3K0XA

Crystal structure of telomere capping protein ten1 from saccharomyces pombe
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
99
structure length
99
Chain Sequence
SAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Ten1
publication title Telomere capping proteins are structurally related to RPA with an additional telomere-specific domain.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 29
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12658 Ten1 Telomere capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k0xA00
5IE8A 3L7ZC 1DGSA 1HZBA 1PH1A 1IBKQ 2HIXA 4TQUS 3A0JA 2B29A 4YHHL 1K8GA 4PZ8A 2PQAA 3W5OA 4A3JH 5IP9G 3HOZH 3KF6B 3HOXH 4YCWA 3RLFA 4C3IH 4A3GH 2I5HA 4DUYQ 4B3TQ 2RHQB 1WCMG 4LF6L 3GTMH 5M5WH 1PH4A 1L1OA 5LMUQ 2UUCL 2QA4A 1IZ6A 2R7ZG 2PMZE 1XNRL 5C44G 3ER0A 4JI5Q 4DAYB 4OWTB 4BBRG 3F2BA 4PG3A 1AH9A 3K7AH 4R4QA 1UE7A 2OTJA 1X56A 4NXNL 3PCOB 3HOYG 1NTGA 4AQYQ 4DKAC 1WI5A 4IPGA 1PYSB 2JQOA 4XTCS 4X64L 4UPAA 4A3FH 3HOUG 4DR4L 4IFDJ 1KXLA 2E2HH 1JT8A 4LFCL 4LF4L 4IPCA 4NXML 2IX1A 4BA1I 4A4IA 2Z6KC 3NBHB 3KJPA 1GD7A 1KRSA 5M3MH 1VQPA 2NVTH 4BBSG 3PV0A 3E0EA 3PUVA 1Q12A 4KHPL 2AHOB 5GAHC 2KENA 1SR3A 4OXPA 4GNXC 4AYBG 4JI6Q 3AYHB 3UDGA 3TS0A 4DR2Q 2CKZB 4O0AA 3S1QH 1KD1C 2JA7G 1A62A 2CWPA 1LM0A 1IL2A 5JEAJ 3U50C 5LMNL 1OXXK 3NENA 4GS3A 1IYJB 1V9PA 1SFOH 3CC2A 2R93G 3UDXA 1JJGA 4GNXB 2VS1A 1CKNB 1A63A 4HJ5A 1AE2A 1PYBA 1GM5A 2ZTCA 3HOUH 1HNWL 2CWAA 1Y1WH 5GROA 1O7IA 1NE3A 3PIOA 3S1NH 4GKJL 1UE5A 4DV7Q 4X6AH 2K75A 4APVA 1EFWA 5GADC 4OWXB 4GN5A 1OXSC 4GLXA 4IOAA 1J6QA 1K73C 1PV4A 2MQHA 1IBLQ 4YY3Q 4EQ5A 4JI8L 3UE1A 5C0XI 4BY7H 4XIGS 3KF8B 2NVYH 2ATWA 2K50A 3GTKH 3F8TA 1TWCH 1P16A 3VDYA 4DAMA 4DV3L 3D31A 4HJ7A 1N36L 4LF9Q 1Q86C 4P75A 3OYYA 3PGZA 4B3MQ 3CP0A 1X6OA 4LWCA 1HR0W 1YJ9A 3OTOL 3S2HH 1XTDA 3BZKA 4NB3A 4GOPB 3PSIA 3RNUA 1VQDA 4IPDA 2Q2HA 1SMXA 4X62Q 5BR8L 2K5VA 5C4XG 1RIPA 3HKSA 2I5LX 4L5QA 4DR6L 2AMCB 1ASYA 5H1SE 2Q2TA 4JI0Q 1GO3E 4A3DH 4BY1H 1LYLA 4DR1Q 4IJHA 2Z6KA 3A74A 3CPWA 4DR5Q 3M4OH 4AH6A 3KJOA 4QL5A 3RLOA 1MIUA 3KDFB 1K83H 5C3EG 1VQOA 3NEMA 3S15H 4BXXH 4DV0L 2LXJA 2OWOA 5JJIA 1HNZL 4LUVA 4JI3Q 2UXCL 4JOIA 1XMQQ 1TWHH 1PH5A 1NY4A 3TREA 2ZJPA 3KFUA 4JI7L 4EX5A 1BBWA 3BU2A 3RR5A 4DV5L 1S3OA 4A3KG 3G6EA 5FJ8H 2AWNA 1YITA 1IBMQ 1FL0A 2MNAA 4DNIA 3GD7A 4JBMA 1JJCB 1UE6A 3M4PA 3STBD 5IP7G 1VQ5A 2OCEA 1VQJA 4RG1A 4YCVA 1J5EL 1AE3A 4LFAL 1Z47A 2VQEL 4R4CA 2PQAB 3GTQH 3GTOH 3I4MG 2BA0A 3STBC 3ZJYC 3H0GH 3S1MH 4A3BG 3MXNB 3FKIH 1N34L 2E8GA 2ZJQA 2UUBQ 3RZDH 2KHJA 2HHHL 1L1OB 5M5YH 5C0XJ 3U4VA 2IT1A 5LMNW 1VCIA 2YU9H 1C9OA 2BH8A 3K80C 4TVAB 3S24A 3CMAA 1VQ8A 3H3VI 3HOWH 4JV5Q 4B3RQ 3S2DH 1VQHA 2R6GA 4A3JG 1W2BA 3H15A 3HOZG 2XTIA 3Q8DA 2YTYA 1YHQA 3I55A 4A3GG 1VQIA 3KYHC 1VQ7A 4LUZA 4R4OA 4HIOA 1U5KA 1N32L 2E5LQ 1KL9A 5C4JH 1NMGA 4DUZQ 1OXTA 3PUWA 1I94L 5AJ3Q 3T1HQ 4A93H 2IHEA 4DR3Q 1IBKL 3PF5A 4DV6Q 1X9NA 4J15A 3OW2A 1BKBA 1WOCA 2KHIA 2GN5A 4DV4L 1EYGA 4LF8Q 4A3FG 1HNXQ 3K8AA 4P73A 1HR0Q 1N33Q 2UXDL 3UDFA 1VQKA 4A3MH 4QJFA 4R4TA 1EQQA 1CSPA 2JA9A 1I50H 3SGIA 4QGUA 3CD6A 4X65L 2D62A 5M3MG 2YYZA 2BH2A 1UWVA 2JA6H 1VQ4A 1QVFA 4JI5L 3HOVH 2ALYB 2Y0SE 4B3SQ 2E2JH 1L2FA 1VQBA 2CCZA 5GAGC 2N78A 2YTXA 2UUCQ 5IWAQ 4LFBQ 1A8VA 3ULJA 3AFPA 3GTJH 1XNQQ 1YZ6A 1QVGA 1XNRQ 3GO5A 2WB1G 3H3VH 2UXBQ 1YJWA 4JBWA 3G71A 1VS0A 1E1OA 4MNOA 2C35B 2L15A 3E9IA 2NVXH 1YNXA 3PIPA 1X54A 4A3EG 1IXRA 4NXNQ 4OX9Q 3CCSA 1HZ9A 2BA1A 3JAMc 1X3EA 4A76A 1WCMH 2EQSA 3F2CA 1Y1WG 1FVIA 1KHIA 3JAMi 4JI6L 3TS2A 1JB7A 5M5XH 2NVQH 1PH6A 2WAQG 1X65A 3ULPA 4C3JH 2KBNA 3T1YQ 1Y1VH 4LF5L 1B70B 4L5TA 4OWWB 4BY7G 4HJ9A 2NN6G 4UP8A 2UUAQ 4FDBA 2HT1A 2KCTA 1G51A 1K0RA 5LMNQ 4IJLA 3EIVA 1M90C 1YVCA 1X3FA 1VQAA 4JG2A 2EIFA 3EBEA 2R92H 1MJCA 4YCUA 5IYCH 2IY5B 2PI2A 4DV7L 1XPUA 1NMFA 1EIYB 4UY8C 1KQSA 4JI1Q 1YHAA 4GOPC 1K9MC 2DUDA 2Q2UA 4K0KQ 4QQBX 4YY3L 1VQMA 4YWKA 2XGTA 2JEBI 4GKJQ 1W3SA 4AIMA 5FLMH 4A3DG 1I6HH 1LUZA 4BY1G 2AKWB 1SLJA 1B8AA 4DK3C 4HIMA 2RCNA 2YV5A 4LF9L 3TEHB 4JI8Q 2MFIA 4B3ML 1L0WA 3CQZH 2VUMH 4BXXG 1XMOL 1X55A 1PHJA 4X62L 1ASZA 3M85A 1C0AA 4DV2Q 2VQFQ 2JE6I 4IPHA 1JJ2A 1E3PA 3CCEA 4POGA 2MO1A 2ZTDA 4UP7A 4C3HH 4DV1Q 3J80c 2F4VQ 4DR1L 5FJ8G 3M4QA 5BR8Q 3PUYA 4GNXA 3UE0A 2ES2A 3PO3H 2I0QA 3HKZE 1CKNA 3FHWA 1HZAA 5ELOA 3J80i 3CF5A 4DR5L 3J7ZC 2UU9L 2B3GA 3I4NH 3M9BA 2OTLA 1G291 2VZAA 2R7FA 4A3LG 3S17H 1HH2P 1WYDA 4QY7A 3H0GG 4X66L 1OXVA 3K7UC 3FKIG 1SROA 4JI3L 3CMEA 1E24A 2JA8H 1XMQL 5IT9c 2HQLA 2LSSA 1VQ6A 1MJEA 4JBKA 2ZM6Q 2FXQA 1S72A 1L1OC 1IBML 1KIXA 3HOWG 3ULLA 2A19A 5IYBH 5C4XH 2E2IH 3PUXA 2JK8A 4GKKQ 1FJGL 2JJQA 1YJNA 3GTPH 1JE5A 4DV5Q 4DR7Q 2LXKA 3UDIA 2D0OA 1R9TH 4UP9A 4OO1I 5IYDH 1BVSA 1CKOA 1U0LA 2QEXA 1C7YA 4JI4Q 4HIKA 2N49A 3JC66 2UUBL 2ID0A 4A3IH 4JI2Q 1E22A 1SRUA 3HOXG 4A93G 4B3RL 1EWIA 4JV5L 3RLNA 3L0OA 1CUKA 1D8LA 2HIVA 1G6PA 2VY3A 4IFDG 3DLLA 1V43A 2Q2IA 4A3KH 5M3FH 5HY6A 4A3CH 1KAWA 2A1AA 4LF7L 4A3MG 2KCMA 3KLWA 4PZ7A 2VW9A 4WJ4A 2NZOA 1B7YB 2E5LL 2NZHA 1FGUA 4DUZL 1TWFH 1WJJA 2JA6G 4JYAQ 2B63H 3GTLH 3T1HL 3HOVG 4DUYL 4DR3L 4B3TL 1VQNA 2GVAA 2K4KA 3DM3A 2GVBA 1A0IA 3K81C 1M1KC 4YHHQ 5JEAG 5LMUL 3ICEA 4LF8L 1YHBA 4LUOA 1HR0L 4HIDA 1PH7A 1N33L 3A5UA 1PH3A 1JMCA 2JA5H 3M3YH 2K5HA 5E7NA 4LF6Q 4DV4Q 1MKHA 4AQYL 2UXDQ 3J81j 1N8RC 4L5RC 1P8LA 3PO2H 1WFQA 4ME3A 4B3SL 5GAEC 1VQLA 3LGJA 1PA6A 5IWAL 4X65Q 5FLXc 4LFBL 4MTNA 5ELNA 1XNQL 1OXUA 4NPSA 5IP9H 4X64Q 1QUQA 4RMFA 3MEFA 4JCVE 1K3RA 4A75A 4DR4Q 1PH2A 2UXBL 1Y1VG 4LFCQ 4LF4Q 4NXMQ 4OX9L 4H02A 1XPRA 1TWAH 2CFMA 3S1RH 1Q81C 4DK6C 3M7NA 2NN6I 3U4ZA 4DR2L 1PH8A 4LW1A 4JC0A 2R7ZH 1YBYA 1D7QA 5C44H 3K0XA 4BBRH 4KHPQ 1RL2A 1EQRA 2VL6A 3BZCA 2R92G 3ERSX 2ZTEA 1E1TA 5IYCG 1S40A 1KC8C 2WP8J 3KF6A 3RZOH 1H95A 3HOYH 1PH9A 3GDEA 3CAMA 4P74A 1K8AC 4C2MH 1VQ9A 3T1YL 2OQ0A 3CCJA 3CXCA 1BBUA 5FLMG 2K52A 2CQOA 1CKMA 3G4SA 2OQKA 4JOIC 1QZGA 2UUAL 1Z9FA 4BBSH 2Z0SA 1QZHA 1EIFA 2RF4A 2V1CC 2DGYA 1YI2A 1IBLL 4LF5Q 3CCMA 4GLAC 4A3EH 1HNWQ 2VUMG 3W1BA 3TRZA 1VQCA 3HFZB 4P71A 4JI1L 2YTVA 3D0FA 2JA7H 4K0KL 2JEAI 4JBJA 1Q1EA 2EXDA 1NJIC 3AEVA 2R93H 1XPOA 2F52A 4PZ6A 2D0PA 2H5XA 4QIWE 4DPGA 3F1ZA 3CCLA 2N8NA 2N3SA 1Q82C 3PO3G 2Y0SG 4KI0A 5EAYA 2PI2E 1VQFA 3F2DA 4DV3Q 3E9HA 1N36Q 5GQOA 2I5MX 3B6YA 1T9HA 5IY0A 3I4NG 4BA2I 5K36G 3J7A5 3I4OA 4JI0L 4GN4B 1EOVA 2WFWA 3OTOQ 3RN2A 3GTGH 3I2ZA 1V1QA 4DV2L 2JA8G 1EUJA 2VQFL 5C0XG 2K5NA 4DV1L 3PF4A 4DR6Q 4IO9A 1XMOQ 1N9WA 1TXYA 1UE1A 3CPFA 2QGQA 3I56A 2F4VL 4WJ3M 3KOJA 1GKHA 4GN3B 5IYBG 3L2PA 1CSQA 1NBWA 4LNQA 4PMWA 4HJ8A 4KHZA 4IOCA 4GLVB 1Q8KA 3U58A 1HZCA 4L5SA 3AQQA 2VNUD 4R1JA 3CC7A 1OTCA 3RN5A 2RHSB 2IHFA 4P72A 5IYDG 5JJKA 1XJVA 4DV0Q 3CCVA 1I5FA 1KRTA 1HNZQ 2PNHA 2MO0A 2UU9Q 2UXCQ 4O2DA 1SN8A 1Q1BA 3FP9A 1QVCA 1SE8A 4KLKA 2R7DA 3I7FA 1GVPA 2ZM6L 3G48A 2AWOA 3EN2A 4JI7Q 4X66Q 1UEBA 4A3IG 1HNXL 3CW2C 1Q7YC 4GKKL 3IRBA 1PVOA 4IFDI 4GOPA 4DR7L 1TWGH 5M3FG 5C3EH 4ALPA 1J5EQ 4LFAQ 1PFSA 4A3CG 2VQEQ 3CCQA 1VQGA 1VQEA 2WB1E 3CCRA 4Y7NH 4JI4L 4Y52H 1N34Q 3AFQA 1FJGQ 1I3QH 4JI2L 3TQYA 4A3LH 2HHHQ 4AYBE 2B63G 2ASBA 4OONA 2K14A 4MZ9A 4R4IA 5JJLA 3BJUA 1HJPA 2F3IA 5IP7H 3KDFA 3J81c 4YWMA 1X3GA 3S16H 3J81i 1YIJA 3W1GA 1YEZA 5J3BA 2WAQE 1Q46A 3CCUA 2JA5G 3NELA 4YWLA 1QUQB 5AJ3L 3WWVA 3I4MH 5DLQE 4A3BH 1N32Q 5HGQA 3S14H 4DV6L 1Y14B 3CC4A 1E7ZA 4JYAL 4HJAA 3PUZA 2A8VA 4OO1G 4POFA 4LF7Q 3PO2G 3A5ZB 3HKZG 1I94Q 2ZJRA 2IX0A 1LTLA
chains in the Genus database with same CATH superfamily
5IE8A 1HZBA 2HIXA 3A0JA 1K8GA 5C6AA 3HOZH 1JE4A 3KF6B 1JWUD 4A3GH 2I5HA 4B3TQ 4A3BB 1WCMG 3OWFA 1PH4A 1L1OA 5LMUQ 2QA4A 3IAYA 2R7ZG 4LMQD 2PMZE 1XNRL 4K14A 3SK8A 3F2BA 3VYUA 2E74C 4R4QA 2B2TA 1NTGA 4A3JB 2A68D 1WI5A 2JQOA 3SEBA 4IFDJ 4DR4L 2SOBA 4LF4L 4BA1I 2B2VC 1E0BA 3K58A 1VQPA 2NVTH 4A3MB 3DWAA 4KHPL 2L55A 1KAAA 4JI6Q 1A3TA 3AYHB 4YIJA 3VYRA 4DR2Q 3CHBD 1SNMA 1JQYD 3A7LA 4A3FB 1IL2A 2CWPA 1LM0A 2KOLA 5JEAJ 1XX8A 3GTJB 1QNUA 2J4XA 1A63A 1G2TA 4HJ5A 4RGMA 1LTSD 1GM5A 1Y1WH 5CBAE 5GROA 3H09A 5JPNC 4DV7Q 4APVA 2A6EC 3DUZA 1OXSC 2WB1B 3QB3A 4GN5A 4GLXA 5EKIA 3ZYYX 1IL8A 4XIGS 1ZYRD 3E0JA 1C4QA 3GQBA 2NVYH 1TWCH 1P16A 3KLSX 1SE4A 1T5XD 4HN7A 4DAMA 1ZEQX 4DV3L 5EBCA 1Q86C 1STAA 3CP0A 3S1NB 4HCSA 1LT5D 3OTOL 4NB3A 3PSIA 1VQDA 1VF5C 2EY1A 4Z9CB 5IGFA 2K5VA 3ND8A 1RIPA 4DR6L 1RTOA 1G8ZD 1SEBD 4JI0Q 1LYLA 4DXGA 4DR1Q 4IJHA 4NKLA 3A74A 1YNJD 3NQTA 3NEMA 4NDXA 4DV0L 2OWOA 3IFDA 5JJIA 4KMUC 2UXCL 1TWHH 2ZJPA 5I6YA 4A3DB 1BBWA 1FGBD 4OL7A 5FJ8H 1A2UA 4ABNA 5IP7G 2F0IA 1VQJA 4RG1A 1CTMA 2WINB 1YNNC 3NHHA 1J5EL 1A2TA 2HDLA 3S15B 2VQEL 3PO3B 3GTOH 2BA0A 3IL8A 3MEHA 1AFPA 3ERQA 4WORA 5KNDA 2F0QA 5C0XJ 5LMNW 2NUCA 1VCIA 3K80C 1JORA 1VQ8A 1SYDA 3HOZG 1CI3M 3Q8DA 3ONAB 2YTYA 1YHQA 3GTQB 4A3GG 4EQNA 2B2YC 3NBIA 4R4OA 2ZXPA 3NXWA 2L12A 5M5YB 1R9TB 1I94L 2F03A 3C3LA 2EYPA 5G3LD 1EY6A 1MSGA 2SEBD 1N33Q 3BVZA 5KGUA 2JA9A 2DJGC 3CD6A 4FF2A 5DEHA 3WOEA 4TKOB 2Y0SE 4ME5A 1L2FA 2CCZA 2DJFC 1GOZA 3T16A 3ULJA 3GTLB 5TSSA 1YZ6A 3GO5A 3LWEA 5JVG3 1VS0A 4MNOA 4KKUA 1DOMA 2EE1A 3SDZA 2M9VA 3CCSA 3JAMc 2TMPA 2FHTA 2P5ZX 1Y1WG 2RSOA 4JVZA 5M5XH 1KABA 1PYWD 1WD1A 4C3JH 1Y1VH 4HJ9A 4UP8A 1HRJA 1SNDA 2L0CA 1H9KA 3I3CA 1K0RA 4IJLA 1M90C 1YVCA 1UUPA 1VQAA 3D4WA 3EBEA 1CM9A 3T51B 1EIYB 1LV9A 1YHAA 5AFWA 5ELBA 2J7ZA 2A74C 1VQMA 1BUVT 2JEBI 4X3SA 4GKJQ 4G7OC 1I6HH 3D8GA 4C2MB 2RVLA 4DK3C 1H9JA 4LF9L 1CQVA 3TEHB 4B3ML 1H9SA 3E3XA 2VUMH 4BBSB 1EWCA 2HQEA 1XMOL 4QB4A 1XTCD 1PHJA 4X62L 4IPHA 1HFGA 4UP7A 4KN7C 3J81E 4XQQA 2F4VQ 5FJ8G 3PUYA 4ILWA 3UE0A 4CJ2C 4GNXA 3HKZE 1EIHA 3J7ZC 1EY7A 3CQZB 2MPMA 3I4NH 5K36H 1D6EC 2WV6D 2VB3X 1HH2P 5LHY1 1J9OA 3CMEA 2XNAC 4DA2A 4DU9A 5T1IA 4C3HB 3GTGB 3HGBA 2O4XA 2JXMB 5C4XH 2E2IH 1F9SA 3A54A 1ZXTA 2LXKA 2AQ2B 2D0OA 5IYDH 1BVSA 5ELDA 2ZXOA 1DD2A 3JC66 1PZID 4A3IH 1IW7D 1SRUA 3W2DA 3HOXG 5E4WC 1NSNS 2D2CC 1LTGD 2PW5A 4IALA 3SHLA 2SNSA 3DLLA 1ENFA 5CV5A 2K33A 5M3FH 1AN8A 4LF7L 2L5TA 3KLWA 2RA4A 2NZOA 2WKDA 4J6HA 1RF2D 3T56B 1D5MC 1FGUA 2PQEA 3OMCA 4JYAQ 2B63H 3CKIB 1F9QA 3T1HL 4B3TL 2HUGA 1M4VA 1E2VA 3DM3A 5IGGA 5LMUL 4A3KB 3ICEA 1YHBA 2KCCA 2JA5H 3M3YH 2IWHA 4P2CB 2HCCA 1WTHA 4DV4Q 1TWFB 1N8RC 1P8LA 3AB9A 3PO2H 2IW3A 1Q8IA 3H91A 3LGJA 1VQLA 4X65Q 4LFBL 5ELNA 2G9DA 5IP9H 1QUQA 3HG9A 4RMFA 4A75A 1K3RA 1D1IA 4DR4Q 4C3JG 2UXBL 4DN4M 4IUQA 1Y1VG 3HOUG 4LF4Q 1C8CA 3S1RH 3FEWX 2EYMA 4DK6C 3GV6A 4WJWA 2NN6I 4DR2L 1PH8A 4KHVA 3M7NA 2HDMA 4EQOA 4KHPQ 1O7YA 1RL2A 1KC8C 4IUTA 3KF6A 4HAEA 3HOYH 3GDEA 4P74A 1OO9B 1AZPA 3T1YL 1BO0A 2OQ0A 1S5ED 1NNXA 2H4OA 2CQOA 2UUAL 3G4SA 4JOIC 3KUPA 1I4GA 2B2WA 3R8BA 4GLAC 4A3EH 2VUMG 3W1BA 2QCPX 3HFZB 3U9OA 1G2SA 4CJ0B 1EOTA 4ZYSA 2JA7H 4K0KL 3DHQA 2EXDA 1BCPC 2H5XA 4QIWE 3R3OA 1G6ZA 2E75C 4DPGA 3CCLA 2N3SA 3KBXA 5EAYA 3Q0AA 4DV3Q 2Z6BA 3E9HA 2I5MX 5K36G 3I4NG 3NQIA 3J7A5 3I4OA 4JI0L 3OTOQ 1EOVA 1ZKOA 1AW7A 2R93B 2K5NA 5E3FA 1JICA 4DV1L 4DR6Q 4KKTA 3CPFA 1R4PB 1BCPF 3I73A 1GKHA 3L2PA 5IIFA 1CFMA 4MTKA 3SK6A 3AQQA 4R1JA 3CC7A 4IUVA 3RN5A 2DY8A 2ICIA 5IYDG 4DV0Q 3CCVA 2UU9Q 2UXCQ 4O2DA 1SN8A 1Q1BA 4A3IG 1QVCA 3N52A 3G48A 4X66Q 4HSVA 2FMMA 4QUCA 5KYLA 1PVOA 1KNEA 5M3FG 4ALPA 5C3EH 5EKKA 1J5EQ 2F0NA 3OPOA 2VQEQ 4XXEA 3HS0C 1VF7A 3MVVA 1TR5A 1FJGQ 2ZT9C 4A3LH 2RKSA 3KLRA 4AYBE 2B63G 1X3QA 2K14A 1XWEA 3NUCA 1XYIA 3J81c 1C48A 2EYJA 2F0EA 2JA5G 3BVMA 3NELA 4A3BH 1LT4D 4CHTB 5HGQA 1WTXA 1E7ZA 2KQ3A 3PUZA 1HA6A 4POFA 3PO2G 3A5ZB 1I94Q 3OIPA 2IX0A 4DFAA 4EGVA 1DGSA 1SE3A 1PH1A 4TQUS 2B29A 2Q8RE 1PTOC 2EJFC 3I4LA 3W5OA 4A3JH 5IP9G 1Z6HA 4BWGB 4FXDA 3S2DB 2RHQB 3OIQA 3NWTA 5M5WH 3S14B 4QIWB 2CH4W 4G7HC 4DAYB 4PG3A 1AH9A 3K7AH 1UE7A 5C4JB 1X56A 4KKSA 3HOYG 3OWEB 2EZVA 4DKAC 1QB5D 4A3FH 1KXLA 2K6AA 1JT8A 1PTOF 4NXML 4IPCA 4HMIA 4A4IA 2A68C 2Z6KC 3NBHB 3KJPA 1KRSA 1H9SB 4X3KA 1EU4A 1H9MA 1I50B 2AHOB 2KENA 4N9PA 4AYBG 3TS0A 2CKZB 5KIXA 4O0AA 3S1QH 1V1OA 3MHBA 1KD1C 2JA7G 1A62A 3U50C 1V9PA 1SFOH 3UDXA 4GNXB 1GUGA 2VS1A 1S5BD 3P75A 1AE2A 4RHSA 1JWMD 1QE6A 4FF1A 1EY4A 2ZTCA 3PIOA 3S1NH 4GKJL 1UE5A 5IT9E 1ILQA 2K75A 2R3ZA 1EFWA 4X6AH 2PYKA 4OWXB 4IOAA 1J6QA 4XQJA 1PV4A 5D65A 4BY7H 2NVQB 1ENCA 2NN6H 2KHSA 2ATWA 2K50A 3F8TA 4RFBA 3D31A 4LF9Q 5A2QL 1B3AA 1ZYRC 4B3MQ 1HR0W 1YJ9A 3BZKA 3OOCA 3RNUA 4IPDA 4X62Q 2R92B 4L5QA 4A3DH 1LACA 4BY1H 1UAPA 3GTKB 2XN9C 1STNA 2Z6KA 2CW0C 1BF4A 4QL5A 1MIUA 2BOSA 3S15H 1K83H 5C3EG 1VQOA 2PO4A 3S2HB 1GHKA 4BXXH 3TSSA 3K57A 2QEJC 4KTAA 1LTBD 3MFGA 1NY4A 4K6LA 1DCZA 1FR3A 3BU2A 1S3OA 3G6EA 2AWNA 3NWSA 1FL0A 2MNAA 4DNIA 2XIWA 3GD7A 1JJCB 4YCVA 3TMEA 1AE3A 4DAPA 1NR4A 4R4CA 2K5WA 2PQAB 3A7AB 3GTQH 3ZJYC 3S1MH 4A3BG 3MXNB 2PNRC 2E8GA 3KLSA 3W3AA 2L1BA 1GXDC 3RZDH 2KHJA 2HHHL 5M5YH 4G7ZC 2IT1A 4N9TA 2JA8B 2BH8A 3BDOA 5LL6S 1I6VC 3EJIA 4A3JG 3VR3A 1FD7D 1E2ZA 1A3VA 1E2WA 5HURA 1D1KA 2MUYA 1NMGA 1K28A 3BDLA 4IUPA 1EY5A 5AJ3Q 3T1HQ 4A93H 4J15A 3D6CA 1WOCA 4DV4L 1EYGA 5DM73 3WDNA 4A3FG 1HNXQ 4P73A 3IFTA 1VQKA 1MD2D 4R4TA 1PMRA 2PZUA 3SGIA 3EROA 4X65L 2D62A 3V2TA 5IGDA 2YYZA 1UWVA 2JA6H 1VQ4A 2SDFA 3LNNA 2ALYB 2E2JH 4LFBQ 1A8VA 1VMPA 5IGCA 2Z1CA 4N8FA 1QVGA 1BOSA 3H3VH 2WB1G 1WVLA 2F0KA 2UXBQ 1E1OA 1PRTD 1SAPA 3PIPA 5M9OA 5FK9C 4FVMA 2EQSA 5G3LF 3F2CA 3PQIA 1W6KA 3JAMi 4HSPA 1SXTA 2LMCB 1KTKA 3TS2A 1PH6A 2WAQG 3ULPA 1SE2A 3LX0A 2KBNA 3T1YQ 2NVXB 1B70B 4BY7G 1EZ8A 2JSOA 2NN6G 5FLXL 2AQ1B 4FDBA 2UUAQ 2HT1A 2KCTA 1G51A 2K32A 5LMNQ 1WCMB 4HR7B 4FP5D 1GUOA 5EKLA 3K5LA 1MJCA 4YCUA 4OHJA 1TVXA 2PI2A 3N6RA 4ZRZA 3J7YW 3FPPA 3K5OA 1KQSA 4K5VA 4N8X1 4K0KQ 3KK7A 2LKVA 1IKLA 1W3SA 1S4ZA 4A3DG 1LUZA 4BY1G 1A3UA 2RCNA 3TBIB 4I7AA 4I65A 3CQZH 2AUJD 5EQ0A 4BXXG 4DK1A 1ESFA 1C0AA 1ASZA 1BCPB 2B2VA 5IOCA 2KEEA 2F0WA 1JJ2A 4POGA 3CCEA 2MO1A 2ZTDA 4C3HH 4DV1Q 3HP3A 2Z9HA 3QJYA 3BG3A 3J80c 3DM1A 3TP8A 3M4QA 5BR8Q 2ES2A 2B2UC 2I0QA 2D5DA 2JP1A 1HZAA 1DOKA 2UU9L 2B3GA 4F87A 3M9BA 1G291 1STYA 1WYDA 4QY7A 3SK4A 4X66L 3D4DA 2XWJB 1PLFA 1XMQL 5IT9c 2LSSA 1MJEA 4XT3B 3L3OC 2F0UA 2PPBC 4MIUA 3PUXA 2JK8A 4K5WA 1FJGL 2JJQA 1FNUA 4DV5Q 3K59A 3S17B 2QDLA 4UP9A 3DEPA 1MGSA 3HEJA 3MC0B 2ID0A 1Y8NB 4A93G 4JV5L 1EWIA 1SMYD 3L0OA 4KD3A 1G6PA 2KCNA 1IW7C 3C1FA 2RBMA 4A3KH 5HY6A 4K2LA 2K05A 4A3CH 4WJ4A 1JOOA 1B7YB 3G6JB 1QG7A 2JA6G 1TWFH 1M8AA 3S9WA 1F2ZA 1EYAA 4F88A 1VQNA 1I3QB 1A0IA 4LF8L 2R61A 1HR0L 2K5HA 2X6LA 2WIIB 5A2QE 1HXYD 4RWSC 5JJZA 2IX3A 3S16B 1MKHA 1II3A 2CH4A 1WTOA 3M4YA 4K8IA 1SDFA 1WFQA 3RD4A 1PA6A 1DOLA 1PTOB 3MEFA 1TS3A 4RH6A 2I46A 4NXMQ 4BA2I 4H02A 1XPRA 4Q0FA 3C1EA 3PIP3 1NR2A 4A3GB 4LW1A 1EU3A 4BBRH 2Q8TA 1TY2A 2DNCA 1E1TA 1H95A 2B2YA 1U4LA 1PH9A 1VQ9A 1BBUA 3EQLC 5KNBA 3FMCA 1LO5D 1QNKA 1QOHA 1DXMA 3J7AV 4DAYA 3VYTA 1TIID 1QZHA 1EIFA 2F0DA 5C44B 4R8IA 3NE5B 3CCMA 3Q6SA 4JPBW 3RZOB 5A35A 1W6JA 1VQCA 5JOBA 2VB2X 2PCFB 4P71A 4JI1L 3D0FA 4KV6A 2JEAI 4JBJA 1Q1EA 4PV1C 5I2YA 1NJIC 2R93H 1XPOA 5CV9A 3NBHA 1WD0A 4C3HG 4RHRA 2E76C 4LJZC 4OIJA 3F1ZA 2Y0SG 4K2KA 2PI2E 1VQFA 5GQOA 3B6YA 2F0SA 4FNFA 4GN4B 2WFWA 3OW7A 2I07B 1STBA 3I2ZA 4DV2L 5CC4A 1Y1WB 5K5PA 1LTID 1JB3A 3OMGA 2EYFA 2XWBB 3PF4A 4ZK9B 4I7ZC 1UE1A 4WJ3M 4H7BA 2F3WA 1Y69U 4ZQ3A 4IOCA 4KHZA 4GLVB 3QR8A 2RDFA 3V05A 1V8QA 2IHFA 4IUNA 5JJKA 2K5QA 2PNHA 2L11A 2MO0A 3MXUA 3KBGA 4KLKA 1SE8A 1D2BA 1GVPA 4ZUJA 3A8JE 2BE5D 4ULLA 4CDCC 1Q7YC 4GKKL 4IFDI 2O2LD 1YNND 4XYOA 1TWGH 4CJ1B 4DR7L 1PFSA 4A3CG 1IYUA 1VQGA 1VQEA 1JWSD 4Y7NH 4JI4L 4Y52H 4JI2L 2HHHQ 1DJRD 1QJOA 1RD9D 5BN3A 4YWMA 1SYGA 3J81i 4CKEA 3W1GA 4FXGC 2D9UA 3L9AX 5AJ3L 3I4MH 1A6XA 3WWVA 1B50A 4R9WA 3S14H 1GJXA 1IYVA 3HKZG 1HNXL 5I9PA 2EY2A 2ZJRA 2F0JA 4KD4A 5CV4A 1JR0D 4YHHL 2PQAA 1EEID 2F0PA 4YCWA 4C3IH 3MXNA 2N88A 5JAVA 3GTMH 1B2TA 4RCNA 1D5ZC 1IZ6A 4HMJA 4BBRG 2F0GA 2OEOA 4JK1C 2O5IC 1GUWA 1EFID 1WTVA 2CHBD 2OF1A 4ZCKA 3HOXB 4IPGA 1PYSB 4XTCS 4X64L 4UPAA 1Z7TA 2ICEC 4LFCL 2IX1A 5C3WA 2RDHA 1GD7A 4ODGA 3PV0A 3E0EA 3GV3A 5KRUA 3PUVA 4OXPA 2RQXA 5EPJA 2E2HB 5LMNL 3NENA 4GS3A 2R93G 3CC2A 2K01A 2NWGA 1RDPD 1PXUA 5I6WA 5M3MB 2SNMA 2PZWA 1WTWA 1PYBA 1HNWL 2CWAA 2K04A 3K0YA 1EEFD 1O80A 1IKMA 1BNZA 3JAML 4FYDA 2MQHA 4O42A 5C0XI 4IUUA 3KF8B 1ET9A 3GTKH 4RKLA 1Y1VB 1N36L 4HJ7A 3HOUB 1H9RA 1XXGA 4P75A 3OYYA 3D6WA 1X6OA 1I4HA 2V4DA 3S2HH 2F0FA 4WFN3 5BR8L 1SMXA 4DNTB 5C4XG 2I5LX 4B08A 2AMCB 2J0TD 2KVMA 5H1SE 2GA4B 2Q2TA 2EVBA 2AQ3B 5C5MA 1HCZA 1I6HB 4AH6A 1UNSA 2XVSA 3RLOA 1HNZL 3MTSA 4LUVA 3BZDB 3MXPA 2Q8IB 4JOIA 1F77A 1XMQQ 2RCFA 2VUMB 4JI7L 4NW2A 3RR5A 4DV5L 2EDGA 1YITA 4JBMA 3M4PA 3STBD 1SYEA 1IHZA 2B8GA 1VQ5A 3M4OB 4EVOA 4ZUIA 2K03A 4LFAL 1Z47A 3I4MG 4O1NA 3FKIH 3I91A 3I4NB 2MHVA 5FO7B 3NSWA 1G91A 3U4VA 3K6OA 5C4HA 2DY7A 1AEXA 2X69A 1C9OA 4TVAB 3H3VI 3S24A 4JV5Q 1U4PA 2R6GA 1KDBA 1RTNA 4C3IG 1LTTD 3I55A 1BR9A 4BS9A 1Y8OB 1VQ7A 2E2IB 3H0GB 5EGTA 4HIOA 1U5KA 1B3QA 1A15A 1LTAD 2NTTA 1N32L 4RA8A 1RKNA 1AP0A 5CGKA 3PUWA 2YU9B 3HOWB 1B44D 2FJ2A 4UAIA 5CORA 1IBKL 3U9SA 4DV6Q 4IFDH 2A6HD 2KHIA 3I8ZA 2GN5A 4LF8Q 3K8AA 1HR0Q 3VR2A 3UDFA 4A3MH 4QJFA 1EQQA 1O78A 1MI2A 1QILA 5I9OA 2VXWA 2C9OA 3O13A 4QGUA 1KLUD 4Q5VA 3BVGA 4JI5L 2DNEA 2HD3A 1EQVA 1VQBA 4IZ8A 5GAGC 2UUCQ 4HTHA 1HQRD 2FMCA 3AFPA 5JEAH 3GTJH 2C35B 2L15A 3E9IA 2NVXH 4NXNQ 3CRKC 4A3EG 1IXRA 3K5MA 3FRPB 1PDQA 1HZ9A 2BA1A 2JA5B 1X3EA 1PRTC 5COYA 5E4XA 3HOVB 1WCMH 4G57A 1KHIA 4RKBA 4UDUC 1X65A 4RAUC 3EFXD 4OWWB 2XRSD 5EBDA 3FDTA 3EIVA 1QWYA 4JG2A 2EIFA 2IY5B 4FXKC 4CDEC 1S5FD 1PRTF 4UY8C 4JI1Q 4GOPC 2X6GA 2DUDA 4QQBX 3PMFA 3R2TA 4YY3L 1X3PA 2AKWB 2C5CA 3A8IE 1SLJA 1EL0A 4HIMA 2EXZA 2YV5A 1LABA 4JI8Q 2MFIA 5I2XA 4KK7A 1L0WA 3QG1A 1ESRA 1EIGA 2RSNA 1RCVD 1SNQA 4DV2Q 4B9WA 2JE6I 1E3PA 3VA5A 2JA7B 1ML0D 1SJHD 3PO3H 1CKNA 3NK9A 3CF5A 4DR5L 3J80i 1U4RA 4OGQC 1YNJC 1MHWC 1L0XB 4PQXA 2OTLA 1S5CD 2VZAA 4A3LG 2N55A 4J8QA 3S17H 3K7UC 3FKIG 4JI3L 1B53A 5C0XH 2K5DA 3LWUA 1S5DD 5BN5A 3T4AC 1HHVA 5EJWA 1S72A 1L1OC 1IBML 1DM0B 5CV6A 4MN3A 4GKKQ 4KJOA 1YJNA 4DR7Q 4DNRB 3UDIA 2A69D 2IPKD 1B9MA 1R9TH 3T53B 1CKOA 1C7YA 3SR1A 4JI4Q 4HIKA 2UUBL 4JI2Q 3TP6A 3QOJA 4B3RL 1D5XC 1CUKA 1HPCA 2HIVA 1LT6D 2M00A 4IFDG 1V43A 2Q2IA 4M1UB 3GTPB 1KDCA 4QUFA 2A1AA 2G9HD 4PNYA 4A3MG 2KCMA 5E1FA 1J8IA 2E5LL 2QDBA 4F8MA 1R4QB 4TSSA 4DUZL 1WJJA 1V1PB 3GTLH 2TSSA 1Q3LA 4F7XA 4DR3L 2GVAA 2K4KA 4RGNA 4R8NA 5ELEA 3K81C 1M1KC 4YHHQ 3MWYW 5JEAG 1PH7A 1PH3A 3TP7A 2F0OA 3J81L 4RCOA 2UXDQ 1B1ZA 1L0YB 4OO1H 1DONA 4ME3A 4B3SL 1SYFA 1U9RA 5IWAL 4MTNA 1XNQL 4X64Q 4JCVE 1TQOA 1STGA 5C3XA 1PH2A 3TZUA 4LFCQ 4OX9L 2CFMA 1DZ1A 1SNOA 3U4ZA 3AMUA 1EY9A 4JC0A 1GUTA 4DF7A 1EWHA 1D7QA 5C44H 3K0XA 5M5WB 3RZOH 1S40A 4U673 3K5NA 1GUNA 3CAMA 1K8AC 4C2MH 3K7AB 1HQMC 3CCJA 1TWAB 2EYOA 3CXCA 1CKMA 3PIO3 2OQKA 1QZGA 1Z9FA 2EY5A 4BBSH 2R7ZB 2Z0SA 2AUKA 2V1CC 1YI2A 4LF5Q 1HNWQ 1SBBB 5IODA 3P20A 3SK5A 3I90A 1QCBD 2F52A 3S1QB 1HUMA 2D0PA 4XDXA 2N8NA 1EQTA 4OIKA 3NTIA 3PO3G 1SFOB 2EJGC 3F2DA 3FPUB 5CMDA 1N36Q 3RMHA 5IY0A 4DXFA 3NP8A 3GTGH 2XRQD 2VQFL 5C0XG 4M8AA 2WAQB 1N9WA 2QGQA 3I56A 4GN3B 2CW0D 2OXPA 4PMWA 4BY7B 3TP5A 1Q8KA 3U58A 4L5SA 3CU7A 3H6MA 2VNUD 1OTCA 1WTPA 2KA7A 4K5XA 4FO2A 1I5FA 1HNZQ 1F2YA 2HCIA 3KF8A 3CRLC 1EYCA 2B8FA 3I7FA 2ZM6L 4JI7Q 2AWOA 3EN2A 4QF4A 3FVQA 1STEA 1HA5A 1UEBA 5CYUA 2WACA 4GZYC 3IRBA 3X3MA 1TS4A 2PMZB 4RGOS 4BY1B 4LFAQ 1FNWA 2BE5C 3QOLA 3CCQA 3CCRA 1KLGD 2RDGA 1F2LA 1K83B 4CKBA 2F4IA 3TQYA 3OHXC 4OELB 2ASBA 4MZ9A 1JOKA 3BJUA 1HJPA 2F3IA 1NAPA 1X3GA 2FINB 4DAVA 1YEZA 5J3BA 5FO8B 1Q46A 1EYDA 3CCUA 1PFBA 4ID6A 1N32Q 4DV6L 1Y14B 3CC4A 4LAAA 2B2UA 2EPBA 4HJAA 4OO1G 3S1MB 3QO2A 1LTLA 1MSHA 3L7ZC 1IBKQ 3RZDB 1B9NA 4PZ8A 1FYCA 2F0MA 3HOXH 2QKIC 3RLFA 4H13C 5CV8A 4DUYQ 5CBEE 2K1BA 1K8MA 4LF6L 1I4PA 1CQFA 2UUCL 1HTPA 4NP5A 3AU7A 1O7ZA 1PZJD 2K28A 5C44G 3ER0A 4JI5Q 4OWTB 1HUNA 4IURA 2EYLA 2LY7A 2OTJA 4NXNL 3PCOB 4AQYQ 3HOZB 4A93B 3UI2A 2E2HH 1I4RA 3G7LA 4JW0A 1LT3D 5M3MH 4BBSG 1Q12A 4K6DA 5GAHC 1SR3A 4GNXC 3UDGA 2JA6B 2E2JB 1OXXK 1IYJB 1JJGA 4CBVA 2IJ0A 1CKNB 2NVTB 5KYIA 1PRTB 2A6ED 5BN4A 2NTSA 3HOUH 3HRZC 1O7IA 1NE3A 5GADC 3BS1A 1K73C 1IBLQ 4YY3Q 4EQ5A 4JI8L 3UE1A 2A5HA 1K0SA 4DGZA 3VDYA 5DM63 3J7AF 3PGZA 5HGTA 4LWCA 4CGYB 3T13A 1XTDA 4GOPB 2NB0A 4CDFC 2G5DA 2JN4A 2Q2HA 3TZDA 3HKSA 4ZLTF 3A55A 4RGTA 2NVYB 1ASYA 3DMUA 1GO3E 1I4XA 2Z4HA 1TWCB 1CT1D 2KEDA 3CPWA 4DR5Q 3M4OH 1PZKD 3KJOA 3DEOA 3KDFB 4MHEA 1BDOA 1ICWA 2LXJA 5ELFA 4JI3Q 1PH5A 3TREA 3KFUA 2Z4IA 4EX5A 4A3KG 1IBMQ 1KDAA 3BDCA 3X3NA 3BYTB 1UE6A 3VYSA 2OCEA 3BYYB 2PW7A 1PFMA 2Y0SB 2ZXRA 3J80L 2MGSA 3STBC 3H0GH 1N34L 1LTRD 4L6TB 1TWHB 1U4MA 3ND9A 2ZJQA 2EOTA 2UUBQ 3QIAA 4OEMB 1L1OB 5FLXE 1I4QA 2YU9H 3HOWH 3CMAA 4B3RQ 5J39A 2Z8LA 3S2DH 1TS5A 1VQHA 3H94A 5IT9L 1RJTA 1ILPA 1W2BA 3H15A 2XTIA 3VR5A 3GTOB 1VQIA 3KYHC 5NUCA 4LUZA 1KNAA 2E5LQ 1KL9A 4LK1C 5JPMC 2A73B 4G4KA 4KY6A 4KY5A 5D3IB 5FKAC 3V96A 5C4JH 4DUZQ 3SVMA 1OXTA 2LFNA 2IHEA 4DR3Q 3PF5A 3MA2B 1X9NA 2B2WC 1TY0A 3OW2A 1BKBA 2UXDL 1RHPA 1CZWA 3R2IA 2BDNA 2JYOA 1LLRD 3OSOA 1CSPA 1EY0A 1I50H 2A6HC 4C1NK 5M3MG 2BH2A 1QVFA 4S3SA 4EQPA 1WTQA 3HOVH 1NCVA 4B3SQ 4TRDA 2N78A 2YTXA 5IWAQ 2KUMA 2DN8A 4DK0A 1XNQQ 1XNRQ 5EPKA 4KJNA 1YJWA 4X3UA 4JBWA 1TKWB 3G71A 1EZ6A 1YNXA 4OX9Q 1X54A 4WRDA 3RUZA 1BBXC 1V1PA 3SE0A 1X32A 1BQQT 4A76A 2F3VA 5C4ZA 1TU2B 1EY8A 4KN4C 3EA6A 1FVIA 4JI6L 4ZAIA 2E2DC 2BCOA 1JB7A 5DAUA 2NVQH 3HKZB 3MFYA 1WTRA 3WOFA 1ONLA 4LF5L 4L5TA 3VR6A 2CQAA 1UEAB 5CV7A 2H1EA 1B4OA 1STHA 2IL8A 1CA6A 1X3FA 3D4RA 1F2MA 2R92H 5IYCH 4QMGA 4XYQA 3VA7A 4DV7L 1SNCA 3ITPA 4IN3A 5M5XB 1XPUA 1NMFA 4L63B 4V0BA 2NBFA 2Q2UA 4BBRB 5C5LA 1K9MC 4C3JB 3I70A 5L37A 4YWKA 2XGTA 1K3BC 1GHJA 2QF7A 4CDDC 4AIMA 5FLMH 5ELCA 2FFKB 1PFNA 1B8AA 2ENBA 1CZGA 3M7GA 2F0VA 1X55A 1AZQA 5D14A 3M85A 5CR3A 5D3DA 4B9XA 2VQFQ 1FNVA 4DR1L 3FHWA 5ELOA 2F0HA 4HEDA 2R7FA 3Q23A 1K8OA 3H0GG 1OXVA 1SROA 2JA8H 1E24A 1VQ6A 1SYBA 2HQLA 3P7JA 3EVQA 2QW7A 4JBKA 3GP7A 2ZM6Q 2FXQA 3HOWG 1KIXA 3ULLA 2A19A 5IYBH 2KECA 3GTPH 1TS2A 1JE5A 2CVRA 4OO1I 3DWPA 2F1MA 1U0LA 2K7VA 2QEXA 2N49A 3P1HA 2BDOA 1E22A 2A69C 2EYHA 1SSOA 1Y8PB 5DNFA 3RLNA 5C4XB 1D8LA 1MBYA 2VY3A 4H0LC 1KAWA 1O7LA 3HZXA 1SNPA 4PZ7A 2VW9A 4ZKCB 1TWGB 1VDZA 2KJXA 4A3IB 2NZHA 2EJMA 3R93A 2F0LA 4Y7NB 3MAQA 3HOVG 4DUYL 2MJ8A 1Q90A 2GVBA 2MP1A 4XT1B 1CK1A 4X3TA 4FF3A 5M3FB 4LUOA 1N33L 4HIDA 3A5UA 1JMCA 1SYCA 4C56C 5E7NA 4LF6Q 1NUCA 4CKCA 4V190 4AQYL 3J81j 2B63B 3MZ5A 3IKJA 4L5RC 3I4MB 4XQNA 1ENAA 5GAEC 1HFNA 4E6IA 3Q22A 5FLXc 3TDQA 4NMZA 1OXUA 4NPSA 4KY7A 4FF4A 3A8KE 3H3VC 2O5JC 3F2UA 3M3YB 3DWQA 2LS01 1TWAH 1Q81C 2QILA 3I72A 4C3IB 2R7ZH 1DYQA 4ZKBB 3PO2B 1YBYA 2PZTA 3GTMB 1EQRA 2VL6A 3BZCA 2R92G 3ERSX 2ZTEA 5IYCG 2WP8J 3C46A 5FO9B 2NZ1D 1BXTA 5J1ZA 1JOQA 3DXJC 5ISRA 5FLMG 3S1RB 2K52A 3E5SA 3A56A 3NTHA 3J80E 2RF4A 4H44C 4K8JA 2DGYA 3MXGA 4C1NI 1IBLL 1BCPD 4PMBA 3HOYB 3TRZA 2YTVA 2F0TA 3AEVA 5KEEA 1ET6A 4PZ6A 1HTLD 4J1MA 5J22A 5EPLA 4L8JA 1Q82C 4KI0A 4IQZA 4A3EB 1T9HA 3E6ZX 4AYBB 1TT2A 3TN2A 3NTKA 3RN2A 1SJED 1V1QA 2JA8G 4QCLA 1EUJA 2M2LA 3QWNA 2NYZD 2L4NA 4HCEA 4IO9A 1XMOQ 1ICFB 1TXYA 2F4VL 3KOJA 5IYBG 2L9HA 1NBWA 1CSQA 1CA5A 4LNQA 4HJ8A 4U68A 1HZCA 2RHSB 3C2PA 4P72A 1XJVA 1KRTA 2B39A 1JC7A 2WKCA 3FP9A 2OT2A 2R7DA 3VR4A 5IGEA 1GUSA 5IGBA 2B2TC 5FOBB 3D3RA 3CW2C 5LL6X 4GOPA 3Q24A 2WB1E 1N34Q 1JCKB 1RODA 3AFQA 1I3QH 4PMCA 5KNCA 4OONA 3NPPA 4R4IA 4UHVA 5JJLA 1SMYC 2EY6A 5IP7H 3KDFA 1VMCA 3SXHA 5JVH3 5C3EB 3S16H 1YIJA 1CHPD 5F2DA 2WAQE 4YWLA 1QUQB 1T5EA 5DLQE 3URYA 3JAME 1CHQD 5I4DA 1PTOH 4JYAL 1PTOD 1F9PA 2A8VA 4LF7Q 5T1GA 3FKIB 2XSCA 1F9RA
chains in the Genus database with same CATH topology
5IE8A 3L7ZC 1DGSA 1HZBA 1PH1A 1IBKQ 2HIXA 4TQUS 3A0JA 2B29A 4YHHL 1K8GA 4PZ8A 2PQAA 3W5OA 4A3JH 5IP9G 3HOZH 3KF6B 3HOXH 4YCWA 3RLFA 4C3IH 4A3GH 2I5HA 4DUYQ 4B3TQ 2RHQB 1WCMG 4LF6L 3GTMH 5M5WH 1PH4A 1L1OA 5LMUQ 2UUCL 2QA4A 1IZ6A 2R7ZG 2PMZE 1XNRL 5C44G 3ER0A 4JI5Q 4DAYB 4OWTB 4BBRG 3F2BA 4PG3A 1AH9A 3K7AH 4R4QA 1UE7A 2OTJA 1X56A 4NXNL 3PCOB 3HOYG 1NTGA 4AQYQ 4DKAC 1WI5A 4IPGA 1PYSB 2JQOA 4XTCS 4X64L 4UPAA 4A3FH 3HOUG 4DR4L 4IFDJ 1KXLA 2E2HH 1JT8A 4LFCL 4LF4L 4IPCA 4NXML 2IX1A 4BA1I 4A4IA 2Z6KC 3NBHB 3KJPA 1GD7A 1KRSA 5M3MH 1VQPA 2NVTH 4BBSG 3PV0A 3E0EA 3PUVA 1Q12A 4KHPL 2AHOB 5GAHC 2KENA 1SR3A 4OXPA 4GNXC 4AYBG 4JI6Q 3AYHB 3UDGA 3TS0A 4DR2Q 2CKZB 4O0AA 3S1QH 1KD1C 2JA7G 1A62A 2CWPA 1LM0A 1IL2A 5JEAJ 3U50C 5LMNL 1OXXK 3NENA 4GS3A 1IYJB 1V9PA 1SFOH 3CC2A 2R93G 3UDXA 1JJGA 4GNXB 2VS1A 1CKNB 1A63A 4HJ5A 1AE2A 1PYBA 1GM5A 2ZTCA 3HOUH 1HNWL 2CWAA 1Y1WH 5GROA 1O7IA 1NE3A 3PIOA 3S1NH 4GKJL 1UE5A 4DV7Q 4X6AH 2K75A 4APVA 1EFWA 5GADC 4OWXB 4GN5A 1OXSC 4GLXA 4IOAA 1J6QA 1K73C 1PV4A 2MQHA 1IBLQ 4YY3Q 4EQ5A 4JI8L 3UE1A 5C0XI 4BY7H 4XIGS 3KF8B 2NVYH 2ATWA 2K50A 3GTKH 3F8TA 1TWCH 1P16A 3VDYA 4DAMA 4DV3L 3D31A 4HJ7A 1N36L 4LF9Q 1Q86C 4P75A 3OYYA 3PGZA 4B3MQ 3CP0A 1X6OA 4LWCA 1HR0W 1YJ9A 3OTOL 3S2HH 1XTDA 3BZKA 4NB3A 4GOPB 3PSIA 3RNUA 1VQDA 4IPDA 2Q2HA 1SMXA 4X62Q 5BR8L 2K5VA 5C4XG 1RIPA 3HKSA 2I5LX 4L5QA 4DR6L 2AMCB 1ASYA 5H1SE 2Q2TA 4JI0Q 1GO3E 4A3DH 4BY1H 1LYLA 4DR1Q 4IJHA 2Z6KA 3A74A 3CPWA 4DR5Q 3M4OH 4AH6A 3KJOA 4QL5A 3RLOA 1MIUA 3KDFB 1K83H 5C3EG 1VQOA 3NEMA 3S15H 4BXXH 4DV0L 2LXJA 2OWOA 5JJIA 1HNZL 4LUVA 4JI3Q 2UXCL 4JOIA 1XMQQ 1TWHH 1PH5A 1NY4A 3TREA 2ZJPA 3KFUA 4JI7L 4EX5A 1BBWA 3BU2A 3RR5A 4DV5L 1S3OA 4A3KG 3G6EA 5FJ8H 2AWNA 1YITA 1IBMQ 1FL0A 2MNAA 4DNIA 3GD7A 4JBMA 1JJCB 1UE6A 3M4PA 3STBD 5IP7G 1VQ5A 2OCEA 1VQJA 4RG1A 4YCVA 1J5EL 1AE3A 4LFAL 1Z47A 2VQEL 4R4CA 2PQAB 3GTQH 3GTOH 3I4MG 2BA0A 3STBC 3ZJYC 3H0GH 3S1MH 4A3BG 3MXNB 3FKIH 1N34L 2E8GA 2ZJQA 2UUBQ 3RZDH 2KHJA 2HHHL 1L1OB 5M5YH 5C0XJ 3U4VA 2IT1A 5LMNW 1VCIA 2YU9H 1C9OA 2BH8A 3K80C 4TVAB 3S24A 3CMAA 1VQ8A 3H3VI 3HOWH 4JV5Q 4B3RQ 3S2DH 1VQHA 2R6GA 4A3JG 1W2BA 3H15A 3HOZG 2XTIA 3Q8DA 2YTYA 1YHQA 3I55A 4A3GG 1VQIA 3KYHC 1VQ7A 4LUZA 4R4OA 4HIOA 1U5KA 1N32L 2E5LQ 1KL9A 5C4JH 1NMGA 4DUZQ 1OXTA 3PUWA 1I94L 5AJ3Q 3T1HQ 4A93H 2IHEA 4DR3Q 1IBKL 3PF5A 4DV6Q 1X9NA 4J15A 3OW2A 1BKBA 1WOCA 2KHIA 2GN5A 4DV4L 1EYGA 4LF8Q 4A3FG 1HNXQ 3K8AA 4P73A 1HR0Q 1N33Q 2UXDL 3UDFA 1VQKA 4A3MH 4QJFA 4R4TA 1EQQA 1CSPA 2JA9A 1I50H 3SGIA 4QGUA 3CD6A 4X65L 2D62A 5M3MG 2YYZA 2BH2A 1UWVA 2JA6H 1VQ4A 1QVFA 4JI5L 3HOVH 2ALYB 2Y0SE 4B3SQ 2E2JH 1L2FA 1VQBA 2CCZA 5GAGC 2N78A 2YTXA 2UUCQ 5IWAQ 4LFBQ 1A8VA 3ULJA 3AFPA 3GTJH 1XNQQ 1YZ6A 1QVGA 1XNRQ 3GO5A 2WB1G 3H3VH 2UXBQ 1YJWA 4JBWA 3G71A 1VS0A 1E1OA 4MNOA 2C35B 2L15A 3E9IA 2NVXH 1YNXA 3PIPA 1X54A 4A3EG 1IXRA 4NXNQ 4OX9Q 3CCSA 1HZ9A 2BA1A 3JAMc 1X3EA 4A76A 1WCMH 2EQSA 3F2CA 1Y1WG 1FVIA 1KHIA 3JAMi 4JI6L 3TS2A 1JB7A 5M5XH 2NVQH 1PH6A 2WAQG 1X65A 3ULPA 4C3JH 2KBNA 3T1YQ 1Y1VH 4LF5L 1B70B 4L5TA 4OWWB 4BY7G 4HJ9A 2NN6G 4UP8A 2UUAQ 4FDBA 2HT1A 2KCTA 1G51A 1K0RA 5LMNQ 4IJLA 3EIVA 1M90C 1YVCA 1X3FA 1VQAA 4JG2A 2EIFA 3EBEA 2R92H 1MJCA 4YCUA 5IYCH 2IY5B 2PI2A 4DV7L 1XPUA 1NMFA 1EIYB 4UY8C 1KQSA 4JI1Q 1YHAA 4GOPC 1K9MC 2DUDA 2Q2UA 4K0KQ 4QQBX 4YY3L 1VQMA 4YWKA 2XGTA 2JEBI 4GKJQ 1W3SA 4AIMA 5FLMH 4A3DG 1I6HH 1LUZA 4BY1G 2AKWB 1SLJA 1B8AA 4DK3C 4HIMA 2RCNA 2YV5A 4LF9L 3TEHB 4JI8Q 2MFIA 4B3ML 1L0WA 3CQZH 2VUMH 4BXXG 1XMOL 1X55A 1PHJA 4X62L 1ASZA 3M85A 1C0AA 4DV2Q 2VQFQ 2JE6I 4IPHA 1JJ2A 1E3PA 3CCEA 4POGA 2MO1A 2ZTDA 4UP7A 4C3HH 4DV1Q 3J80c 2F4VQ 4DR1L 5FJ8G 3M4QA 5BR8Q 3PUYA 4GNXA 3UE0A 2ES2A 3PO3H 2I0QA 3HKZE 1CKNA 3FHWA 1HZAA 5ELOA 3J80i 3CF5A 4DR5L 3J7ZC 2UU9L 2B3GA 3I4NH 3M9BA 2OTLA 1G291 2VZAA 2R7FA 4A3LG 3S17H 1HH2P 1WYDA 4QY7A 3H0GG 4X66L 1OXVA 3K7UC 3FKIG 1SROA 4JI3L 3CMEA 1E24A 2JA8H 1XMQL 5IT9c 2HQLA 2LSSA 1VQ6A 1MJEA 4JBKA 2ZM6Q 2FXQA 1S72A 1L1OC 1IBML 1KIXA 3HOWG 3ULLA 2A19A 5IYBH 5C4XH 2E2IH 3PUXA 2JK8A 4GKKQ 1FJGL 2JJQA 1YJNA 3GTPH 1JE5A 4DV5Q 4DR7Q 2LXKA 3UDIA 2D0OA 1R9TH 4UP9A 4OO1I 5IYDH 1BVSA 1CKOA 1U0LA 2QEXA 1C7YA 4JI4Q 4HIKA 2N49A 3JC66 2UUBL 2ID0A 4A3IH 4JI2Q 1E22A 1SRUA 3HOXG 4A93G 4B3RL 1EWIA 4JV5L 3RLNA 3L0OA 1CUKA 1D8LA 2HIVA 1G6PA 2VY3A 4IFDG 3DLLA 1V43A 2Q2IA 4A3KH 5M3FH 5HY6A 4A3CH 1KAWA 2A1AA 4LF7L 4A3MG 2KCMA 3KLWA 4PZ7A 2VW9A 4WJ4A 2NZOA 1B7YB 2E5LL 2NZHA 1FGUA 4DUZL 1TWFH 1WJJA 2JA6G 4JYAQ 2B63H 3GTLH 3T1HL 3HOVG 4DUYL 4DR3L 4B3TL 1VQNA 2GVAA 2K4KA 3DM3A 2GVBA 1A0IA 3K81C 1M1KC 4YHHQ 5JEAG 5LMUL 3ICEA 4LF8L 1YHBA 4LUOA 1HR0L 4HIDA 1PH7A 1N33L 3A5UA 1PH3A 1JMCA 2JA5H 3M3YH 2K5HA 5E7NA 4LF6Q 4DV4Q 1MKHA 4AQYL 2UXDQ 3J81j 1N8RC 4L5RC 1P8LA 3PO2H 1WFQA 4ME3A 4B3SL 5GAEC 1VQLA 3LGJA 1PA6A 5IWAL 4X65Q 5FLXc 4LFBL 4MTNA 5ELNA 1XNQL 1OXUA 4NPSA 5IP9H 4X64Q 1QUQA 4RMFA 3MEFA 4JCVE 1K3RA 4A75A 4DR4Q 1PH2A 2UXBL 1Y1VG 4LFCQ 4LF4Q 4NXMQ 4OX9L 4H02A 1XPRA 1TWAH 2CFMA 3S1RH 1Q81C 4DK6C 3M7NA 2NN6I 3U4ZA 4DR2L 1PH8A 4LW1A 4JC0A 2R7ZH 1YBYA 1D7QA 5C44H 3K0XA 4BBRH 4KHPQ 1RL2A 1EQRA 2VL6A 3BZCA 2R92G 3ERSX 2ZTEA 1E1TA 5IYCG 1S40A 1KC8C 2WP8J 3KF6A 3RZOH 1H95A 3HOYH 1PH9A 3GDEA 3CAMA 4P74A 1K8AC 4C2MH 1VQ9A 3T1YL 2OQ0A 3CCJA 3CXCA 1BBUA 5FLMG 2K52A 2CQOA 1CKMA 3G4SA 2OQKA 4JOIC 1QZGA 2UUAL 1Z9FA 4BBSH 2Z0SA 1QZHA 1EIFA 2RF4A 2V1CC 2DGYA 1YI2A 1IBLL 4LF5Q 3CCMA 4GLAC 4A3EH 1HNWQ 2VUMG 3W1BA 3TRZA 1VQCA 3HFZB 4P71A 4JI1L 2YTVA 3D0FA 2JA7H 4K0KL 2JEAI 4JBJA 1Q1EA 2EXDA 1NJIC 3AEVA 2R93H 1XPOA 2F52A 4PZ6A 2D0PA 2H5XA 4QIWE 4DPGA 3F1ZA 3CCLA 2N8NA 2N3SA 1Q82C 3PO3G 2Y0SG 4KI0A 5EAYA 2PI2E 1VQFA 3F2DA 4DV3Q 3E9HA 1N36Q 5GQOA 2I5MX 3B6YA 1T9HA 5IY0A 3I4NG 4BA2I 5K36G 3J7A5 3I4OA 4JI0L 4GN4B 1EOVA 2WFWA 3OTOQ 3RN2A 3GTGH 3I2ZA 1V1QA 4DV2L 2JA8G 1EUJA 2VQFL 5C0XG 2K5NA 4DV1L 3PF4A 4DR6Q 4IO9A 1XMOQ 1N9WA 1TXYA 1UE1A 3CPFA 2QGQA 3I56A 2F4VL 4WJ3M 3KOJA 1GKHA 4GN3B 5IYBG 3L2PA 1CSQA 1NBWA 4LNQA 4PMWA 4HJ8A 4KHZA 4IOCA 4GLVB 1Q8KA 3U58A 1HZCA 4L5SA 3AQQA 2VNUD 4R1JA 3CC7A 1OTCA 3RN5A 2RHSB 2IHFA 4P72A 5IYDG 5JJKA 1XJVA 4DV0Q 3CCVA 1I5FA 1KRTA 1HNZQ 2PNHA 2MO0A 2UU9Q 2UXCQ 4O2DA 1SN8A 1Q1BA 3FP9A 1QVCA 1SE8A 4KLKA 2R7DA 3I7FA 1GVPA 2ZM6L 3G48A 2AWOA 3EN2A 4JI7Q 4X66Q 1UEBA 4A3IG 1HNXL 3CW2C 1Q7YC 4GKKL 3IRBA 1PVOA 4IFDI 4GOPA 4DR7L 1TWGH 5M3FG 5C3EH 4ALPA 1J5EQ 4LFAQ 1PFSA 4A3CG 2VQEQ 3CCQA 1VQGA 1VQEA 2WB1E 3CCRA 4Y7NH 4JI4L 4Y52H 1N34Q 3AFQA 1FJGQ 1I3QH 4JI2L 3TQYA 4A3LH 2HHHQ 4AYBE 2B63G 2ASBA 4OONA 2K14A 4MZ9A 4R4IA 5JJLA 3BJUA 1HJPA 2F3IA 5IP7H 3KDFA 3J81c 4YWMA 1X3GA 3S16H 3J81i 1YIJA 3W1GA 1YEZA 5J3BA 2WAQE 1Q46A 3CCUA 2JA5G 3NELA 4YWLA 1QUQB 5AJ3L 3WWVA 3I4MH 5DLQE 4A3BH 1N32Q 5HGQA 3S14H 4DV6L 1Y14B 3CC4A 1E7ZA 4JYAL 4HJAA 3PUZA 2A8VA 4OO1G 4POFA 4LF7Q 3PO2G 3A5ZB 3HKZG 1I94Q 2ZJRA 2IX0A 1LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IE8 A;  3L7Z C;  1DGS A;  1HZB A;  1PH1 A;  1IBK Q;  2HIX A;  4TQU S;  3A0J A;  2B29 A;  4YHH L;  1K8G A;  4PZ8 A;  2PQA A;  3W5O A;  4A3J H;  5IP9 G;  3HOZ H;  3KF6 B;  3HOX H;  4YCW A;  3RLF A;  4C3I H;  4A3G H;  2I5H A;  4DUY Q;  4B3T Q;  2RHQ B;  1WCM G;  4LF6 L;  3GTM H;  5M5W H;  1PH4 A;  1L1O A;  5LMU Q;  2UUC L;  2QA4 A;  1IZ6 A;  2R7Z G;  2PMZ E;  1XNR L;  5C44 G;  3ER0 A;  4JI5 Q;  4DAY B;  4OWT B;  4BBR G;  3F2B A;  4PG3 A;  1AH9 A;  3K7A H;  4R4Q A;  1UE7 A;  2OTJ A;  1X56 A;  4NXN L;  3PCO B;  3HOY G;  1NTG A;  4AQY Q;  4DKA C;  1WI5 A;  4IPG A;  1PYS B;  2JQO A;  4XTC S;  4X64 L;  4UPA A;  4A3F H;  3HOU G;  4DR4 L;  4IFD J;  1KXL A;  2E2H H;  1JT8 A;  4LFC L;  4LF4 L;  4IPC A;  4NXM L;  2IX1 A;  4BA1 I;  4A4I A;  2Z6K C;  3NBH B;  3KJP A;  1GD7 A;  1KRS A;  5M3M H;  1VQP A;  2NVT H;  4BBS G;  3PV0 A;  3E0E A;  3PUV A;  1Q12 A;  4KHP L;  2AHO B;  5GAH C;  2KEN A;  1SR3 A;  4OXP A;  4GNX C;  4AYB G;  4JI6 Q;  3AYH B;  3UDG A;  3TS0 A;  4DR2 Q;  2CKZ B;  4O0A A;  3S1Q H;  1KD1 C;  2JA7 G;  1A62 A;  2CWP A;  1LM0 A;  1IL2 A;  5JEA J;  3U50 C;  5LMN L;  1OXX K;  3NEN A;  4GS3 A;  1IYJ B;  1V9P A;  1SFO H;  3CC2 A;  2R93 G;  3UDX A;  1JJG A;  4GNX B;  2VS1 A;  1CKN B;  1A63 A;  4HJ5 A;  1AE2 A;  1PYB A;  1GM5 A;  2ZTC A;  3HOU H;  1HNW L;  2CWA A;  1Y1W H;  5GRO A;  1O7I A;  1NE3 A;  3PIO A;  3S1N H;  4GKJ L;  1UE5 A;  4DV7 Q;  4X6A H;  2K75 A;  4APV A;  1EFW A;  5GAD C;  4OWX B;  4GN5 A;  1OXS C;  4GLX A;  4IOA A;  1J6Q A;  1K73 C;  1PV4 A;  2MQH A;  1IBL Q;  4YY3 Q;  4EQ5 A;  4JI8 L;  3UE1 A;  5C0X I;  4BY7 H;  4XIG S;  3KF8 B;  2NVY H;  2ATW A;  2K50 A;  3GTK H;  3F8T A;  1TWC H;  1P16 A;  3VDY A;  4DAM A;  4DV3 L;  3D31 A;  4HJ7 A;  1N36 L;  4LF9 Q;  1Q86 C;  4P75 A;  3OYY A;  3PGZ A;  4B3M Q;  3CP0 A;  1X6O A;  4LWC A;  1HR0 W;  1YJ9 A;  3OTO L;  3S2H H;  1XTD A;  3BZK A;  4NB3 A;  4GOP B;  3PSI A;  3RNU A;  1VQD A;  4IPD A;  2Q2H A;  1SMX A;  4X62 Q;  5BR8 L;  2K5V A;  5C4X G;  1RIP A;  3HKS A;  2I5L X;  4L5Q A;  4DR6 L;  2AMC B;  1ASY A;  5H1S E;  2Q2T A;  4JI0 Q;  1GO3 E;  4A3D H;  4BY1 H;  1LYL A;  4DR1 Q;  4IJH A;  2Z6K A;  3A74 A;  3CPW A;  4DR5 Q;  3M4O H;  4AH6 A;  3KJO A;  4QL5 A;  3RLO A;  1MIU A;  3KDF B;  1K83 H;  5C3E G;  1VQO A;  3NEM A;  3S15 H;  4BXX H;  4DV0 L;  2LXJ A;  2OWO A;  5JJI A;  1HNZ L;  4LUV A;  4JI3 Q;  2UXC L;  4JOI A;  1XMQ Q;  1TWH H;  1PH5 A;  1NY4 A;  3TRE A;  2ZJP A;  3KFU A;  4JI7 L;  4EX5 A;  1BBW A;  3BU2 A;  3RR5 A;  4DV5 L;  1S3O A;  4A3K G;  3G6E A;  5FJ8 H;  2AWN A;  1YIT A;  1IBM Q;  1FL0 A;  2MNA A;  4DNI A;  3GD7 A;  4JBM A;  1JJC B;  1UE6 A;  3M4P A;  3STB D;  5IP7 G;  1VQ5 A;  2OCE A;  1VQJ A;  4RG1 A;  4YCV A;  1J5E L;  1AE3 A;  4LFA L;  1Z47 A;  2VQE L;  4R4C A;  2PQA B;  3GTQ H;  3GTO H;  3I4M G;  2BA0 A;  3STB C;  3ZJY C;  3H0G H;  3S1M H;  4A3B G;  3MXN B;  3FKI H;  1N34 L;  2E8G A;  2ZJQ A;  2UUB Q;  3RZD H;  2KHJ A;  2HHH L;  1L1O B;  5M5Y H;  5C0X J;  3U4V A;  2IT1 A;  5LMN W;  1VCI A;  2YU9 H;  1C9O A;  2BH8 A;  3K80 C;  4TVA B;  3S24 A;  3CMA A;  1VQ8 A;  3H3V I;  3HOW H;  4JV5 Q;  4B3R Q;  3S2D H;  1VQH A;  2R6G A;  4A3J G;  1W2B A;  3H15 A;  3HOZ G;  2XTI A;  3Q8D A;  2YTY A;  1YHQ A;  3I55 A;  4A3G G;  1VQI A;  3KYH C;  1VQ7 A;  4LUZ A;  4R4O A;  4HIO A;  1U5K A;  1N32 L;  2E5L Q;  1KL9 A;  5C4J H;  1NMG A;  4DUZ Q;  1OXT A;  3PUW A;  1I94 L;  5AJ3 Q;  3T1H Q;  4A93 H;  2IHE A;  4DR3 Q;  1IBK L;  3PF5 A;  4DV6 Q;  1X9N A;  4J15 A;  3OW2 A;  1BKB A;  1WOC A;  2KHI A;  2GN5 A;  4DV4 L;  1EYG A;  4LF8 Q;  4A3F G;  1HNX Q;  3K8A A;  4P73 A;  1HR0 Q;  1N33 Q;  2UXD L;  3UDF A;  1VQK A;  4A3M H;  4QJF A;  4R4T A;  1EQQ A;  1CSP A;  2JA9 A;  1I50 H;  3SGI A;  4QGU A;  3CD6 A;  4X65 L;  2D62 A;  5M3M G;  2YYZ A;  2BH2 A;  1UWV A;  2JA6 H;  1VQ4 A;  1QVF A;  4JI5 L;  3HOV H;  2ALY B;  2Y0S E;  4B3S Q;  2E2J H;  1L2F A;  1VQB A;  2CCZ A;  5GAG C;  2N78 A;  2YTX A;  2UUC Q;  5IWA Q;  4LFB Q;  1A8V A;  3ULJ A;  3AFP A;  3GTJ H;  1XNQ Q;  1YZ6 A;  1QVG A;  1XNR Q;  3GO5 A;  2WB1 G;  3H3V H;  2UXB Q;  1YJW A;  4JBW A;  3G71 A;  1VS0 A;  1E1O A;  4MNO A;  2C35 B;  2L15 A;  3E9I A;  2NVX H;  1YNX A;  3PIP A;  1X54 A;  4A3E G;  1IXR A;  4NXN Q;  4OX9 Q;  3CCS A;  1HZ9 A;  2BA1 A;  3JAM c;  1X3E A;  4A76 A;  1WCM H;  2EQS A;  3F2C A;  1Y1W G;  1FVI A;  1KHI A;  3JAM i;  4JI6 L;  3TS2 A;  1JB7 A;  5M5X H;  2NVQ H;  1PH6 A;  2WAQ G;  1X65 A;  3ULP A;  4C3J H;  2KBN A;  3T1Y Q;  1Y1V H;  4LF5 L;  1B70 B;  4L5T A;  4OWW B;  4BY7 G;  4HJ9 A;  2NN6 G;  4UP8 A;  2UUA Q;  4FDB A;  2HT1 A;  2KCT A;  1G51 A;  1K0R A;  5LMN Q;  4IJL A;  3EIV A;  1M90 C;  1YVC A;  1X3F A;  1VQA A;  4JG2 A;  2EIF A;  3EBE A;  2R92 H;  1MJC A;  4YCU A;  5IYC H;  2IY5 B;  2PI2 A;  4DV7 L;  1XPU A;  1NMF A;  1EIY B;  4UY8 C;  1KQS A;  4JI1 Q;  1YHA A;  4GOP C;  1K9M C;  2DUD A;  2Q2U A;  4K0K Q;  4QQB X;  4YY3 L;  1VQM A;  4YWK A;  2XGT A;  2JEB I;  4GKJ Q;  1W3S A;  4AIM A;  5FLM H;  4A3D G;  1I6H H;  1LUZ A;  4BY1 G;  2AKW B;  1SLJ A;  1B8A A;  4DK3 C;  4HIM A;  2RCN A;  2YV5 A;  4LF9 L;  3TEH B;  4JI8 Q;  2MFI A;  4B3M L;  1L0W A;  3CQZ H;  2VUM H;  4BXX G;  1XMO L;  1X55 A;  1PHJ A;  4X62 L;  1ASZ A;  3M85 A;  1C0A A;  4DV2 Q;  2VQF Q;  2JE6 I;  4IPH A;  1JJ2 A;  1E3P A;  3CCE A;  4POG A;  2MO1 A;  2ZTD A;  4UP7 A;  4C3H H;  4DV1 Q;  3J80 c;  2F4V Q;  4DR1 L;  5FJ8 G;  3M4Q A;  5BR8 Q;  3PUY A;  4GNX A;  3UE0 A;  2ES2 A;  3PO3 H;  2I0Q A;  3HKZ E;  1CKN A;  3FHW A;  1HZA A;  5ELO A;  3J80 i;  3CF5 A;  4DR5 L;  3J7Z C;  2UU9 L;  2B3G A;  3I4N H;  3M9B A;  2OTL A;  1G29 1;  2VZA A;  2R7F A;  4A3L G;  3S17 H;  1HH2 P;  1WYD A;  4QY7 A;  3H0G G;  4X66 L;  1OXV A;  3K7U C;  3FKI G;  1SRO A;  4JI3 L;  3CME A;  1E24 A;  2JA8 H;  1XMQ L;  5IT9 c;  2HQL A;  2LSS A;  1VQ6 A;  1MJE A;  4JBK A;  2ZM6 Q;  2FXQ A;  1S72 A;  1L1O C;  1IBM L;  1KIX A;  3HOW G;  3ULL A;  2A19 A;  5IYB H;  5C4X H;  2E2I H;  3PUX A;  2JK8 A;  4GKK Q;  1FJG L;  2JJQ A;  1YJN A;  3GTP H;  1JE5 A;  4DV5 Q;  4DR7 Q;  2LXK A;  3UDI A;  2D0O A;  1R9T H;  4UP9 A;  4OO1 I;  5IYD H;  1BVS A;  1CKO A;  1U0L A;  2QEX A;  1C7Y A;  4JI4 Q;  4HIK A;  2N49 A;  3JC6 6;  2UUB L;  2ID0 A;  4A3I H;  4JI2 Q;  1E22 A;  1SRU A;  3HOX G;  4A93 G;  4B3R L;  1EWI A;  4JV5 L;  3RLN A;  3L0O A;  1CUK A;  1D8L A;  2HIV A;  1G6P A;  2VY3 A;  4IFD G;  3DLL A;  1V43 A;  2Q2I A;  4A3K H;  5M3F H;  5HY6 A;  4A3C H;  1KAW A;  2A1A A;  4LF7 L;  4A3M G;  2KCM A;  3KLW A;  4PZ7 A;  2VW9 A;  4WJ4 A;  2NZO A;  1B7Y B;  2E5L L;  2NZH A;  1FGU A;  4DUZ L;  1TWF H;  1WJJ A;  2JA6 G;  4JYA Q;  2B63 H;  3GTL H;  3T1H L;  3HOV G;  4DUY L;  4DR3 L;  4B3T L;  1VQN A;  2GVA A;  2K4K A;  3DM3 A;  2GVB A;  1A0I A;  3K81 C;  1M1K C;  4YHH Q;  5JEA G;  5LMU L;  3ICE A;  4LF8 L;  1YHB A;  4LUO A;  1HR0 L;  4HID A;  1PH7 A;  1N33 L;  3A5U A;  1PH3 A;  1JMC A;  2JA5 H;  3M3Y H;  2K5H A;  5E7N A;  4LF6 Q;  4DV4 Q;  1MKH A;  4AQY L;  2UXD Q;  3J81 j;  1N8R C;  4L5R C;  1P8L A;  3PO2 H;  1WFQ A;  4ME3 A;  4B3S L;  5GAE C;  1VQL A;  3LGJ A;  1PA6 A;  5IWA L;  4X65 Q;  5FLX c;  4LFB L;  4MTN A;  5ELN A;  1XNQ L;  1OXU A;  4NPS A;  5IP9 H;  4X64 Q;  1QUQ A;  4RMF A;  3MEF A;  4JCV E;  1K3R A;  4A75 A;  4DR4 Q;  1PH2 A;  2UXB L;  1Y1V G;  4LFC Q;  4LF4 Q;  4NXM Q;  4OX9 L;  4H02 A;  1XPR A;  1TWA H;  2CFM A;  3S1R H;  1Q81 C;  4DK6 C;  3M7N A;  2NN6 I;  3U4Z A;  4DR2 L;  1PH8 A;  4LW1 A;  4JC0 A;  2R7Z H;  1YBY A;  1D7Q A;  5C44 H;  3K0X A;  4BBR H;  4KHP Q;  1RL2 A;  1EQR A;  2VL6 A;  3BZC A;  2R92 G;  3ERS X;  2ZTE A;  1E1T A;  5IYC G;  1S40 A;  1KC8 C;  2WP8 J;  3KF6 A;  3RZO H;  1H95 A;  3HOY H;  1PH9 A;  3GDE A;  3CAM A;  4P74 A;  1K8A C;  4C2M H;  1VQ9 A;  3T1Y L;  2OQ0 A;  3CCJ A;  3CXC A;  1BBU A;  5FLM G;  2K52 A;  2CQO A;  1CKM A;  3G4S A;  2OQK A;  4JOI C;  1QZG A;  2UUA L;  1Z9F A;  4BBS H;  2Z0S A;  1QZH A;  1EIF A;  2RF4 A;  2V1C C;  2DGY A;  1YI2 A;  1IBL L;  4LF5 Q;  3CCM A;  4GLA C;  4A3E H;  1HNW Q;  2VUM G;  3W1B A;  3TRZ A;  1VQC A;  3HFZ B;  4P71 A;  4JI1 L;  2YTV A;  3D0F A;  2JA7 H;  4K0K L;  2JEA I;  4JBJ A;  1Q1E A;  2EXD A;  1NJI C;  3AEV A;  2R93 H;  1XPO A;  2F52 A;  4PZ6 A;  2D0P A;  2H5X A;  4QIW E;  4DPG A;  3F1Z A;  3CCL A;  2N8N A;  2N3S A;  1Q82 C;  3PO3 G;  2Y0S G;  4KI0 A;  5EAY A;  2PI2 E;  1VQF A;  3F2D A;  4DV3 Q;  3E9H A;  1N36 Q;  5GQO A;  2I5M X;  3B6Y A;  1T9H A;  5IY0 A;  3I4N G;  4BA2 I;  5K36 G;  3J7A 5;  3I4O A;  4JI0 L;  4GN4 B;  1EOV A;  2WFW A;  3OTO Q;  3RN2 A;  3GTG H;  3I2Z A;  1V1Q A;  4DV2 L;  2JA8 G;  1EUJ A;  2VQF L;  5C0X G;  2K5N A;  4DV1 L;  3PF4 A;  4DR6 Q;  4IO9 A;  1XMO Q;  1N9W A;  1TXY A;  1UE1 A;  3CPF A;  2QGQ A;  3I56 A;  2F4V L;  4WJ3 M;  3KOJ A;  1GKH A;  4GN3 B;  5IYB G;  3L2P A;  1CSQ A;  1NBW A;  4LNQ A;  4PMW A;  4HJ8 A;  4KHZ A;  4IOC A;  4GLV B;  1Q8K A;  3U58 A;  1HZC A;  4L5S A;  3AQQ A;  2VNU D;  4R1J A;  3CC7 A;  1OTC A;  3RN5 A;  2RHS B;  2IHF A;  4P72 A;  5IYD G;  5JJK A;  1XJV A;  4DV0 Q;  3CCV A;  1I5F A;  1KRT A;  1HNZ Q;  2PNH A;  2MO0 A;  2UU9 Q;  2UXC Q;  4O2D A;  1SN8 A;  1Q1B A;  3FP9 A;  1QVC A;  1SE8 A;  4KLK A;  2R7D A;  3I7F A;  1GVP A;  2ZM6 L;  3G48 A;  2AWO A;  3EN2 A;  4JI7 Q;  4X66 Q;  1UEB A;  4A3I G;  1HNX L;  3CW2 C;  1Q7Y C;  4GKK L;  3IRB A;  1PVO A;  4IFD I;  4GOP A;  4DR7 L;  1TWG H;  5M3F G;  5C3E H;  4ALP A;  1J5E Q;  4LFA Q;  1PFS A;  4A3C G;  2VQE Q;  3CCQ A;  1VQG A;  1VQE A;  2WB1 E;  3CCR A;  4Y7N H;  4JI4 L;  4Y52 H;  1N34 Q;  3AFQ A;  1FJG Q;  1I3Q H;  4JI2 L;  3TQY A;  4A3L H;  2HHH Q;  4AYB E;  2B63 G;  2ASB A;  4OON A;  2K14 A;  4MZ9 A;  4R4I A;  5JJL A;  3BJU A;  1HJP A;  2F3I A;  5IP7 H;  3KDF A;  3J81 c;  4YWM A;  1X3G A;  3S16 H;  3J81 i;  1YIJ A;  3W1G A;  1YEZ A;  5J3B A;  2WAQ E;  1Q46 A;  3CCU A;  2JA5 G;  3NEL A;  4YWL A;  1QUQ B;  5AJ3 L;  3WWV A;  3I4M H;  5DLQ E;  4A3B H;  1N32 Q;  5HGQ A;  3S14 H;  4DV6 L;  1Y14 B;  3CC4 A;  1E7Z A;  4JYA L;  4HJA A;  3PUZ A;  2A8V A;  4OO1 G;  4POF A;  4LF7 Q;  3PO2 G;  3A5Z B;  3HKZ G;  1I94 Q;  2ZJR A;  2IX0 A;  1LTL A; 
#chains in the Genus database with same CATH topology
 5IE8 A;  1HZB A;  2HIX A;  3A0J A;  1K8G A;  5C6A A;  3HOZ H;  1JE4 A;  3KF6 B;  1JWU D;  4A3G H;  2I5H A;  4B3T Q;  4A3B B;  1WCM G;  3OWF A;  1PH4 A;  1L1O A;  5LMU Q;  2QA4 A;  3IAY A;  2R7Z G;  4LMQ D;  2PMZ E;  1XNR L;  4K14 A;  3SK8 A;  3F2B A;  3VYU A;  2E74 C;  4R4Q A;  2B2T A;  1NTG A;  4A3J B;  2A68 D;  1WI5 A;  2JQO A;  3SEB A;  4IFD J;  4DR4 L;  2SOB A;  4LF4 L;  4BA1 I;  2B2V C;  1E0B A;  3K58 A;  1VQP A;  2NVT H;  4A3M B;  3DWA A;  4KHP L;  2L55 A;  1KAA A;  4JI6 Q;  1A3T A;  3AYH B;  4YIJ A;  3VYR A;  4DR2 Q;  3CHB D;  1SNM A;  1JQY D;  3A7L A;  4A3F B;  1IL2 A;  2CWP A;  1LM0 A;  2KOL A;  5JEA J;  1XX8 A;  3GTJ B;  1QNU A;  2J4X A;  1A63 A;  1G2T A;  4HJ5 A;  4RGM A;  1LTS D;  1GM5 A;  1Y1W H;  5CBA E;  5GRO A;  3H09 A;  5JPN C;  4DV7 Q;  4APV A;  2A6E C;  3DUZ A;  1OXS C;  2WB1 B;  3QB3 A;  4GN5 A;  4GLX A;  5EKI A;  3ZYY X;  1IL8 A;  4XIG S;  1ZYR D;  3E0J A;  1C4Q A;  3GQB A;  2NVY H;  1TWC H;  1P16 A;  3KLS X;  1SE4 A;  1T5X D;  4HN7 A;  4DAM A;  1ZEQ X;  4DV3 L;  5EBC A;  1Q86 C;  1STA A;  3CP0 A;  3S1N B;  4HCS A;  1LT5 D;  3OTO L;  4NB3 A;  3PSI A;  1VQD A;  1VF5 C;  2EY1 A;  4Z9C B;  5IGF A;  2K5V A;  3ND8 A;  1RIP A;  4DR6 L;  1RTO A;  1G8Z D;  1SEB D;  4JI0 Q;  1LYL A;  4DXG A;  4DR1 Q;  4IJH A;  4NKL A;  3A74 A;  1YNJ D;  3NQT A;  3NEM A;  4NDX A;  4DV0 L;  2OWO A;  3IFD A;  5JJI A;  4KMU C;  2UXC L;  1TWH H;  2ZJP A;  5I6Y A;  4A3D B;  1BBW A;  1FGB D;  4OL7 A;  5FJ8 H;  1A2U A;  4ABN A;  5IP7 G;  2F0I A;  1VQJ A;  4RG1 A;  1CTM A;  2WIN B;  1YNN C;  3NHH A;  1J5E L;  1A2T A;  2HDL A;  3S15 B;  2VQE L;  3PO3 B;  3GTO H;  2BA0 A;  3IL8 A;  3MEH A;  1AFP A;  3ERQ A;  4WOR A;  5KND A;  2F0Q A;  5C0X J;  5LMN W;  2NUC A;  1VCI A;  3K80 C;  1JOR A;  1VQ8 A;  1SYD A;  3HOZ G;  1CI3 M;  3Q8D A;  3ONA B;  2YTY A;  1YHQ A;  3GTQ B;  4A3G G;  4EQN A;  2B2Y C;  3NBI A;  4R4O A;  2ZXP A;  3NXW A;  2L12 A;  5M5Y B;  1R9T B;  1I94 L;  2F03 A;  3C3L A;  2EYP A;  5G3L D;  1EY6 A;  1MSG A;  2SEB D;  1N33 Q;  3BVZ A;  5KGU A;  2JA9 A;  2DJG C;  3CD6 A;  4FF2 A;  5DEH A;  3WOE A;  4TKO B;  2Y0S E;  4ME5 A;  1L2F A;  2CCZ A;  2DJF C;  1GOZ A;  3T16 A;  3ULJ A;  3GTL B;  5TSS A;  1YZ6 A;  3GO5 A;  3LWE A;  5JVG 3;  1VS0 A;  4MNO A;  4KKU A;  1DOM A;  2EE1 A;  3SDZ A;  2M9V A;  3CCS A;  3JAM c;  2TMP A;  2FHT A;  2P5Z X;  1Y1W G;  2RSO A;  4JVZ A;  5M5X H;  1KAB A;  1PYW D;  1WD1 A;  4C3J H;  1Y1V H;  4HJ9 A;  4UP8 A;  1HRJ A;  1SND A;  2L0C A;  1H9K A;  3I3C A;  1K0R A;  4IJL A;  1M90 C;  1YVC A;  1UUP A;  1VQA A;  3D4W A;  3EBE A;  1CM9 A;  3T51 B;  1EIY B;  1LV9 A;  1YHA A;  5AFW A;  5ELB A;  2J7Z A;  2A74 C;  1VQM A;  1BUV T;  2JEB I;  4X3S A;  4GKJ Q;  4G7O C;  1I6H H;  3D8G A;  4C2M B;  2RVL A;  4DK3 C;  1H9J A;  4LF9 L;  1CQV A;  3TEH B;  4B3M L;  1H9S A;  3E3X A;  2VUM H;  4BBS B;  1EWC A;  2HQE A;  1XMO L;  4QB4 A;  1XTC D;  1PHJ A;  4X62 L;  4IPH A;  1HFG A;  4UP7 A;  4KN7 C;  3J81 E;  4XQQ A;  2F4V Q;  5FJ8 G;  3PUY A;  4ILW A;  3UE0 A;  4CJ2 C;  4GNX A;  3HKZ E;  1EIH A;  3J7Z C;  1EY7 A;  3CQZ B;  2MPM A;  3I4N H;  5K36 H;  1D6E C;  2WV6 D;  2VB3 X;  1HH2 P;  5LHY 1;  1J9O A;  3CME A;  2XNA C;  4DA2 A;  4DU9 A;  5T1I A;  4C3H B;  3GTG B;  3HGB A;  2O4X A;  2JXM B;  5C4X H;  2E2I H;  1F9S A;  3A54 A;  1ZXT A;  2LXK A;  2AQ2 B;  2D0O A;  5IYD H;  1BVS A;  5ELD A;  2ZXO A;  1DD2 A;  3JC6 6;  1PZI D;  4A3I H;  1IW7 D;  1SRU A;  3W2D A;  3HOX G;  5E4W C;  1NSN S;  2D2C C;  1LTG D;  2PW5 A;  4IAL A;  3SHL A;  2SNS A;  3DLL A;  1ENF A;  5CV5 A;  2K33 A;  5M3F H;  1AN8 A;  4LF7 L;  2L5T A;  3KLW A;  2RA4 A;  2NZO A;  2WKD A;  4J6H A;  1RF2 D;  3T56 B;  1D5M C;  1FGU A;  2PQE A;  3OMC A;  4JYA Q;  2B63 H;  3CKI B;  1F9Q A;  3T1H L;  4B3T L;  2HUG A;  1M4V A;  1E2V A;  3DM3 A;  5IGG A;  5LMU L;  4A3K B;  3ICE A;  1YHB A;  2KCC A;  2JA5 H;  3M3Y H;  2IWH A;  4P2C B;  2HCC A;  1WTH A;  4DV4 Q;  1TWF B;  1N8R C;  1P8L A;  3AB9 A;  3PO2 H;  2IW3 A;  1Q8I A;  3H91 A;  3LGJ A;  1VQL A;  4X65 Q;  4LFB L;  5ELN A;  2G9D A;  5IP9 H;  1QUQ A;  3HG9 A;  4RMF A;  4A75 A;  1K3R A;  1D1I A;  4DR4 Q;  4C3J G;  2UXB L;  4DN4 M;  4IUQ A;  1Y1V G;  3HOU G;  4LF4 Q;  1C8C A;  3S1R H;  3FEW X;  2EYM A;  4DK6 C;  3GV6 A;  4WJW A;  2NN6 I;  4DR2 L;  1PH8 A;  4KHV A;  3M7N A;  2HDM A;  4EQO A;  4KHP Q;  1O7Y A;  1RL2 A;  1KC8 C;  4IUT A;  3KF6 A;  4HAE A;  3HOY H;  3GDE A;  4P74 A;  1OO9 B;  1AZP A;  3T1Y L;  1BO0 A;  2OQ0 A;  1S5E D;  1NNX A;  2H4O A;  2CQO A;  2UUA L;  3G4S A;  4JOI C;  3KUP A;  1I4G A;  2B2W A;  3R8B A;  4GLA C;  4A3E H;  2VUM G;  3W1B A;  2QCP X;  3HFZ B;  3U9O A;  1G2S A;  4CJ0 B;  1EOT A;  4ZYS A;  2JA7 H;  4K0K L;  3DHQ A;  2EXD A;  1BCP C;  2H5X A;  4QIW E;  3R3O A;  1G6Z A;  2E75 C;  4DPG A;  3CCL A;  2N3S A;  3KBX A;  5EAY A;  3Q0A A;  4DV3 Q;  2Z6B A;  3E9H A;  2I5M X;  5K36 G;  3I4N G;  3NQI A;  3J7A 5;  3I4O A;  4JI0 L;  3OTO Q;  1EOV A;  1ZKO A;  1AW7 A;  2R93 B;  2K5N A;  5E3F A;  1JIC A;  4DV1 L;  4DR6 Q;  4KKT A;  3CPF A;  1R4P B;  1BCP F;  3I73 A;  1GKH A;  3L2P A;  5IIF A;  1CFM A;  4MTK A;  3SK6 A;  3AQQ A;  4R1J A;  3CC7 A;  4IUV A;  3RN5 A;  2DY8 A;  2ICI A;  5IYD G;  4DV0 Q;  3CCV A;  2UU9 Q;  2UXC Q;  4O2D A;  1SN8 A;  1Q1B A;  4A3I G;  1QVC A;  3N52 A;  3G48 A;  4X66 Q;  4HSV A;  2FMM A;  4QUC A;  5KYL A;  1PVO A;  1KNE A;  5M3F G;  4ALP A;  5C3E H;  5EKK A;  1J5E Q;  2F0N A;  3OPO A;  2VQE Q;  4XXE A;  3HS0 C;  1VF7 A;  3MVV A;  1TR5 A;  1FJG Q;  2ZT9 C;  4A3L H;  2RKS A;  3KLR A;  4AYB E;  2B63 G;  1X3Q A;  2K14 A;  1XWE A;  3NUC A;  1XYI A;  3J81 c;  1C48 A;  2EYJ A;  2F0E A;  2JA5 G;  3BVM A;  3NEL A;  4A3B H;  1LT4 D;  4CHT B;  5HGQ A;  1WTX A;  1E7Z A;  2KQ3 A;  3PUZ A;  1HA6 A;  4POF A;  3PO2 G;  3A5Z B;  1I94 Q;  3OIP A;  2IX0 A;  4DFA A;  4EGV A;  1DGS A;  1SE3 A;  1PH1 A;  4TQU S;  2B29 A;  2Q8R E;  1PTO C;  2EJF C;  3I4L A;  3W5O A;  4A3J H;  5IP9 G;  1Z6H A;  4BWG B;  4FXD A;  3S2D B;  2RHQ B;  3OIQ A;  3NWT A;  5M5W H;  3S14 B;  4QIW B;  2CH4 W;  4G7H C;  4DAY B;  4PG3 A;  1AH9 A;  3K7A H;  1UE7 A;  5C4J B;  1X56 A;  4KKS A;  3HOY G;  3OWE B;  2EZV A;  4DKA C;  1QB5 D;  4A3F H;  1KXL A;  2K6A A;  1JT8 A;  1PTO F;  4NXM L;  4IPC A;  4HMI A;  4A4I A;  2A68 C;  2Z6K C;  3NBH B;  3KJP A;  1KRS A;  1H9S B;  4X3K A;  1EU4 A;  1H9M A;  1I50 B;  2AHO B;  2KEN A;  4N9P A;  4AYB G;  3TS0 A;  2CKZ B;  5KIX A;  4O0A A;  3S1Q H;  1V1O A;  3MHB A;  1KD1 C;  2JA7 G;  1A62 A;  3U50 C;  1V9P A;  1SFO H;  3UDX A;  4GNX B;  1GUG A;  2VS1 A;  1S5B D;  3P75 A;  1AE2 A;  4RHS A;  1JWM D;  1QE6 A;  4FF1 A;  1EY4 A;  2ZTC A;  3PIO A;  3S1N H;  4GKJ L;  1UE5 A;  5IT9 E;  1ILQ A;  2K75 A;  2R3Z A;  1EFW A;  4X6A H;  2PYK A;  4OWX B;  4IOA A;  1J6Q A;  4XQJ A;  1PV4 A;  5D65 A;  4BY7 H;  2NVQ B;  1ENC A;  2NN6 H;  2KHS A;  2ATW A;  2K50 A;  3F8T A;  4RFB A;  3D31 A;  4LF9 Q;  5A2Q L;  1B3A A;  1ZYR C;  4B3M Q;  1HR0 W;  1YJ9 A;  3BZK A;  3OOC A;  3RNU A;  4IPD A;  4X62 Q;  2R92 B;  4L5Q A;  4A3D H;  1LAC A;  4BY1 H;  1UAP A;  3GTK B;  2XN9 C;  1STN A;  2Z6K A;  2CW0 C;  1BF4 A;  4QL5 A;  1MIU A;  2BOS A;  3S15 H;  1K83 H;  5C3E G;  1VQO A;  2PO4 A;  3S2H B;  1GHK A;  4BXX H;  3TSS A;  3K57 A;  2QEJ C;  4KTA A;  1LTB D;  3MFG A;  1NY4 A;  4K6L A;  1DCZ A;  1FR3 A;  3BU2 A;  1S3O A;  3G6E A;  2AWN A;  3NWS A;  1FL0 A;  2MNA A;  4DNI A;  2XIW A;  3GD7 A;  1JJC B;  4YCV A;  3TME A;  1AE3 A;  4DAP A;  1NR4 A;  4R4C A;  2K5W A;  2PQA B;  3A7A B;  3GTQ H;  3ZJY C;  3S1M H;  4A3B G;  3MXN B;  2PNR C;  2E8G A;  3KLS A;  3W3A A;  2L1B A;  1GXD C;  3RZD H;  2KHJ A;  2HHH L;  5M5Y H;  4G7Z C;  2IT1 A;  4N9T A;  2JA8 B;  2BH8 A;  3BDO A;  5LL6 S;  1I6V C;  3EJI A;  4A3J G;  3VR3 A;  1FD7 D;  1E2Z A;  1A3V A;  1E2W A;  5HUR A;  1D1K A;  2MUY A;  1NMG A;  1K28 A;  3BDL A;  4IUP A;  1EY5 A;  5AJ3 Q;  3T1H Q;  4A93 H;  4J15 A;  3D6C A;  1WOC A;  4DV4 L;  1EYG A;  5DM7 3;  3WDN A;  4A3F G;  1HNX Q;  4P73 A;  3IFT A;  1VQK A;  1MD2 D;  4R4T A;  1PMR A;  2PZU A;  3SGI A;  3ERO A;  4X65 L;  2D62 A;  3V2T A;  5IGD A;  2YYZ A;  1UWV A;  2JA6 H;  1VQ4 A;  2SDF A;  3LNN A;  2ALY B;  2E2J H;  4LFB Q;  1A8V A;  1VMP A;  5IGC A;  2Z1C A;  4N8F A;  1QVG A;  1BOS A;  3H3V H;  2WB1 G;  1WVL A;  2F0K A;  2UXB Q;  1E1O A;  1PRT D;  1SAP A;  3PIP A;  5M9O A;  5FK9 C;  4FVM A;  2EQS A;  5G3L F;  3F2C A;  3PQI A;  1W6K A;  3JAM i;  4HSP A;  1SXT A;  2LMC B;  1KTK A;  3TS2 A;  1PH6 A;  2WAQ G;  3ULP A;  1SE2 A;  3LX0 A;  2KBN A;  3T1Y Q;  2NVX B;  1B70 B;  4BY7 G;  1EZ8 A;  2JSO A;  2NN6 G;  5FLX L;  2AQ1 B;  4FDB A;  2UUA Q;  2HT1 A;  2KCT A;  1G51 A;  2K32 A;  5LMN Q;  1WCM B;  4HR7 B;  4FP5 D;  1GUO A;  5EKL A;  3K5L A;  1MJC A;  4YCU A;  4OHJ A;  1TVX A;  2PI2 A;  3N6R A;  4ZRZ A;  3J7Y W;  3FPP A;  3K5O A;  1KQS A;  4K5V A;  4N8X 1;  4K0K Q;  3KK7 A;  2LKV A;  1IKL A;  1W3S A;  1S4Z A;  4A3D G;  1LUZ A;  4BY1 G;  1A3U A;  2RCN A;  3TBI B;  4I7A A;  4I65 A;  3CQZ H;  2AUJ D;  5EQ0 A;  4BXX G;  4DK1 A;  1ESF A;  1C0A A;  1ASZ A;  1BCP B;  2B2V A;  5IOC A;  2KEE A;  2F0W A;  1JJ2 A;  4POG A;  3CCE A;  2MO1 A;  2ZTD A;  4C3H H;  4DV1 Q;  3HP3 A;  2Z9H A;  3QJY A;  3BG3 A;  3J80 c;  3DM1 A;  3TP8 A;  3M4Q A;  5BR8 Q;  2ES2 A;  2B2U C;  2I0Q A;  2D5D A;  2JP1 A;  1HZA A;  1DOK A;  2UU9 L;  2B3G A;  4F87 A;  3M9B A;  1G29 1;  1STY A;  1WYD A;  4QY7 A;  3SK4 A;  4X66 L;  3D4D A;  2XWJ B;  1PLF A;  1XMQ L;  5IT9 c;  2LSS A;  1MJE A;  4XT3 B;  3L3O C;  2F0U A;  2PPB C;  4MIU A;  3PUX A;  2JK8 A;  4K5W A;  1FJG L;  2JJQ A;  1FNU A;  4DV5 Q;  3K59 A;  3S17 B;  2QDL A;  4UP9 A;  3DEP A;  1MGS A;  3HEJ A;  3MC0 B;  2ID0 A;  1Y8N B;  4A93 G;  4JV5 L;  1EWI A;  1SMY D;  3L0O A;  4KD3 A;  1G6P A;  2KCN A;  1IW7 C;  3C1F A;  2RBM A;  4A3K H;  5HY6 A;  4K2L A;  2K05 A;  4A3C H;  4WJ4 A;  1JOO A;  1B7Y B;  3G6J B;  1QG7 A;  2JA6 G;  1TWF H;  1M8A A;  3S9W A;  1F2Z A;  1EYA A;  4F88 A;  1VQN A;  1I3Q B;  1A0I A;  4LF8 L;  2R61 A;  1HR0 L;  2K5H A;  2X6L A;  2WII B;  5A2Q E;  1HXY D;  4RWS C;  5JJZ A;  2IX3 A;  3S16 B;  1MKH A;  1II3 A;  2CH4 A;  1WTO A;  3M4Y A;  4K8I A;  1SDF A;  1WFQ A;  3RD4 A;  1PA6 A;  1DOL A;  1PTO B;  3MEF A;  1TS3 A;  4RH6 A;  2I46 A;  4NXM Q;  4BA2 I;  4H02 A;  1XPR A;  4Q0F A;  3C1E A;  3PIP 3;  1NR2 A;  4A3G B;  4LW1 A;  1EU3 A;  4BBR H;  2Q8T A;  1TY2 A;  2DNC A;  1E1T A;  1H95 A;  2B2Y A;  1U4L A;  1PH9 A;  1VQ9 A;  1BBU A;  3EQL C;  5KNB A;  3FMC A;  1LO5 D;  1QNK A;  1QOH A;  1DXM A;  3J7A V;  4DAY A;  3VYT A;  1TII D;  1QZH A;  1EIF A;  2F0D A;  5C44 B;  4R8I A;  3NE5 B;  3CCM A;  3Q6S A;  4JPB W;  3RZO B;  5A35 A;  1W6J A;  1VQC A;  5JOB A;  2VB2 X;  2PCF B;  4P71 A;  4JI1 L;  3D0F A;  4KV6 A;  2JEA I;  4JBJ A;  1Q1E A;  4PV1 C;  5I2Y A;  1NJI C;  2R93 H;  1XPO A;  5CV9 A;  3NBH A;  1WD0 A;  4C3H G;  4RHR A;  2E76 C;  4LJZ C;  4OIJ A;  3F1Z A;  2Y0S G;  4K2K A;  2PI2 E;  1VQF A;  5GQO A;  3B6Y A;  2F0S A;  4FNF A;  4GN4 B;  2WFW A;  3OW7 A;  2I07 B;  1STB A;  3I2Z A;  4DV2 L;  5CC4 A;  1Y1W B;  5K5P A;  1LTI D;  1JB3 A;  3OMG A;  2EYF A;  2XWB B;  3PF4 A;  4ZK9 B;  4I7Z C;  1UE1 A;  4WJ3 M;  4H7B A;  2F3W A;  1Y69 U;  4ZQ3 A;  4IOC A;  4KHZ A;  4GLV B;  3QR8 A;  2RDF A;  3V05 A;  1V8Q A;  2IHF A;  4IUN A;  5JJK A;  2K5Q A;  2PNH A;  2L11 A;  2MO0 A;  3MXU A;  3KBG A;  4KLK A;  1SE8 A;  1D2B A;  1GVP A;  4ZUJ A;  3A8J E;  2BE5 D;  4ULL A;  4CDC C;  1Q7Y C;  4GKK L;  4IFD I;  2O2L D;  1YNN D;  4XYO A;  1TWG H;  4CJ1 B;  4DR7 L;  1PFS A;  4A3C G;  1IYU A;  1VQG A;  1VQE A;  1JWS D;  4Y7N H;  4JI4 L;  4Y52 H;  4JI2 L;  2HHH Q;  1DJR D;  1QJO A;  1RD9 D;  5BN3 A;  4YWM A;  1SYG A;  3J81 i;  4CKE A;  3W1G A;  4FXG C;  2D9U A;  3L9A X;  5AJ3 L;  3I4M H;  1A6X A;  3WWV A;  1B50 A;  4R9W A;  3S14 H;  1GJX A;  1IYV A;  3HKZ G;  1HNX L;  5I9P A;  2EY2 A;  2ZJR A;  2F0J A;  4KD4 A;  5CV4 A;  1JR0 D;  4YHH L;  2PQA A;  1EEI D;  2F0P A;  4YCW A;  4C3I H;  3MXN A;  2N88 A;  5JAV A;  3GTM H;  1B2T A;  4RCN A;  1D5Z C;  1IZ6 A;  4HMJ A;  4BBR G;  2F0G A;  2OEO A;  4JK1 C;  2O5I C;  1GUW A;  1EFI D;  1WTV A;  2CHB D;  2OF1 A;  4ZCK A;  3HOX B;  4IPG A;  1PYS B;  4XTC S;  4X64 L;  4UPA A;  1Z7T A;  2ICE C;  4LFC L;  2IX1 A;  5C3W A;  2RDH A;  1GD7 A;  4ODG A;  3PV0 A;  3E0E A;  3GV3 A;  5KRU A;  3PUV A;  4OXP A;  2RQX A;  5EPJ A;  2E2H B;  5LMN L;  3NEN A;  4GS3 A;  2R93 G;  3CC2 A;  2K01 A;  2NWG A;  1RDP D;  1PXU A;  5I6W A;  5M3M B;  2SNM A;  2PZW A;  1WTW A;  1PYB A;  1HNW L;  2CWA A;  2K04 A;  3K0Y A;  1EEF D;  1O80 A;  1IKM A;  1BNZ A;  3JAM L;  4FYD A;  2MQH A;  4O42 A;  5C0X I;  4IUU A;  3KF8 B;  1ET9 A;  3GTK H;  4RKL A;  1Y1V B;  1N36 L;  4HJ7 A;  3HOU B;  1H9R A;  1XXG A;  4P75 A;  3OYY A;  3D6W A;  1X6O A;  1I4H A;  2V4D A;  3S2H H;  2F0F A;  4WFN 3;  5BR8 L;  1SMX A;  4DNT B;  5C4X G;  2I5L X;  4B08 A;  2AMC B;  2J0T D;  2KVM A;  5H1S E;  2GA4 B;  2Q2T A;  2EVB A;  2AQ3 B;  5C5M A;  1HCZ A;  1I6H B;  4AH6 A;  1UNS A;  2XVS A;  3RLO A;  1HNZ L;  3MTS A;  4LUV A;  3BZD B;  3MXP A;  2Q8I B;  4JOI A;  1F77 A;  1XMQ Q;  2RCF A;  2VUM B;  4JI7 L;  4NW2 A;  3RR5 A;  4DV5 L;  2EDG A;  1YIT A;  4JBM A;  3M4P A;  3STB D;  1SYE A;  1IHZ A;  2B8G A;  1VQ5 A;  3M4O B;  4EVO A;  4ZUI A;  2K03 A;  4LFA L;  1Z47 A;  3I4M G;  4O1N A;  3FKI H;  3I91 A;  3I4N B;  2MHV A;  5FO7 B;  3NSW A;  1G91 A;  3U4V A;  3K6O A;  5C4H A;  2DY7 A;  1AEX A;  2X69 A;  1C9O A;  4TVA B;  3H3V I;  3S24 A;  4JV5 Q;  1U4P A;  2R6G A;  1KDB A;  1RTN A;  4C3I G;  1LTT D;  3I55 A;  1BR9 A;  4BS9 A;  1Y8O B;  1VQ7 A;  2E2I B;  3H0G B;  5EGT A;  4HIO A;  1U5K A;  1B3Q A;  1A15 A;  1LTA D;  2NTT A;  1N32 L;  4RA8 A;  1RKN A;  1AP0 A;  5CGK A;  3PUW A;  2YU9 B;  3HOW B;  1B44 D;  2FJ2 A;  4UAI A;  5COR A;  1IBK L;  3U9S A;  4DV6 Q;  4IFD H;  2A6H D;  2KHI A;  3I8Z A;  2GN5 A;  4LF8 Q;  3K8A A;  1HR0 Q;  3VR2 A;  3UDF A;  4A3M H;  4QJF A;  1EQQ A;  1O78 A;  1MI2 A;  1QIL A;  5I9O A;  2VXW A;  2C9O A;  3O13 A;  4QGU A;  1KLU D;  4Q5V A;  3BVG A;  4JI5 L;  2DNE A;  2HD3 A;  1EQV A;  1VQB A;  4IZ8 A;  5GAG C;  2UUC Q;  4HTH A;  1HQR D;  2FMC A;  3AFP A;  5JEA H;  3GTJ H;  2C35 B;  2L15 A;  3E9I A;  2NVX H;  4NXN Q;  3CRK C;  4A3E G;  1IXR A;  3K5M A;  3FRP B;  1PDQ A;  1HZ9 A;  2BA1 A;  2JA5 B;  1X3E A;  1PRT C;  5COY A;  5E4X A;  3HOV B;  1WCM H;  4G57 A;  1KHI A;  4RKB A;  4UDU C;  1X65 A;  4RAU C;  3EFX D;  4OWW B;  2XRS D;  5EBD A;  3FDT A;  3EIV A;  1QWY A;  4JG2 A;  2EIF A;  2IY5 B;  4FXK C;  4CDE C;  1S5F D;  1PRT F;  4UY8 C;  4JI1 Q;  4GOP C;  2X6G A;  2DUD A;  4QQB X;  3PMF A;  3R2T A;  4YY3 L;  1X3P A;  2AKW B;  2C5C A;  3A8I E;  1SLJ A;  1EL0 A;  4HIM A;  2EXZ A;  2YV5 A;  1LAB A;  4JI8 Q;  2MFI A;  5I2X A;  4KK7 A;  1L0W A;  3QG1 A;  1ESR A;  1EIG A;  2RSN A;  1RCV D;  1SNQ A;  4DV2 Q;  4B9W A;  2JE6 I;  1E3P A;  3VA5 A;  2JA7 B;  1ML0 D;  1SJH D;  3PO3 H;  1CKN A;  3NK9 A;  3CF5 A;  4DR5 L;  3J80 i;  1U4R A;  4OGQ C;  1YNJ C;  1MHW C;  1L0X B;  4PQX A;  2OTL A;  1S5C D;  2VZA A;  4A3L G;  2N55 A;  4J8Q A;  3S17 H;  3K7U C;  3FKI G;  4JI3 L;  1B53 A;  5C0X H;  2K5D A;  3LWU A;  1S5D D;  5BN5 A;  3T4A C;  1HHV A;  5EJW A;  1S72 A;  1L1O C;  1IBM L;  1DM0 B;  5CV6 A;  4MN3 A;  4GKK Q;  4KJO A;  1YJN A;  4DR7 Q;  4DNR B;  3UDI A;  2A69 D;  2IPK D;  1B9M A;  1R9T H;  3T53 B;  1CKO A;  1C7Y A;  3SR1 A;  4JI4 Q;  4HIK A;  2UUB L;  4JI2 Q;  3TP6 A;  3QOJ A;  4B3R L;  1D5X C;  1CUK A;  1HPC A;  2HIV A;  1LT6 D;  2M00 A;  4IFD G;  1V43 A;  2Q2I A;  4M1U B;  3GTP B;  1KDC A;  4QUF A;  2A1A A;  2G9H D;  4PNY A;  4A3M G;  2KCM A;  5E1F A;  1J8I A;  2E5L L;  2QDB A;  4F8M A;  1R4Q B;  4TSS A;  4DUZ L;  1WJJ A;  1V1P B;  3GTL H;  2TSS A;  1Q3L A;  4F7X A;  4DR3 L;  2GVA A;  2K4K A;  4RGN A;  4R8N A;  5ELE A;  3K81 C;  1M1K C;  4YHH Q;  3MWY W;  5JEA G;  1PH7 A;  1PH3 A;  3TP7 A;  2F0O A;  3J81 L;  4RCO A;  2UXD Q;  1B1Z A;  1L0Y B;  4OO1 H;  1DON A;  4ME3 A;  4B3S L;  1SYF A;  1U9R A;  5IWA L;  4MTN A;  1XNQ L;  4X64 Q;  4JCV E;  1TQO A;  1STG A;  5C3X A;  1PH2 A;  3TZU A;  4LFC Q;  4OX9 L;  2CFM A;  1DZ1 A;  1SNO A;  3U4Z A;  3AMU A;  1EY9 A;  4JC0 A;  1GUT A;  4DF7 A;  1EWH A;  1D7Q A;  5C44 H;  3K0X A;  5M5W B;  3RZO H;  1S40 A;  4U67 3;  3K5N A;  1GUN A;  3CAM A;  1K8A C;  4C2M H;  3K7A B;  1HQM C;  3CCJ A;  1TWA B;  2EYO A;  3CXC A;  1CKM A;  3PIO 3;  2OQK A;  1QZG A;  1Z9F A;  2EY5 A;  4BBS H;  2R7Z B;  2Z0S A;  2AUK A;  2V1C C;  1YI2 A;  4LF5 Q;  1HNW Q;  1SBB B;  5IOD A;  3P20 A;  3SK5 A;  3I90 A;  1QCB D;  2F52 A;  3S1Q B;  1HUM A;  2D0P A;  4XDX A;  2N8N A;  1EQT A;  4OIK A;  3NTI A;  3PO3 G;  1SFO B;  2EJG C;  3F2D A;  3FPU B;  5CMD A;  1N36 Q;  3RMH A;  5IY0 A;  4DXF A;  3NP8 A;  3GTG H;  2XRQ D;  2VQF L;  5C0X G;  4M8A A;  2WAQ B;  1N9W A;  2QGQ A;  3I56 A;  4GN3 B;  2CW0 D;  2OXP A;  4PMW A;  4BY7 B;  3TP5 A;  1Q8K A;  3U58 A;  4L5S A;  3CU7 A;  3H6M A;  2VNU D;  1OTC A;  1WTP A;  2KA7 A;  4K5X A;  4FO2 A;  1I5F A;  1HNZ Q;  1F2Y A;  2HCI A;  3KF8 A;  3CRL C;  1EYC A;  2B8F A;  3I7F A;  2ZM6 L;  4JI7 Q;  2AWO A;  3EN2 A;  4QF4 A;  3FVQ A;  1STE A;  1HA5 A;  1UEB A;  5CYU A;  2WAC A;  4GZY C;  3IRB A;  3X3M A;  1TS4 A;  2PMZ B;  4RGO S;  4BY1 B;  4LFA Q;  1FNW A;  2BE5 C;  3QOL A;  3CCQ A;  3CCR A;  1KLG D;  2RDG A;  1F2L A;  1K83 B;  4CKB A;  2F4I A;  3TQY A;  3OHX C;  4OEL B;  2ASB A;  4MZ9 A;  1JOK A;  3BJU A;  1HJP A;  2F3I A;  1NAP A;  1X3G A;  2FIN B;  4DAV A;  1YEZ A;  5J3B A;  5FO8 B;  1Q46 A;  1EYD A;  3CCU A;  1PFB A;  4ID6 A;  1N32 Q;  4DV6 L;  1Y14 B;  3CC4 A;  4LAA A;  2B2U A;  2EPB A;  4HJA A;  4OO1 G;  3S1M B;  3QO2 A;  1LTL A;  1MSH A;  3L7Z C;  1IBK Q;  3RZD B;  1B9N A;  4PZ8 A;  1FYC A;  2F0M A;  3HOX H;  2QKI C;  3RLF A;  4H13 C;  5CV8 A;  4DUY Q;  5CBE E;  2K1B A;  1K8M A;  4LF6 L;  1I4P A;  1CQF A;  2UUC L;  1HTP A;  4NP5 A;  3AU7 A;  1O7Z A;  1PZJ D;  2K28 A;  5C44 G;  3ER0 A;  4JI5 Q;  4OWT B;  1HUN A;  4IUR A;  2EYL A;  2LY7 A;  2OTJ A;  4NXN L;  3PCO B;  4AQY Q;  3HOZ B;  4A93 B;  3UI2 A;  2E2H H;  1I4R A;  3G7L A;  4JW0 A;  1LT3 D;  5M3M H;  4BBS G;  1Q12 A;  4K6D A;  5GAH C;  1SR3 A;  4GNX C;  3UDG A;  2JA6 B;  2E2J B;  1OXX K;  1IYJ B;  1JJG A;  4CBV A;  2IJ0 A;  1CKN B;  2NVT B;  5KYI A;  1PRT B;  2A6E D;  5BN4 A;  2NTS A;  3HOU H;  3HRZ C;  1O7I A;  1NE3 A;  5GAD C;  3BS1 A;  1K73 C;  1IBL Q;  4YY3 Q;  4EQ5 A;  4JI8 L;  3UE1 A;  2A5H A;  1K0S A;  4DGZ A;  3VDY A;  5DM6 3;  3J7A F;  3PGZ A;  5HGT A;  4LWC A;  4CGY B;  3T13 A;  1XTD A;  4GOP B;  2NB0 A;  4CDF C;  2G5D A;  2JN4 A;  2Q2H A;  3TZD A;  3HKS A;  4ZLT F;  3A55 A;  4RGT A;  2NVY B;  1ASY A;  3DMU A;  1GO3 E;  1I4X A;  2Z4H A;  1TWC B;  1CT1 D;  2KED A;  3CPW A;  4DR5 Q;  3M4O H;  1PZK D;  3KJO A;  3DEO A;  3KDF B;  4MHE A;  1BDO A;  1ICW A;  2LXJ A;  5ELF A;  4JI3 Q;  1PH5 A;  3TRE A;  3KFU A;  2Z4I A;  4EX5 A;  4A3K G;  1IBM Q;  1KDA A;  3BDC A;  3X3N A;  3BYT B;  1UE6 A;  3VYS A;  2OCE A;  3BYY B;  2PW7 A;  1PFM A;  2Y0S B;  2ZXR A;  3J80 L;  2MGS A;  3STB C;  3H0G H;  1N34 L;  1LTR D;  4L6T B;  1TWH B;  1U4M A;  3ND9 A;  2ZJQ A;  2EOT A;  2UUB Q;  3QIA A;  4OEM B;  1L1O B;  5FLX E;  1I4Q A;  2YU9 H;  3HOW H;  3CMA A;  4B3R Q;  5J39 A;  2Z8L A;  3S2D H;  1TS5 A;  1VQH A;  3H94 A;  5IT9 L;  1RJT A;  1ILP A;  1W2B A;  3H15 A;  2XTI A;  3VR5 A;  3GTO B;  1VQI A;  3KYH C;  5NUC A;  4LUZ A;  1KNA A;  2E5L Q;  1KL9 A;  4LK1 C;  5JPM C;  2A73 B;  4G4K A;  4KY6 A;  4KY5 A;  5D3I B;  5FKA C;  3V96 A;  5C4J H;  4DUZ Q;  3SVM A;  1OXT A;  2LFN A;  2IHE A;  4DR3 Q;  3PF5 A;  3MA2 B;  1X9N A;  2B2W C;  1TY0 A;  3OW2 A;  1BKB A;  2UXD L;  1RHP A;  1CZW A;  3R2I A;  2BDN A;  2JYO A;  1LLR D;  3OSO A;  1CSP A;  1EY0 A;  1I50 H;  2A6H C;  4C1N K;  5M3M G;  2BH2 A;  1QVF A;  4S3S A;  4EQP A;  1WTQ A;  3HOV H;  1NCV A;  4B3S Q;  4TRD A;  2N78 A;  2YTX A;  5IWA Q;  2KUM A;  2DN8 A;  4DK0 A;  1XNQ Q;  1XNR Q;  5EPK A;  4KJN A;  1YJW A;  4X3U A;  4JBW A;  1TKW B;  3G71 A;  1EZ6 A;  1YNX A;  4OX9 Q;  1X54 A;  4WRD A;  3RUZ A;  1BBX C;  1V1P A;  3SE0 A;  1X32 A;  1BQQ T;  4A76 A;  2F3V A;  5C4Z A;  1TU2 B;  1EY8 A;  4KN4 C;  3EA6 A;  1FVI A;  4JI6 L;  4ZAI A;  2E2D C;  2BCO A;  1JB7 A;  5DAU A;  2NVQ H;  3HKZ B;  3MFY A;  1WTR A;  3WOF A;  1ONL A;  4LF5 L;  4L5T A;  3VR6 A;  2CQA A;  1UEA B;  5CV7 A;  2H1E A;  1B4O A;  1STH A;  2IL8 A;  1CA6 A;  1X3F A;  3D4R A;  1F2M A;  2R92 H;  5IYC H;  4QMG A;  4XYQ A;  3VA7 A;  4DV7 L;  1SNC A;  3ITP A;  4IN3 A;  5M5X B;  1XPU A;  1NMF A;  4L63 B;  4V0B A;  2NBF A;  2Q2U A;  4BBR B;  5C5L A;  1K9M C;  4C3J B;  3I70 A;  5L37 A;  4YWK A;  2XGT A;  1K3B C;  1GHJ A;  2QF7 A;  4CDD C;  4AIM A;  5FLM H;  5ELC A;  2FFK B;  1PFN A;  1B8A A;  2ENB A;  1CZG A;  3M7G A;  2F0V A;  1X55 A;  1AZQ A;  5D14 A;  3M85 A;  5CR3 A;  5D3D A;  4B9X A;  2VQF Q;  1FNV A;  4DR1 L;  3FHW A;  5ELO A;  2F0H A;  4HED A;  2R7F A;  3Q23 A;  1K8O A;  3H0G G;  1OXV A;  1SRO A;  2JA8 H;  1E24 A;  1VQ6 A;  1SYB A;  2HQL A;  3P7J A;  3EVQ A;  2QW7 A;  4JBK A;  3GP7 A;  2ZM6 Q;  2FXQ A;  3HOW G;  1KIX A;  3ULL A;  2A19 A;  5IYB H;  2KEC A;  3GTP H;  1TS2 A;  1JE5 A;  2CVR A;  4OO1 I;  3DWP A;  2F1M A;  1U0L A;  2K7V A;  2QEX A;  2N49 A;  3P1H A;  2BDO A;  1E22 A;  2A69 C;  2EYH A;  1SSO A;  1Y8P B;  5DNF A;  3RLN A;  5C4X B;  1D8L A;  1MBY A;  2VY3 A;  4H0L C;  1KAW A;  1O7L A;  3HZX A;  1SNP A;  4PZ7 A;  2VW9 A;  4ZKC B;  1TWG B;  1VDZ A;  2KJX A;  4A3I B;  2NZH A;  2EJM A;  3R93 A;  2F0L A;  4Y7N B;  3MAQ A;  3HOV G;  4DUY L;  2MJ8 A;  1Q90 A;  2GVB A;  2MP1 A;  4XT1 B;  1CK1 A;  4X3T A;  4FF3 A;  5M3F B;  4LUO A;  1N33 L;  4HID A;  3A5U A;  1JMC A;  1SYC A;  4C56 C;  5E7N A;  4LF6 Q;  1NUC A;  4CKC A;  4V19 0;  4AQY L;  3J81 j;  2B63 B;  3MZ5 A;  3IKJ A;  4L5R C;  3I4M B;  4XQN A;  1ENA A;  5GAE C;  1HFN A;  4E6I A;  3Q22 A;  5FLX c;  3TDQ A;  4NMZ A;  1OXU A;  4NPS A;  4KY7 A;  4FF4 A;  3A8K E;  3H3V C;  2O5J C;  3F2U A;  3M3Y B;  3DWQ A;  2LS0 1;  1TWA H;  1Q81 C;  2QIL A;  3I72 A;  4C3I B;  2R7Z H;  1DYQ A;  4ZKB B;  3PO2 B;  1YBY A;  2PZT A;  3GTM B;  1EQR A;  2VL6 A;  3BZC A;  2R92 G;  3ERS X;  2ZTE A;  5IYC G;  2WP8 J;  3C46 A;  5FO9 B;  2NZ1 D;  1BXT A;  5J1Z A;  1JOQ A;  3DXJ C;  5ISR A;  5FLM G;  3S1R B;  2K52 A;  3E5S A;  3A56 A;  3NTH A;  3J80 E;  2RF4 A;  4H44 C;  4K8J A;  2DGY A;  3MXG A;  4C1N I;  1IBL L;  1BCP D;  4PMB A;  3HOY B;  3TRZ A;  2YTV A;  2F0T A;  3AEV A;  5KEE A;  1ET6 A;  4PZ6 A;  1HTL D;  4J1M A;  5J22 A;  5EPL A;  4L8J A;  1Q82 C;  4KI0 A;  4IQZ A;  4A3E B;  1T9H A;  3E6Z X;  4AYB B;  1TT2 A;  3TN2 A;  3NTK A;  3RN2 A;  1SJE D;  1V1Q A;  2JA8 G;  4QCL A;  1EUJ A;  2M2L A;  3QWN A;  2NYZ D;  2L4N A;  4HCE A;  4IO9 A;  1XMO Q;  1ICF B;  1TXY A;  2F4V L;  3KOJ A;  5IYB G;  2L9H A;  1NBW A;  1CSQ A;  1CA5 A;  4LNQ A;  4HJ8 A;  4U68 A;  1HZC A;  2RHS B;  3C2P A;  4P72 A;  1XJV A;  1KRT A;  2B39 A;  1JC7 A;  2WKC A;  3FP9 A;  2OT2 A;  2R7D A;  3VR4 A;  5IGE A;  1GUS A;  5IGB A;  2B2T C;  5FOB B;  3D3R A;  3CW2 C;  5LL6 X;  4GOP A;  3Q24 A;  2WB1 E;  1N34 Q;  1JCK B;  1ROD A;  3AFQ A;  1I3Q H;  4PMC A;  5KNC A;  4OON A;  3NPP A;  4R4I A;  4UHV A;  5JJL A;  1SMY C;  2EY6 A;  5IP7 H;  3KDF A;  1VMC A;  3SXH A;  5JVH 3;  5C3E B;  3S16 H;  1YIJ A;  1CHP D;  5F2D A;  2WAQ E;  4YWL A;  1QUQ B;  1T5E A;  5DLQ E;  3URY A;  3JAM E;  1CHQ D;  5I4D A;  1PTO H;  4JYA L;  1PTO D;  1F9P A;  2A8V A;  4LF7 Q;  5T1G A;  3FKI B;  2XSC A;  1F9R A; 
#chains in the Genus database with same CATH homology
 5IE8 A;  3L7Z C;  1DGS A;  1HZB A;  1PH1 A;  1IBK Q;  2HIX A;  4TQU S;  3A0J A;  2B29 A;  4YHH L;  1K8G A;  4PZ8 A;  2PQA A;  3W5O A;  4A3J H;  5IP9 G;  3HOZ H;  3KF6 B;  3HOX H;  4YCW A;  3RLF A;  4C3I H;  4A3G H;  2I5H A;  4DUY Q;  4B3T Q;  2RHQ B;  1WCM G;  4LF6 L;  3GTM H;  5M5W H;  1PH4 A;  1L1O A;  5LMU Q;  2UUC L;  2QA4 A;  1IZ6 A;  2R7Z G;  2PMZ E;  1XNR L;  5C44 G;  3ER0 A;  4JI5 Q;  4DAY B;  4OWT B;  4BBR G;  3F2B A;  4PG3 A;  1AH9 A;  3K7A H;  4R4Q A;  1UE7 A;  2OTJ A;  1X56 A;  4NXN L;  3PCO B;  3HOY G;  1NTG A;  4AQY Q;  4DKA C;  1WI5 A;  4IPG A;  1PYS B;  2JQO A;  4XTC S;  4X64 L;  4UPA A;  4A3F H;  3HOU G;  4DR4 L;  4IFD J;  1KXL A;  2E2H H;  1JT8 A;  4LFC L;  4LF4 L;  4IPC A;  4NXM L;  2IX1 A;  4BA1 I;  4A4I A;  2Z6K C;  3NBH B;  3KJP A;  1GD7 A;  1KRS A;  5M3M H;  1VQP A;  2NVT H;  4BBS G;  3PV0 A;  3E0E A;  3PUV A;  1Q12 A;  4KHP L;  2AHO B;  5GAH C;  2KEN A;  1SR3 A;  4OXP A;  4GNX C;  4AYB G;  4JI6 Q;  3AYH B;  3UDG A;  3TS0 A;  4DR2 Q;  2CKZ B;  4O0A A;  3S1Q H;  1KD1 C;  2JA7 G;  1A62 A;  2CWP A;  1LM0 A;  1IL2 A;  5JEA J;  3U50 C;  5LMN L;  1OXX K;  3NEN A;  4GS3 A;  1IYJ B;  1V9P A;  1SFO H;  3CC2 A;  2R93 G;  3UDX A;  1JJG A;  4GNX B;  2VS1 A;  1CKN B;  1A63 A;  4HJ5 A;  1AE2 A;  1PYB A;  1GM5 A;  2ZTC A;  3HOU H;  1HNW L;  2CWA A;  1Y1W H;  5GRO A;  1O7I A;  1NE3 A;  3PIO A;  3S1N H;  4GKJ L;  1UE5 A;  4DV7 Q;  4X6A H;  2K75 A;  4APV A;  1EFW A;  5GAD C;  4OWX B;  4GN5 A;  1OXS C;  4GLX A;  4IOA A;  1J6Q A;  1K73 C;  1PV4 A;  2MQH A;  1IBL Q;  4YY3 Q;  4EQ5 A;  4JI8 L;  3UE1 A;  5C0X I;  4BY7 H;  4XIG S;  3KF8 B;  2NVY H;  2ATW A;  2K50 A;  3GTK H;  3F8T A;  1TWC H;  1P16 A;  3VDY A;  4DAM A;  4DV3 L;  3D31 A;  4HJ7 A;  1N36 L;  4LF9 Q;  1Q86 C;  4P75 A;  3OYY A;  3PGZ A;  4B3M Q;  3CP0 A;  1X6O A;  4LWC A;  1HR0 W;  1YJ9 A;  3OTO L;  3S2H H;  1XTD A;  3BZK A;  4NB3 A;  4GOP B;  3PSI A;  3RNU A;  1VQD A;  4IPD A;  2Q2H A;  1SMX A;  4X62 Q;  5BR8 L;  2K5V A;  5C4X G;  1RIP A;  3HKS A;  2I5L X;  4L5Q A;  4DR6 L;  2AMC B;  1ASY A;  5H1S E;  2Q2T A;  4JI0 Q;  1GO3 E;  4A3D H;  4BY1 H;  1LYL A;  4DR1 Q;  4IJH A;  2Z6K A;  3A74 A;  3CPW A;  4DR5 Q;  3M4O H;  4AH6 A;  3KJO A;  4QL5 A;  3RLO A;  1MIU A;  3KDF B;  1K83 H;  5C3E G;  1VQO A;  3NEM A;  3S15 H;  4BXX H;  4DV0 L;  2LXJ A;  2OWO A;  5JJI A;  1HNZ L;  4LUV A;  4JI3 Q;  2UXC L;  4JOI A;  1XMQ Q;  1TWH H;  1PH5 A;  1NY4 A;  3TRE A;  2ZJP A;  3KFU A;  4JI7 L;  4EX5 A;  1BBW A;  3BU2 A;  3RR5 A;  4DV5 L;  1S3O A;  4A3K G;  3G6E A;  5FJ8 H;  2AWN A;  1YIT A;  1IBM Q;  1FL0 A;  2MNA A;  4DNI A;  3GD7 A;  4JBM A;  1JJC B;  1UE6 A;  3M4P A;  3STB D;  5IP7 G;  1VQ5 A;  2OCE A;  1VQJ A;  4RG1 A;  4YCV A;  1J5E L;  1AE3 A;  4LFA L;  1Z47 A;  2VQE L;  4R4C A;  2PQA B;  3GTQ H;  3GTO H;  3I4M G;  2BA0 A;  3STB C;  3ZJY C;  3H0G H;  3S1M H;  4A3B G;  3MXN B;  3FKI H;  1N34 L;  2E8G A;  2ZJQ A;  2UUB Q;  3RZD H;  2KHJ A;  2HHH L;  1L1O B;  5M5Y H;  5C0X J;  3U4V A;  2IT1 A;  5LMN W;  1VCI A;  2YU9 H;  1C9O A;  2BH8 A;  3K80 C;  4TVA B;  3S24 A;  3CMA A;  1VQ8 A;  3H3V I;  3HOW H;  4JV5 Q;  4B3R Q;  3S2D H;  1VQH A;  2R6G A;  4A3J G;  1W2B A;  3H15 A;  3HOZ G;  2XTI A;  3Q8D A;  2YTY A;  1YHQ A;  3I55 A;  4A3G G;  1VQI A;  3KYH C;  1VQ7 A;  4LUZ A;  4R4O A;  4HIO A;  1U5K A;  1N32 L;  2E5L Q;  1KL9 A;  5C4J H;  1NMG A;  4DUZ Q;  1OXT A;  3PUW A;  1I94 L;  5AJ3 Q;  3T1H Q;  4A93 H;  2IHE A;  4DR3 Q;  1IBK L;  3PF5 A;  4DV6 Q;  1X9N A;  4J15 A;  3OW2 A;  1BKB A;  1WOC A;  2KHI A;  2GN5 A;  4DV4 L;  1EYG A;  4LF8 Q;  4A3F G;  1HNX Q;  3K8A A;  4P73 A;  1HR0 Q;  1N33 Q;  2UXD L;  3UDF A;  1VQK A;  4A3M H;  4QJF A;  4R4T A;  1EQQ A;  1CSP A;  2JA9 A;  1I50 H;  3SGI A;  4QGU A;  3CD6 A;  4X65 L;  2D62 A;  5M3M G;  2YYZ A;  2BH2 A;  1UWV A;  2JA6 H;  1VQ4 A;  1QVF A;  4JI5 L;  3HOV H;  2ALY B;  2Y0S E;  4B3S Q;  2E2J H;  1L2F A;  1VQB A;  2CCZ A;  5GAG C;  2N78 A;  2YTX A;  2UUC Q;  5IWA Q;  4LFB Q;  1A8V A;  3ULJ A;  3AFP A;  3GTJ H;  1XNQ Q;  1YZ6 A;  1QVG A;  1XNR Q;  3GO5 A;  2WB1 G;  3H3V H;  2UXB Q;  1YJW A;  4JBW A;  3G71 A;  1VS0 A;  1E1O A;  4MNO A;  2C35 B;  2L15 A;  3E9I A;  2NVX H;  1YNX A;  3PIP A;  1X54 A;  4A3E G;  1IXR A;  4NXN Q;  4OX9 Q;  3CCS A;  1HZ9 A;  2BA1 A;  3JAM c;  1X3E A;  4A76 A;  1WCM H;  2EQS A;  3F2C A;  1Y1W G;  1FVI A;  1KHI A;  3JAM i;  4JI6 L;  3TS2 A;  1JB7 A;  5M5X H;  2NVQ H;  1PH6 A;  2WAQ G;  1X65 A;  3ULP A;  4C3J H;  2KBN A;  3T1Y Q;  1Y1V H;  4LF5 L;  1B70 B;  4L5T A;  4OWW B;  4BY7 G;  4HJ9 A;  2NN6 G;  4UP8 A;  2UUA Q;  4FDB A;  2HT1 A;  2KCT A;  1G51 A;  1K0R A;  5LMN Q;  4IJL A;  3EIV A;  1M90 C;  1YVC A;  1X3F A;  1VQA A;  4JG2 A;  2EIF A;  3EBE A;  2R92 H;  1MJC A;  4YCU A;  5IYC H;  2IY5 B;  2PI2 A;  4DV7 L;  1XPU A;  1NMF A;  1EIY B;  4UY8 C;  1KQS A;  4JI1 Q;  1YHA A;  4GOP C;  1K9M C;  2DUD A;  2Q2U A;  4K0K Q;  4QQB X;  4YY3 L;  1VQM A;  4YWK A;  2XGT A;  2JEB I;  4GKJ Q;  1W3S A;  4AIM A;  5FLM H;  4A3D G;  1I6H H;  1LUZ A;  4BY1 G;  2AKW B;  1SLJ A;  1B8A A;  4DK3 C;  4HIM A;  2RCN A;  2YV5 A;  4LF9 L;  3TEH B;  4JI8 Q;  2MFI A;  4B3M L;  1L0W A;  3CQZ H;  2VUM H;  4BXX G;  1XMO L;  1X55 A;  1PHJ A;  4X62 L;  1ASZ A;  3M85 A;  1C0A A;  4DV2 Q;  2VQF Q;  2JE6 I;  4IPH A;  1JJ2 A;  1E3P A;  3CCE A;  4POG A;  2MO1 A;  2ZTD A;  4UP7 A;  4C3H H;  4DV1 Q;  3J80 c;  2F4V Q;  4DR1 L;  5FJ8 G;  3M4Q A;  5BR8 Q;  3PUY A;  4GNX A;  3UE0 A;  2ES2 A;  3PO3 H;  2I0Q A;  3HKZ E;  1CKN A;  3FHW A;  1HZA A;  5ELO A;  3J80 i;  3CF5 A;  4DR5 L;  3J7Z C;  2UU9 L;  2B3G A;  3I4N H;  3M9B A;  2OTL A;  1G29 1;  2VZA A;  2R7F A;  4A3L G;  3S17 H;  1HH2 P;  1WYD A;  4QY7 A;  3H0G G;  4X66 L;  1OXV A;  3K7U C;  3FKI G;  1SRO A;  4JI3 L;  3CME A;  1E24 A;  2JA8 H;  1XMQ L;  5IT9 c;  2HQL A;  2LSS A;  1VQ6 A;  1MJE A;  4JBK A;  2ZM6 Q;  2FXQ A;  1S72 A;  1L1O C;  1IBM L;  1KIX A;  3HOW G;  3ULL A;  2A19 A;  5IYB H;  5C4X H;  2E2I H;  3PUX A;  2JK8 A;  4GKK Q;  1FJG L;  2JJQ A;  1YJN A;  3GTP H;  1JE5 A;  4DV5 Q;  4DR7 Q;  2LXK A;  3UDI A;  2D0O A;  1R9T H;  4UP9 A;  4OO1 I;  5IYD H;  1BVS A;  1CKO A;  1U0L A;  2QEX A;  1C7Y A;  4JI4 Q;  4HIK A;  2N49 A;  3JC6 6;  2UUB L;  2ID0 A;  4A3I H;  4JI2 Q;  1E22 A;  1SRU A;  3HOX G;  4A93 G;  4B3R L;  1EWI A;  4JV5 L;  3RLN A;  3L0O A;  1CUK A;  1D8L A;  2HIV A;  1G6P A;  2VY3 A;  4IFD G;  3DLL A;  1V43 A;  2Q2I A;  4A3K H;  5M3F H;  5HY6 A;  4A3C H;  1KAW A;  2A1A A;  4LF7 L;  4A3M G;  2KCM A;  3KLW A;  4PZ7 A;  2VW9 A;  4WJ4 A;  2NZO A;  1B7Y B;  2E5L L;  2NZH A;  1FGU A;  4DUZ L;  1TWF H;  1WJJ A;  2JA6 G;  4JYA Q;  2B63 H;  3GTL H;  3T1H L;  3HOV G;  4DUY L;  4DR3 L;  4B3T L;  1VQN A;  2GVA A;  2K4K A;  3DM3 A;  2GVB A;  1A0I A;  3K81 C;  1M1K C;  4YHH Q;  5JEA G;  5LMU L;  3ICE A;  4LF8 L;  1YHB A;  4LUO A;  1HR0 L;  4HID A;  1PH7 A;  1N33 L;  3A5U A;  1PH3 A;  1JMC A;  2JA5 H;  3M3Y H;  2K5H A;  5E7N A;  4LF6 Q;  4DV4 Q;  1MKH A;  4AQY L;  2UXD Q;  3J81 j;  1N8R C;  4L5R C;  1P8L A;  3PO2 H;  1WFQ A;  4ME3 A;  4B3S L;  5GAE C;  1VQL A;  3LGJ A;  1PA6 A;  5IWA L;  4X65 Q;  5FLX c;  4LFB L;  4MTN A;  5ELN A;  1XNQ L;  1OXU A;  4NPS A;  5IP9 H;  4X64 Q;  1QUQ A;  4RMF A;  3MEF A;  4JCV E;  1K3R A;  4A75 A;  4DR4 Q;  1PH2 A;  2UXB L;  1Y1V G;  4LFC Q;  4LF4 Q;  4NXM Q;  4OX9 L;  4H02 A;  1XPR A;  1TWA H;  2CFM A;  3S1R H;  1Q81 C;  4DK6 C;  3M7N A;  2NN6 I;  3U4Z A;  4DR2 L;  1PH8 A;  4LW1 A;  4JC0 A;  2R7Z H;  1YBY A;  1D7Q A;  5C44 H;  3K0X A;  4BBR H;  4KHP Q;  1RL2 A;  1EQR A;  2VL6 A;  3BZC A;  2R92 G;  3ERS X;  2ZTE A;  1E1T A;  5IYC G;  1S40 A;  1KC8 C;  2WP8 J;  3KF6 A;  3RZO H;  1H95 A;  3HOY H;  1PH9 A;  3GDE A;  3CAM A;  4P74 A;  1K8A C;  4C2M H;  1VQ9 A;  3T1Y L;  2OQ0 A;  3CCJ A;  3CXC A;  1BBU A;  5FLM G;  2K52 A;  2CQO A;  1CKM A;  3G4S A;  2OQK A;  4JOI C;  1QZG A;  2UUA L;  1Z9F A;  4BBS H;  2Z0S A;  1QZH A;  1EIF A;  2RF4 A;  2V1C C;  2DGY A;  1YI2 A;  1IBL L;  4LF5 Q;  3CCM A;  4GLA C;  4A3E H;  1HNW Q;  2VUM G;  3W1B A;  3TRZ A;  1VQC A;  3HFZ B;  4P71 A;  4JI1 L;  2YTV A;  3D0F A;  2JA7 H;  4K0K L;  2JEA I;  4JBJ A;  1Q1E A;  2EXD A;  1NJI C;  3AEV A;  2R93 H;  1XPO A;  2F52 A;  4PZ6 A;  2D0P A;  2H5X A;  4QIW E;  4DPG A;  3F1Z A;  3CCL A;  2N8N A;  2N3S A;  1Q82 C;  3PO3 G;  2Y0S G;  4KI0 A;  5EAY A;  2PI2 E;  1VQF A;  3F2D A;  4DV3 Q;  3E9H A;  1N36 Q;  5GQO A;  2I5M X;  3B6Y A;  1T9H A;  5IY0 A;  3I4N G;  4BA2 I;  5K36 G;  3J7A 5;  3I4O A;  4JI0 L;  4GN4 B;  1EOV A;  2WFW A;  3OTO Q;  3RN2 A;  3GTG H;  3I2Z A;  1V1Q A;  4DV2 L;  2JA8 G;  1EUJ A;  2VQF L;  5C0X G;  2K5N A;  4DV1 L;  3PF4 A;  4DR6 Q;  4IO9 A;  1XMO Q;  1N9W A;  1TXY A;  1UE1 A;  3CPF A;  2QGQ A;  3I56 A;  2F4V L;  4WJ3 M;  3KOJ A;  1GKH A;  4GN3 B;  5IYB G;  3L2P A;  1CSQ A;  1NBW A;  4LNQ A;  4PMW A;  4HJ8 A;  4KHZ A;  4IOC A;  4GLV B;  1Q8K A;  3U58 A;  1HZC A;  4L5S A;  3AQQ A;  2VNU D;  4R1J A;  3CC7 A;  1OTC A;  3RN5 A;  2RHS B;  2IHF A;  4P72 A;  5IYD G;  5JJK A;  1XJV A;  4DV0 Q;  3CCV A;  1I5F A;  1KRT A;  1HNZ Q;  2PNH A;  2MO0 A;  2UU9 Q;  2UXC Q;  4O2D A;  1SN8 A;  1Q1B A;  3FP9 A;  1QVC A;  1SE8 A;  4KLK A;  2R7D A;  3I7F A;  1GVP A;  2ZM6 L;  3G48 A;  2AWO A;  3EN2 A;  4JI7 Q;  4X66 Q;  1UEB A;  4A3I G;  1HNX L;  3CW2 C;  1Q7Y C;  4GKK L;  3IRB A;  1PVO A;  4IFD I;  4GOP A;  4DR7 L;  1TWG H;  5M3F G;  5C3E H;  4ALP A;  1J5E Q;  4LFA Q;  1PFS A;  4A3C G;  2VQE Q;  3CCQ A;  1VQG A;  1VQE A;  2WB1 E;  3CCR A;  4Y7N H;  4JI4 L;  4Y52 H;  1N34 Q;  3AFQ A;  1FJG Q;  1I3Q H;  4JI2 L;  3TQY A;  4A3L H;  2HHH Q;  4AYB E;  2B63 G;  2ASB A;  4OON A;  2K14 A;  4MZ9 A;  4R4I A;  5JJL A;  3BJU A;  1HJP A;  2F3I A;  5IP7 H;  3KDF A;  3J81 c;  4YWM A;  1X3G A;  3S16 H;  3J81 i;  1YIJ A;  3W1G A;  1YEZ A;  5J3B A;  2WAQ E;  1Q46 A;  3CCU A;  2JA5 G;  3NEL A;  4YWL A;  1QUQ B;  5AJ3 L;  3WWV A;  3I4M H;  5DLQ E;  4A3B H;  1N32 Q;  5HGQ A;  3S14 H;  4DV6 L;  1Y14 B;  3CC4 A;  1E7Z A;  4JYA L;  4HJA A;  3PUZ A;  2A8V A;  4OO1 G;  4POF A;  4LF7 Q;  3PO2 G;  3A5Z B;  3HKZ G;  1I94 Q;  2ZJR A;  2IX0 A;  1LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...