3K0XA

Crystal structure of telomere capping protein ten1 from saccharomyces pombe
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
SAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Ten1
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12658 Ten1 Telomere capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k0xA00
3I56A 2A8VA 1CKOA 1N33Q 3CMEA 3UDXA 5IYCG 3KJOA 3CCJA 3KOJA 4YHHL 4UPAA 1EIFA 4DV0L 3HOUG 4B3RQ 4JG2A 4DUZQ 5IYBH 4H02A 1I6HH 1RL2A 5FJ8H 5C0XG 2UUBQ 3PO2H 4Y52H 1IBLL 3BJUA 1UWVA 5DLQE 1XPUA 1WI5A 1L1OB 5BR8L 2YU9H 1E3PA 4WJ4A 1AE2A 3CF5A 4LFAL 3K81C 1RIPA 1JJCB 1Q8KA 3U50C 2DUDA 1TXYA 1VQ8A 3K0XA 2D0OA 1XNQQ 2ALYB 3I4MH 2JEAI 1KRSA 2IT1A 4QGUA 4PZ7A 1YEZA 1A62A 1VQ7A 3HOVG 1K0RA 1HNWL 1OTCA 3LGJA 4GS3A 4DNIA 3J81j 4A3KG 2V1CC 3S14H 1Q82C 4O0AA 5K36G 2B63G 4BA2I 2MO1A 2CFMA 2H5XA 3PF5A 2YTVA 5C3EG 1XTDA 1YJNA 4R4CA 1X9NA 2Q2TA 4AYBG 1VQLA 2PNHA 4KHPL 1B7YB 1HZCA 1VQGA 1WCMH 4L5QA 4NXNL 2VUMG 4BY1G 1PA6A 3HOWG 3RN2A 4DR6L 1Y14B 4R4IA 4JI1Q 1X54A 1Z47A 1KAWA 4GOPB 1QVFA 2Y0SE 5M3MH 1EWIA 2KHIA 4DV3Q 2IX0A 1K9MC 4LF6L 2JA6H 4PZ8A 2AWOA 1PFSA 2CKZB 2QEXA 2HIXA 4A75A 2E2HH 1TWHH 3I4NG 3PUVA 5IWAQ 1VQHA 3HOZG 1FJGL 5LMNL 3ERSX 1VQAA 4ALPA 4YWLA 4DR1L 1AH9A 3OTOQ 2HT1A 4LF8Q 2VZAA 3PCOB 3S1RH 1KIXA 5C44H 4GOPC 2R7DA 1XPRA 1VQKA 5IYBG 2WAQG 4HJAA 4JYAL 1SR3A 2Z6KA 2HHHQ 5FJ8G 2A1AA 2PQAB 2UUAQ 3PO2G 2JK8A 4R4OA 2IX1A 2K5VA 1NE3A 2F3IA 2RHQB 4IPHA 3S1MH 4DR3Q 1HNXQ 3UDGA 4X6AH 4DV1Q 4MNOA 4LF9L 5FLMG 1XMQL 2N78A 4B3ML 3I4MG 3E9HA 3KDFB 3KJPA 1YIJA 1OXXK 1MJEA 3OW2A 3ULLA 4JI4L 4YCVA 4X62L 1KD1C 1A8VA 3CPWA 1NMFA 2I5MX 4PG3A 3WWVA 4YY3Q 5H1SE 3KYHC 3CCRA 1S72A 4LFBL 1T9HA 4GLXA 3CPFA 2R92H 2UXDL 3A74A 4POGA 1WCMG 5IYCH 3A5UA 4O2DA 3H3VI 1NTGA 2BA1A 4BA1I 1FVIA 1HH2P 1S3OA 2CQOA 3JAMi 1VCIA 3M9BA 3CCMA 4A3IH 2UUCL 4BBSG 3MEFA 4LUVA 1XNRL 1C7YA 3S16H 5M3MG 1FL0A 4DV0Q 2JA6G 2I5HA 1EFWA 1XJVA 1V9PA 1YHBA 4AQYL 1CKNB 1N34L 1PV4A 5IE8A 4GNXB 4KLKA 5EAYA 1KQSA 4BXXH 1TWGH 4C3JH 1A63A 2KBNA 4DK6C 1EYGA 1IBLQ 5BR8Q 1QUQB 2VQEL 2PMZE 3CQZH 2NZHA 2E8GA 4LF5Q 3HOVH 3HFZB 4XIGS 3E9IA 4JOIA 4R4TA 3CC4A 2AMCB 4JI0L 1HZBA 2JEBI 1PYSB 4IO9A 1KRTA 5J3BA 3FKIH 1SLJA 5C44G 3RN5A 3T1YQ 1VS0A 1WOCA 1W2BA 2B63H 1PH3A 1HNWQ 1JE5A 1VQBA 1Q7YC 2K5NA 2UU9L 2PI2A 3G48A 1XMOL 4GNXC 3GDEA 3CAMA 4BY1H 3HOWH 3W1BA 1R9TH 2XGTA 1C9OA 1LM0A 1WFQA 2K75A 2OQKA 4X64L 1YHAA 3F2BA 1K73C 1L1OA 2JA7H 1Q81C 4DV6L 1G291 2AWNA 3BZCA 3HKZE 4A76A 1JJ2A 4DV4L 3GTGH 4HIKA 4JI3Q 4HIDA 4JBKA 5JJIA 5LMNW 3CCEA 3S24A 1EQQA 1O7IA 4BY7H 4LF6Q 2F52A 2LXJA 4LUOA 3UDFA 4A3FH 2ZM6Q 5GAHC 4DR2L 2R92G 1PH6A 3CCSA 2NVXH 4OX9L 2EQSA 4P71A 4IJLA 3G6EA 1VQCA 1Q1BA 3JC66 2VW9A 1FJGQ 5LMNQ 2IHFA 4A3IG 2DGYA 1K3RA 3I2ZA 3A0JA 5C0XI 4HIMA 4DAYB 3M4QA 2KCTA 1SE8A 4K0KQ 1P16A 4PMWA 3J80i 4GOPA 3TS0A 4OWWB 3I7FA 2UXBQ 1OXSC 3ZJYC 4A3DH 1M1KC 1UE1A 3GTPH 2JE6I 4XTCS 1YITA 4BXXG 1A0IA 3S1NH 5FLMH 5LMUL 2OTLA 2IY5B 3G71A 1KL9A 1N9WA 2AKWB 5FLXc 4WJ3M 3AFQA 2YV5A 1QVCA 4GKKQ 3UDIA 4LF4Q 1MIUA 2WFWA 4DAMA 4B3SL 1D7QA 4YCUA 4DV2L 3FKIG 4JBJA 5JEAJ 1KC8C 3K7UC 4B3TL 2Q2UA 3PO3H 4LF7L 3EIVA 4JI4Q 3S2DH 4DR4L 3L0OA 2R7ZH 1N32L 3RLFA 1UE6A 4GKJL 2JQOA 4JCVE 4PZ6A 3STBD 2ASBA 2K52A 2PQAA 4BBSH 2JJQA 2Q2HA 1X65A 1AE3A 5HY6A 2WP8J 5ELNA 1VQNA 2JA7G 4QL5A 1J5EL 2UXDQ 1CSPA 3AYHB 4JI8L 2N8NA 1N36Q 1JB7A 4X65L 3H15A 1LYLA 4DR5Q 2UUCQ 2WB1G 1PH8A 1GO3E 3KDFA 2XTIA 1PH4A 1SFOH 4LFCL 3KF8B 4BY7G 4A93G 4P75A 2JA5H 1BBUA 2HQLA 5GAGC 2EIFA 3VDYA 4A3FG 1S40A 1SN8A 2F4VQ 1IYJB 2ZJRA 1LUZA 1L0WA 3PIOA 3BU2A 1Y1VH 3I55A 1VQDA 4DUYL 3HOYG 1BVSA 2CWPA 3D0FA 5IT9c 2CWAA 4DR7Q 2Y0SG 2UXCL 2RF4A 2A19A 2WAQE 2L15A 4NXML 1I3QH 4GN4B 4JBWA 5AJ3Q 2IHEA 4A3DG 4DV5L 1N33L 5JEAG 1CKMA 2UU9Q 1PH1A 1CKNA 1JJGA 2I0QA 4GNXA 3PSIA 4JV5Q 4B3RL 1E1OA 4DUZL 3S17H 1HNZL 2B3GA 4A3CH 1QUQA 1X3EA 4DPGA 2KCMA 5HGQA 1I94Q 3UE0A 3EN2A 1K83H 4DV6Q 4JI2L 2OTJA 1H95A 2YYZA 4JI5Q 1W3SA 1PH5A 3PO3G 2E5LQ 3K8AA 3NENA 4IPGA 2R7ZG 3E0EA 1UE5A 4A3BH 2FXQA 4LUZA 4IFDI 1VQIA 4C3IH 1PH7A 1L2FA 2LXKA 4A3LH 4OX9Q 1V1QA 4YHHQ 3A5ZB 4MZ9A 4P72A 5C4JH 1UEBA 3L2PA 2OQ0A 2R6GA 4IOAA 4OWTB 1N8RC 4A4IA 2JA5G 4JI1L 1MJCA 2VY3A 3PUZA 3CW2C 1NBWA 2EXDA 4LW1A 4MTNA 4LFAQ 3J81c 1JMCA 4OONA 2KHJA 4A3JH 1J6QA 4IJHA 1Y1VG 3CD6A 5IP9H 4DV3L 4DK3C 3UE1A 1HR0L 1VQ4A 5IYDH 1IBKL 1X3GA 5GQOA 3M85A 1E1TA 3ULJA 5IP7H 4C2MH 5M5XH 3F2DA 3HOXG 5IWAL 3CCUA 1Q1EA 1PVOA 3CCQA 4Y7NH 4B3TQ 4YWKA 4HJ9A 4DR4Q 2YTXA 4KHPQ 4LF8L 2BH2A 4NXNQ 4GKJQ 2E2JH 4QQBX 2N3SA 4IPCA 1YNXA 1IXRA 3NBHB 4APVA 4DV7L 4DR6Q 3NEMA 3PUYA 3W1GA 1GD7A 3GTLH 1CSQA 2Z6KC 4A3CG 4KI0A 2UUAL 2ZJQA 3CXCA 3GTJH 1KXLA 1G51A 4A93H 1E22A 3PV0A 4X65Q 1Y1WH 3T1HL 2MO0A 1PHJA 4A3MH 4NB3A 1YZ6A 1U0LA 1WYDA 4IPDA 4POFA 4JBMA 3S1QH 3KF6B 4KHZA 2VNUD 3CMAA 4A3EH 4A3GH 4RMFA 2R7FA 3HOYH 1B70B 4A3BG 2QGQA 1IBML 4DR1Q 4OO1G 4A3LG 3EBEA 4X66L 1OXTA 3RR5A 2UXCQ 3CC7A 4JYAQ 3B6YA 4HJ5A 1TWAH 1X6OA 2VQFL 1QZHA 5M3FH 1V43A 2CCZA 2NN6G 1BBWA 1SMXA 1K8GA 3J7A5 3J7ZC 2B29A 1PH9A 4DV5Q 4J15A 2K14A 4UP7A 4A3JG 2ATWA 4GLVB 1VQJA 3F1ZA 3K80C 1XMQQ 1YI2A 1CUKA 5IP9G 2D0PA 5IYDG 4HIOA 2OWOA 4B3MQ 4JC0A 4JI6L 1C0AA 1QVGA 4UY8C 4TVAB 3PUXA 1HNZQ 3MXNB 4BBRH 1OXUA 5GROA 3CCVA 5IP7G 1NJIC 2RHSB 4X62Q 1K8AC 2NVYH 3GO5A 5ELOA 4JI2Q 2ZTCA 3H0GH 4YWMA 2AHOB 4AYBE 1IL2A 3TEHB 4LFBQ 4LF5L 2E2IH 2HIVA 2R93G 3PUWA 4JOIC 4UP9A 1KHIA 3GTQH 3S2HH 5C4XG 2ZTDA 4IOCA 3RLNA 3K7AH 1B8AA 3T1YL 3GTMH 2K50A 4R4QA 2GVBA 4GN3B 2ZTEA 1VQ9A 1XNRQ 2WB1E 1X3FA 3SGIA 4UP8A 1Y1WG 2QA4A 2NZOA 4AQYQ 4A3MG 1N34Q 1HR0W 3TRZA 2BH8A 1L1OC 2JA8H 3GTKH 4DKAC 4EQ5A 4A3EG 3H3VH 4A3GG 1VQ5A 2VQEQ 1HZ9A 4JI7L 4JI3L 1U5KA 3RNUA 2LSSA 2VS1A 3AQQA 4JI0Q 1LTLA 3HOXH 1HR0Q 1QZGA 1SROA 1ASZA 1IBKQ 1WJJA 2ZM6L 4HJ7A 1IZ6A 1XMOQ 1X56A 5M3FG 4IFDJ 2PI2E 2YTYA 1MKHA 5IY0A 3U58A 4X64Q 2K5HA 3CCLA 3RZDH 1SRUA 2UUBL 1M90C 3F8TA 4K0KL 2UXBL 4DV7Q 1NY4A 1YJWA 4GN5A 3PGZA 4DV4Q 4C3HH 4LF9Q 4BBRG 3ER0A 3JAMc 3FP9A 4QIWE 1Q46A 3RZOH 4NPSA 5GADC 3TQYA 1XNQL 5JJKA 3H0GG 1FGUA 3M4OH 3T1HQ 4P73A 5GAEC 3U4ZA 1YJ9A 2RCNA 4GKKL 1HZAA 3OYYA 4LF4L 4DR2Q 3FHWA 2GVAA 1E24A 2ID0A 4OXPA 5E7NA 1EIYB 4OWXB 3U4VA 1HJPA 1I50H 1IBMQ 2MFIA 4LWCA 3PIPA 1GVPA 5M5YH 1BKBA 1VQ6A 2BA0A 3TREA 3S15H 1EOVA 3G4SA 2D62A 4L5TA 4X66Q 4AIMA 2NVTH 3TS2A 1EQRA 3STBC 4GLAC 3NELA 4QJFA 2JA8G 1X55A 5C4XH 2VQFQ 5JJLA 5LMUQ 3HOUH 1GKHA 4ME3A 1N36L 3CP0A 2ES2A 3KF6A 2C35B 3RLOA 4DR5L 3CC2A 5M5WH 3KLWA 4EX5A 4IFDG 4B3SQ 2Z0SA 1VQFA 1Z9FA 1Q12A 4QY7A 1D8LA 4DV2Q 4JI6Q 3M3YH 1DGSA 2MNAA 4LF7Q 4TQUS 2GN5A 2N49A 3OTOL 4L5SA 2F4VL 1N32Q 4RG1A 2R93H 2VL6A 4FDBA 2Q2IA 3L7ZC 2KENA 1G6PA 1YBYA 1YVCA 5C0XJ 4DR7L 1P8LA 2HHHL 3D31A 4A3KH 1VQPA 1J5EQ 4AH6A 4HJ8A 4L5RC 1I5FA 4JI8Q 5AJ3L 1VQMA 1ASYA 2NVQH 1UE7A 5C3EH 3J81i 3PF4A 4DR3L 1HNXL 1E7ZA 3BZKA 4DV1L 4P74A 3F2CA 3GD7A 3GTOH 3ICEA 2VUMH 4LFCQ 3M4PA 4JV5L 1JT8A 2OCEA 4YCWA 3DM3A 1EUJA 3J80c 4R1JA 3AFPA 2K4KA 2MQHA 4OO1I 3DLLA 3ULPA 3HKSA 3HKZG 1PH2A 1I94L 3KFUA 1GM5A 1TWCH 2I5LX 1PYBA 4DUYQ 2JA9A 1VQEA 4JI5L 1OXVA 4YY3L 4JI7Q 3AEVA 1VQOA 2E5LL 3I4OA 1XPOA 1YHQA 3M7NA 2ZJPA 1NMGA 3IRBA 1TWFH 4NXMQ 3I4NH 3HOZH 2NN6I 1Q86C 4LNQA 3Q8DA 3W5OA
chains in the Genus database with same CATH superfamily
5C4ZA 4KKUA 2A8VA 1CKOA 1N33Q 3UDXA 3KOJA 2LS01 2Z4HA 1H9MA 3TZDA 4H02A 3I4MB 2FJ2A 5C0XG 2UUBQ 3BDCA 4OELB 2F0OA 1UWVA 4WJ4A 3EQLC 3W2DA 2DUDA 3K0XA 3I4MH 2IT1A 2R7ZB 1CM9A 1HRJA 1ET6A 2IX3A 2H4OA 5K36G 4BA2I 2MO1A 2H5XA 4FF1A 1WD0A 5CV4A 1XTDA 1X9NA 2Q2TA 2JSOA 1WCMH 2VUMG 1R4PB 4BY1G 1PA6A 4DR6L 1U4RA 1TWHB 3KBXA 4KJNA 1KAWA 1S5DD 1RTOA 1GUOA 3OIQA 4RGTA 2XRQD 2M9VA 1PFSA 2CKZB 2A69C 1XYIA 2E2HH 1TWHH 3GP7A 3ERSX 1JB3A 4K6DA 4ALPA 2HT1A 3A7AB 3MTSA 2VZAA 3S1MB 4L63B 4GOPC 1VQKA 2ICIA 1SR3A 4TRDA 2HHHQ 2A1AA 2UUAQ 4ID6A 1QNKA 1SNDA 5J22A 3H3VC 4CDCC 3GV6A 3S1MH 1HNXQ 3CKIB 4KD4A 4X6AH 4G7HC 4B3ML 2MHVA 2EPBA 3S9WA 3E9HA 3VR4A 2BDOA 3OIPA 1JWMD 4JI4L 2EYJA 3QR8A 1DONA 1NMFA 2I5MX 3HS0C 3WWVA 3R3OA 4YY3Q 3CCRA 4LFBL 2UXDL 3A74A 5ELFA 4QUFA 5EBCA 5C4JB 4O2DA 2B39A 4BBSG 2UUCL 1ONLA 5HURA 4DV0Q 4OGQC 2NTTA 1EFWA 1V9PA 1Y8PB 2A74C 5IE8A 1UAPA 2HQEA 4BXXH 4DK6C 1EYGA 1NNXA 1F9RA 4C2MB 1BBXC 1BDOA 4XIGS 3EROA 4JOIA 4Y7NB 4FF4A 4KKSA 2JEBI 1I4GA 3FKIH 2QW7A 1EY8A 2FMCA 1HNWQ 4DAPA 2UU9L 2A6HC 1WVLA 4GNXC 2N88A 1XMOL 4BY1H 4H44C 2XGTA 1C9OA 2OQKA 1YHAA 4A93B 1U4PA 4DGZA 2LKVA 2RVLA 3NHHA 4TSSA 4JK1C 1Q81C 3VYTA 1EEID 4RKLA 5JJIA 3LWUA 4HIKA 1RDPD 3E0JA 1KDCA 1FR3A 1EQQA 2LXJA 3UDFA 1SNQA 5GAHC 3TP7A 3CCSA 3D6CA 2EQSA 5DEHA 4FF3A 1B4OA 4FVMA 1HQMC 2IHFA 4CDDC 5IODA 3NWTA 5J39A 4PNYA 5IGEA 4DAYB 1JORA 3ND9A 1P16A 4PMWA 5IGGA 2UXBQ 3TS0A 4R9WA 4A3DH 1CA5A 2JE6I 3D6WA 3PO3B 2SOBA 2AKWB 4WJ3M 4GKKQ 5CYUA 5CGKA 4B3TL 2RDFA 2Q2UA 3PO3H 2EY2A 3K57A 1WTPA 2JYOA 4KKTA 1BCPC 2K52A 4BBSH 5HY6A 2WP8J 3VR5A 2J4XA 3QJYA 3AYHB 4JI8L 1JB7A 1NUCA 4X65L 1PH8A 1GO3E 5FO7B 2Z9HA 2XTIA 3KLSX 1PRTC 1QG7A 3IL8A 5GAGC 2HQLA 1S40A 1LTTD 1SN8A 2F4VQ 3AMUA 1IYJB 2EYFA 1LUZA 3ITPA 4K5WA 1L0WA 3SE0A 3VYUA 2G9HD 3MXPA 4IZ8A 3SK6A 2K03A 1CI3M 2CHBD 1H9SB 2CWAA 2RF4A 2BE5C 3A8JE 4NXML 1OO9B 2PZTA 2QEJC 3RUZA 1IL8A 5I4DA 1LT4D 2IHEA 4DV5L 2B2VA 1CKMA 1I4QA 3DXJC 1KDAA 4DUZL 3M4OB 2B3GA 1NR2A 5FOBB 4DPGA 2A68C 4DV6Q 1D5ZC 2OTJA 1H95A 2WACA 3R2TA 5FK9C 2E5LQ 2K6AA 4IPGA 1I50B 3E0EA 4LAAA 3LNNA 3MFGA 3U9SA 1L2FA 2NVTB 2LXKA 5LL6X 1E0BA 5IT9E 4OX9Q 1V1QA 4LMQD 4IUTA 5BN4A 4K8IA 1QE6A 5M5WB 4OWTB 1JWUD 5EQ0A 4PMCA 1DYQA 2RCFA 1J6QA 1PZJD 4DK3C 3LWEA 4V190 1IBKL 1UUPA 2B2TC 2VB2X 5IP7H 3F2DA 1PVOA 1SNOA 4YWKA 4DAYA 3OMCA 4RHRA 2NYZD 3CRKC 2N3SA 1IXRA 4DNRB 4APVA 4K8JA 4DV7L 4DR6Q 1O7LA 4HSPA 5JVG3 1TIID 3NUCA 3W1GA 3GTLH 1CHPD 1VF7A 2Z6KC 2AQ3B 4KI0A 3CXCA 1G51A 1WTRA 1C48A 1AZQA 2MO0A 2A69D 4A3MH 4C3HG 1TWCB 4JBMA 4LK1C 1HHVA 3J81E 1D5MC 4A3BG 1T5XD 2E75C 3DM1A 1Y8OB 1Q8IA 2EJGC 3H91A 5KYIA 3VA5A 4HJ5A 3BYYB 2PZUA 1I6HB 1QZHA 2EVBA 1PH9A 1D2BA 1EQVA 1MSHA 2B2UC 4A3JG 5C4XG 1VQJA 3F1ZA 1YI2A 1CUKA 4HIOA 4B3MQ 3S2HB 3FMCA 2F0VA 4UY8C 1HNZQ 1STHA 4MTKA 1NJIC 1DD2A 1H9SA 5ELOA 1IL2A 1IW7D 4LFBQ 4XQJA 5KRUA 2HIVA 4HMJA 3S2HH 3RLNA 1B8AA 1KAAA 3PIO3 4GN3B 2ZTEA 3MHBA 2F0EA 1IKMA 2RDHA 5KNDA 2BH8A 3KK7A 3GTKH 1ZXTA 4IQZA 4A3EG 3Q24A 3T53B 2EYMA 2JXMB 1RKNA 1LTLA 1PZID 1FNUA 3C3LA 1ASZA 1RCVD 1IZ6A 1BO0A 1XMOQ 5M3FG 4X3TA 1X3QA 2YTYA 5IY0A 1ILPA 1HA6A 2PQEA 2O2LD 3N6RA 4ZKCB 3NSWA 2UUBL 1XWEA 1M90C 4K0KL 1NY4A 4GN5A 4C3HH 3TP8A 1DOLA 1B9NA 3ER0A 2DNEA 1LACA 3FP9A 4K5VA 4L8JA 4NPSA 5EKKA 4Z9CB 3SDZA 5JJKA 1FGUA 2XVSA 5GAEC 1YJ9A 3TN2A 2MP1A 3NWSA 3URYA 3A8KE 1E24A 2MGSA 4OXPA 2R92B 4OWXB 3MWYW 3U4VA 3K5MA 3HOUB 2SNSA 4LWCA 5CORA 4ZUJA 5M5YH 1IYVA 1EOVA 3LX0A 1AN8A 4L5TA 1NCVA 1LT6D 2F0MA 3NELA 3I72A 4H13C 4QJFA 2JA8G 4CJ1B 1SYBA 5C4XH 5JJLA 1KLUD 3HOUH 4ME3A 3CP0A 4C3JB 3K6OA 4DR5L 3EVQA 4EX5A 2Z0SA 1VMCA 3JAME 1XXGA 1Z9FA 3SK8A 1AZPA 1Q12A 1D8LA 1C4QA 3VYSA 2KJXA 5IOCA 3BDOA 3NTKA 1GJXA 2F0JA 2NVQB 4RG1A 1TY2A 4FDBA 4I7ZC 1G6PA 1YVCA 2B2YC 2SNMA 3SK5A 4DR7L 1P8LA 2HHHL 1R9TB 3KLSA 4HJ8A 1B2TA 4L5RC 1TY0A 3FDTA 3OOCA 4JI8Q 5AJ3L 2NVQH 2XSCA 3PF4A 3E6ZX 1HNXL 1PRTD 3BZKA 4P74A 3F2CA 3GD7A 3GTOH 3GTGB 3DWQA 4QMGA 5EKIA 3I91A 4R1JA 2K4KA 3HOZB 3DLLA 2F4IA 5KYLA 3HKSA 1LTAD 1AW7A 1A3VA 1PYBA 2PW5A 4JI5L 4YY3L 3OSOA 4JI7Q 3AEVA 3KUPA 3I4OA 1XPOA 4ME5A 1NMGA 4NXMQ 3HOZH 2NN6I 5IIFA 1QOHA 3Q8DA 3W5OA 2XRSD 1ENFA 3I56A 5L37A 3CMEA 2G9DA 5CMDA 4DV0L 5DNFA 4KD3A 4XQQA 2K1BA 1S5FD 4JG2A 4DUZQ 1EY9A 3CHBD 4KY6A 1SNPA 2FMMA 3BJUA 1ML0D 1L1OB 1PLFA 2CVRA 1RJTA 3CF5A 1RIPA 2FINB 4RHSA 3J80E 1VQ8A 1TXYA 1QILA 2D0OA 1PTOF 4PZ7A 1VQ7A 1A62A 1HNWL 1OTCA 4GS3A 4E6IA 4U673 1A6XA 4DNIA 2I46A 3V05A 4OIJA 4EQNA 1FYCA 3PF5A 4R4CA 1K8OA 5CV6A 4AYBG 1VQGA 4L5QA 3NP8A 3RN2A 1Y14B 4R4IA 5ELCA 2J7ZA 3W3AA 4GOPB 1SBBB 4WORA 2Y0SE 3C2PA 1WTHA 5M3MH 4B9XA 2AWOA 5C44B 3TDQA 1VQHA 5C5LA 2KA7A 3RMHA 3GV3A 1M8AA 1AH9A 1O78A 3OTOQ 1PTOD 4XXEA 1KTKA 5E4WC 4KN4C 1U4LA 3S1RH 1KIXA 1WTWA 5C44H 1UEAB 3HGBA 3S17B 2JK8A 2IX1A 1ILQA 3PIP3 1K83B 3ERQA 4DR3Q 1II3A 3UDGA 3I4MG 3KDFB 5IGDA 3KJPA 1ENCA 4J6HA 3ULLA 2Z6BA 1A8VA 3CPWA 2F0HA 3S16B 4GLXA 4ZCKA 3CPFA 5C6AA 1WCMG 1MHWC 1JCKB 1FVIA 3SXHA 2CQOA 3CCMA 1LTBD 1SMYC 1XNRL 4N9TA 3S16H 1FL0A 1YHBA 1ICFB 4GNXB 2GA4B 4F8MA 2CH4A 1K8MA 1IBLQ 1QUQB 2PMZE 2E8GA 4ODGA 2K5DA 3SVMA 4R4TA 1HZBA 5AFWA 4IO9A 1HTLD 3RN5A 2JA7B 1W2BA 1WOCA 4IUNA 1CQFA 1PH3A 2CQAA 4B08A 2PPBC 2K5NA 4H0LC 2PI2A 3VR3A 2RDGA 1G2SA 1LM0A 3F2BA 1Y1WB 1K73C 1L1OA 2JA7H 2F0WA 3K59A 4ZQ3A 4DV6L 1JJ2A 2F0SA 4A3GB 2EY1A 2N55A 3TP6A 5CV7A 1O7IA 4BY7H 3KBGA 4A3FH 4CJ2C 3G6JB 4DR2L 3R2IA 3FPPA 2NVXH 4OX9L 4P71A 4DFAA 3G6EA 1VQCA 1Q1BA 3JC66 2VW9A 2EDGA 3DEPA 1TWAB 2DGYA 1K3RA 1FGBD 3DEOA 4K0KQ 4GOPA 4OWWB 1OXSC 4KN7C 1F77A 3ZJYC 1EIGA 1UE1A 4QIWB 4BXXG 5CBEE 2IY5B 4BBRB 2OTLA 1E2VA 2YV5A 1QVCA 2DNCA 1MIUA 2WFWA 5FKAC 4DAMA 4B3SL 1ET9A 3FKIG 3FPUB 1SYCA 1PRTB 4LF7L 1CTMA 3L0OA 2R7ZH 4ZAIA 1UE6A 4MN3A 2JJQA 1X65A 1LABA 2JA5B 3MEHA 1J5EL 2PCFB 5T1IA 2N8NA 3H15A 1Y1VB 4DR5Q 1ZKOA 3KDFA 1PH4A 4TKOB 4LFCL 2KOLA 4A93G 4P75A 2JA5H 1BBUA 2EIFA 2ZJRA 1Y1VH 1VQDA 4KK7A 4MIUA 4DR7Q 4RGMA 3WDNA 4JBWA 1QNUA 5AJ3Q 1HCZA 2VB3X 4CDFC 1V1OA 2WV6D 3IAYA 4A3DG 1PH1A 2I0QA 4GNXA 1SJHD 1HNZL 1STGA 4A3CH 1QUQA 2KCMA 1YNJC 1HPCA 2YYZA 4JI5Q 3QIAA 2PO4A 4CDEC 3PO3G 4HR7B 5C3WA 1Z7TA 1UE5A 4PQXA 2M2LA 2FXQA 2EY5A 1VQIA 1WTVA 2KEEA 4JW0A 4J1MA 1EOTA 2Z8LA 4P72A 1UNSA 5C4JH 3DWPA 1EY0A 2R6GA 2RBMA 3OW7A 1ZYRC 1N8RC 4ILWA 1KABA 2EXZA 2NN6H 2AQ2B 4JI1L 1PTOB 2EXDA 2K5QA 5IYDH 2R93B 1CZWA 2E74C 5GQOA 3M85A 3ULJA 2RKSA 4BS9A 4C2MH 1PTOH 5IWAL 3O13A 2EYOA 4Y7NH 3GTJB 4EQPA 4DR4Q 2YTXA 3CU7A 4LF8L 4G7OC 4GKJQ 2FFKB 4QQBX 3D4WA 4IPCA 3NEMA 1TKWB 3PUYA 3NTIA 1ENAA 1CSQA 2A5HA 3T13A 3GTJH 2SEBD 3C46A 1KXLA 4A93H 2L55A 1E22A 2O4XA 4NB3A 1YZ6A 4IPDA 4G57A 4R8NA 5I6WA 3KF6B 4KHZA 3CMAA 3FVQA 1KNAA 2R7FA 1B70B 2C5CA 2PZWA 5JOBA 4QCLA 2R3ZA 2L1BA 4CBVA 2L0CA 4RFBA 4HN7A 1BR9A 1OXTA 3VA7A 2LY7A 3B6YA 4CKCA 1DM0B 2CCZA 3J7A5 1SMXA 5IGCA 1K8GA 1G91A 3H0GB 4J15A 2YU9B 2ATWA 4UP7A 5CV8A 1RD9D 4CKEA 3I8ZA 1QVGA 1X3PA 1TR5A 5GROA 5IP7G 4NDXA 4XT3B 4JI2Q 3A7LA 2F0TA 3H0GH 2AHOB 1F9PA 1CT1D 4JOIC 4UP9A 2ZTDA 4X3UA 2K50A 2NBFA 3X3NA 4R4QA 4IALA 4KY7A 1VQ9A 1XNRQ 1G8ZD 4RKBA 4UHVA 5FO8B 4FXGC 1DOKA 1X3FA 3SEBA 4EGVA 2NZOA 5DM63 5EGTA 4A3MG 5FLXE 3K0YA 4JI7L 1EY5A 1KDBA 2ZXOA 3ZYYX 3AQQA 4ULLA 1HR0Q 4HCSA 4K2KA 1QZGA 4C1NK 1WJJA 4DNTB 2ZM6L 1NSNS 1Z6HA 1LT5D 3UI2A 1FD7D 2O5JC 3U58A 3NBIA 3BDLA 3RD4A 4X3KA 2AQ1B 3HKZB 3PGZA 3SHLA 3WOEA 5GADC 3M4OH 3H6MA 1GHKA 4N8FA 3T1HQ 3MC0B 4P73A 4DR2Q 2OT2A 3VR6A 1QJOA 2GVAA 1I50H 1IBMQ 2MFIA 3BVGA 1GVPA 1JR0D 4X66Q 2NVTH 3STBC 2VQFQ 2OXPA 2X6GA 1GKHA 2ES2A 3KF6A 2C35B 4ZUIA 2EYLA 3RLOA 3CC2A 5M5WH 3NXWA 1EZ6A 2B2UA 3KLWA 5CV5A 4B3SQ 3CQZB 3HOVB 3X3MA 4PMBA 4RWSC 1GHJA 4A3KB 2BOSA 1DGSA 5JPNC 2MNAA 4LF7Q 2B63B 5A35A 3OTOL 4L5SA 1TT2A 1JOQA 5C3EB 2Q2IA 4XYOA 2KENA 3QOLA 3MZ5A 3K5NA 3HOWB 3D31A 4A3KH 1J5EQ 4AH6A 1I5FA 1ASYA 5C3EH 1EY7A 1F2ZA 3J81i 4DR3L 1E7ZA 2B8FA 4LFCQ 2QKIC 4JV5L 2OCEA 4YCWA 1CK1A 1TWFB 2AUJD 3AFPA 3I4NB 2MQHA 3AU7A 4OO1I 2RQXA 1HUMA 3EJIA 1B9MA 1I94L 3KFUA 1TWCH 3I4LA 5I9OA 1VQEA 1OXVA 3K5OA 1VQOA 1YHQA 3M7NA 2ZJPA 1TWFH 4EQOA 4RA8A 2WAQB 3I4NH 4LNQA 4CHTB 3PO2B 2VXWA 1MBYA 5IYCG 3KJOA 4YHHL 4UPAA 3HOUG 1PYWD 3ND8A 2KCNA 5IYBH 1I6HH 1YNJD 1DJRD 1Q3LA 1RL2A 2F1MA 5FJ8H 3PO2H 4Y52H 2K04A 1IBLL 4K14A 1XPUA 1WI5A 2DN8A 4LFAL 3K81C 1JJCB 5F2DA 5A2QL 1EYDA 2JEAI 4QGUA 2IJ0A 1K0RA 3J81j 1KLGD 3P7JA 1Q82C 2CW0C 2CFMA 3MXGA 2YTVA 1W6KA 2K32A 5BN5A 2JA6B 1ZYRD 4JPBW 1B7YB 4NXNL 5EPLA 1SFOB 4JI1Q 1X54A 3QO2A 1EQTA 4OL7A 2LMCB 1EWIA 3FEWX 1XX8A 2IX0A 2JA6H 4PZ8A 3NPPA 4BWGB 1HTPA 3HG9A 4XYQA 2QEXA 3J7AV 2A6HD 2HIXA 2K5WA 1SYGA 2RSOA 1SYEA 5IWAQ 3HOZG 3P1HA 1EYAA 4DR1L 1I4RA 4LF8Q 1SYFA 3E5SA 3PCOB 2R7DA 3TZUA 4HJAA 1X32A 5J1ZA 4JYAL 2NWGA 5IGBA 3T16A 5I9PA 1NE3A 2Z1CA 1BXTA 2F3IA 1SE2A 1BCPF 4IPHA 3J7YW 1YNNC 4DV1Q 2CH4W 1MD2D 2N78A 1EU4A 2PNRC 2EOTA 4ZLTF 3A55A 3D4DA 4YCVA 3V2TA 4A3IB 1PRTF 4PG3A 5H1SE 3KYHC 1SNCA 1T9HA 1DZ1A 2R92H 4POGA 5IYCH 2BA1A 4V0BA 3JAMi 1HH2P 1TWGB 4A3IH 1QB5D 1VCIA 3M9BA 5D65A 3MEFA 4LUVA 1C7YA 5M3MG 3L9AX 4AQYL 1T5EA 5KIXA 1GUSA 4KLKA 4DF7A 1F9QA 1TWGH 1BCPD 4C3JH 1A63A 1I4XA 5CBAE 5BR8Q 4RCNA 2VQEL 5M5XB 2NZHA 3HFZB 3E9IA 3CC4A 4JI0L 2A73B 4G4KA 5C44G 1VS0A 2B2WA 3SR1A 1VQBA 4CGYB 1GXDC 3G48A 2K33A 2WB1B 3CAMA 3GDEA 3W1BA 1R9TH 1WFQA 2K75A 1A15A 2TMPA 1EU3A 1SYDA 4IUVA 4DU9A 2AWNA 3S1QB 4FXDA 3HRZC 2BE5D 2JP1A 2L4NA 3GTGH 4JBKA 3HOYB 1LTSD 2Y0SB 1JOOA 4LF6Q 2ZM6Q 3E3XA 1PH6A 2IL8A 4IJLA 2QDLA 1SXTA 4I65A 3BVMA 3GTPB 1FJGQ 5LMNQ 2F0QA 2Q8RE 2EYHA 2A68D 3I2ZA 5C0XI 4HIMA 3M4QA 2KCTA 3J80i 3I7FA 3GTPH 4XTCS 1A0IA 3Q0AA 1KL9A 1N9WA 5FLXc 3AFQA 2IPKD 3UDIA 4WFN3 1GOZA 1ICWA 1JICA 4YCUA 2E2IB 1EFID 4DV2L 1KC8C 4JBJA 5JEAJ 3K7UC 4HTHA 2HD3A 4FP5D 2L5TA 5DM73 3EIVA 3K7AB 2XWBB 3GTMB 4DR4L 3M7GA 4WRDA 3RLFA 1JC7A 4GKJL 3CRLC 1DOMA 5BN3A 4PZ6A 3STBD 1NR4A 4CJ0B 2ASBA 3MXUA 4RAUC 1Y8NB 5FO9B 1CA6A 1AE3A 2JA7G 4QL5A 1CSPA 1GUWA 3J7AF 1G2TA 4HSVA 2PW7A 2WKDA 1HXYD 1LYLA 3KF8B 4WJWA 3GQBA 4BY7G 4A3FG 1TU2B 3VDYA 2KEDA 1I3QB 3HOXB 3BZDB 1I4HA 1K28A 3PIOA 3I55A 4DUYL 3D0FA 5IT9c 2PMZB 1DCZA 2A19A 2A6EC 2L15A 1I3QH 4GN4B 3RZDB 4N9PA 4DXFA 1WTQA 1SDFA 3HZXA 5D14A 5JEAG 1JJGA 3PSIA 4JV5Q 4B3RL 3S17H 1GUNA 1O7ZA 1I94Q 3UE0A 3EN2A 1K83H 4C3IB 4JI2L 3DHQA 2D2CC 3K8AA 3NENA 2R7ZG 4G7ZC 4RCOA 3S15B 4LUZA 2D5DA 1PZKD 4IFDI 4C3IH 1BNZA 4OO1H 4A3LH 5KGUA 4O42A 4YHHQ 4R8IA 4MZ9A 4DK0A 1UEBA 3L2PA 4IOAA 3VR2A 3NTHA 3N52A 2K01A 2JA5G 4LW1A 2VY3A 3PUZA 3CW2C 2ZT9C 4MTNA 4LFAQ 3J81c 3M3YB 1Y1VG 5IP9H 4DV3L 1HR0L 3KLRA 3UE1A 1VQ4A 1X3GA 1E1TA 4M1UB 1S5ED 1O7YA 2BCOA 2CW0D 1Q1EA 4H7BA 4HJ9A 1I4PA 2HCCA 4NXNQ 1M4VA 1YNXA 3NBHB 5G3LD 4UDUC 1GD7A 4A3CG 3I90A 3PV0A 1Y1WH 3BVZA 3T1HL 1U0LA 1WYDA 2VNUD 5TSSA 4A3GH 1A3TA 1IBML 4DR1Q 3NK9A 3TSSA 3EBEA 4X66L 1A2TA 4KTAA 4O1NA 2UXCQ 2I07B 4DXGA 1IHZA 1BCPB 4JYAQ 5JEAH 1TWAH 1X6OA 2VQFL 1TS3A 2NN6G 1BBWA 4Q5VA 1YNND 2NVYB 3KF8A 4DK1A 3T4AC 1SE3A 5IYDG 3M4YA 1DXMA 2KQ3A 4TVAB 3PUXA 4PV1C 4BBRH 2NB0A 1OXUA 2K28A 3CCVA 1K8AC 1L0YB 2NVYH 3GO5A 4AYBE 3QG1A 2ZTCA 4YWMA 5I2XA 4LF5L 2LFNA 2R93G 1Q90A 4KHVA 2XIWA 1BF4A 3T1YL 1STAA 1WCMB 2GVBA 3HP3A 4QF4A 3U9OA 4C56C 3PMFA 1EWHA 5IT9L 4UP8A 2QA4A 4AQYQ 1EZ8A 2B8GA 3L3OC 1HR0W 1FNVA 2EE1A 3TRZA 1L1OC 4EQ5A 4KV6A 2VQEQ 2E2HB 4JI3L 1U5KA 2VS1A 1LTRD 1E2ZA 4JI0Q 1B3QA 4ZYSA 1RF2D 4MHEA 4QB4A 3H94A 1RODA 4HJ7A 2H1EA 3NQIA 1LTGD 2F0NA 4IFDJ 1MKHA 1SSOA 4KJOA 3VYRA 2KCCA 4NW2A 1YJWA 1RHPA 4RGOS 3JAMc 4QIWE 2XN9C 3TBIB 3TQYA 1STYA 3H0GG 5EJWA 3U4ZA 2RCNA 1HZAA 3OYYA 4LF4L 4DA2A 3I70A 4DAVA 3FHWA 1EIYB 3J81L 1HJPA 3PIPA 3NBHA 1BKBA 2BA0A 4ZKBB 2KUMA 3G4SA 2D62A 3NE5B 4AIMA 2L12A 4NKLA 2KHSA 1IW7C 1X55A 1JWSD 1CHQD 1N36L 1IYUA 4IFDG 5C0XH 1EL0A 1LT3D 2F0LA 4DV2Q 4JI6Q 4P2CB 1AP0A 3FKIB 2R93H 2N49A 1F2LA 3L7ZC 1PFNA 1YBYA 2VUMB 4BY1B 2PYKA 4XDXA 3EA6A 1CFMA 5K36H 1VQMA 4FO2A 5JJZA 1A3UA 4IURA 4IN3A 4DV1L 2VUMH 3DUZA 1JT8A 5COYA 3J80c 4N8X1 3ULPA 3HKZG 1PH2A 5EPKA 1GM5A 2I5LX 4DUYQ 2JA9A 1FNWA 2A6ED 4Q0FA 4XQNA 4L6TB 3IRBA 1B50A 2Q8IB 2L9HA 2DY8A 2E76C 3OMGA 3ONAB 3K58A 3CCJA 1PDQA 4A3DB 4GZYC 1EIFA 4B3RQ 1A2UA 4OHJA 2V4DA 2DY7A 5DLQE 5BR8L 2YU9H 1E3PA 1STBA 2K7VA 1AE2A 3S14B 3QB3A 3IFTA 1Q8KA 3U50C 1XNQQ 2F3WA 2ALYB 1KRSA 3K5LA 1SMYD 1YEZA 2RSNA 3HOVG 1V8QA 3D4RA 3LGJA 4HCEA 4A3KG 4BBSB 2V1CC 3S14H 3Q23A 4O0AA 1I6VC 2B63G 1B1ZA 5C3EG 1YJNA 2F0GA 1VQLA 2PNHA 4KHPL 1HZCA 2NUCA 1PMRA 3HOWG 5ELEA 1EY6A 1KNEA 1Z47A 2EYPA 4IFDH 1QVFA 1E2WA 3OHXC 1K9MC 2KHIA 5CR3A 4DV3Q 4LF6L 3MA2B 2F0KA 1WTXA 2B2TA 4A75A 3I4NG 3PUVA 1FJGL 3JAML 5LMNL 1H9KA 1J9OA 1VQAA 1ESRA 4YWLA 3TMEA 1XPRA 3MAQA 5IYBG 2WAQG 2Z6KA 5FJ8G 2PQAB 3PO2G 1PFMA 4R4OA 4IUUA 2K5VA 4NMZA 1XTCD 1HUNA 1JQYD 4HAEA 2RHQB 4FXKC 2K05A 1LTID 3HEJA 4MNOA 4LF9L 5FLMG 1XMQL 4J8QA 1O80A 1D5XC 1EWCA 1SJED 1YIJA 1OXXK 1MJEA 3OW2A 1EYCA 1CQVA 4ABNA 4X62L 3BS1A 1KD1C 1S72A 3V96A 4M8AA 2J0TD 3H09A 2NTSA 3H3VI 2F0IA 3A5UA 1NTGA 4BA1I 3P20A 3C1EA 1S3OA 2JA6G 2I5HA 1XJVA 1CKNB 1N34L 1PV4A 5EAYA 4KMUC 1KQSA 1U4MA 2KBNA 3P75A 3Q6SA 1K3BC 2EZVA 3CQZH 4LF5Q 3HOVH 2QCPX 2AMCB 5DAUA 1PYSB 1B3AA 1ZEQX 5J3BA 1KRTA 5ELDA 1SLJA 1SNMA 3J80L 3T1YQ 2B63H 2WIIB 3C1FA 3MFYA 5EKLA 1JE5A 2B2VC 1Q7YC 1F2YA 3GTLB 3HOWH 5E3FA 1D1IA 2P5ZX 2HDLA 3MVVA 4X64L 1B44D 3AB9A 4A3MB 1PTOC 1G291 3BZCA 3HKZE 4A76A 4DV4L 3OWEB 1NAPA 1SE4A 4JI3Q 4HIDA 5C3XA 5LMNW 3CCEA 4X3SA 4F88A 3S24A 2F52A 4LUOA 2R92G 2AUKA 3F2UA 2ENBA 4EVOA 5NUCA 3S1NB 4A3IG 2M00A 5JVH3 3A0JA 1SE8A 5EBDA 1S5CD 1M1KC 1YITA 4C3JG 3S1NH 5FLMH 5LMUL 1L0XB 3S2DB 3G71A 1BQQT 4LF4Q 4YIJA 4QUCA 3BYTB 2X69A 1J8IA 5JAVA 2TSSA 1D7QA 4HMIA 2JN4A 4JI4Q 3S2DH 1N32L 2KECA 2JQOA 4JCVE 3A54A 3A56A 2G5DA 2PQAA 1MSGA 1TVXA 2Q2HA 3QWNA 5ELNA 1VQNA 2UXDQ 1N36Q 3GTKB 2WINB 1D6EC 2UUCQ 2WB1G 1SFOH 1R4QB 2F0FA 3PQIA 1MGSA 3BU2A 3HOYG 3WOFA 2B2YA 1BVSA 2CWPA 2MPMA 2Y0SG 2UXCL 5KNCA 2WAQE 2ZXRA 5D3IB 1LLRD 2F0UA 4K5XA 2NZ1D 1N33L 1JE4A 1TS4A 1SEBD 2UU9Q 1CKNA 4C3HB 5HGTA 2O5IC 1S4ZA 1STNA 1E1OA 4FF2A 1W6JA 4JVZA 3QOJA 4A3BB 1X3EA 5HGQA 1V1PB 1EY4A 4I7AA 1W3SA 1PH5A 1HFNA 1GUGA 2EY6A 4S3SA 4KY5A 2X6LA 5M5YB 4XT1B 4A3BH 3T56B 2F0PA 3EFXD 1PH7A 3BG3A 4RGNA 1LO5D 1G6ZA 3A5ZB 2Q8TA 4A3JB 5C4XB 1JOKA 4C1NI 2ZXPA 1Y69U 3R8BA 2OQ0A 1AEXA 2XWJB 4A4IA 1TS2A 2OEOA 1MJCA 1NBWA 1JMCA 2HDMA 2KHJA 4OONA 4A3JH 4IJHA 3CD6A 4IUPA 3TP5A 4NP5A 1CZGA 2E2JB 1BUVT 5M5XH 4FYDA 2IW3A 3HOXG 3CCUA 3CCQA 4B3TQ 1STEA 4KHPQ 2BH2A 1TS5A 2E2JH 3NQTA 1BOSA 3G7LA 3GTOB 4A3EB 3DMUA 2MJ8A 1HQRD 4F7XA 1D1KA 3I3CA 2UUAL 2ZJQA 2F03A 3DWAA 5D3DA 4X65Q 1PHJA 4ZK9B 4ZRZA 5IGFA 1GUTA 3S1QH 4POFA 4A3EH 4K2LA 4RMFA 3HOYH 2KVMA 2QGQA 1K0SA 4C3IG 5M3FB 1B53A 4OO1G 4A3LG 5EPJA 3RR5A 4K6LA 1SAPA 3CC7A 3R93A 2R61A 5M3FH 1V43A 3OWFA 5C5MA 2FHTA 3J7ZC 2B29A 4DV5Q 2K14A 4GLVB 2HCIA 3K80C 1XMQQ 4LF9Q 1C0AA 5IP9G 2D0PA 2OWOA 1RTNA 4JC0A 4JI6L 3GTQB 2EJFC 4OEMB 3MXNB 2RHSB 4X62Q 1H9RA 1IKLA 3TEHB 2E2IH 1QWYA 3PUWA 3FRPB 1KHIA 3GTQH 1HA5A 5I2YA 4IOCA 1EEFD 2L11A 3K7AH 5C4HA 3GTMH 2JA8B 2B2WC 2QF7A 4DN4M 2WB1E 5ISRA 2OF1A 3SGIA 1Y1WG 3A8IE 1N34Q 1V1PA 5M3MB 2QILA 1ESFA 1F9SA 2JA8H 4DKAC 3H3VH 4A3GG 1VQ5A 5E1FA 1HZ9A 3RNUA 2LSSA 5E4XA 4CKBA 3T51B 3HOXH 1SROA 1IBKQ 3S1RB 4U68A 1X56A 2PI2E 2IWHA 3OPOA 3RZOB 1VF5C 4X64Q 4FNFA 2WKCA 2K5HA 3D8GA 5CC4A 3RZDH 1SRUA 3CCLA 5T1GA 3F8TA 2DJFC 4DV7Q 2UXBL 4DV4Q 5ELBA 1MI2A 4BBRG 1Q46A 3RZOH 5A2QE 1AFPA 4IUQA 1XNQL 1WD1A 1VDZA 2F3VA 4LJZC 2D9UA 4GKKL 1PXUA 5G3LF 1EIHA 2XNAC 5LHY1 5M9OA 1U9RA 1TQOA 2ID0A 2SDFA 4OIKA 5E7NA 4RH6A 1VQ6A 4UAIA 3S15H 2C9OA 3TREA 3TS2A 1EQRA 4GLAC 5LMUQ 5I6YA 5CV9A 1QCBD 4B9WA 2BDNA 3D3RA 3IFDA 1VQFA 3Q22A 4QY7A 3M3YH 1HFGA 2QDBA 4TQUS 2GN5A 2F4VL 1N32Q 2VL6A 5KEEA 4AYBB 2RA4A 1LV9A 5C0XJ 2EJMA 3SK4A 5K5PA 1VQPA 5LL6S 5JPMC 1WTOA 2Z4IA 3IKJA 1UE7A 3I73A 2HUGA 2F0DA 4HEDA 3ICEA 2DJGC 3M4PA 3MXNA 1VMPA 1PFBA 1EUJA 3DM3A 1F2MA 1H9JA 4BY7B 2E2DC 4A3FB 2ICEC 1C8CA 5FLXL 1S5BD 5KNBA 2NVXB 2E5LL 2MUYA 1Q86C 4F87A
chains in the Genus database with same CATH topology
3I56A 2A8VA 1CKOA 1N33Q 3CMEA 3UDXA 5IYCG 3KJOA 3CCJA 3KOJA 4YHHL 4UPAA 1EIFA 4DV0L 3HOUG 4B3RQ 4JG2A 4DUZQ 5IYBH 4H02A 1I6HH 1RL2A 5FJ8H 5C0XG 2UUBQ 3PO2H 4Y52H 1IBLL 3BJUA 1UWVA 5DLQE 1XPUA 1WI5A 1L1OB 5BR8L 2YU9H 1E3PA 4WJ4A 1AE2A 3CF5A 4LFAL 3K81C 1RIPA 1JJCB 1Q8KA 3U50C 2DUDA 1TXYA 1VQ8A 3K0XA 2D0OA 1XNQQ 2ALYB 3I4MH 2JEAI 1KRSA 2IT1A 4QGUA 4PZ7A 1YEZA 1A62A 1VQ7A 3HOVG 1K0RA 1HNWL 1OTCA 3LGJA 4GS3A 4DNIA 3J81j 4A3KG 2V1CC 3S14H 1Q82C 4O0AA 5K36G 2B63G 4BA2I 2MO1A 2CFMA 2H5XA 3PF5A 2YTVA 5C3EG 1XTDA 1YJNA 4R4CA 1X9NA 2Q2TA 4AYBG 1VQLA 2PNHA 4KHPL 1B7YB 1HZCA 1VQGA 1WCMH 4L5QA 4NXNL 2VUMG 4BY1G 1PA6A 3HOWG 3RN2A 4DR6L 1Y14B 4R4IA 4JI1Q 1X54A 1Z47A 1KAWA 4GOPB 1QVFA 2Y0SE 5M3MH 1EWIA 2KHIA 4DV3Q 2IX0A 1K9MC 4LF6L 2JA6H 4PZ8A 2AWOA 1PFSA 2CKZB 2QEXA 2HIXA 4A75A 2E2HH 1TWHH 3I4NG 3PUVA 5IWAQ 1VQHA 3HOZG 1FJGL 5LMNL 3ERSX 1VQAA 4ALPA 4YWLA 4DR1L 1AH9A 3OTOQ 2HT1A 4LF8Q 2VZAA 3PCOB 3S1RH 1KIXA 5C44H 4GOPC 2R7DA 1XPRA 1VQKA 5IYBG 2WAQG 4HJAA 4JYAL 1SR3A 2Z6KA 2HHHQ 5FJ8G 2A1AA 2PQAB 2UUAQ 3PO2G 2JK8A 4R4OA 2IX1A 2K5VA 1NE3A 2F3IA 2RHQB 4IPHA 3S1MH 4DR3Q 1HNXQ 3UDGA 4X6AH 4DV1Q 4MNOA 4LF9L 5FLMG 1XMQL 2N78A 4B3ML 3I4MG 3E9HA 3KDFB 3KJPA 1YIJA 1OXXK 1MJEA 3OW2A 3ULLA 4JI4L 4YCVA 4X62L 1KD1C 1A8VA 3CPWA 1NMFA 2I5MX 4PG3A 3WWVA 4YY3Q 5H1SE 3KYHC 3CCRA 1S72A 4LFBL 1T9HA 4GLXA 3CPFA 2R92H 2UXDL 3A74A 4POGA 1WCMG 5IYCH 3A5UA 4O2DA 3H3VI 1NTGA 2BA1A 4BA1I 1FVIA 1HH2P 1S3OA 2CQOA 3JAMi 1VCIA 3M9BA 3CCMA 4A3IH 2UUCL 4BBSG 3MEFA 4LUVA 1XNRL 1C7YA 3S16H 5M3MG 1FL0A 4DV0Q 2JA6G 2I5HA 1EFWA 1XJVA 1V9PA 1YHBA 4AQYL 1CKNB 1N34L 1PV4A 5IE8A 4GNXB 4KLKA 5EAYA 1KQSA 4BXXH 1TWGH 4C3JH 1A63A 2KBNA 4DK6C 1EYGA 1IBLQ 5BR8Q 1QUQB 2VQEL 2PMZE 3CQZH 2NZHA 2E8GA 4LF5Q 3HOVH 3HFZB 4XIGS 3E9IA 4JOIA 4R4TA 3CC4A 2AMCB 4JI0L 1HZBA 2JEBI 1PYSB 4IO9A 1KRTA 5J3BA 3FKIH 1SLJA 5C44G 3RN5A 3T1YQ 1VS0A 1WOCA 1W2BA 2B63H 1PH3A 1HNWQ 1JE5A 1VQBA 1Q7YC 2K5NA 2UU9L 2PI2A 3G48A 1XMOL 4GNXC 3GDEA 3CAMA 4BY1H 3HOWH 3W1BA 1R9TH 2XGTA 1C9OA 1LM0A 1WFQA 2K75A 2OQKA 4X64L 1YHAA 3F2BA 1K73C 1L1OA 2JA7H 1Q81C 4DV6L 1G291 2AWNA 3BZCA 3HKZE 4A76A 1JJ2A 4DV4L 3GTGH 4HIKA 4JI3Q 4HIDA 4JBKA 5JJIA 5LMNW 3CCEA 3S24A 1EQQA 1O7IA 4BY7H 4LF6Q 2F52A 2LXJA 4LUOA 3UDFA 4A3FH 2ZM6Q 5GAHC 4DR2L 2R92G 1PH6A 3CCSA 2NVXH 4OX9L 2EQSA 4P71A 4IJLA 3G6EA 1VQCA 1Q1BA 3JC66 2VW9A 1FJGQ 5LMNQ 2IHFA 4A3IG 2DGYA 1K3RA 3I2ZA 3A0JA 5C0XI 4HIMA 4DAYB 3M4QA 2KCTA 1SE8A 4K0KQ 1P16A 4PMWA 3J80i 4GOPA 3TS0A 4OWWB 3I7FA 2UXBQ 1OXSC 3ZJYC 4A3DH 1M1KC 1UE1A 3GTPH 2JE6I 4XTCS 1YITA 4BXXG 1A0IA 3S1NH 5FLMH 5LMUL 2OTLA 2IY5B 3G71A 1KL9A 1N9WA 2AKWB 5FLXc 4WJ3M 3AFQA 2YV5A 1QVCA 4GKKQ 3UDIA 4LF4Q 1MIUA 2WFWA 4DAMA 4B3SL 1D7QA 4YCUA 4DV2L 3FKIG 4JBJA 5JEAJ 1KC8C 3K7UC 4B3TL 2Q2UA 3PO3H 4LF7L 3EIVA 4JI4Q 3S2DH 4DR4L 3L0OA 2R7ZH 1N32L 3RLFA 1UE6A 4GKJL 2JQOA 4JCVE 4PZ6A 3STBD 2ASBA 2K52A 2PQAA 4BBSH 2JJQA 2Q2HA 1X65A 1AE3A 5HY6A 2WP8J 5ELNA 1VQNA 2JA7G 4QL5A 1J5EL 2UXDQ 1CSPA 3AYHB 4JI8L 2N8NA 1N36Q 1JB7A 4X65L 3H15A 1LYLA 4DR5Q 2UUCQ 2WB1G 1PH8A 1GO3E 3KDFA 2XTIA 1PH4A 1SFOH 4LFCL 3KF8B 4BY7G 4A93G 4P75A 2JA5H 1BBUA 2HQLA 5GAGC 2EIFA 3VDYA 4A3FG 1S40A 1SN8A 2F4VQ 1IYJB 2ZJRA 1LUZA 1L0WA 3PIOA 3BU2A 1Y1VH 3I55A 1VQDA 4DUYL 3HOYG 1BVSA 2CWPA 3D0FA 5IT9c 2CWAA 4DR7Q 2Y0SG 2UXCL 2RF4A 2A19A 2WAQE 2L15A 4NXML 1I3QH 4GN4B 4JBWA 5AJ3Q 2IHEA 4A3DG 4DV5L 1N33L 5JEAG 1CKMA 2UU9Q 1PH1A 1CKNA 1JJGA 2I0QA 4GNXA 3PSIA 4JV5Q 4B3RL 1E1OA 4DUZL 3S17H 1HNZL 2B3GA 4A3CH 1QUQA 1X3EA 4DPGA 2KCMA 5HGQA 1I94Q 3UE0A 3EN2A 1K83H 4DV6Q 4JI2L 2OTJA 1H95A 2YYZA 4JI5Q 1W3SA 1PH5A 3PO3G 2E5LQ 3K8AA 3NENA 4IPGA 2R7ZG 3E0EA 1UE5A 4A3BH 2FXQA 4LUZA 4IFDI 1VQIA 4C3IH 1PH7A 1L2FA 2LXKA 4A3LH 4OX9Q 1V1QA 4YHHQ 3A5ZB 4MZ9A 4P72A 5C4JH 1UEBA 3L2PA 2OQ0A 2R6GA 4IOAA 4OWTB 1N8RC 4A4IA 2JA5G 4JI1L 1MJCA 2VY3A 3PUZA 3CW2C 1NBWA 2EXDA 4LW1A 4MTNA 4LFAQ 3J81c 1JMCA 4OONA 2KHJA 4A3JH 1J6QA 4IJHA 1Y1VG 3CD6A 5IP9H 4DV3L 4DK3C 3UE1A 1HR0L 1VQ4A 5IYDH 1IBKL 1X3GA 5GQOA 3M85A 1E1TA 3ULJA 5IP7H 4C2MH 5M5XH 3F2DA 3HOXG 5IWAL 3CCUA 1Q1EA 1PVOA 3CCQA 4Y7NH 4B3TQ 4YWKA 4HJ9A 4DR4Q 2YTXA 4KHPQ 4LF8L 2BH2A 4NXNQ 4GKJQ 2E2JH 4QQBX 2N3SA 4IPCA 1YNXA 1IXRA 3NBHB 4APVA 4DV7L 4DR6Q 3NEMA 3PUYA 3W1GA 1GD7A 3GTLH 1CSQA 2Z6KC 4A3CG 4KI0A 2UUAL 2ZJQA 3CXCA 3GTJH 1KXLA 1G51A 4A93H 1E22A 3PV0A 4X65Q 1Y1WH 3T1HL 2MO0A 1PHJA 4A3MH 4NB3A 1YZ6A 1U0LA 1WYDA 4IPDA 4POFA 4JBMA 3S1QH 3KF6B 4KHZA 2VNUD 3CMAA 4A3EH 4A3GH 4RMFA 2R7FA 3HOYH 1B70B 4A3BG 2QGQA 1IBML 4DR1Q 4OO1G 4A3LG 3EBEA 4X66L 1OXTA 3RR5A 2UXCQ 3CC7A 4JYAQ 3B6YA 4HJ5A 1TWAH 1X6OA 2VQFL 1QZHA 5M3FH 1V43A 2CCZA 2NN6G 1BBWA 1SMXA 1K8GA 3J7A5 3J7ZC 2B29A 1PH9A 4DV5Q 4J15A 2K14A 4UP7A 4A3JG 2ATWA 4GLVB 1VQJA 3F1ZA 3K80C 1XMQQ 1YI2A 1CUKA 5IP9G 2D0PA 5IYDG 4HIOA 2OWOA 4B3MQ 4JC0A 4JI6L 1C0AA 1QVGA 4UY8C 4TVAB 3PUXA 1HNZQ 3MXNB 4BBRH 1OXUA 5GROA 3CCVA 5IP7G 1NJIC 2RHSB 4X62Q 1K8AC 2NVYH 3GO5A 5ELOA 4JI2Q 2ZTCA 3H0GH 4YWMA 2AHOB 4AYBE 1IL2A 3TEHB 4LFBQ 4LF5L 2E2IH 2HIVA 2R93G 3PUWA 4JOIC 4UP9A 1KHIA 3GTQH 3S2HH 5C4XG 2ZTDA 4IOCA 3RLNA 3K7AH 1B8AA 3T1YL 3GTMH 2K50A 4R4QA 2GVBA 4GN3B 2ZTEA 1VQ9A 1XNRQ 2WB1E 1X3FA 3SGIA 4UP8A 1Y1WG 2QA4A 2NZOA 4AQYQ 4A3MG 1N34Q 1HR0W 3TRZA 2BH8A 1L1OC 2JA8H 3GTKH 4DKAC 4EQ5A 4A3EG 3H3VH 4A3GG 1VQ5A 2VQEQ 1HZ9A 4JI7L 4JI3L 1U5KA 3RNUA 2LSSA 2VS1A 3AQQA 4JI0Q 1LTLA 3HOXH 1HR0Q 1QZGA 1SROA 1ASZA 1IBKQ 1WJJA 2ZM6L 4HJ7A 1IZ6A 1XMOQ 1X56A 5M3FG 4IFDJ 2PI2E 2YTYA 1MKHA 5IY0A 3U58A 4X64Q 2K5HA 3CCLA 3RZDH 1SRUA 2UUBL 1M90C 3F8TA 4K0KL 2UXBL 4DV7Q 1NY4A 1YJWA 4GN5A 3PGZA 4DV4Q 4C3HH 4LF9Q 4BBRG 3ER0A 3JAMc 3FP9A 4QIWE 1Q46A 3RZOH 4NPSA 5GADC 3TQYA 1XNQL 5JJKA 3H0GG 1FGUA 3M4OH 3T1HQ 4P73A 5GAEC 3U4ZA 1YJ9A 2RCNA 4GKKL 1HZAA 3OYYA 4LF4L 4DR2Q 3FHWA 2GVAA 1E24A 2ID0A 4OXPA 5E7NA 1EIYB 4OWXB 3U4VA 1HJPA 1I50H 1IBMQ 2MFIA 4LWCA 3PIPA 1GVPA 5M5YH 1BKBA 1VQ6A 2BA0A 3TREA 3S15H 1EOVA 3G4SA 2D62A 4L5TA 4X66Q 4AIMA 2NVTH 3TS2A 1EQRA 3STBC 4GLAC 3NELA 4QJFA 2JA8G 1X55A 5C4XH 2VQFQ 5JJLA 5LMUQ 3HOUH 1GKHA 4ME3A 1N36L 3CP0A 2ES2A 3KF6A 2C35B 3RLOA 4DR5L 3CC2A 5M5WH 3KLWA 4EX5A 4IFDG 4B3SQ 2Z0SA 1VQFA 1Z9FA 1Q12A 4QY7A 1D8LA 4DV2Q 4JI6Q 3M3YH 1DGSA 2MNAA 4LF7Q 4TQUS 2GN5A 2N49A 3OTOL 4L5SA 2F4VL 1N32Q 4RG1A 2R93H 2VL6A 4FDBA 2Q2IA 3L7ZC 2KENA 1G6PA 1YBYA 1YVCA 5C0XJ 4DR7L 1P8LA 2HHHL 3D31A 4A3KH 1VQPA 1J5EQ 4AH6A 4HJ8A 4L5RC 1I5FA 4JI8Q 5AJ3L 1VQMA 1ASYA 2NVQH 1UE7A 5C3EH 3J81i 3PF4A 4DR3L 1HNXL 1E7ZA 3BZKA 4DV1L 4P74A 3F2CA 3GD7A 3GTOH 3ICEA 2VUMH 4LFCQ 3M4PA 4JV5L 1JT8A 2OCEA 4YCWA 3DM3A 1EUJA 3J80c 4R1JA 3AFPA 2K4KA 2MQHA 4OO1I 3DLLA 3ULPA 3HKSA 3HKZG 1PH2A 1I94L 3KFUA 1GM5A 1TWCH 2I5LX 1PYBA 4DUYQ 2JA9A 1VQEA 4JI5L 1OXVA 4YY3L 4JI7Q 3AEVA 1VQOA 2E5LL 3I4OA 1XPOA 1YHQA 3M7NA 2ZJPA 1NMGA 3IRBA 1TWFH 4NXMQ 3I4NH 3HOZH 2NN6I 1Q86C 4LNQA 3Q8DA 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 A;  2A8V A;  1CKO A;  1N33 Q;  3CME A;  3UDX A;  5IYC G;  3KJO A;  3CCJ A;  3KOJ A;  4YHH L;  4UPA A;  1EIF A;  4DV0 L;  3HOU G;  4B3R Q;  4JG2 A;  4DUZ Q;  5IYB H;  4H02 A;  1I6H H;  1RL2 A;  5FJ8 H;  5C0X G;  2UUB Q;  3PO2 H;  4Y52 H;  1IBL L;  3BJU A;  1UWV A;  5DLQ E;  1XPU A;  1WI5 A;  1L1O B;  5BR8 L;  2YU9 H;  1E3P A;  4WJ4 A;  1AE2 A;  3CF5 A;  4LFA L;  3K81 C;  1RIP A;  1JJC B;  1Q8K A;  3U50 C;  2DUD A;  1TXY A;  1VQ8 A;  3K0X A;  2D0O A;  1XNQ Q;  2ALY B;  3I4M H;  2JEA I;  1KRS A;  2IT1 A;  4QGU A;  4PZ7 A;  1YEZ A;  1A62 A;  1VQ7 A;  3HOV G;  1K0R A;  1HNW L;  1OTC A;  3LGJ A;  4GS3 A;  4DNI A;  3J81 j;  4A3K G;  2V1C C;  3S14 H;  1Q82 C;  4O0A A;  5K36 G;  2B63 G;  4BA2 I;  2MO1 A;  2CFM A;  2H5X A;  3PF5 A;  2YTV A;  5C3E G;  1XTD A;  1YJN A;  4R4C A;  1X9N A;  2Q2T A;  4AYB G;  1VQL A;  2PNH A;  4KHP L;  1B7Y B;  1HZC A;  1VQG A;  1WCM H;  4L5Q A;  4NXN L;  2VUM G;  4BY1 G;  1PA6 A;  3HOW G;  3RN2 A;  4DR6 L;  1Y14 B;  4R4I A;  4JI1 Q;  1X54 A;  1Z47 A;  1KAW A;  4GOP B;  1QVF A;  2Y0S E;  5M3M H;  1EWI A;  2KHI A;  4DV3 Q;  2IX0 A;  1K9M C;  4LF6 L;  2JA6 H;  4PZ8 A;  2AWO A;  1PFS A;  2CKZ B;  2QEX A;  2HIX A;  4A75 A;  2E2H H;  1TWH H;  3I4N G;  3PUV A;  5IWA Q;  1VQH A;  3HOZ G;  1FJG L;  5LMN L;  3ERS X;  1VQA A;  4ALP A;  4YWL A;  4DR1 L;  1AH9 A;  3OTO Q;  2HT1 A;  4LF8 Q;  2VZA A;  3PCO B;  3S1R H;  1KIX A;  5C44 H;  4GOP C;  2R7D A;  1XPR A;  1VQK A;  5IYB G;  2WAQ G;  4HJA A;  4JYA L;  1SR3 A;  2Z6K A;  2HHH Q;  5FJ8 G;  2A1A A;  2PQA B;  2UUA Q;  3PO2 G;  2JK8 A;  4R4O A;  2IX1 A;  2K5V A;  1NE3 A;  2F3I A;  2RHQ B;  4IPH A;  3S1M H;  4DR3 Q;  1HNX Q;  3UDG A;  4X6A H;  4DV1 Q;  4MNO A;  4LF9 L;  5FLM G;  1XMQ L;  2N78 A;  4B3M L;  3I4M G;  3E9H A;  3KDF B;  3KJP A;  1YIJ A;  1OXX K;  1MJE A;  3OW2 A;  3ULL A;  4JI4 L;  4YCV A;  4X62 L;  1KD1 C;  1A8V A;  3CPW A;  1NMF A;  2I5M X;  4PG3 A;  3WWV A;  4YY3 Q;  5H1S E;  3KYH C;  3CCR A;  1S72 A;  4LFB L;  1T9H A;  4GLX A;  3CPF A;  2R92 H;  2UXD L;  3A74 A;  4POG A;  1WCM G;  5IYC H;  3A5U A;  4O2D A;  3H3V I;  1NTG A;  2BA1 A;  4BA1 I;  1FVI A;  1HH2 P;  1S3O A;  2CQO A;  3JAM i;  1VCI A;  3M9B A;  3CCM A;  4A3I H;  2UUC L;  4BBS G;  3MEF A;  4LUV A;  1XNR L;  1C7Y A;  3S16 H;  5M3M G;  1FL0 A;  4DV0 Q;  2JA6 G;  2I5H A;  1EFW A;  1XJV A;  1V9P A;  1YHB A;  4AQY L;  1CKN B;  1N34 L;  1PV4 A;  5IE8 A;  4GNX B;  4KLK A;  5EAY A;  1KQS A;  4BXX H;  1TWG H;  4C3J H;  1A63 A;  2KBN A;  4DK6 C;  1EYG A;  1IBL Q;  5BR8 Q;  1QUQ B;  2VQE L;  2PMZ E;  3CQZ H;  2NZH A;  2E8G A;  4LF5 Q;  3HOV H;  3HFZ B;  4XIG S;  3E9I A;  4JOI A;  4R4T A;  3CC4 A;  2AMC B;  4JI0 L;  1HZB A;  2JEB I;  1PYS B;  4IO9 A;  1KRT A;  5J3B A;  3FKI H;  1SLJ A;  5C44 G;  3RN5 A;  3T1Y Q;  1VS0 A;  1WOC A;  1W2B A;  2B63 H;  1PH3 A;  1HNW Q;  1JE5 A;  1VQB A;  1Q7Y C;  2K5N A;  2UU9 L;  2PI2 A;  3G48 A;  1XMO L;  4GNX C;  3GDE A;  3CAM A;  4BY1 H;  3HOW H;  3W1B A;  1R9T H;  2XGT A;  1C9O A;  1LM0 A;  1WFQ A;  2K75 A;  2OQK A;  4X64 L;  1YHA A;  3F2B A;  1K73 C;  1L1O A;  2JA7 H;  1Q81 C;  4DV6 L;  1G29 1;  2AWN A;  3BZC A;  3HKZ E;  4A76 A;  1JJ2 A;  4DV4 L;  3GTG H;  4HIK A;  4JI3 Q;  4HID A;  4JBK A;  5JJI A;  5LMN W;  3CCE A;  3S24 A;  1EQQ A;  1O7I A;  4BY7 H;  4LF6 Q;  2F52 A;  2LXJ A;  4LUO A;  3UDF A;  4A3F H;  2ZM6 Q;  5GAH C;  4DR2 L;  2R92 G;  1PH6 A;  3CCS A;  2NVX H;  4OX9 L;  2EQS A;  4P71 A;  4IJL A;  3G6E A;  1VQC A;  1Q1B A;  3JC6 6;  2VW9 A;  1FJG Q;  5LMN Q;  2IHF A;  4A3I G;  2DGY A;  1K3R A;  3I2Z A;  3A0J A;  5C0X I;  4HIM A;  4DAY B;  3M4Q A;  2KCT A;  1SE8 A;  4K0K Q;  1P16 A;  4PMW A;  3J80 i;  4GOP A;  3TS0 A;  4OWW B;  3I7F A;  2UXB Q;  1OXS C;  3ZJY C;  4A3D H;  1M1K C;  1UE1 A;  3GTP H;  2JE6 I;  4XTC S;  1YIT A;  4BXX G;  1A0I A;  3S1N H;  5FLM H;  5LMU L;  2OTL A;  2IY5 B;  3G71 A;  1KL9 A;  1N9W A;  2AKW B;  5FLX c;  4WJ3 M;  3AFQ A;  2YV5 A;  1QVC A;  4GKK Q;  3UDI A;  4LF4 Q;  1MIU A;  2WFW A;  4DAM A;  4B3S L;  1D7Q A;  4YCU A;  4DV2 L;  3FKI G;  4JBJ A;  5JEA J;  1KC8 C;  3K7U C;  4B3T L;  2Q2U A;  3PO3 H;  4LF7 L;  3EIV A;  4JI4 Q;  3S2D H;  4DR4 L;  3L0O A;  2R7Z H;  1N32 L;  3RLF A;  1UE6 A;  4GKJ L;  2JQO A;  4JCV E;  4PZ6 A;  3STB D;  2ASB A;  2K52 A;  2PQA A;  4BBS H;  2JJQ A;  2Q2H A;  1X65 A;  1AE3 A;  5HY6 A;  2WP8 J;  5ELN A;  1VQN A;  2JA7 G;  4QL5 A;  1J5E L;  2UXD Q;  1CSP A;  3AYH B;  4JI8 L;  2N8N A;  1N36 Q;  1JB7 A;  4X65 L;  3H15 A;  1LYL A;  4DR5 Q;  2UUC Q;  2WB1 G;  1PH8 A;  1GO3 E;  3KDF A;  2XTI A;  1PH4 A;  1SFO H;  4LFC L;  3KF8 B;  4BY7 G;  4A93 G;  4P75 A;  2JA5 H;  1BBU A;  2HQL A;  5GAG C;  2EIF A;  3VDY A;  4A3F G;  1S40 A;  1SN8 A;  2F4V Q;  1IYJ B;  2ZJR A;  1LUZ A;  1L0W A;  3PIO A;  3BU2 A;  1Y1V H;  3I55 A;  1VQD A;  4DUY L;  3HOY G;  1BVS A;  2CWP A;  3D0F A;  5IT9 c;  2CWA A;  4DR7 Q;  2Y0S G;  2UXC L;  2RF4 A;  2A19 A;  2WAQ E;  2L15 A;  4NXM L;  1I3Q H;  4GN4 B;  4JBW A;  5AJ3 Q;  2IHE A;  4A3D G;  4DV5 L;  1N33 L;  5JEA G;  1CKM A;  2UU9 Q;  1PH1 A;  1CKN A;  1JJG A;  2I0Q A;  4GNX A;  3PSI A;  4JV5 Q;  4B3R L;  1E1O A;  4DUZ L;  3S17 H;  1HNZ L;  2B3G A;  4A3C H;  1QUQ A;  1X3E A;  4DPG A;  2KCM A;  5HGQ A;  1I94 Q;  3UE0 A;  3EN2 A;  1K83 H;  4DV6 Q;  4JI2 L;  2OTJ A;  1H95 A;  2YYZ A;  4JI5 Q;  1W3S A;  1PH5 A;  3PO3 G;  2E5L Q;  3K8A A;  3NEN A;  4IPG A;  2R7Z G;  3E0E A;  1UE5 A;  4A3B H;  2FXQ A;  4LUZ A;  4IFD I;  1VQI A;  4C3I H;  1PH7 A;  1L2F A;  2LXK A;  4A3L H;  4OX9 Q;  1V1Q A;  4YHH Q;  3A5Z B;  4MZ9 A;  4P72 A;  5C4J H;  1UEB A;  3L2P A;  2OQ0 A;  2R6G A;  4IOA A;  4OWT B;  1N8R C;  4A4I A;  2JA5 G;  4JI1 L;  1MJC A;  2VY3 A;  3PUZ A;  3CW2 C;  1NBW A;  2EXD A;  4LW1 A;  4MTN A;  4LFA Q;  3J81 c;  1JMC A;  4OON A;  2KHJ A;  4A3J H;  1J6Q A;  4IJH A;  1Y1V G;  3CD6 A;  5IP9 H;  4DV3 L;  4DK3 C;  3UE1 A;  1HR0 L;  1VQ4 A;  5IYD H;  1IBK L;  1X3G A;  5GQO A;  3M85 A;  1E1T A;  3ULJ A;  5IP7 H;  4C2M H;  5M5X H;  3F2D A;  3HOX G;  5IWA L;  3CCU A;  1Q1E A;  1PVO A;  3CCQ A;  4Y7N H;  4B3T Q;  4YWK A;  4HJ9 A;  4DR4 Q;  2YTX A;  4KHP Q;  4LF8 L;  2BH2 A;  4NXN Q;  4GKJ Q;  2E2J H;  4QQB X;  2N3S A;  4IPC A;  1YNX A;  1IXR A;  3NBH B;  4APV A;  4DV7 L;  4DR6 Q;  3NEM A;  3PUY A;  3W1G A;  1GD7 A;  3GTL H;  1CSQ A;  2Z6K C;  4A3C G;  4KI0 A;  2UUA L;  2ZJQ A;  3CXC A;  3GTJ H;  1KXL A;  1G51 A;  4A93 H;  1E22 A;  3PV0 A;  4X65 Q;  1Y1W H;  3T1H L;  2MO0 A;  1PHJ A;  4A3M H;  4NB3 A;  1YZ6 A;  1U0L A;  1WYD A;  4IPD A;  4POF A;  4JBM A;  3S1Q H;  3KF6 B;  4KHZ A;  2VNU D;  3CMA A;  4A3E H;  4A3G H;  4RMF A;  2R7F A;  3HOY H;  1B70 B;  4A3B G;  2QGQ A;  1IBM L;  4DR1 Q;  4OO1 G;  4A3L G;  3EBE A;  4X66 L;  1OXT A;  3RR5 A;  2UXC Q;  3CC7 A;  4JYA Q;  3B6Y A;  4HJ5 A;  1TWA H;  1X6O A;  2VQF L;  1QZH A;  5M3F H;  1V43 A;  2CCZ A;  2NN6 G;  1BBW A;  1SMX A;  1K8G A;  3J7A 5;  3J7Z C;  2B29 A;  1PH9 A;  4DV5 Q;  4J15 A;  2K14 A;  4UP7 A;  4A3J G;  2ATW A;  4GLV B;  1VQJ A;  3F1Z A;  3K80 C;  1XMQ Q;  1YI2 A;  1CUK A;  5IP9 G;  2D0P A;  5IYD G;  4HIO A;  2OWO A;  4B3M Q;  4JC0 A;  4JI6 L;  1C0A A;  1QVG A;  4UY8 C;  4TVA B;  3PUX A;  1HNZ Q;  3MXN B;  4BBR H;  1OXU A;  5GRO A;  3CCV A;  5IP7 G;  1NJI C;  2RHS B;  4X62 Q;  1K8A C;  2NVY H;  3GO5 A;  5ELO A;  4JI2 Q;  2ZTC A;  3H0G H;  4YWM A;  2AHO B;  4AYB E;  1IL2 A;  3TEH B;  4LFB Q;  4LF5 L;  2E2I H;  2HIV A;  2R93 G;  3PUW A;  4JOI C;  4UP9 A;  1KHI A;  3GTQ H;  3S2H H;  5C4X G;  2ZTD A;  4IOC A;  3RLN A;  3K7A H;  1B8A A;  3T1Y L;  3GTM H;  2K50 A;  4R4Q A;  2GVB A;  4GN3 B;  2ZTE A;  1VQ9 A;  1XNR Q;  2WB1 E;  1X3F A;  3SGI A;  4UP8 A;  1Y1W G;  2QA4 A;  2NZO A;  4AQY Q;  4A3M G;  1N34 Q;  1HR0 W;  3TRZ A;  2BH8 A;  1L1O C;  2JA8 H;  3GTK H;  4DKA C;  4EQ5 A;  4A3E G;  3H3V H;  4A3G G;  1VQ5 A;  2VQE Q;  1HZ9 A;  4JI7 L;  4JI3 L;  1U5K A;  3RNU A;  2LSS A;  2VS1 A;  3AQQ A;  4JI0 Q;  1LTL A;  3HOX H;  1HR0 Q;  1QZG A;  1SRO A;  1ASZ A;  1IBK Q;  1WJJ A;  2ZM6 L;  4HJ7 A;  1IZ6 A;  1XMO Q;  1X56 A;  5M3F G;  4IFD J;  2PI2 E;  2YTY A;  1MKH A;  5IY0 A;  3U58 A;  4X64 Q;  2K5H A;  3CCL A;  3RZD H;  1SRU A;  2UUB L;  1M90 C;  3F8T A;  4K0K L;  2UXB L;  4DV7 Q;  1NY4 A;  1YJW A;  4GN5 A;  3PGZ A;  4DV4 Q;  4C3H H;  4LF9 Q;  4BBR G;  3ER0 A;  3JAM c;  3FP9 A;  4QIW E;  1Q46 A;  3RZO H;  4NPS A;  5GAD C;  3TQY A;  1XNQ L;  5JJK A;  3H0G G;  1FGU A;  3M4O H;  3T1H Q;  4P73 A;  5GAE C;  3U4Z A;  1YJ9 A;  2RCN A;  4GKK L;  1HZA A;  3OYY A;  4LF4 L;  4DR2 Q;  3FHW A;  2GVA A;  1E24 A;  2ID0 A;  4OXP A;  5E7N A;  1EIY B;  4OWX B;  3U4V A;  1HJP A;  1I50 H;  1IBM Q;  2MFI A;  4LWC A;  3PIP A;  1GVP A;  5M5Y H;  1BKB A;  1VQ6 A;  2BA0 A;  3TRE A;  3S15 H;  1EOV A;  3G4S A;  2D62 A;  4L5T A;  4X66 Q;  4AIM A;  2NVT H;  3TS2 A;  1EQR A;  3STB C;  4GLA C;  3NEL A;  4QJF A;  2JA8 G;  1X55 A;  5C4X H;  2VQF Q;  5JJL A;  5LMU Q;  3HOU H;  1GKH A;  4ME3 A;  1N36 L;  3CP0 A;  2ES2 A;  3KF6 A;  2C35 B;  3RLO A;  4DR5 L;  3CC2 A;  5M5W H;  3KLW A;  4EX5 A;  4IFD G;  4B3S Q;  2Z0S A;  1VQF A;  1Z9F A;  1Q12 A;  4QY7 A;  1D8L A;  4DV2 Q;  4JI6 Q;  3M3Y H;  1DGS A;  2MNA A;  4LF7 Q;  4TQU S;  2GN5 A;  2N49 A;  3OTO L;  4L5S A;  2F4V L;  1N32 Q;  4RG1 A;  2R93 H;  2VL6 A;  4FDB A;  2Q2I A;  3L7Z C;  2KEN A;  1G6P A;  1YBY A;  1YVC A;  5C0X J;  4DR7 L;  1P8L A;  2HHH L;  3D31 A;  4A3K H;  1VQP A;  1J5E Q;  4AH6 A;  4HJ8 A;  4L5R C;  1I5F A;  4JI8 Q;  5AJ3 L;  1VQM A;  1ASY A;  2NVQ H;  1UE7 A;  5C3E H;  3J81 i;  3PF4 A;  4DR3 L;  1HNX L;  1E7Z A;  3BZK A;  4DV1 L;  4P74 A;  3F2C A;  3GD7 A;  3GTO H;  3ICE A;  2VUM H;  4LFC Q;  3M4P A;  4JV5 L;  1JT8 A;  2OCE A;  4YCW A;  3DM3 A;  1EUJ A;  3J80 c;  4R1J A;  3AFP A;  2K4K A;  2MQH A;  4OO1 I;  3DLL A;  3ULP A;  3HKS A;  3HKZ G;  1PH2 A;  1I94 L;  3KFU A;  1GM5 A;  1TWC H;  2I5L X;  1PYB A;  4DUY Q;  2JA9 A;  1VQE A;  4JI5 L;  1OXV A;  4YY3 L;  4JI7 Q;  3AEV A;  1VQO A;  2E5L L;  3I4O A;  1XPO A;  1YHQ A;  3M7N A;  2ZJP A;  1NMG A;  3IRB A;  1TWF H;  4NXM Q;  3I4N H;  3HOZ H;  2NN6 I;  1Q86 C;  4LNQ A;  3Q8D A;  3W5O A; 
#chains in the Genus database with same CATH topology
 5C4Z A;  4KKU A;  2A8V A;  1CKO A;  1N33 Q;  3UDX A;  3KOJ A;  2LS0 1;  2Z4H A;  1H9M A;  3TZD A;  4H02 A;  3I4M B;  2FJ2 A;  5C0X G;  2UUB Q;  3BDC A;  4OEL B;  2F0O A;  1UWV A;  4WJ4 A;  3EQL C;  3W2D A;  2DUD A;  3K0X A;  3I4M H;  2IT1 A;  2R7Z B;  1CM9 A;  1HRJ A;  1ET6 A;  2IX3 A;  2H4O A;  5K36 G;  4BA2 I;  2MO1 A;  2H5X A;  4FF1 A;  1WD0 A;  5CV4 A;  1XTD A;  1X9N A;  2Q2T A;  2JSO A;  1WCM H;  2VUM G;  1R4P B;  4BY1 G;  1PA6 A;  4DR6 L;  1U4R A;  1TWH B;  3KBX A;  4KJN A;  1KAW A;  1S5D D;  1RTO A;  1GUO A;  3OIQ A;  4RGT A;  2XRQ D;  2M9V A;  1PFS A;  2CKZ B;  2A69 C;  1XYI A;  2E2H H;  1TWH H;  3GP7 A;  3ERS X;  1JB3 A;  4K6D A;  4ALP A;  2HT1 A;  3A7A B;  3MTS A;  2VZA A;  3S1M B;  4L63 B;  4GOP C;  1VQK A;  2ICI A;  1SR3 A;  4TRD A;  2HHH Q;  2A1A A;  2UUA Q;  4ID6 A;  1QNK A;  1SND A;  5J22 A;  3H3V C;  4CDC C;  3GV6 A;  3S1M H;  1HNX Q;  3CKI B;  4KD4 A;  4X6A H;  4G7H C;  4B3M L;  2MHV A;  2EPB A;  3S9W A;  3E9H A;  3VR4 A;  2BDO A;  3OIP A;  1JWM D;  4JI4 L;  2EYJ A;  3QR8 A;  1DON A;  1NMF A;  2I5M X;  3HS0 C;  3WWV A;  3R3O A;  4YY3 Q;  3CCR A;  4LFB L;  2UXD L;  3A74 A;  5ELF A;  4QUF A;  5EBC A;  5C4J B;  4O2D A;  2B39 A;  4BBS G;  2UUC L;  1ONL A;  5HUR A;  4DV0 Q;  4OGQ C;  2NTT A;  1EFW A;  1V9P A;  1Y8P B;  2A74 C;  5IE8 A;  1UAP A;  2HQE A;  4BXX H;  4DK6 C;  1EYG A;  1NNX A;  1F9R A;  4C2M B;  1BBX C;  1BDO A;  4XIG S;  3ERO A;  4JOI A;  4Y7N B;  4FF4 A;  4KKS A;  2JEB I;  1I4G A;  3FKI H;  2QW7 A;  1EY8 A;  2FMC A;  1HNW Q;  4DAP A;  2UU9 L;  2A6H C;  1WVL A;  4GNX C;  2N88 A;  1XMO L;  4BY1 H;  4H44 C;  2XGT A;  1C9O A;  2OQK A;  1YHA A;  4A93 B;  1U4P A;  4DGZ A;  2LKV A;  2RVL A;  3NHH A;  4TSS A;  4JK1 C;  1Q81 C;  3VYT A;  1EEI D;  4RKL A;  5JJI A;  3LWU A;  4HIK A;  1RDP D;  3E0J A;  1KDC A;  1FR3 A;  1EQQ A;  2LXJ A;  3UDF A;  1SNQ A;  5GAH C;  3TP7 A;  3CCS A;  3D6C A;  2EQS A;  5DEH A;  4FF3 A;  1B4O A;  4FVM A;  1HQM C;  2IHF A;  4CDD C;  5IOD A;  3NWT A;  5J39 A;  4PNY A;  5IGE A;  4DAY B;  1JOR A;  3ND9 A;  1P16 A;  4PMW A;  5IGG A;  2UXB Q;  3TS0 A;  4R9W A;  4A3D H;  1CA5 A;  2JE6 I;  3D6W A;  3PO3 B;  2SOB A;  2AKW B;  4WJ3 M;  4GKK Q;  5CYU A;  5CGK A;  4B3T L;  2RDF A;  2Q2U A;  3PO3 H;  2EY2 A;  3K57 A;  1WTP A;  2JYO A;  4KKT A;  1BCP C;  2K52 A;  4BBS H;  5HY6 A;  2WP8 J;  3VR5 A;  2J4X A;  3QJY A;  3AYH B;  4JI8 L;  1JB7 A;  1NUC A;  4X65 L;  1PH8 A;  1GO3 E;  5FO7 B;  2Z9H A;  2XTI A;  3KLS X;  1PRT C;  1QG7 A;  3IL8 A;  5GAG C;  2HQL A;  1S40 A;  1LTT D;  1SN8 A;  2F4V Q;  3AMU A;  1IYJ B;  2EYF A;  1LUZ A;  3ITP A;  4K5W A;  1L0W A;  3SE0 A;  3VYU A;  2G9H D;  3MXP A;  4IZ8 A;  3SK6 A;  2K03 A;  1CI3 M;  2CHB D;  1H9S B;  2CWA A;  2RF4 A;  2BE5 C;  3A8J E;  4NXM L;  1OO9 B;  2PZT A;  2QEJ C;  3RUZ A;  1IL8 A;  5I4D A;  1LT4 D;  2IHE A;  4DV5 L;  2B2V A;  1CKM A;  1I4Q A;  3DXJ C;  1KDA A;  4DUZ L;  3M4O B;  2B3G A;  1NR2 A;  5FOB B;  4DPG A;  2A68 C;  4DV6 Q;  1D5Z C;  2OTJ A;  1H95 A;  2WAC A;  3R2T A;  5FK9 C;  2E5L Q;  2K6A A;  4IPG A;  1I50 B;  3E0E A;  4LAA A;  3LNN A;  3MFG A;  3U9S A;  1L2F A;  2NVT B;  2LXK A;  5LL6 X;  1E0B A;  5IT9 E;  4OX9 Q;  1V1Q A;  4LMQ D;  4IUT A;  5BN4 A;  4K8I A;  1QE6 A;  5M5W B;  4OWT B;  1JWU D;  5EQ0 A;  4PMC A;  1DYQ A;  2RCF A;  1J6Q A;  1PZJ D;  4DK3 C;  3LWE A;  4V19 0;  1IBK L;  1UUP A;  2B2T C;  2VB2 X;  5IP7 H;  3F2D A;  1PVO A;  1SNO A;  4YWK A;  4DAY A;  3OMC A;  4RHR A;  2NYZ D;  3CRK C;  2N3S A;  1IXR A;  4DNR B;  4APV A;  4K8J A;  4DV7 L;  4DR6 Q;  1O7L A;  4HSP A;  5JVG 3;  1TII D;  3NUC A;  3W1G A;  3GTL H;  1CHP D;  1VF7 A;  2Z6K C;  2AQ3 B;  4KI0 A;  3CXC A;  1G51 A;  1WTR A;  1C48 A;  1AZQ A;  2MO0 A;  2A69 D;  4A3M H;  4C3H G;  1TWC B;  4JBM A;  4LK1 C;  1HHV A;  3J81 E;  1D5M C;  4A3B G;  1T5X D;  2E75 C;  3DM1 A;  1Y8O B;  1Q8I A;  2EJG C;  3H91 A;  5KYI A;  3VA5 A;  4HJ5 A;  3BYY B;  2PZU A;  1I6H B;  1QZH A;  2EVB A;  1PH9 A;  1D2B A;  1EQV A;  1MSH A;  2B2U C;  4A3J G;  5C4X G;  1VQJ A;  3F1Z A;  1YI2 A;  1CUK A;  4HIO A;  4B3M Q;  3S2H B;  3FMC A;  2F0V A;  4UY8 C;  1HNZ Q;  1STH A;  4MTK A;  1NJI C;  1DD2 A;  1H9S A;  5ELO A;  1IL2 A;  1IW7 D;  4LFB Q;  4XQJ A;  5KRU A;  2HIV A;  4HMJ A;  3S2H H;  3RLN A;  1B8A A;  1KAA A;  3PIO 3;  4GN3 B;  2ZTE A;  3MHB A;  2F0E A;  1IKM A;  2RDH A;  5KND A;  2BH8 A;  3KK7 A;  3GTK H;  1ZXT A;  4IQZ A;  4A3E G;  3Q24 A;  3T53 B;  2EYM A;  2JXM B;  1RKN A;  1LTL A;  1PZI D;  1FNU A;  3C3L A;  1ASZ A;  1RCV D;  1IZ6 A;  1BO0 A;  1XMO Q;  5M3F G;  4X3T A;  1X3Q A;  2YTY A;  5IY0 A;  1ILP A;  1HA6 A;  2PQE A;  2O2L D;  3N6R A;  4ZKC B;  3NSW A;  2UUB L;  1XWE A;  1M90 C;  4K0K L;  1NY4 A;  4GN5 A;  4C3H H;  3TP8 A;  1DOL A;  1B9N A;  3ER0 A;  2DNE A;  1LAC A;  3FP9 A;  4K5V A;  4L8J A;  4NPS A;  5EKK A;  4Z9C B;  3SDZ A;  5JJK A;  1FGU A;  2XVS A;  5GAE C;  1YJ9 A;  3TN2 A;  2MP1 A;  3NWS A;  3URY A;  3A8K E;  1E24 A;  2MGS A;  4OXP A;  2R92 B;  4OWX B;  3MWY W;  3U4V A;  3K5M A;  3HOU B;  2SNS A;  4LWC A;  5COR A;  4ZUJ A;  5M5Y H;  1IYV A;  1EOV A;  3LX0 A;  1AN8 A;  4L5T A;  1NCV A;  1LT6 D;  2F0M A;  3NEL A;  3I72 A;  4H13 C;  4QJF A;  2JA8 G;  4CJ1 B;  1SYB A;  5C4X H;  5JJL A;  1KLU D;  3HOU H;  4ME3 A;  3CP0 A;  4C3J B;  3K6O A;  4DR5 L;  3EVQ A;  4EX5 A;  2Z0S A;  1VMC A;  3JAM E;  1XXG A;  1Z9F A;  3SK8 A;  1AZP A;  1Q12 A;  1D8L A;  1C4Q A;  3VYS A;  2KJX A;  5IOC A;  3BDO A;  3NTK A;  1GJX A;  2F0J A;  2NVQ B;  4RG1 A;  1TY2 A;  4FDB A;  4I7Z C;  1G6P A;  1YVC A;  2B2Y C;  2SNM A;  3SK5 A;  4DR7 L;  1P8L A;  2HHH L;  1R9T B;  3KLS A;  4HJ8 A;  1B2T A;  4L5R C;  1TY0 A;  3FDT A;  3OOC A;  4JI8 Q;  5AJ3 L;  2NVQ H;  2XSC A;  3PF4 A;  3E6Z X;  1HNX L;  1PRT D;  3BZK A;  4P74 A;  3F2C A;  3GD7 A;  3GTO H;  3GTG B;  3DWQ A;  4QMG A;  5EKI A;  3I91 A;  4R1J A;  2K4K A;  3HOZ B;  3DLL A;  2F4I A;  5KYL A;  3HKS A;  1LTA D;  1AW7 A;  1A3V A;  1PYB A;  2PW5 A;  4JI5 L;  4YY3 L;  3OSO A;  4JI7 Q;  3AEV A;  3KUP A;  3I4O A;  1XPO A;  4ME5 A;  1NMG A;  4NXM Q;  3HOZ H;  2NN6 I;  5IIF A;  1QOH A;  3Q8D A;  3W5O A;  2XRS D;  1ENF A;  3I56 A;  5L37 A;  3CME A;  2G9D A;  5CMD A;  4DV0 L;  5DNF A;  4KD3 A;  4XQQ A;  2K1B A;  1S5F D;  4JG2 A;  4DUZ Q;  1EY9 A;  3CHB D;  4KY6 A;  1SNP A;  2FMM A;  3BJU A;  1ML0 D;  1L1O B;  1PLF A;  2CVR A;  1RJT A;  3CF5 A;  1RIP A;  2FIN B;  4RHS A;  3J80 E;  1VQ8 A;  1TXY A;  1QIL A;  2D0O A;  1PTO F;  4PZ7 A;  1VQ7 A;  1A62 A;  1HNW L;  1OTC A;  4GS3 A;  4E6I A;  4U67 3;  1A6X A;  4DNI A;  2I46 A;  3V05 A;  4OIJ A;  4EQN A;  1FYC A;  3PF5 A;  4R4C A;  1K8O A;  5CV6 A;  4AYB G;  1VQG A;  4L5Q A;  3NP8 A;  3RN2 A;  1Y14 B;  4R4I A;  5ELC A;  2J7Z A;  3W3A A;  4GOP B;  1SBB B;  4WOR A;  2Y0S E;  3C2P A;  1WTH A;  5M3M H;  4B9X A;  2AWO A;  5C44 B;  3TDQ A;  1VQH A;  5C5L A;  2KA7 A;  3RMH A;  3GV3 A;  1M8A A;  1AH9 A;  1O78 A;  3OTO Q;  1PTO D;  4XXE A;  1KTK A;  5E4W C;  4KN4 C;  1U4L A;  3S1R H;  1KIX A;  1WTW A;  5C44 H;  1UEA B;  3HGB A;  3S17 B;  2JK8 A;  2IX1 A;  1ILQ A;  3PIP 3;  1K83 B;  3ERQ A;  4DR3 Q;  1II3 A;  3UDG A;  3I4M G;  3KDF B;  5IGD A;  3KJP A;  1ENC A;  4J6H A;  3ULL A;  2Z6B A;  1A8V A;  3CPW A;  2F0H A;  3S16 B;  4GLX A;  4ZCK A;  3CPF A;  5C6A A;  1WCM G;  1MHW C;  1JCK B;  1FVI A;  3SXH A;  2CQO A;  3CCM A;  1LTB D;  1SMY C;  1XNR L;  4N9T A;  3S16 H;  1FL0 A;  1YHB A;  1ICF B;  4GNX B;  2GA4 B;  4F8M A;  2CH4 A;  1K8M A;  1IBL Q;  1QUQ B;  2PMZ E;  2E8G A;  4ODG A;  2K5D A;  3SVM A;  4R4T A;  1HZB A;  5AFW A;  4IO9 A;  1HTL D;  3RN5 A;  2JA7 B;  1W2B A;  1WOC A;  4IUN A;  1CQF A;  1PH3 A;  2CQA A;  4B08 A;  2PPB C;  2K5N A;  4H0L C;  2PI2 A;  3VR3 A;  2RDG A;  1G2S A;  1LM0 A;  3F2B A;  1Y1W B;  1K73 C;  1L1O A;  2JA7 H;  2F0W A;  3K59 A;  4ZQ3 A;  4DV6 L;  1JJ2 A;  2F0S A;  4A3G B;  2EY1 A;  2N55 A;  3TP6 A;  5CV7 A;  1O7I A;  4BY7 H;  3KBG A;  4A3F H;  4CJ2 C;  3G6J B;  4DR2 L;  3R2I A;  3FPP A;  2NVX H;  4OX9 L;  4P71 A;  4DFA A;  3G6E A;  1VQC A;  1Q1B A;  3JC6 6;  2VW9 A;  2EDG A;  3DEP A;  1TWA B;  2DGY A;  1K3R A;  1FGB D;  3DEO A;  4K0K Q;  4GOP A;  4OWW B;  1OXS C;  4KN7 C;  1F77 A;  3ZJY C;  1EIG A;  1UE1 A;  4QIW B;  4BXX G;  5CBE E;  2IY5 B;  4BBR B;  2OTL A;  1E2V A;  2YV5 A;  1QVC A;  2DNC A;  1MIU A;  2WFW A;  5FKA C;  4DAM A;  4B3S L;  1ET9 A;  3FKI G;  3FPU B;  1SYC A;  1PRT B;  4LF7 L;  1CTM A;  3L0O A;  2R7Z H;  4ZAI A;  1UE6 A;  4MN3 A;  2JJQ A;  1X65 A;  1LAB A;  2JA5 B;  3MEH A;  1J5E L;  2PCF B;  5T1I A;  2N8N A;  3H15 A;  1Y1V B;  4DR5 Q;  1ZKO A;  3KDF A;  1PH4 A;  4TKO B;  4LFC L;  2KOL A;  4A93 G;  4P75 A;  2JA5 H;  1BBU A;  2EIF A;  2ZJR A;  1Y1V H;  1VQD A;  4KK7 A;  4MIU A;  4DR7 Q;  4RGM A;  3WDN A;  4JBW A;  1QNU A;  5AJ3 Q;  1HCZ A;  2VB3 X;  4CDF C;  1V1O A;  2WV6 D;  3IAY A;  4A3D G;  1PH1 A;  2I0Q A;  4GNX A;  1SJH D;  1HNZ L;  1STG A;  4A3C H;  1QUQ A;  2KCM A;  1YNJ C;  1HPC A;  2YYZ A;  4JI5 Q;  3QIA A;  2PO4 A;  4CDE C;  3PO3 G;  4HR7 B;  5C3W A;  1Z7T A;  1UE5 A;  4PQX A;  2M2L A;  2FXQ A;  2EY5 A;  1VQI A;  1WTV A;  2KEE A;  4JW0 A;  4J1M A;  1EOT A;  2Z8L A;  4P72 A;  1UNS A;  5C4J H;  3DWP A;  1EY0 A;  2R6G A;  2RBM A;  3OW7 A;  1ZYR C;  1N8R C;  4ILW A;  1KAB A;  2EXZ A;  2NN6 H;  2AQ2 B;  4JI1 L;  1PTO B;  2EXD A;  2K5Q A;  5IYD H;  2R93 B;  1CZW A;  2E74 C;  5GQO A;  3M85 A;  3ULJ A;  2RKS A;  4BS9 A;  4C2M H;  1PTO H;  5IWA L;  3O13 A;  2EYO A;  4Y7N H;  3GTJ B;  4EQP A;  4DR4 Q;  2YTX A;  3CU7 A;  4LF8 L;  4G7O C;  4GKJ Q;  2FFK B;  4QQB X;  3D4W A;  4IPC A;  3NEM A;  1TKW B;  3PUY A;  3NTI A;  1ENA A;  1CSQ A;  2A5H A;  3T13 A;  3GTJ H;  2SEB D;  3C46 A;  1KXL A;  4A93 H;  2L55 A;  1E22 A;  2O4X A;  4NB3 A;  1YZ6 A;  4IPD A;  4G57 A;  4R8N A;  5I6W A;  3KF6 B;  4KHZ A;  3CMA A;  3FVQ A;  1KNA A;  2R7F A;  1B70 B;  2C5C A;  2PZW A;  5JOB A;  4QCL A;  2R3Z A;  2L1B A;  4CBV A;  2L0C A;  4RFB A;  4HN7 A;  1BR9 A;  1OXT A;  3VA7 A;  2LY7 A;  3B6Y A;  4CKC A;  1DM0 B;  2CCZ A;  3J7A 5;  1SMX A;  5IGC A;  1K8G A;  1G91 A;  3H0G B;  4J15 A;  2YU9 B;  2ATW A;  4UP7 A;  5CV8 A;  1RD9 D;  4CKE A;  3I8Z A;  1QVG A;  1X3P A;  1TR5 A;  5GRO A;  5IP7 G;  4NDX A;  4XT3 B;  4JI2 Q;  3A7L A;  2F0T A;  3H0G H;  2AHO B;  1F9P A;  1CT1 D;  4JOI C;  4UP9 A;  2ZTD A;  4X3U A;  2K50 A;  2NBF A;  3X3N A;  4R4Q A;  4IAL A;  4KY7 A;  1VQ9 A;  1XNR Q;  1G8Z D;  4RKB A;  4UHV A;  5FO8 B;  4FXG C;  1DOK A;  1X3F A;  3SEB A;  4EGV A;  2NZO A;  5DM6 3;  5EGT A;  4A3M G;  5FLX E;  3K0Y A;  4JI7 L;  1EY5 A;  1KDB A;  2ZXO A;  3ZYY X;  3AQQ A;  4ULL A;  1HR0 Q;  4HCS A;  4K2K A;  1QZG A;  4C1N K;  1WJJ A;  4DNT B;  2ZM6 L;  1NSN S;  1Z6H A;  1LT5 D;  3UI2 A;  1FD7 D;  2O5J C;  3U58 A;  3NBI A;  3BDL A;  3RD4 A;  4X3K A;  2AQ1 B;  3HKZ B;  3PGZ A;  3SHL A;  3WOE A;  5GAD C;  3M4O H;  3H6M A;  1GHK A;  4N8F A;  3T1H Q;  3MC0 B;  4P73 A;  4DR2 Q;  2OT2 A;  3VR6 A;  1QJO A;  2GVA A;  1I50 H;  1IBM Q;  2MFI A;  3BVG A;  1GVP A;  1JR0 D;  4X66 Q;  2NVT H;  3STB C;  2VQF Q;  2OXP A;  2X6G A;  1GKH A;  2ES2 A;  3KF6 A;  2C35 B;  4ZUI A;  2EYL A;  3RLO A;  3CC2 A;  5M5W H;  3NXW A;  1EZ6 A;  2B2U A;  3KLW A;  5CV5 A;  4B3S Q;  3CQZ B;  3HOV B;  3X3M A;  4PMB A;  4RWS C;  1GHJ A;  4A3K B;  2BOS A;  1DGS A;  5JPN C;  2MNA A;  4LF7 Q;  2B63 B;  5A35 A;  3OTO L;  4L5S A;  1TT2 A;  1JOQ A;  5C3E B;  2Q2I A;  4XYO A;  2KEN A;  3QOL A;  3MZ5 A;  3K5N A;  3HOW B;  3D31 A;  4A3K H;  1J5E Q;  4AH6 A;  1I5F A;  1ASY A;  5C3E H;  1EY7 A;  1F2Z A;  3J81 i;  4DR3 L;  1E7Z A;  2B8F A;  4LFC Q;  2QKI C;  4JV5 L;  2OCE A;  4YCW A;  1CK1 A;  1TWF B;  2AUJ D;  3AFP A;  3I4N B;  2MQH A;  3AU7 A;  4OO1 I;  2RQX A;  1HUM A;  3EJI A;  1B9M A;  1I94 L;  3KFU A;  1TWC H;  3I4L A;  5I9O A;  1VQE A;  1OXV A;  3K5O A;  1VQO A;  1YHQ A;  3M7N A;  2ZJP A;  1TWF H;  4EQO A;  4RA8 A;  2WAQ B;  3I4N H;  4LNQ A;  4CHT B;  3PO2 B;  2VXW A;  1MBY A;  5IYC G;  3KJO A;  4YHH L;  4UPA A;  3HOU G;  1PYW D;  3ND8 A;  2KCN A;  5IYB H;  1I6H H;  1YNJ D;  1DJR D;  1Q3L A;  1RL2 A;  2F1M A;  5FJ8 H;  3PO2 H;  4Y52 H;  2K04 A;  1IBL L;  4K14 A;  1XPU A;  1WI5 A;  2DN8 A;  4LFA L;  3K81 C;  1JJC B;  5F2D A;  5A2Q L;  1EYD A;  2JEA I;  4QGU A;  2IJ0 A;  1K0R A;  3J81 j;  1KLG D;  3P7J A;  1Q82 C;  2CW0 C;  2CFM A;  3MXG A;  2YTV A;  1W6K A;  2K32 A;  5BN5 A;  2JA6 B;  1ZYR D;  4JPB W;  1B7Y B;  4NXN L;  5EPL A;  1SFO B;  4JI1 Q;  1X54 A;  3QO2 A;  1EQT A;  4OL7 A;  2LMC B;  1EWI A;  3FEW X;  1XX8 A;  2IX0 A;  2JA6 H;  4PZ8 A;  3NPP A;  4BWG B;  1HTP A;  3HG9 A;  4XYQ A;  2QEX A;  3J7A V;  2A6H D;  2HIX A;  2K5W A;  1SYG A;  2RSO A;  1SYE A;  5IWA Q;  3HOZ G;  3P1H A;  1EYA A;  4DR1 L;  1I4R A;  4LF8 Q;  1SYF A;  3E5S A;  3PCO B;  2R7D A;  3TZU A;  4HJA A;  1X32 A;  5J1Z A;  4JYA L;  2NWG A;  5IGB A;  3T16 A;  5I9P A;  1NE3 A;  2Z1C A;  1BXT A;  2F3I A;  1SE2 A;  1BCP F;  4IPH A;  3J7Y W;  1YNN C;  4DV1 Q;  2CH4 W;  1MD2 D;  2N78 A;  1EU4 A;  2PNR C;  2EOT A;  4ZLT F;  3A55 A;  3D4D A;  4YCV A;  3V2T A;  4A3I B;  1PRT F;  4PG3 A;  5H1S E;  3KYH C;  1SNC A;  1T9H A;  1DZ1 A;  2R92 H;  4POG A;  5IYC H;  2BA1 A;  4V0B A;  3JAM i;  1HH2 P;  1TWG B;  4A3I H;  1QB5 D;  1VCI A;  3M9B A;  5D65 A;  3MEF A;  4LUV A;  1C7Y A;  5M3M G;  3L9A X;  4AQY L;  1T5E A;  5KIX A;  1GUS A;  4KLK A;  4DF7 A;  1F9Q A;  1TWG H;  1BCP D;  4C3J H;  1A63 A;  1I4X A;  5CBA E;  5BR8 Q;  4RCN A;  2VQE L;  5M5X B;  2NZH A;  3HFZ B;  3E9I A;  3CC4 A;  4JI0 L;  2A73 B;  4G4K A;  5C44 G;  1VS0 A;  2B2W A;  3SR1 A;  1VQB A;  4CGY B;  1GXD C;  3G48 A;  2K33 A;  2WB1 B;  3CAM A;  3GDE A;  3W1B A;  1R9T H;  1WFQ A;  2K75 A;  1A15 A;  2TMP A;  1EU3 A;  1SYD A;  4IUV A;  4DU9 A;  2AWN A;  3S1Q B;  4FXD A;  3HRZ C;  2BE5 D;  2JP1 A;  2L4N A;  3GTG H;  4JBK A;  3HOY B;  1LTS D;  2Y0S B;  1JOO A;  4LF6 Q;  2ZM6 Q;  3E3X A;  1PH6 A;  2IL8 A;  4IJL A;  2QDL A;  1SXT A;  4I65 A;  3BVM A;  3GTP B;  1FJG Q;  5LMN Q;  2F0Q A;  2Q8R E;  2EYH A;  2A68 D;  3I2Z A;  5C0X I;  4HIM A;  3M4Q A;  2KCT A;  3J80 i;  3I7F A;  3GTP H;  4XTC S;  1A0I A;  3Q0A A;  1KL9 A;  1N9W A;  5FLX c;  3AFQ A;  2IPK D;  3UDI A;  4WFN 3;  1GOZ A;  1ICW A;  1JIC A;  4YCU A;  2E2I B;  1EFI D;  4DV2 L;  1KC8 C;  4JBJ A;  5JEA J;  3K7U C;  4HTH A;  2HD3 A;  4FP5 D;  2L5T A;  5DM7 3;  3EIV A;  3K7A B;  2XWB B;  3GTM B;  4DR4 L;  3M7G A;  4WRD A;  3RLF A;  1JC7 A;  4GKJ L;  3CRL C;  1DOM A;  5BN3 A;  4PZ6 A;  3STB D;  1NR4 A;  4CJ0 B;  2ASB A;  3MXU A;  4RAU C;  1Y8N B;  5FO9 B;  1CA6 A;  1AE3 A;  2JA7 G;  4QL5 A;  1CSP A;  1GUW A;  3J7A F;  1G2T A;  4HSV A;  2PW7 A;  2WKD A;  1HXY D;  1LYL A;  3KF8 B;  4WJW A;  3GQB A;  4BY7 G;  4A3F G;  1TU2 B;  3VDY A;  2KED A;  1I3Q B;  3HOX B;  3BZD B;  1I4H A;  1K28 A;  3PIO A;  3I55 A;  4DUY L;  3D0F A;  5IT9 c;  2PMZ B;  1DCZ A;  2A19 A;  2A6E C;  2L15 A;  1I3Q H;  4GN4 B;  3RZD B;  4N9P A;  4DXF A;  1WTQ A;  1SDF A;  3HZX A;  5D14 A;  5JEA G;  1JJG A;  3PSI A;  4JV5 Q;  4B3R L;  3S17 H;  1GUN A;  1O7Z A;  1I94 Q;  3UE0 A;  3EN2 A;  1K83 H;  4C3I B;  4JI2 L;  3DHQ A;  2D2C C;  3K8A A;  3NEN A;  2R7Z G;  4G7Z C;  4RCO A;  3S15 B;  4LUZ A;  2D5D A;  1PZK D;  4IFD I;  4C3I H;  1BNZ A;  4OO1 H;  4A3L H;  5KGU A;  4O42 A;  4YHH Q;  4R8I A;  4MZ9 A;  4DK0 A;  1UEB A;  3L2P A;  4IOA A;  3VR2 A;  3NTH A;  3N52 A;  2K01 A;  2JA5 G;  4LW1 A;  2VY3 A;  3PUZ A;  3CW2 C;  2ZT9 C;  4MTN A;  4LFA Q;  3J81 c;  3M3Y B;  1Y1V G;  5IP9 H;  4DV3 L;  1HR0 L;  3KLR A;  3UE1 A;  1VQ4 A;  1X3G A;  1E1T A;  4M1U B;  1S5E D;  1O7Y A;  2BCO A;  2CW0 D;  1Q1E A;  4H7B A;  4HJ9 A;  1I4P A;  2HCC A;  4NXN Q;  1M4V A;  1YNX A;  3NBH B;  5G3L D;  4UDU C;  1GD7 A;  4A3C G;  3I90 A;  3PV0 A;  1Y1W H;  3BVZ A;  3T1H L;  1U0L A;  1WYD A;  2VNU D;  5TSS A;  4A3G H;  1A3T A;  1IBM L;  4DR1 Q;  3NK9 A;  3TSS A;  3EBE A;  4X66 L;  1A2T A;  4KTA A;  4O1N A;  2UXC Q;  2I07 B;  4DXG A;  1IHZ A;  1BCP B;  4JYA Q;  5JEA H;  1TWA H;  1X6O A;  2VQF L;  1TS3 A;  2NN6 G;  1BBW A;  4Q5V A;  1YNN D;  2NVY B;  3KF8 A;  4DK1 A;  3T4A C;  1SE3 A;  5IYD G;  3M4Y A;  1DXM A;  2KQ3 A;  4TVA B;  3PUX A;  4PV1 C;  4BBR H;  2NB0 A;  1OXU A;  2K28 A;  3CCV A;  1K8A C;  1L0Y B;  2NVY H;  3GO5 A;  4AYB E;  3QG1 A;  2ZTC A;  4YWM A;  5I2X A;  4LF5 L;  2LFN A;  2R93 G;  1Q90 A;  4KHV A;  2XIW A;  1BF4 A;  3T1Y L;  1STA A;  1WCM B;  2GVB A;  3HP3 A;  4QF4 A;  3U9O A;  4C56 C;  3PMF A;  1EWH A;  5IT9 L;  4UP8 A;  2QA4 A;  4AQY Q;  1EZ8 A;  2B8G A;  3L3O C;  1HR0 W;  1FNV A;  2EE1 A;  3TRZ A;  1L1O C;  4EQ5 A;  4KV6 A;  2VQE Q;  2E2H B;  4JI3 L;  1U5K A;  2VS1 A;  1LTR D;  1E2Z A;  4JI0 Q;  1B3Q A;  4ZYS A;  1RF2 D;  4MHE A;  4QB4 A;  3H94 A;  1ROD A;  4HJ7 A;  2H1E A;  3NQI A;  1LTG D;  2F0N A;  4IFD J;  1MKH A;  1SSO A;  4KJO A;  3VYR A;  2KCC A;  4NW2 A;  1YJW A;  1RHP A;  4RGO S;  3JAM c;  4QIW E;  2XN9 C;  3TBI B;  3TQY A;  1STY A;  3H0G G;  5EJW A;  3U4Z A;  2RCN A;  1HZA A;  3OYY A;  4LF4 L;  4DA2 A;  3I70 A;  4DAV A;  3FHW A;  1EIY B;  3J81 L;  1HJP A;  3PIP A;  3NBH A;  1BKB A;  2BA0 A;  4ZKB B;  2KUM A;  3G4S A;  2D62 A;  3NE5 B;  4AIM A;  2L12 A;  4NKL A;  2KHS A;  1IW7 C;  1X55 A;  1JWS D;  1CHQ D;  1N36 L;  1IYU A;  4IFD G;  5C0X H;  1EL0 A;  1LT3 D;  2F0L A;  4DV2 Q;  4JI6 Q;  4P2C B;  1AP0 A;  3FKI B;  2R93 H;  2N49 A;  1F2L A;  3L7Z C;  1PFN A;  1YBY A;  2VUM B;  4BY1 B;  2PYK A;  4XDX A;  3EA6 A;  1CFM A;  5K36 H;  1VQM A;  4FO2 A;  5JJZ A;  1A3U A;  4IUR A;  4IN3 A;  4DV1 L;  2VUM H;  3DUZ A;  1JT8 A;  5COY A;  3J80 c;  4N8X 1;  3ULP A;  3HKZ G;  1PH2 A;  5EPK A;  1GM5 A;  2I5L X;  4DUY Q;  2JA9 A;  1FNW A;  2A6E D;  4Q0F A;  4XQN A;  4L6T B;  3IRB A;  1B50 A;  2Q8I B;  2L9H A;  2DY8 A;  2E76 C;  3OMG A;  3ONA B;  3K58 A;  3CCJ A;  1PDQ A;  4A3D B;  4GZY C;  1EIF A;  4B3R Q;  1A2U A;  4OHJ A;  2V4D A;  2DY7 A;  5DLQ E;  5BR8 L;  2YU9 H;  1E3P A;  1STB A;  2K7V A;  1AE2 A;  3S14 B;  3QB3 A;  3IFT A;  1Q8K A;  3U50 C;  1XNQ Q;  2F3W A;  2ALY B;  1KRS A;  3K5L A;  1SMY D;  1YEZ A;  2RSN A;  3HOV G;  1V8Q A;  3D4R A;  3LGJ A;  4HCE A;  4A3K G;  4BBS B;  2V1C C;  3S14 H;  3Q23 A;  4O0A A;  1I6V C;  2B63 G;  1B1Z A;  5C3E G;  1YJN A;  2F0G A;  1VQL A;  2PNH A;  4KHP L;  1HZC A;  2NUC A;  1PMR A;  3HOW G;  5ELE A;  1EY6 A;  1KNE A;  1Z47 A;  2EYP A;  4IFD H;  1QVF A;  1E2W A;  3OHX C;  1K9M C;  2KHI A;  5CR3 A;  4DV3 Q;  4LF6 L;  3MA2 B;  2F0K A;  1WTX A;  2B2T A;  4A75 A;  3I4N G;  3PUV A;  1FJG L;  3JAM L;  5LMN L;  1H9K A;  1J9O A;  1VQA A;  1ESR A;  4YWL A;  3TME A;  1XPR A;  3MAQ A;  5IYB G;  2WAQ G;  2Z6K A;  5FJ8 G;  2PQA B;  3PO2 G;  1PFM A;  4R4O A;  4IUU A;  2K5V A;  4NMZ A;  1XTC D;  1HUN A;  1JQY D;  4HAE A;  2RHQ B;  4FXK C;  2K05 A;  1LTI D;  3HEJ A;  4MNO A;  4LF9 L;  5FLM G;  1XMQ L;  4J8Q A;  1O80 A;  1D5X C;  1EWC A;  1SJE D;  1YIJ A;  1OXX K;  1MJE A;  3OW2 A;  1EYC A;  1CQV A;  4ABN A;  4X62 L;  3BS1 A;  1KD1 C;  1S72 A;  3V96 A;  4M8A A;  2J0T D;  3H09 A;  2NTS A;  3H3V I;  2F0I A;  3A5U A;  1NTG A;  4BA1 I;  3P20 A;  3C1E A;  1S3O A;  2JA6 G;  2I5H A;  1XJV A;  1CKN B;  1N34 L;  1PV4 A;  5EAY A;  4KMU C;  1KQS A;  1U4M A;  2KBN A;  3P75 A;  3Q6S A;  1K3B C;  2EZV A;  3CQZ H;  4LF5 Q;  3HOV H;  2QCP X;  2AMC B;  5DAU A;  1PYS B;  1B3A A;  1ZEQ X;  5J3B A;  1KRT A;  5ELD A;  1SLJ A;  1SNM A;  3J80 L;  3T1Y Q;  2B63 H;  2WII B;  3C1F A;  3MFY A;  5EKL A;  1JE5 A;  2B2V C;  1Q7Y C;  1F2Y A;  3GTL B;  3HOW H;  5E3F A;  1D1I A;  2P5Z X;  2HDL A;  3MVV A;  4X64 L;  1B44 D;  3AB9 A;  4A3M B;  1PTO C;  1G29 1;  3BZC A;  3HKZ E;  4A76 A;  4DV4 L;  3OWE B;  1NAP A;  1SE4 A;  4JI3 Q;  4HID A;  5C3X A;  5LMN W;  3CCE A;  4X3S A;  4F88 A;  3S24 A;  2F52 A;  4LUO A;  2R92 G;  2AUK A;  3F2U A;  2ENB A;  4EVO A;  5NUC A;  3S1N B;  4A3I G;  2M00 A;  5JVH 3;  3A0J A;  1SE8 A;  5EBD A;  1S5C D;  1M1K C;  1YIT A;  4C3J G;  3S1N H;  5FLM H;  5LMU L;  1L0X B;  3S2D B;  3G71 A;  1BQQ T;  4LF4 Q;  4YIJ A;  4QUC A;  3BYT B;  2X69 A;  1J8I A;  5JAV A;  2TSS A;  1D7Q A;  4HMI A;  2JN4 A;  4JI4 Q;  3S2D H;  1N32 L;  2KEC A;  2JQO A;  4JCV E;  3A54 A;  3A56 A;  2G5D A;  2PQA A;  1MSG A;  1TVX A;  2Q2H A;  3QWN A;  5ELN A;  1VQN A;  2UXD Q;  1N36 Q;  3GTK B;  2WIN B;  1D6E C;  2UUC Q;  2WB1 G;  1SFO H;  1R4Q B;  2F0F A;  3PQI A;  1MGS A;  3BU2 A;  3HOY G;  3WOF A;  2B2Y A;  1BVS A;  2CWP A;  2MPM A;  2Y0S G;  2UXC L;  5KNC A;  2WAQ E;  2ZXR A;  5D3I B;  1LLR D;  2F0U A;  4K5X A;  2NZ1 D;  1N33 L;  1JE4 A;  1TS4 A;  1SEB D;  2UU9 Q;  1CKN A;  4C3H B;  5HGT A;  2O5I C;  1S4Z A;  1STN A;  1E1O A;  4FF2 A;  1W6J A;  4JVZ A;  3QOJ A;  4A3B B;  1X3E A;  5HGQ A;  1V1P B;  1EY4 A;  4I7A A;  1W3S A;  1PH5 A;  1HFN A;  1GUG A;  2EY6 A;  4S3S A;  4KY5 A;  2X6L A;  5M5Y B;  4XT1 B;  4A3B H;  3T56 B;  2F0P A;  3EFX D;  1PH7 A;  3BG3 A;  4RGN A;  1LO5 D;  1G6Z A;  3A5Z B;  2Q8T A;  4A3J B;  5C4X B;  1JOK A;  4C1N I;  2ZXP A;  1Y69 U;  3R8B A;  2OQ0 A;  1AEX A;  2XWJ B;  4A4I A;  1TS2 A;  2OEO A;  1MJC A;  1NBW A;  1JMC A;  2HDM A;  2KHJ A;  4OON A;  4A3J H;  4IJH A;  3CD6 A;  4IUP A;  3TP5 A;  4NP5 A;  1CZG A;  2E2J B;  1BUV T;  5M5X H;  4FYD A;  2IW3 A;  3HOX G;  3CCU A;  3CCQ A;  4B3T Q;  1STE A;  4KHP Q;  2BH2 A;  1TS5 A;  2E2J H;  3NQT A;  1BOS A;  3G7L A;  3GTO B;  4A3E B;  3DMU A;  2MJ8 A;  1HQR D;  4F7X A;  1D1K A;  3I3C A;  2UUA L;  2ZJQ A;  2F03 A;  3DWA A;  5D3D A;  4X65 Q;  1PHJ A;  4ZK9 B;  4ZRZ A;  5IGF A;  1GUT A;  3S1Q H;  4POF A;  4A3E H;  4K2L A;  4RMF A;  3HOY H;  2KVM A;  2QGQ A;  1K0S A;  4C3I G;  5M3F B;  1B53 A;  4OO1 G;  4A3L G;  5EPJ A;  3RR5 A;  4K6L A;  1SAP A;  3CC7 A;  3R93 A;  2R61 A;  5M3F H;  1V43 A;  3OWF A;  5C5M A;  2FHT A;  3J7Z C;  2B29 A;  4DV5 Q;  2K14 A;  4GLV B;  2HCI A;  3K80 C;  1XMQ Q;  4LF9 Q;  1C0A A;  5IP9 G;  2D0P A;  2OWO A;  1RTN A;  4JC0 A;  4JI6 L;  3GTQ B;  2EJF C;  4OEM B;  3MXN B;  2RHS B;  4X62 Q;  1H9R A;  1IKL A;  3TEH B;  2E2I H;  1QWY A;  3PUW A;  3FRP B;  1KHI A;  3GTQ H;  1HA5 A;  5I2Y A;  4IOC A;  1EEF D;  2L11 A;  3K7A H;  5C4H A;  3GTM H;  2JA8 B;  2B2W C;  2QF7 A;  4DN4 M;  2WB1 E;  5ISR A;  2OF1 A;  3SGI A;  1Y1W G;  3A8I E;  1N34 Q;  1V1P A;  5M3M B;  2QIL A;  1ESF A;  1F9S A;  2JA8 H;  4DKA C;  3H3V H;  4A3G G;  1VQ5 A;  5E1F A;  1HZ9 A;  3RNU A;  2LSS A;  5E4X A;  4CKB A;  3T51 B;  3HOX H;  1SRO A;  1IBK Q;  3S1R B;  4U68 A;  1X56 A;  2PI2 E;  2IWH A;  3OPO A;  3RZO B;  1VF5 C;  4X64 Q;  4FNF A;  2WKC A;  2K5H A;  3D8G A;  5CC4 A;  3RZD H;  1SRU A;  3CCL A;  5T1G A;  3F8T A;  2DJF C;  4DV7 Q;  2UXB L;  4DV4 Q;  5ELB A;  1MI2 A;  4BBR G;  1Q46 A;  3RZO H;  5A2Q E;  1AFP A;  4IUQ A;  1XNQ L;  1WD1 A;  1VDZ A;  2F3V A;  4LJZ C;  2D9U A;  4GKK L;  1PXU A;  5G3L F;  1EIH A;  2XNA C;  5LHY 1;  5M9O A;  1U9R A;  1TQO A;  2ID0 A;  2SDF A;  4OIK A;  5E7N A;  4RH6 A;  1VQ6 A;  4UAI A;  3S15 H;  2C9O A;  3TRE A;  3TS2 A;  1EQR A;  4GLA C;  5LMU Q;  5I6Y A;  5CV9 A;  1QCB D;  4B9W A;  2BDN A;  3D3R A;  3IFD A;  1VQF A;  3Q22 A;  4QY7 A;  3M3Y H;  1HFG A;  2QDB A;  4TQU S;  2GN5 A;  2F4V L;  1N32 Q;  2VL6 A;  5KEE A;  4AYB B;  2RA4 A;  1LV9 A;  5C0X J;  2EJM A;  3SK4 A;  5K5P A;  1VQP A;  5LL6 S;  5JPM C;  1WTO A;  2Z4I A;  3IKJ A;  1UE7 A;  3I73 A;  2HUG A;  2F0D A;  4HED A;  3ICE A;  2DJG C;  3M4P A;  3MXN A;  1VMP A;  1PFB A;  1EUJ A;  3DM3 A;  1F2M A;  1H9J A;  4BY7 B;  2E2D C;  4A3F B;  2ICE C;  1C8C A;  5FLX L;  1S5B D;  5KNB A;  2NVX B;  2E5L L;  2MUY A;  1Q86 C;  4F87 A; 
#chains in the Genus database with same CATH homology
 3I56 A;  2A8V A;  1CKO A;  1N33 Q;  3CME A;  3UDX A;  5IYC G;  3KJO A;  3CCJ A;  3KOJ A;  4YHH L;  4UPA A;  1EIF A;  4DV0 L;  3HOU G;  4B3R Q;  4JG2 A;  4DUZ Q;  5IYB H;  4H02 A;  1I6H H;  1RL2 A;  5FJ8 H;  5C0X G;  2UUB Q;  3PO2 H;  4Y52 H;  1IBL L;  3BJU A;  1UWV A;  5DLQ E;  1XPU A;  1WI5 A;  1L1O B;  5BR8 L;  2YU9 H;  1E3P A;  4WJ4 A;  1AE2 A;  3CF5 A;  4LFA L;  3K81 C;  1RIP A;  1JJC B;  1Q8K A;  3U50 C;  2DUD A;  1TXY A;  1VQ8 A;  3K0X A;  2D0O A;  1XNQ Q;  2ALY B;  3I4M H;  2JEA I;  1KRS A;  2IT1 A;  4QGU A;  4PZ7 A;  1YEZ A;  1A62 A;  1VQ7 A;  3HOV G;  1K0R A;  1HNW L;  1OTC A;  3LGJ A;  4GS3 A;  4DNI A;  3J81 j;  4A3K G;  2V1C C;  3S14 H;  1Q82 C;  4O0A A;  5K36 G;  2B63 G;  4BA2 I;  2MO1 A;  2CFM A;  2H5X A;  3PF5 A;  2YTV A;  5C3E G;  1XTD A;  1YJN A;  4R4C A;  1X9N A;  2Q2T A;  4AYB G;  1VQL A;  2PNH A;  4KHP L;  1B7Y B;  1HZC A;  1VQG A;  1WCM H;  4L5Q A;  4NXN L;  2VUM G;  4BY1 G;  1PA6 A;  3HOW G;  3RN2 A;  4DR6 L;  1Y14 B;  4R4I A;  4JI1 Q;  1X54 A;  1Z47 A;  1KAW A;  4GOP B;  1QVF A;  2Y0S E;  5M3M H;  1EWI A;  2KHI A;  4DV3 Q;  2IX0 A;  1K9M C;  4LF6 L;  2JA6 H;  4PZ8 A;  2AWO A;  1PFS A;  2CKZ B;  2QEX A;  2HIX A;  4A75 A;  2E2H H;  1TWH H;  3I4N G;  3PUV A;  5IWA Q;  1VQH A;  3HOZ G;  1FJG L;  5LMN L;  3ERS X;  1VQA A;  4ALP A;  4YWL A;  4DR1 L;  1AH9 A;  3OTO Q;  2HT1 A;  4LF8 Q;  2VZA A;  3PCO B;  3S1R H;  1KIX A;  5C44 H;  4GOP C;  2R7D A;  1XPR A;  1VQK A;  5IYB G;  2WAQ G;  4HJA A;  4JYA L;  1SR3 A;  2Z6K A;  2HHH Q;  5FJ8 G;  2A1A A;  2PQA B;  2UUA Q;  3PO2 G;  2JK8 A;  4R4O A;  2IX1 A;  2K5V A;  1NE3 A;  2F3I A;  2RHQ B;  4IPH A;  3S1M H;  4DR3 Q;  1HNX Q;  3UDG A;  4X6A H;  4DV1 Q;  4MNO A;  4LF9 L;  5FLM G;  1XMQ L;  2N78 A;  4B3M L;  3I4M G;  3E9H A;  3KDF B;  3KJP A;  1YIJ A;  1OXX K;  1MJE A;  3OW2 A;  3ULL A;  4JI4 L;  4YCV A;  4X62 L;  1KD1 C;  1A8V A;  3CPW A;  1NMF A;  2I5M X;  4PG3 A;  3WWV A;  4YY3 Q;  5H1S E;  3KYH C;  3CCR A;  1S72 A;  4LFB L;  1T9H A;  4GLX A;  3CPF A;  2R92 H;  2UXD L;  3A74 A;  4POG A;  1WCM G;  5IYC H;  3A5U A;  4O2D A;  3H3V I;  1NTG A;  2BA1 A;  4BA1 I;  1FVI A;  1HH2 P;  1S3O A;  2CQO A;  3JAM i;  1VCI A;  3M9B A;  3CCM A;  4A3I H;  2UUC L;  4BBS G;  3MEF A;  4LUV A;  1XNR L;  1C7Y A;  3S16 H;  5M3M G;  1FL0 A;  4DV0 Q;  2JA6 G;  2I5H A;  1EFW A;  1XJV A;  1V9P A;  1YHB A;  4AQY L;  1CKN B;  1N34 L;  1PV4 A;  5IE8 A;  4GNX B;  4KLK A;  5EAY A;  1KQS A;  4BXX H;  1TWG H;  4C3J H;  1A63 A;  2KBN A;  4DK6 C;  1EYG A;  1IBL Q;  5BR8 Q;  1QUQ B;  2VQE L;  2PMZ E;  3CQZ H;  2NZH A;  2E8G A;  4LF5 Q;  3HOV H;  3HFZ B;  4XIG S;  3E9I A;  4JOI A;  4R4T A;  3CC4 A;  2AMC B;  4JI0 L;  1HZB A;  2JEB I;  1PYS B;  4IO9 A;  1KRT A;  5J3B A;  3FKI H;  1SLJ A;  5C44 G;  3RN5 A;  3T1Y Q;  1VS0 A;  1WOC A;  1W2B A;  2B63 H;  1PH3 A;  1HNW Q;  1JE5 A;  1VQB A;  1Q7Y C;  2K5N A;  2UU9 L;  2PI2 A;  3G48 A;  1XMO L;  4GNX C;  3GDE A;  3CAM A;  4BY1 H;  3HOW H;  3W1B A;  1R9T H;  2XGT A;  1C9O A;  1LM0 A;  1WFQ A;  2K75 A;  2OQK A;  4X64 L;  1YHA A;  3F2B A;  1K73 C;  1L1O A;  2JA7 H;  1Q81 C;  4DV6 L;  1G29 1;  2AWN A;  3BZC A;  3HKZ E;  4A76 A;  1JJ2 A;  4DV4 L;  3GTG H;  4HIK A;  4JI3 Q;  4HID A;  4JBK A;  5JJI A;  5LMN W;  3CCE A;  3S24 A;  1EQQ A;  1O7I A;  4BY7 H;  4LF6 Q;  2F52 A;  2LXJ A;  4LUO A;  3UDF A;  4A3F H;  2ZM6 Q;  5GAH C;  4DR2 L;  2R92 G;  1PH6 A;  3CCS A;  2NVX H;  4OX9 L;  2EQS A;  4P71 A;  4IJL A;  3G6E A;  1VQC A;  1Q1B A;  3JC6 6;  2VW9 A;  1FJG Q;  5LMN Q;  2IHF A;  4A3I G;  2DGY A;  1K3R A;  3I2Z A;  3A0J A;  5C0X I;  4HIM A;  4DAY B;  3M4Q A;  2KCT A;  1SE8 A;  4K0K Q;  1P16 A;  4PMW A;  3J80 i;  4GOP A;  3TS0 A;  4OWW B;  3I7F A;  2UXB Q;  1OXS C;  3ZJY C;  4A3D H;  1M1K C;  1UE1 A;  3GTP H;  2JE6 I;  4XTC S;  1YIT A;  4BXX G;  1A0I A;  3S1N H;  5FLM H;  5LMU L;  2OTL A;  2IY5 B;  3G71 A;  1KL9 A;  1N9W A;  2AKW B;  5FLX c;  4WJ3 M;  3AFQ A;  2YV5 A;  1QVC A;  4GKK Q;  3UDI A;  4LF4 Q;  1MIU A;  2WFW A;  4DAM A;  4B3S L;  1D7Q A;  4YCU A;  4DV2 L;  3FKI G;  4JBJ A;  5JEA J;  1KC8 C;  3K7U C;  4B3T L;  2Q2U A;  3PO3 H;  4LF7 L;  3EIV A;  4JI4 Q;  3S2D H;  4DR4 L;  3L0O A;  2R7Z H;  1N32 L;  3RLF A;  1UE6 A;  4GKJ L;  2JQO A;  4JCV E;  4PZ6 A;  3STB D;  2ASB A;  2K52 A;  2PQA A;  4BBS H;  2JJQ A;  2Q2H A;  1X65 A;  1AE3 A;  5HY6 A;  2WP8 J;  5ELN A;  1VQN A;  2JA7 G;  4QL5 A;  1J5E L;  2UXD Q;  1CSP A;  3AYH B;  4JI8 L;  2N8N A;  1N36 Q;  1JB7 A;  4X65 L;  3H15 A;  1LYL A;  4DR5 Q;  2UUC Q;  2WB1 G;  1PH8 A;  1GO3 E;  3KDF A;  2XTI A;  1PH4 A;  1SFO H;  4LFC L;  3KF8 B;  4BY7 G;  4A93 G;  4P75 A;  2JA5 H;  1BBU A;  2HQL A;  5GAG C;  2EIF A;  3VDY A;  4A3F G;  1S40 A;  1SN8 A;  2F4V Q;  1IYJ B;  2ZJR A;  1LUZ A;  1L0W A;  3PIO A;  3BU2 A;  1Y1V H;  3I55 A;  1VQD A;  4DUY L;  3HOY G;  1BVS A;  2CWP A;  3D0F A;  5IT9 c;  2CWA A;  4DR7 Q;  2Y0S G;  2UXC L;  2RF4 A;  2A19 A;  2WAQ E;  2L15 A;  4NXM L;  1I3Q H;  4GN4 B;  4JBW A;  5AJ3 Q;  2IHE A;  4A3D G;  4DV5 L;  1N33 L;  5JEA G;  1CKM A;  2UU9 Q;  1PH1 A;  1CKN A;  1JJG A;  2I0Q A;  4GNX A;  3PSI A;  4JV5 Q;  4B3R L;  1E1O A;  4DUZ L;  3S17 H;  1HNZ L;  2B3G A;  4A3C H;  1QUQ A;  1X3E A;  4DPG A;  2KCM A;  5HGQ A;  1I94 Q;  3UE0 A;  3EN2 A;  1K83 H;  4DV6 Q;  4JI2 L;  2OTJ A;  1H95 A;  2YYZ A;  4JI5 Q;  1W3S A;  1PH5 A;  3PO3 G;  2E5L Q;  3K8A A;  3NEN A;  4IPG A;  2R7Z G;  3E0E A;  1UE5 A;  4A3B H;  2FXQ A;  4LUZ A;  4IFD I;  1VQI A;  4C3I H;  1PH7 A;  1L2F A;  2LXK A;  4A3L H;  4OX9 Q;  1V1Q A;  4YHH Q;  3A5Z B;  4MZ9 A;  4P72 A;  5C4J H;  1UEB A;  3L2P A;  2OQ0 A;  2R6G A;  4IOA A;  4OWT B;  1N8R C;  4A4I A;  2JA5 G;  4JI1 L;  1MJC A;  2VY3 A;  3PUZ A;  3CW2 C;  1NBW A;  2EXD A;  4LW1 A;  4MTN A;  4LFA Q;  3J81 c;  1JMC A;  4OON A;  2KHJ A;  4A3J H;  1J6Q A;  4IJH A;  1Y1V G;  3CD6 A;  5IP9 H;  4DV3 L;  4DK3 C;  3UE1 A;  1HR0 L;  1VQ4 A;  5IYD H;  1IBK L;  1X3G A;  5GQO A;  3M85 A;  1E1T A;  3ULJ A;  5IP7 H;  4C2M H;  5M5X H;  3F2D A;  3HOX G;  5IWA L;  3CCU A;  1Q1E A;  1PVO A;  3CCQ A;  4Y7N H;  4B3T Q;  4YWK A;  4HJ9 A;  4DR4 Q;  2YTX A;  4KHP Q;  4LF8 L;  2BH2 A;  4NXN Q;  4GKJ Q;  2E2J H;  4QQB X;  2N3S A;  4IPC A;  1YNX A;  1IXR A;  3NBH B;  4APV A;  4DV7 L;  4DR6 Q;  3NEM A;  3PUY A;  3W1G A;  1GD7 A;  3GTL H;  1CSQ A;  2Z6K C;  4A3C G;  4KI0 A;  2UUA L;  2ZJQ A;  3CXC A;  3GTJ H;  1KXL A;  1G51 A;  4A93 H;  1E22 A;  3PV0 A;  4X65 Q;  1Y1W H;  3T1H L;  2MO0 A;  1PHJ A;  4A3M H;  4NB3 A;  1YZ6 A;  1U0L A;  1WYD A;  4IPD A;  4POF A;  4JBM A;  3S1Q H;  3KF6 B;  4KHZ A;  2VNU D;  3CMA A;  4A3E H;  4A3G H;  4RMF A;  2R7F A;  3HOY H;  1B70 B;  4A3B G;  2QGQ A;  1IBM L;  4DR1 Q;  4OO1 G;  4A3L G;  3EBE A;  4X66 L;  1OXT A;  3RR5 A;  2UXC Q;  3CC7 A;  4JYA Q;  3B6Y A;  4HJ5 A;  1TWA H;  1X6O A;  2VQF L;  1QZH A;  5M3F H;  1V43 A;  2CCZ A;  2NN6 G;  1BBW A;  1SMX A;  1K8G A;  3J7A 5;  3J7Z C;  2B29 A;  1PH9 A;  4DV5 Q;  4J15 A;  2K14 A;  4UP7 A;  4A3J G;  2ATW A;  4GLV B;  1VQJ A;  3F1Z A;  3K80 C;  1XMQ Q;  1YI2 A;  1CUK A;  5IP9 G;  2D0P A;  5IYD G;  4HIO A;  2OWO A;  4B3M Q;  4JC0 A;  4JI6 L;  1C0A A;  1QVG A;  4UY8 C;  4TVA B;  3PUX A;  1HNZ Q;  3MXN B;  4BBR H;  1OXU A;  5GRO A;  3CCV A;  5IP7 G;  1NJI C;  2RHS B;  4X62 Q;  1K8A C;  2NVY H;  3GO5 A;  5ELO A;  4JI2 Q;  2ZTC A;  3H0G H;  4YWM A;  2AHO B;  4AYB E;  1IL2 A;  3TEH B;  4LFB Q;  4LF5 L;  2E2I H;  2HIV A;  2R93 G;  3PUW A;  4JOI C;  4UP9 A;  1KHI A;  3GTQ H;  3S2H H;  5C4X G;  2ZTD A;  4IOC A;  3RLN A;  3K7A H;  1B8A A;  3T1Y L;  3GTM H;  2K50 A;  4R4Q A;  2GVB A;  4GN3 B;  2ZTE A;  1VQ9 A;  1XNR Q;  2WB1 E;  1X3F A;  3SGI A;  4UP8 A;  1Y1W G;  2QA4 A;  2NZO A;  4AQY Q;  4A3M G;  1N34 Q;  1HR0 W;  3TRZ A;  2BH8 A;  1L1O C;  2JA8 H;  3GTK H;  4DKA C;  4EQ5 A;  4A3E G;  3H3V H;  4A3G G;  1VQ5 A;  2VQE Q;  1HZ9 A;  4JI7 L;  4JI3 L;  1U5K A;  3RNU A;  2LSS A;  2VS1 A;  3AQQ A;  4JI0 Q;  1LTL A;  3HOX H;  1HR0 Q;  1QZG A;  1SRO A;  1ASZ A;  1IBK Q;  1WJJ A;  2ZM6 L;  4HJ7 A;  1IZ6 A;  1XMO Q;  1X56 A;  5M3F G;  4IFD J;  2PI2 E;  2YTY A;  1MKH A;  5IY0 A;  3U58 A;  4X64 Q;  2K5H A;  3CCL A;  3RZD H;  1SRU A;  2UUB L;  1M90 C;  3F8T A;  4K0K L;  2UXB L;  4DV7 Q;  1NY4 A;  1YJW A;  4GN5 A;  3PGZ A;  4DV4 Q;  4C3H H;  4LF9 Q;  4BBR G;  3ER0 A;  3JAM c;  3FP9 A;  4QIW E;  1Q46 A;  3RZO H;  4NPS A;  5GAD C;  3TQY A;  1XNQ L;  5JJK A;  3H0G G;  1FGU A;  3M4O H;  3T1H Q;  4P73 A;  5GAE C;  3U4Z A;  1YJ9 A;  2RCN A;  4GKK L;  1HZA A;  3OYY A;  4LF4 L;  4DR2 Q;  3FHW A;  2GVA A;  1E24 A;  2ID0 A;  4OXP A;  5E7N A;  1EIY B;  4OWX B;  3U4V A;  1HJP A;  1I50 H;  1IBM Q;  2MFI A;  4LWC A;  3PIP A;  1GVP A;  5M5Y H;  1BKB A;  1VQ6 A;  2BA0 A;  3TRE A;  3S15 H;  1EOV A;  3G4S A;  2D62 A;  4L5T A;  4X66 Q;  4AIM A;  2NVT H;  3TS2 A;  1EQR A;  3STB C;  4GLA C;  3NEL A;  4QJF A;  2JA8 G;  1X55 A;  5C4X H;  2VQF Q;  5JJL A;  5LMU Q;  3HOU H;  1GKH A;  4ME3 A;  1N36 L;  3CP0 A;  2ES2 A;  3KF6 A;  2C35 B;  3RLO A;  4DR5 L;  3CC2 A;  5M5W H;  3KLW A;  4EX5 A;  4IFD G;  4B3S Q;  2Z0S A;  1VQF A;  1Z9F A;  1Q12 A;  4QY7 A;  1D8L A;  4DV2 Q;  4JI6 Q;  3M3Y H;  1DGS A;  2MNA A;  4LF7 Q;  4TQU S;  2GN5 A;  2N49 A;  3OTO L;  4L5S A;  2F4V L;  1N32 Q;  4RG1 A;  2R93 H;  2VL6 A;  4FDB A;  2Q2I A;  3L7Z C;  2KEN A;  1G6P A;  1YBY A;  1YVC A;  5C0X J;  4DR7 L;  1P8L A;  2HHH L;  3D31 A;  4A3K H;  1VQP A;  1J5E Q;  4AH6 A;  4HJ8 A;  4L5R C;  1I5F A;  4JI8 Q;  5AJ3 L;  1VQM A;  1ASY A;  2NVQ H;  1UE7 A;  5C3E H;  3J81 i;  3PF4 A;  4DR3 L;  1HNX L;  1E7Z A;  3BZK A;  4DV1 L;  4P74 A;  3F2C A;  3GD7 A;  3GTO H;  3ICE A;  2VUM H;  4LFC Q;  3M4P A;  4JV5 L;  1JT8 A;  2OCE A;  4YCW A;  3DM3 A;  1EUJ A;  3J80 c;  4R1J A;  3AFP A;  2K4K A;  2MQH A;  4OO1 I;  3DLL A;  3ULP A;  3HKS A;  3HKZ G;  1PH2 A;  1I94 L;  3KFU A;  1GM5 A;  1TWC H;  2I5L X;  1PYB A;  4DUY Q;  2JA9 A;  1VQE A;  4JI5 L;  1OXV A;  4YY3 L;  4JI7 Q;  3AEV A;  1VQO A;  2E5L L;  3I4O A;  1XPO A;  1YHQ A;  3M7N A;  2ZJP A;  1NMG A;  3IRB A;  1TWF H;  4NXM Q;  3I4N H;  3HOZ H;  2NN6 I;  1Q86 C;  4LNQ A;  3Q8D A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...