F2L A;  1F9Q A;  3MXG A;  3KK7 A;  4A3J G;  3DXJ C;  2K7V A;  4WFN 3;  3Q8D A;  4GLA C;  1JOO A;  1YVC A;  1EUJ A;  3T56 B;  5DM7 3;  3BVM A;  3VR4 A;  4QGU A;  4NDX A;  4BBS G;  4O2D A;  3FP9 A;  1N34 L;  3OIQ A;  1EL0 A;  3H6M A;  4A3I G;  2B2Y C;  3QJY A;  2WV6 D;  4FDB A;  3PO2 H;  2DNC A;  4P71 A;  4GKJ L;  1PYW D;  2EDG A;  3U4V A;  2I5H A;  3Q23 A;  3HGB A;  1JMC A;  1EIF A;  2EYJ A;  3M4Q A;  2JA9 A;  1EIH A;  4K5W A;  5EPK A;  1SYC A;  4KHV A;  1TWF B;  2RKS A;  2JQO A;  1ICF B;  2HDL A;  5LMN W;  4LUO A;  3TRZ A;  3IFT A;  4JI3 Q;  5D14 A;  4EGV A;  5IYD G;  1L0Y B;  4GOP A;  1XMQ L;  4NP5 A;  1NR2 A;  3E0J A;  3HS0 C;  3FKI B;  3ONA B;  3UDG A;  3A8K E;  2EXZ A;  4G7Z C;  1GHJ A;  1F77 A;  2XSC A;  4RCO A;  3KLW A;  5I4D A;  4P73 A;  3RZD H;  1S5D D;  1J5E L;  1WCM B;  2B63 G;  3RNU A;  1UE7 A;  3BVG A;  4OO1 H;  2BE5 C;  1D5X C;  2KOL A;  4BA1 I;  2WIN B;  2JK8 A;  2JP1 A;  4KY5 A;  2YU9 H;  2B2W A;  1TVX A;  1SJH D;  1JWU D;  1PH3 A;  3GTM H;  2EYH A;  1MI2 A;  2KQ3 A;  1BCP D;  5BN3 A;  2E2J B;  4XQN A;  5COY A;  3I4L A;  3S15 H;  4EQN A;  2WAC A;  3N6R A;  4PNY A;  4K5V A;  2K5H A;  3RN5 A;  1DOL A;  5IOC A;  2K01 A;  4HSP A;  3NSW A;  2IJ0 A;  1H9S B;  4L6T B;  4OO1 G;  2ZXO A;  3KF6 A;  1KD1 C;  2B3G A;  5IYB G;  1M90 C;  2PNH A;  1TWA H;  3S2H B;  1ET6 A;  3HG9 A;  1Y1V G;  1ENA A;  2JA8 G;  3MWY W;  2RQX A;  4AQY Q;  2F3I A;  3K81 C;  4IPG A;  1GUO A;  1HZB A;  3G6E A;  3SK4 A;  1Y1W G;  2H1E A;  1HR0 L;  1BUV T;  2LS0 1;  3U4Z A;  1HNZ L;  1ENF A;  3ERO A;  3K0Y A;  5IYB H;  1SYF A;  4WJW A;  1QCB D;  3HKZ B;  2ZM6 Q;  4C3I G;  3TN2 A;  5C3E G;  1HR0 Q;  3EQL C;  2NZH A;  3PIP 3;  3PO2 B;  3PCO B;  4C3H G;  1O7Y A;  3NEM A;  2JA6 H;  2ZXP A;  2KEN A;  2F52 A;  1HQM C;  2UXC Q;  3R3O A;  2NVX B;  1KQS A;  1KLG D;  2UXD L;  4RGT A;  2CH4 W;  4A3D B;  1PFN A;  1EY5 A;  1SEB D;  2F0V A;  2F0W A;  2UUC Q;  1UEB A;  3F2U A;  1BBX C;  4HR7 B;  3I4M G;  4BY7 B;  3P20 A;  1HFN A;  1U4M A;  4NKL A;  3NBI A;  4QF4 A;  3ULL A;  1LTR D;  2XTI A;  1I94 L;  5IGE A;  3GV3 A;  4K0K Q;  2HHH L;  1PH7 A;  3TS0 A;  2EY5 A;  2RSN A;  4LF8 L;  2LY7 A;  1V43 A;  3K6O A;  5LMU Q;  1GJX A;  1EQR A;  2DJG C;  2B8G A;  3KDF B;  1SMY D;  2F0D A;  4JI0 Q;  3A7A B;  4L8J A;  3GTL H;  1QIL A;  4IOA A;  3ZYY X;  1W3S A;  1EQV A;  3T1Y L;  1UUP A;  1HZ9 A;  3D6W A;  5A35 A;  2PNR C;  1IW7 C;  4U67 3;  1E1O A;  1SNM A;  2Q2U A;  4MNO A;  3VYR A;  4HCS A;  1YHQ A;  1LAC A;  4X65 L;  2DNE A;  2JA7 G;  3S1Q H;  1GD7 A;  4CDC C;  1KLU D;  4OO1 I;  5FJ8 G;  4G4K A;  1EYC A;  4UDU C;  4JI8 L;  4ME3 A;  5HUR A;  4LF4 L;  2X6G A;  4HJ5 A;  1HHV A;  4IJL A;  3H91 A;  4FF4 A;  5JOB A;  1S3O A;  5G3L D;  1EYD A;  1TWC H;  4HIO A;  1LTI D;  4IN3 A;  4C3J H;  1G2T A;  2NTS A;  1A3V A;  5CV6 A;  3P7J A;  3RZO H;  1VMP A;  2EYF A;  4RH6 A;  3CPF A;  3VR3 A;  3GDE A;  1TWH B;  4JPB W;  1STY A;  1PLF A;  3RR5 A;  3EJI A;  1WTW A;  4JV5 L;  2FIN B;  1QUQ A;  4P2C B;  3GTP B;  3NUC A;  1Q8I A;  3HOW B;  1ZKO A;  1YJW A;  1BVS A;  4A3B H;  4OGQ C;  5HGT A;  2B2W C;  4LK1 C;  4TQU S;  4P75 A;  2F0F A;  4IQZ A;  1UWV A;  2KEE A;  5J22 A;  4A3E H;  1JT8 A;  3KLS X;  3QB3 A;  4OWW B;  2R7Z G;  3X3M A;  1KDA A;  4WRD A;  4FXD A;  4RGN A;  4FF3 A;  3SK5 A;  1X32 A;  2K5V A;  3EVQ A;  1E24 A;  3H15 A;  1K0R A;  2XNA C;  5IP9 G;  3JAM c;  1GVP A;  4TSS A;  1K8A C;  1LT5 D;  2F0G A;  4XIG S;  5FKA C;  1WYD A;  3GTG B;  4DUY Q;  4OON A;  3K7A H;  3RLN A;  3R2T A;  3OWE B;  3MFY A;  5CR3 A;  4AYB G;  2ZJR A;  4DR6 Q;  1KXL A;  1A62 A;  5M3F H;  2AQ2 B;  1AH9 A;  4ZCK A;  5IT9 c;  1JOK A;  5JEA H;  5JVG 3;  3JC6 6;  4M8A A;  1JOR A;  1ET9 A;  1V1Q A;  3QOJ A;  3CC4 A;  1ZEQ X;  1B2T A;  1DCZ A;  1RF2 D;  3PIO 3;  5AJ3 L;  1GXD C;  3SE0 A;  3L2P A;  4EVO A;  4ZKC B;  2M00 A;  3L0O A;  3TQY A;  4LFA L;  4A3K B;  5M3F G;  2R7Z B;  3IFD A;  4GN5 A;  1K83 B;  1NJI C;  1KNA A;  5C0X G;  2R6G A;  4JI7 L;  4L5S A;  1H9J A;  2F0H A;  2D5D A;  1HNX Q;  2GVA A;  2UXC L;  2JA7 H;  1MJE A;  2N78 A;  2SOB A;  1QG7 A;  1MHW C;  4CJ2 C;  1TWC B;  3QOL A;  2MFI A;  3J7A 5;  1SNO A;  3RZO B;  4OXP A;  1MIU A;  3BU2 A;  4TVA B;  3TSS A;  5GAE C;  3HOU G;  4X3U A;  4JOI C;  3CCV A;  1IXR A;  4IUT A;  1HPC A;  3CHB D;  2N88 A;  2QCP X;  5ELB A;  3FKI H;  3HFZ B;  2SDF A;  3J81 E;  1EY9 A;  1SAP A;  2A6E C;  3IL8 A;  1XYI A;  1KNE A;  2EJG C;  2Z4H A;  2KJX A;  5G3L F;  2B8F A;  4DR6 L;  1JIC A;  2VL6 A;  1WCM H;  5E4W C;  5C0X I;  4A3B B;  4ZRZ A;  1ONL A;  3DWP A;  4QUF A;  1SE2 A;  4K14 A;  1S5B D;  4RMF A;  4DV0 Q;  1IKL A;  2N8N A;  3GTM B;  2KHI A;  1ZYR D;  4DFA A;  4JBK A;  4DAM A;  1A8V A;  5EKI A;  4JOI A;  3W1G A;  3I2Z A;  5DEH A;  2OQ0 A;  3K8A A;  4QL5 A;  3CMA A;  4NXM Q;  1VMC A;  1N36 Q;  2L0C A;  3K7A B;  2PQA A;  3J7Y W;  3DUZ A;  1TS5 A;  2QDL A;  2UUB Q;  2F0T A;  3SVM A;  4JYA L;  2K52 A;  2I0Q A;  2VB2 X;  1BXT A;  2CWA A;  2VUM G;  2KHS A;  1YNN C;  4R1J A;  4DN4 M;  1D2B A;  1VQC A;  4UP9 A;  4XT3 B;  4PG3 A;  3FHW A;  4A3F H;  2RHQ B;  4YY3 L;  2N3S A;  1H9R A;  5M9O A;  2QDB A;  4IZ8 A;  4YWK A;  3J80 i;  2VUM H;  3J80 L;  3TP8 A;  4YIJ A;  2JA6 B;  3NWS A;  1AP0 A;  1GOZ A;  4IUQ A;  2NZO A;  5AJ3 Q;  1PH6 A;  2EQS A;  2NN6 I;  2AHO B;  3S24 A;  3KF8 A;  2JA7 B;  3EIV A;  4IFD H;  4LF8 Q;  1CM9 A;  3OIP A;  2X6L A;  1NY4 A;  4O1N A;  5IY0 A;  2A6E D;  3MZ5 A;  2RDG A;  5FO9 B;  3W1B A;  3G4S A;  5H1S E;  3T16 A;  1M4V A;  2V1C C;  2Q8T A;  1KDB A;  3G71 A;  2HQE A;  5EAY A;  1XMO L;  3PO2 G;  2K32 A;  4LMQ D;  4UPA A;  2VQF Q;  3P75 A;  1VQH A;  3GQB A;  1G91 A;  1OTC A;  3HEJ A;  2IL8 A;  2CQO A;  2B2Y A;  1QB5 D;  4JK1 C;  2XVS A;  3OTO L;  4FP5 D;  1LO5 D;  1GO3 E;  1V1P A;  2L1B A;  2RBM A;  4X64 Q;  4YHH L;  2F0K A;  3OPO A;  3HRZ C;  3KBG A;  2EOT A;  2EJM A;  1TU2 B;  2Q8R E;  4MZ9 A;  2Z6B A;  3VR2 A;  3BS1 A;  5K5P A;  3I4N H;  2R92 H;  3HKS A;  4DKA C;  2QEJ C;  4XYQ A;  3S14 H;  1YHA A;  5CV4 A;  2HD3 A;  4K6L A;  3E5S A;  4DR2 L;  2B2U C;  1X3P A;  3I4M B;  1HNZ Q;  1PZJ D;  2YYZ A;  3PUW A;  1C8C A;  3STB C;  5J1Z A;  4DUZ L;  3BDC A;  4V19 0;  2R61 A;  1VCI A;  3W3A A;  2XIW A;  3K5N A;  2NVQ B;  1KAA A;  3A5Z B;  3C1F A;  1PXU A;  3R93 A;  2ES2 A;  1W6J A;  3NWT A;  1EWH A;  3K5M A;  3T53 B;  2JJQ A;  3F2D A;  3UDF A;  3U58 A;  1TII D;  2QA4 A;  1TS4 A;  1K0S A;  2KEC A;  2R7F A;  2WFW A;  4YCW A;  1R4Q B;  2PMZ B;  3F2C A;  1EQQ A;  4X3K A;  1X3Q A;  2B29 A;  1A3T A;  2E2H H;  2RA4 A;  4RA8 A;  1EY8 A;  3M4O B;  5E7N A;  3ITP A;  1Y69 U;  1Y1W H;  5DAU A;  1XTD A;  1PH8 A;  4DK1 A;  3DWQ A;  2NYZ D;  2OF1 A;  1RDP D;  2A19 A;  5DM6 3;  2AMC B;  1XPU A;  3J7A F;  4A3C H;  2ZJP A;  4LW1 A;  3ICE A;  1PRT D;  1K8G A;  2WII B;  4TKO B;  1ILQ A;  1XWE A;  2Q8I B;  1LTB D;  1SFO B;  4R9W A;  2NVT B;  2CWP A;  1SDF A;  1KAW A;  1FR3 A;  4RKL A;  2BH2 A;  1R9T H;  2JA6 G;  2QGQ A;  1SMX A;  3HOY G;  2F0M A;  2XWB B;  1YNN D;  1FL0 A;  1TT2 A;  3T1Y Q;  3VYS A;  3PV0 A;  4BA2 I;  3H94 A;  2YV5 A;  1CSP A;  2LSS A;  3V05 A;  3I3C A;  2YTX A;  3GTG H;  3F2B A;  2R3Z A;  4F88 A;  4NPS A;  1ROD A;  3I4N B;  4JW0 A;  3S2H H;  3CC7 A;  1QZG A;  3U9S A;  3GTQ H;  3AU7 A;  4LF6 Q;  1YNJ D;  4KJN A;  4DK0 A;  4DUY L;  1IYV A;  1EYG A;  4ALP A;  1FGB D;  5C3E B;  5I6Y A;  2F0N A;  4XTC S;  1KIX A;  2R92 G;  4HID A;  1EWC A;  2I5M X;  4RFB A;  4CKC A;  4EQP A;  1AEX A;  3TP6 A;  3PSI A;  1GHK A;  1E7Z A;  3NTH A;  5KRU A;  1LT4 D;  3CME A;  1RIP A;  5EBD A;  1I4X A;  1PH5 A;  5FK9 C;  1YNX A;  3MEH A;  4DR3 Q;  1CI3 M;  1QOH A;  2NVX H;  3QWN A;  2Y0S G;  2AKW B;  3SGI A;  4DV3 L;  4R4Q A;  3OW7 A;  4PV1 C;  1RCV D;  2XGT A;  3KLS A;  4MTN A;  3OWF A;  5KEE A;  4IUU A;  5HY6 A;  2FJ2 A;  1BCP B;  2PQA B;  1F2Z A;  5EBC A;  1E22 A;  1SE8 A;  4AYB B;  1Y1W B;  1EIY B;  4IUV A;  2FHT A;  2JA8 B;  4R4T A;  4DR4 L;  4S3S A;  3TZD A;  3AEV A;  4HIM A;  2OEO A;  1SE4 A;  2E2I B;  1PTO H;  1TS3 A;  2EYP A;  2AWO A;  4ID6 A;  1BCP C;  1HH2 P;  3PIP A;  1VQ9 A;  1X6O A;  4K8I A;  1VQN A;  5JPM C;  4DK3 C;  4DR1 Q;  4GKJ Q;  4QB4 A;  1MJC A;  2E5L L;  4A3K G;  3FMC A;  1CZG A;  5JJZ A;  5A2Q E;  1C0A A;  4HTH A;  2GN5 A;  3KLR A;  5KGU A;  1P8L A;  1PMR A;  3ZJY C;  2K75 A;  1YZ6 A;  1JJG A;  3P1H A;  3D4R A;  1OXU A;  1B4O A;  4JYA Q;  1WCM G;  1OXT A;  1STN A;  1CUK A;  2VB3 X;  4CDE C;  4DV7 Q;  1PVO A;  4C3I H;  5C3E H;  5IGF A;  5NUC A;  4HJA A;  3OMC A;  3CAM A;  3PUX A;  2EZV A;  2G5D A;  3GTO B;  2BA0 A;  3BZD B;  2F3W A;  5K36 G;  2D62 A;  1B3A A;  5I6W A;  2J7Z A;  3PF5 A;  1A2U A;  2ENB A;  3CCJ A;  1BF4 A;  3D4D A;  1I4P A;  2ZT9 C;  4C3H B;  1BO0 A;  4H44 C;  3J81 L; 
#chains in the Genus database with same CATH homology
 1TWC H;  4HIO A;  3HOZ H;  4X62 Q;  4C3J H;  3M85 A;  5ELN A;  1X54 A;  5IWA Q;  3HOW H;  3CCU A;  3RZO H;  3CCQ A;  4P74 A;  3OW2 A;  4B3S L;  3CPF A;  4B3R L;  4P72 A;  1LM0 A;  1X3F A;  3GDE A;  1L1O A;  2IHE A;  3NBH B;  2OWO A;  2D0P A;  3IRB A;  5JJI A;  5M3M G;  4PZ6 A;  3RR5 A;  1L1O C;  1G29 1;  2RCN A;  4DUZ Q;  1PH4 A;  1X56 A;  3J81 c;  5C44 G;  4AQY L;  2WAQ E;  1QVF A;  1QUQ B;  2A8V A;  4JV5 L;  3KJP A;  1QUQ A;  1BBW A;  1J5E Q;  2BA1 A;  4DV6 L;  3CCL A;  3UDI A;  1EFW A;  4A3L G;  5IP7 G;  1YJW A;  1BVS A;  2E8G A;  4B3S Q;  4A3B H;  4KHP Q;  4WJ3 M;  4TQU S;  2HQL A;  3KF6 B;  4P75 A;  4B3T L;  4Y52 H;  1UWV A;  2I5L X;  4LF7 Q;  4X66 L;  4A76 A;  1KL9 A;  4A3E H;  4AH6 A;  1DGS A;  4KI0 A;  1N36 L;  1XNR L;  1JT8 A;  1YJN A;  2E2I H;  3TRE A;  4OWW B;  2R7Z G;  1MKH A;  4C2M H;  4GNX B;  3GTP H;  1LUZ A;  4JI8 Q;  1XNQ Q;  3PO3 G;  2K5V A;  4LFC Q;  2N49 A;  4PMW A;  1E24 A;  3H15 A;  1K0R A;  3J81 i;  1C9O A;  2GVB A;  1VQG A;  1X3G A;  1GVP A;  1U0L A;  3FKI G;  4PZ7 A;  5DLQ E;  5GQO A;  5IP9 G;  1YJ9 A;  1K8A C;  4LFB Q;  2MQH A;  4XIG S;  1VQJ A;  1WYD A;  4DUY Q;  1IBK Q;  1YI2 A;  1Z9F A;  4OON A;  2CCZ A;  3K7A H;  3RLN A;  4AYB G;  2ZJR A;  1Q81 C;  4OWX B;  1YEZ A;  4JI1 Q;  3RLO A;  3TEH B;  4OX9 Q;  4DR6 Q;  1KXL A;  1A62 A;  4NB3 A;  1AE2 A;  5M3F H;  1NBW A;  1NMG A;  5GRO A;  4DR5 Q;  1LTL A;  1VQ7 A;  5IT9 c;  2F4V Q;  2UXB L;  4AYB E;  1AH9 A;  4A3K H;  1VQ5 A;  2Q2T A;  1G6P A;  1EWI A;  3S17 H;  5IYC H;  3JC6 6;  4JI1 L;  2K4K A;  1V1Q A;  2ZJQ A;  3CC4 A;  4GOP B;  2H5X A;  2ID0 A;  3BZC A;  2K50 A;  3DM3 A;  4DR3 L;  4YWL A;  1VQO A;  4JI0 L;  1QVG A;  5AJ3 L;  3L2P A;  3KOJ A;  1GM5 A;  2E5L Q;  5HGQ A;  1WOC A;  3L0O A;  4JC0 A;  3TQY A;  3GO5 A;  4LFA L;  1CKN B;  3HKZ E;  1HZC A;  3L7Z C;  4JI4 Q;  4PZ8 A;  1VQI A;  3AFP A;  2JE6 I;  5M3F G;  2MO0 A;  1JJ2 A;  4GN5 A;  1JE5 A;  4LF7 L;  4R4O A;  1A0I A;  1NJI C;  3I4M H;  3HOV G;  4HJ8 A;  4A4I A;  2R6G A;  5C0X G;  4JI7 L;  2KCM A;  5JEA J;  2R7D A;  1PH1 A;  3M3Y H;  4HJ9 A;  4BBR G;  4X66 Q;  1U5K A;  4L5S A;  2HIV A;  1HNX Q;  2GVA A;  1V9P A;  2UXC L;  4J15 A;  1Q7Y C;  2IT1 A;  3AQQ A;  4Y7N H;  2N78 A;  4GS3 A;  4DV6 Q;  1MJE A;  4LF5 Q;  3M4O H;  3J7Z C;  1B70 B;  2MFI A;  1VQK A;  1BKB A;  2PMZ E;  2ZTD A;  3CCE A;  4GLX A;  1Q46 A;  2NVQ H;  3E9H A;  3J7A 5;  3JAM c;  1X3E A;  4NXM L;  4OXP A;  1MIU A;  3GTJ H;  2R7Z H;  4BXX H;  3KYH C;  2UUA L;  1SN8 A;  2CFM A;  2WAQ G;  4LF6 L;  3S1M H;  1FJG Q;  3BU2 A;  4TVA B;  5GAE C;  3H0G G;  4IO9 A;  3HOU G;  3PO3 H;  2ZTC A;  4JOI C;  4JI6 L;  1VQP A;  3CCV A;  1IXR A;  3PUZ A;  2LXK A;  3HOZ G;  4QIW E;  3PIO A;  2C35 B;  4LUZ A;  3FKI H;  5IP9 H;  1G51 A;  3OTO Q;  4BY1 H;  3HFZ B;  3HOW G;  1GKH A;  1SR3 A;  1VQF A;  4DV5 Q;  4DR6 L;  3KDF A;  2PI2 E;  3NEL A;  2VL6 A;  1T9H A;  1WCM H;  5C0X I;  1XPR A;  1FJG L;  4A3D G;  5BR8 L;  4IFD G;  1HNW L;  4GKK Q;  4RMF A;  4DV0 Q;  5GAH C;  1YIT A;  3HKZ G;  2IX0 A;  4DV4 Q;  2N8N A;  3I55 A;  4B3M L;  3H0G H;  2KHI A;  3JAM i;  2Y0S E;  4JBK A;  3KF8 B;  1L2F A;  4APV A;  4DAM A;  4A3L H;  1A8V A;  3I7F A;  5IP7 H;  1HNX L;  4IJH A;  4JOI A;  1N33 Q;  3S1N H;  3W1G A;  3I2Z A;  1X65 A;  5IWA L;  2JEA I;  4GN4 B;  4GKK L;  3D0F A;  3EN2 A;  2OQ0 A;  4R4I A;  4BY1 G;  3HOX H;  3A5U A;  3K8A A;  4JBJ A;  4JI3 L;  1OXX K;  4QL5 A;  3CMA A;  2KBN A;  1M1K C;  4DV7 L;  4OWT B;  1S40 A;  4NXM Q;  4A3J H;  1N36 Q;  2BH8 A;  4A3G G;  3CPW A;  4GNX A;  4LF4 Q;  3AFQ A;  1IL2 A;  2NVT H;  2PQA A;  4LF5 L;  1Q1E A;  2IHF A;  4JG2 A;  3DLL A;  4DR7 Q;  3UDX A;  3B6Y A;  4DPG A;  1CSQ A;  5LMN L;  2ALY B;  1KC8 C;  2UUB Q;  4JYA L;  2OQK A;  2K52 A;  2I0Q A;  4BBS H;  2VQF L;  2VUM G;  2CWA A;  4JI2 L;  4LWC A;  4X65 Q;  3K0X A;  3CCM A;  2FXQ A;  1C7Y A;  4A3I H;  4EQ5 A;  1D8L A;  1QVC A;  4R1J A;  1E3P A;  1K73 C;  1IBL Q;  1VQC A;  4UP9 A;  4PG3 A;  2DUD A;  1CKN A;  1IBM L;  2UXB Q;  1Y14 B;  1PH2 A;  2UU9 L;  3FHW A;  4BXX G;  4A3F H;  4A3G H;  2KCT A;  3J81 j;  2RHQ B;  4YY3 L;  2VNU D;  2N3S A;  1W2B A;  3HOU H;  5LMU L;  4A93 H;  4X62 L;  1Q86 C;  1OXV A;  1L0W A;  3E0E A;  4YWK A;  3J80 i;  1NTG A;  1VQE A;  1NE3 A;  3BZK A;  1I94 Q;  2VUM H;  4IPC A;  2LXJ A;  4LFA Q;  5JJL A;  4X6A H;  3CW2 C;  4O0A A;  5IE8 A;  2NZO A;  5AJ3 Q;  1PH6 A;  4OX9 L;  2EQS A;  1TWG H;  2NN6 I;  2AHO B;  3S24 A;  3WWV A;  4L5R C;  4HIK A;  3EIV A;  3F8T A;  4JI7 Q;  1VQ8 A;  2NN6 G;  4LF8 Q;  4QY7 A;  1K9M C;  2L15 A;  1NY4 A;  1AE3 A;  4R4C A;  5LMN Q;  5IY0 A;  3CC2 A;  4UY8 C;  1YHB A;  4B3T Q;  3W1B A;  3G4S A;  5H1S E;  4A93 G;  2OTL A;  2B63 H;  1LYL A;  3ER0 A;  1TWH H;  2OCE A;  4BBR H;  4DV2 L;  2V1C C;  3G71 A;  4DV4 L;  1PHJ A;  4UP7 A;  1IZ6 A;  1H95 A;  1IBL L;  2PI2 A;  2K14 A;  3PGZ A;  1YIJ A;  5EAY A;  1XMO L;  4DV3 Q;  3VDY A;  3PO2 G;  1UE5 A;  4NXN Q;  4UPA A;  2RF4 A;  3E9I A;  2IX1 A;  3STB D;  2VQF Q;  2R93 H;  1VQH A;  1OTC A;  2UUC L;  1OXS C;  1VQA A;  2CQO A;  4YY3 Q;  1PH9 A;  1EOV A;  4IPH A;  4YHH Q;  2UU9 Q;  2UXD Q;  4IOC A;  2OTJ A;  3OTO L;  1GO3 E;  1HR0 W;  4YHH L;  4X64 Q;  4GOP C;  2RHS B;  1IBM Q;  3NEN A;  4IFD I;  1N34 Q;  3CP0 A;  3I56 A;  5BR8 Q;  4LF9 L;  3A0J A;  4MZ9 A;  2YTV A;  4YWM A;  2E2J H;  5C0X J;  1B8A A;  2ASB A;  1O7I A;  3I4N H;  2R92 H;  3HKS A;  5IYD H;  4DKA C;  4DV5 L;  2KHJ A;  3S14 H;  4A3D H;  1YHA A;  4A75 A;  1ASY A;  1WI5 A;  1I50 H;  1P16 A;  1Y1V H;  4GNX C;  2R93 G;  4GLV B;  4DK6 C;  4DR2 L;  4A3F G;  1FVI A;  1B7Y B;  3RLF A;  2VQE L;  2YYZ A;  1HNZ Q;  3PUW A;  1HNW Q;  2AWN A;  1PFS A;  3PUY A;  3STB C;  4HJ7 A;  2JA5 G;  4DUZ L;  1VQB A;  2WB1 E;  1I6H H;  1J6Q A;  1VCI A;  2DGY A;  1PV4 A;  3GTO H;  3S2D H;  2EIF A;  3ULJ A;  3I4N G;  4A3J G;  1A63 A;  4GN3 B;  3ULP A;  1XPO A;  4KHP L;  3A5Z B;  4KHZ A;  3Q8D A;  4GLA C;  2ES2 A;  5J3B A;  1XJV A;  1N32 L;  1YVC A;  1EUJ A;  1I5F A;  2Z6K C;  4NXN L;  4C3H H;  3UE1 A;  1NMF A;  2JJQ A;  2VY3 A;  3F2D A;  4QGU A;  2K5N A;  4BBS G;  3UDF A;  4O2D A;  3U58 A;  2D0O A;  3FP9 A;  2QA4 A;  1N34 L;  1KRS A;  2MO1 A;  3M7N A;  4JBW A;  4A3I G;  1RL2 A;  4QQB X;  1TXY A;  2R7F A;  2WFW A;  4FDB A;  4YCW A;  3PO2 H;  3KJO A;  3F2C A;  4YCV A;  1EQQ A;  4P71 A;  4JI6 Q;  4GKJ L;  2B29 A;  3U4V A;  2E2H H;  2Z0S A;  2I5H A;  3S1R H;  1JMC A;  1EIF A;  1WFQ A;  3M4Q A;  4WJ4 A;  4RG1 A;  2JA9 A;  1I3Q H;  1SFO H;  5E7N A;  1CKO A;  1KRT A;  1Y1W H;  1XTD A;  4DR5 L;  4DAY B;  4QJF A;  2JQO A;  1PH8 A;  5M5X H;  2EXD A;  5LMN W;  2A19 A;  5FLX c;  4LUO A;  2AMC B;  3HOX G;  2HT1 A;  1UE6 A;  1XPU A;  4A3C H;  3TRZ A;  1S72 A;  4JI3 Q;  2ZJP A;  4DR1 L;  1N8R C;  4LW1 A;  1K3R A;  5IYD G;  3ICE A;  4GOP A;  4YCU A;  1XMQ L;  3TS2 A;  2A1A A;  1K8G A;  3H3V H;  2VZA A;  2QEX A;  1VQ6 A;  3KFU A;  3UDG A;  1TWF H;  2CWP A;  4IFD J;  4B3M Q;  1KAW A;  2BH2 A;  1FGU A;  2F4V L;  1R9T H;  2JEB I;  3KLW A;  3UE0 A;  2JA6 G;  2QGQ A;  1SMX A;  3HOY G;  2WP8 J;  4P73 A;  3RZD H;  1BBU A;  1J5E L;  2B63 G;  3RNU A;  1FL0 A;  1UE7 A;  3T1Y Q;  2JA5 H;  3PV0 A;  4BA2 I;  1CKM A;  1SRU A;  2YV5 A;  4BA1 I;  1QZH A;  1CSP A;  2LSS A;  1SLJ A;  2JK8 A;  3GD7 A;  2YTX A;  2YU9 H;  2ZM6 L;  3GTG H;  3F2B A;  3GTM H;  1PH3 A;  4NPS A;  5C44 H;  4H02 A;  3S15 H;  4LFC L;  1Q82 C;  5JJK A;  3S2H H;  3CC7 A;  1QZG A;  2K5H A;  5FLM G;  3GTQ H;  2UUA Q;  4LF6 Q;  2HIX A;  2WB1 G;  3RN5 A;  4DUY L;  1IBK L;  1EYG A;  4ALP A;  4K0K L;  4L5Q A;  2VW9 A;  4OO1 G;  5FJ8 H;  3KF6 A;  4XTC S;  2B3G A;  1XMQ Q;  4HID A;  1KD1 C;  5IYB G;  1KIX A;  3CCS A;  2CKZ B;  1M90 C;  2R92 G;  2I5M X;  3J80 c;  5GAG C;  5GAD C;  3CF5 A;  3T1H Q;  2PNH A;  3PSI A;  1TWA H;  1VQD A;  4BY7 G;  1VQM A;  3I4O A;  1Y1V G;  1E7Z A;  1X55 A;  3CME A;  2JA8 G;  3CQZ H;  1RIP A;  1PYS B;  4DR4 Q;  1Q1B A;  4AQY Q;  1PH5 A;  2F3I A;  3K81 C;  4IPG A;  1KHI A;  4A3M G;  1HZB A;  4JBM A;  3LGJ A;  5FLM H;  3G6E A;  1Y1W G;  1HR0 L;  3K80 C;  3U4Z A;  2VQE Q;  1HNZ L;  3S16 H;  1X9N A;  4DV1 Q;  3RN2 A;  5M3M H;  1YNX A;  4DR3 Q;  1N33 L;  4DV1 L;  1HJP A;  2NVX H;  2Y0S G;  1Z47 A;  4L5T A;  4JI5 L;  5C4X H;  5IYB H;  2AKW B;  1PA6 A;  3SGI A;  2ZM6 Q;  3U50 C;  5C3E G;  3W5O A;  3BJU A;  1HR0 Q;  4DV3 L;  2ATW A;  2NZH A;  4R4Q A;  5JEA G;  2XGT A;  2YTY A;  4MTN A;  2JA8 H;  3PCO B;  4POG A;  4A3B G;  5C4J H;  3NEM A;  2JA6 H;  1XMO Q;  3HOY H;  2KEN A;  2Q2I A;  4A3M H;  1VS0 A;  1JB7 A;  2F52 A;  5HY6 A;  2UXC Q;  3MXN B;  2MNA A;  4X64 L;  2PQA B;  4KLK A;  1E22 A;  1PYB A;  1HZA A;  3ERS X;  1SE8 A;  4IPD A;  4DNI A;  3MEF A;  1KQS A;  2UXD L;  4AIM A;  1EIY B;  3K7U C;  2UUC Q;  1UEB A;  1N9W A;  5C4X G;  3PF4 A;  4R4T A;  4DR4 L;  1K83 H;  4LUV A;  3PUV A;  3I4M G;  5M5Y H;  3AEV A;  3OYY A;  4HIM A;  3G48 A;  3M4P A;  5M5W H;  3T1H L;  4EX5 A;  4DR2 Q;  3ULL A;  2XTI A;  3AYH B;  1I94 L;  2AWO A;  1ASZ A;  2JA7 H;  1HH2 P;  3EBE A;  3PIP A;  1X6O A;  1VQ9 A;  1VQN A;  4K0K Q;  2HHH L;  1PH7 A;  3TS0 A;  4LF8 L;  3D31 A;  4DK3 C;  1V43 A;  5LMU Q;  4DR1 Q;  4GKJ Q;  4JI4 L;  1EQR A;  1SRO A;  4JCV E;  3GTK H;  1MJC A;  1VQ4 A;  3KDF B;  2E5L L;  4BY7 H;  4A3K G;  4LF9 Q;  2VS1 A;  2IY5 B;  5IYC G;  4JI0 Q;  1L1O B;  1C0A A;  4JV5 Q;  2GN5 A;  1P8L A;  3ZJY C;  3GTL H;  1IYJ B;  1UE1 A;  2HHH Q;  2K75 A;  3CD6 A;  4IOA A;  1YZ6 A;  3CXC A;  1W3S A;  1JJG A;  1JJC B;  4A3E G;  1OXU A;  4JI5 Q;  4UP8 A;  2Z6K A;  4JYA Q;  1WCM G;  3T1Y L;  4B3R Q;  1HZ9 A;  4LNQ A;  4POF A;  3F1Z A;  1YBY A;  3H3V I;  1OXT A;  1XNQ L;  1CUK A;  4DV7 Q;  1PVO A;  1E1T A;  4C3I H;  5C3E H;  1E1O A;  4DV2 Q;  3HOV H;  4HJA A;  2Q2U A;  4MNO A;  1XNR Q;  1Q12 A;  1Q8K A;  3CAM A;  3PUX A;  1YHQ A;  2Q2H A;  2NVY H;  2BA0 A;  4X65 L;  4JI2 Q;  2JA7 G;  3S1Q H;  5K36 G;  1N32 Q;  1GD7 A;  2D62 A;  2UUB L;  2ZTE A;  3PF5 A;  4OO1 I;  4A3C G;  3CCJ A;  4LFB L;  3CCR A;  1WJJ A;  5FJ8 G;  4DR7 L;  4JI8 L;  4ME3 A;  4LF4 L;  1D7Q A;  5ELO A;  4HJ5 A;  4DV0 L;  1VQL A;  4IJL A;  3A74 A;  1S3O A;  3M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...