3K0YA

Crystal structure of putative toxin related protein (yp_001303978.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
198
Chain Sequence
DIWIAVATVVPEGNNVYYLRLDDGDKLWPAATNYPNYQPKPNQRALVNFTILADSHYIKVNAIHNILTKSIAKNEGAANDSIYGTDPVSIYNNNMWIGDGYLNIYFETLWGGKTAHFINLIQPDAENDPYTLEFRHNAYDDPQYTIGAGRVAFNLSSLPDTKGETVDLVVNYWTSEGKQAYKLKYNSDKTKMNITDMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TOXIN related protein
publication title Crystal structure of Putative TOXIN related protein (YP_001303978.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Toxin
total genus 44
structure length 198
sequence length 220
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k0yA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k0yA02
4J8QA 3NQIA 4PQXA 3K0YA 3K6OA 3QWNA
chains in the Genus database with same CATH superfamily
1WBYB 2HP4A 4JRXA 1D5BA 5MEOB 3HI1A 1WIPA 2PTUA 1Q7YC 5D1XA 2NY3B 4OCWL 1TYEB 1BO0A 2GPZA 3B6SA 2W9EL 2XZQL 5CHNB 3BZDB 7FABH 2EE9A 4PJ8D 3AAZA 3OHXA 1OAYH 3V6FB 3L4TA 1YYLH 3ATFA 3PHOB 4J3TA 2HCZX 4OD1H 1E5UI 3UPRB 1U91B 1YDPA 1G6RB 4PJFE 4KTDH 3T4YB 3JC66 5TFSH 4YZWA 2GY7B 4TNVF 1J88A 4I8DA 1QBML 3S88L 2J8OA 2ZUWA 2HT4C 1GUGA 1RU9H 2X40A 3DO3A 5ICUA 3RVUC 1S7QA 4AT6B 3PWLA 5E23A 5GS0H 3AWFA 4GN3B 3UO1L 3U2IA 2DB8A 4W9KC 3WTSA 5CLZA 3M46A 4Y16A 5CJXA 4P04A 4YJZL 1VEPA 1NCNA 3HMWH 2BY2A 2ROYA 1IGMH 3V0VA 3VFMB 5L6YL 2BSEA 3C5ZC 3QFJE 5IEHB 2YMXH 3IFOB 2JFCA 5LAXB 2R4SL 1E8ZA 3MZTA 1KBKA 1G9ML 4AG4L 4ODVH 1PTOH 3BZ4A 3LB6D 2GSIA 5HYIA 3RGVB 4AMWA 3CSBA 5EEYA 2I27N 4HT1H 2XTIA 2EIZB 5C0XH 3HE6C 2AK1H 4UU9B 1KENL 1ZANH 5C1MB 4WTZG 4F8LA 1PDQA 3CUPB 1LO4L 2V5RA 2VLKA 5HJGA 5C9JA 1SLWA 4QO1B 2H3KA 4JV5L 4DV7Q 4OZFH 3QSKB 3NDYE 4HU8A 3GEFA 3MDJA 1I1CA 3UBXI 1TWFB 4A6YH 3NK4A 3CFMA 1VQMA 2R29H 4FLOA 5I19H 4NAQA 3MREA 3O4LE 3MR9A 1I9IH 4PRPB 5DFTA 5AW5B 3IVKB 4YWGH 4G1MA 5KS9A 1L6ZA 3MXNB 5E6YA 4EUPA 1HI6B 3FRPG 3D0AA 4JFDB 5FO8B 3N04A 1CSQA 1SM3H 3QAZB 2JKIS 3BSHA 3RTQC 5A2JH 4KK6D 5DZOA 2EYLA 1PRTF 2WVUA 4F2ME 2PO6B 4XO5A 3V0WH 3LWUA 3QYCA 1QVFA 3LRKA 5E9DA 1YCSA 2P8LA 3KBXA 4JNXA 1BQQT 5CSZB 5JIDA 2Y36L 3SSGA 3V79C 2XBZA 5C0IA 4OZIF 3KDFA 4RGOL 5CN3A 2V5TA 2WIIA 1WP6A 1YMMD 5A6LA 3UCQA 1S7WA 3NACL 4AL8C 1TQTA 2R0WH 5DRWB 3ULVC 4UMGA 4XP6H 3U0PB 3I9GL 3QZLA 1A25A 1TSHA 1BM3L 1AQDA 3SQRA 2ZSWA 1GC1H 1TS4A 5IMKA 4J1UA 4NRYA 2O5IC 2G60L 3BH8B 4YWMA 3T2QA 4Z3GA 3KDMA 5IW6A 2A9BA 3BSZA 3ULUC 4AEEA 1Y6MR 3EGXA 4GAGL 1S7UB 2H3NB 3PGDA 1E3FA 5CZVL 4CJ1B 5C9KA 3M4OB 3K6FA 2ODHA 2VL4A 1QO3B 3EH4B 5F96H 4Z6AT 2RAMA 1JZ2A 3MXUA 2EZ0C 2LAAA 5SWQA 2YEZB 1ETB1 1SFHA 3F7YA 2CJUL 1PZID 1MHPH 1ETJA 1MI2A 1H8LA 1KZQA 3OF6A 3PWPE 4A76A 1EANA 2ITDB 3KLRA 4KK7A 3HE7A 3KF8B 4PUBL 5H37H 4FFZA 5T1LD 3X1NA 4ZYSA 3P9LA 1FN4B 2J6EA 4LU5L 2WZ0A 3HB3D 5L2KD 3DROA 3B2VL 4LGRB 4B3RQ 4WSGA 5F0JB 1S5HA 3UMTA 4CMHC 4L0YA 1B2WL 4M8AA 2VDNH 3R7QA 4E9VA 3CX5J 3MC0B 4FABH 1AGEB 4FKEA 2VDQL 1ASPA 3OIQA 1K5NA 1P4IH 1TQUA 2L8AA 2OMTA 4N0UB 4PJ8C 4KGJA 2EIJB 4FN0A 1A6VH 3A7LA 2A38A 1BR9A 2BIQA 3ZR6A 3N9GL 1VESA 3SEPA 3VSQA 4CMMB 4G72B 4WHYH 5CLYA 5LVEA 1SYVB 5AW9B 2L7JA 3MKGA 3LKOB 1QJOA 3FO2A 1TZHA 1QSEE 4OI8A 3FUHA 3QIBC 5AL8A 5AW1B 1LUZA 3MNMA 3BZEA 2A19A 1TTFA 3ARDA 5CCGE 5JPMC 3ZTEA 5E8NB 5IROD 2ZX6A 1PYBA 5AYUH 4LF8Q 3KLSA 5FUOH 3HMXL 4PJDB 3C8KA 1I7UA 1BXTA 3BPNC 2SNMA 1C08B 3AGWA 4WK0B 5GRJH 2F74B 2GBUA 4GS3A 3SE4C 2DWEA 3QVAA 3KPLA 4G9DA 4Y5VC 4EVNA 4UOZA 1GPOH 2MRYA 1JPTH 2DEWX 3HUJB 3NCJH 3PFUA 3HOGA 4MNQB 4LCUA 1DBAL 4UQ3B 1JRHI 3MJ9H 4DFAA 5CC4A 2EADA 4UDTB 3TYFA 4FQCL 4PPTA 1Y6KR 2X4PA 2QILA 3N52A 4KJOA 4YFDB 1JTTA 1Q3LA 5EEXA 3TZVB 1LE5B 1V1QA 4B3ML 2IOIA 2Q2IA 1X5ZA 4N8VG 4A3DH 3E8VA 5DUPL 5C09E 1KGWA 3GEWB 4YZFE 1JNLL 4P23B 1A6ZB 3VFPA 2FK9A 4LK1C 4MASA 2CUIA 1BV8A 3BWUC 5DQJB 1CQKA 3PQYA 2Q8AH 3RR5A 1UNSA 3K80C 1OZUA 3KJ6H 1AO7D 1ICTA 2WWKO 5BZXA 1BKBA 1SSOA 5E6UB 3VGAC 5M95B 3U48A 2DL2A 2CLRA 4Q0XL 3WHXB 3QG7H 5JXAL 4XXCC 4HD9A 2MHAA 4KK6C 5H35A 3MRFA 3HOVB 1ZY9A 3OXSB 1JWMD 3DUHA 3BDYL 1JC7A 5D5MF 1DOMA 3QQ3B 2YPLE 4G5ZH 2B1AH 2IXQA 2ZXPA 2EXTA 5MEPA 3IRCA 4WWKB 3GBNH 3VTMA 2LTQB 5E1IA 2IANA 1IVLA 3CIQA 3UROR 2QV2A 2XX0A 1JT8A 3LRSB 4ZOBA 1U4LA 4IRSB 4GB9A 1IEBA 4NUGH 4MD0A 1KACB 2ZX7A 2IAMD 5EO1A 4BBSH 3FFDB 2VB2X 4LGPB 2K78A 1KCRH 1Y7VA 4XOBA 2XA3A 4P9MH 1OCCB 3CQPA 1IBMQ 3RPBA 3U4BL 5E4WC 2Z92A 2VDOL 3KS0J 4OLZH 3JAMc 3HOUG 5A7BA 4B9KC 3E0EA 3TM6A 3ARGD 1DHKA 3GMPA 3D3VD 3HBQA 1J10A 3MGTB 4Q56A 1AC0A 3F58H 3MBEB 1K6QH 3SGKC 2DWYA 2UWEE 5E08H 3HR6A 5ICXB 2PCPB 3LD8B 3ZJAA 4E0RA 2AV7B 2CO3A 2DMCA 1EYAA 2XY2A 1QFWL 2MO0A 3U6RA 2EC9U 3FBQA 5IVXA 5DZJA 2HDMA 4FLQA 4APQD 3CSTA 2BHFA 4G6AD 4B41A 5LMUQ 4IS6A 4YHIB 4X50A 3PG2A 1A0QL 3WMSA 3BP4B 3SCMA 3PP3H 2Z4HA 2DQCH 4F7MA 1JF5A 3JTSB 4JGUA 1CXFA 1M57B 5F9AC 6TAAA 3FSOA 1HTLD 4S1QL 5GGRY 2JB5H 1DTUA 1GS6X 3I6GB 4QGYA 4K6DA 4AV5A 2CCZA 1PKQE 4OGAD 4DZ8A 1Z47A 3GSNA 3CHQA 2WXMA 5EEVA 2P46B 3GBDA 2H8PB 5A6MA 3AS0A 1JWUD 3HB3C 5K9KA 1USQA 5AB0A 5T3XL 2VMCA 3I6KA 3DEOA 3NE5B 1QTPA 3MX0A 1RZFH 1FRGH 4PS7A 4MX7A 2A0LD 4JO3L 5JEAH 1YUHB 1F97A 1BAFH 3HLAA 3NJNA 2ZNXA 1EUTA 5BOPA 3FT3B 5I1LB 3IJHB 2JB6A 5DHVA 3G5YA 4OO1H 2QSCH 1YHBA 5ISZA 1SUJA 5D7LB 2UXCQ 2RBMA 4P48A 1C5BH 2IOOA 5EPMA 1D3CA 2YKLL 5FIEA 4FYTA 4EXPX 1XT5A 2Y0SB 3HZVB 4Z0XA 1IC7L 1WTPA 5EZOL 5F7WC 3H9HA 1JYVA 4JI7Q 1HHHA 5I6OA 4LDCA 1VGKB 5IROC 2OTUB 5DI8A 3C60A 1ED3B 5F97E 2C9VA 3AU7A 3W9DB 2DI8A 1CU4H 2IC2A 3H42H 4HS3B 4JRYA 2DJGC 2YD6A 3L2NA 4XMUA 5B1JA 3MVVA 4HBQA 4LMQI 1PVOA 2UZPA 4IOAA 1OF0A 3AVEA 1PLGL 2ENYA 3ND9A 1SXBA 4HEMA 2JXMB 1CDJA 2HUHA 4G6JL 3MNDA 5A43C 1SVZA 4PLKD 2YWYA 4V1DA 4XNBA 3ZKMD 4FA6A 1IBGL 5BO1H 4PGCB 5GZOD 2G3NA 1AGFB 1YLBB 4F58H 5EU7E 4PI2A 1DVSA 1NIAA 3NIGE 5DUML 4QRSB 4G3YH 1AD0B 3HS9A 2Y1AA 2FFKB 1KJ3H 4QRRE 3QORB 3EUDA 1TVHB 1XAUA 2AI0H 1UA6L 2BWIA 3B9KB 4FI7A 5CGTA 4HWUA 1EIYB 3OPUA 3QZBA 4Z76B 2CO2A 3H3KA 1OXSC 5F8QC 4UTCA 4GP8B 3LS5L 1SE4A 1F4YH 1RK1B 4PAZA 4DV0Q 4PJEB 3T6WA 1JB7A 2ZXGA 5E2UL 5I2IB 3WUWG 2OJEB 1R47A 4OJAA 1ZLSH 4YCVA 4UQBA 2NZ1D 2VXVH 2OLDA 1P5VA 2F0DA 3FO0L 4M8QA 3PJNA 3J7ZC 4GXVH 1OGTA 2PKDA 3VR4A 1KG0B 1Q94A 3D0LB 2ZPKL 3Q5OA 5I5MA 3RU8H 2WCGA 1YJWA 1UENA 4JL1A 2PZUA 3I7FA 3KYOB 4GPVA 3GJFA 4S0SD 5C0GB 3QEQB 2DKMA 2BZ7A 3VA7A 3PUVA 3U83A 4A2GA 3BP7A 3GMOA 1SROA 2N55A 1HIML 1HWHB 1XGRB 1U41A 2F6AA 4NX0A 4FYQA 4OCXH 4QKXB 3BKCL 5IBLD 2I25N 3PDOA 1DUYA 5HYJA 4LUOA 4JFEA 5GJTL 3AUWB 2X4QB 5KJ7E 4XGZB 2OSXA 2IAMC 4FTDA 5E8EA 1QB5D 1TR7A 2ALWA 3ZHLA 5GRZA 5C07D 2JA6B 1A9BB 1AMXA 4JRXE 4MB1A 5K9JL 4YSOA 4FZ8H 2D3VA 2W95A 3QDGA 2Y7QB 1NCCL 1OPGL 4PJFB 4UQAA 4NKIH 2K9UA 5L8KB 4FF2A 1I3RB 1FJGQ 4JCWA 5F1KC 5KWYC 1F42A 3J07A 3TN0A 4Z3IA 1OALA 5C44B 3ARGC 3PWJA 3JWDL 5M5WH 1U92A 1BQHB 5LNEA 4FXGB 1XGYH 2YBGA 4HOWA 1L6XA 3K91A 1GSKA 1OB1A 4K8RL 3LKNB 3ARUA 5I16B 2DL9A 1XPUA 3VRLE 32C2B 4BH8A 4APQC 1PH2A 3QQ4B 3BPOB 3QFJB 4G6AC 3WFEL 5IW3A 2ZAIA 4N9GA 3KYAA 3ZE0E 3ABLB 4NQCD 1P5UA 4WTWA 1IQDB 5FWRA 3OMIB 3T3PE 2F54A 4JI6Q 4Y4KB 4JI8Q 1ANUA 1Q9WB 2HAZA 4OGAC 4L3CA 4Q2ZA 3FT9A 3U9WA 4AV0A 2JJUA 3RWGA 4RIRB 2XICA 3HZYA 4NPKA 3SE9L 1RL1A 3E1F1 5DHYB 5KANG 3FDTA 4KHZA 3VYTA 1CR9L 1KC5H 4HWBL 1BFVH 4JY5L 4A63A 3VQ1C 4QQBX 2A0LC 4OFQA 1I6HH 3VXME 4UOW1 2JQMA 1X5HA 1F3JB 1ZIBA 2Z4QA 2Y3AA 3OZKA 3JUYA 3K46A 2XZAH 3TREA 1HFNA 3D85A 2VJ8A 4P4RB 3UH8A 2VL6A 2IFFH 4X99B 5IYBH 1QBLH 3MHZA 3X3FL 3L9RB 4N2GA 1BMZA 5KS9E 3DI3B 1PJ9A 3FRUB 2CO6A 3RQ3A 4F2MB 2W59A 5I23A 3QI9D 1CTMA 4HGMA 2BVQB 4OZIB 4J1MA 4MMXA 3ASNB 1MQ8A 2VXTL 5EZIL 5ABZA 4KVCL 1OSPH 3QJYA 1MVFA 3VB8A 3EDFA 4Q0FA 3GDBA 2QPDB 3PP3K 3UOAB 3JZ7A 1X3EA 5SWZA 1S7RB 1E6JL 4EKXA 3UZQA 1JXDA 3EH1A 4P4KA 4O02L 5F9JB 3SB3A 1U0LA 4PZ6A 1E2VA 4UP9A 1F2XK 4JEGB 1HCFX 3CD6A 5EOCH 4BHUI 4PLKC 3ZKMC 5C0XJ 5GZOC 3RIKA 1UUSA 3V0HA 3BIBX 4ONGH 2R0KH 2WQUA 4HSAC 2K5HA 3BZFA 3OC5A 4DK3C 2YS4A 4IUNA 3BKJH 1XD0A 4K7PX 3OKEB 3N40F 3FUNA 1ADQA 1VA9A 4V11A 2BCOA 3VG0H 2N7SA 4PJ5E 2HFEA 2WUBL 3OR7B 3RNQB 3CZSA 4A3IH 3EYVB 4JYAL 2AJVL 2WLNA 4NUPA 1KXVA 2ZM6Q 2J1XA 3QRGH 5DMGD 4XNMB 4AYFB 1JRHH 1JD9A 1R24B 1S7VA 5JQHC 5I8OL 3ROOB 1F3RB 3DVNA 1NCGA 2X44D 1C16B 4NXNL 4WSKA 2KERA 2J20A 1KCVH 3SPVB 2XZCH 4UT7H 4WEBL 1EEUA 2NYZD 3EDEA 4BV1A 1EVUA 1FL5B 4LE8A 2B16A 2DIEA 1A7OL 1KCWA 5F7EL 5M3MB 1CFTB 4YBQC 4XQQA 2Y6TE 3EYQC 2WYZA 3C5SB 3MA2B 3AY4C 4Y4FA 4RFEB 1C8QA 1V7ML 3GJEB 1DDHA 2OZ4L 4PVLA 1PYWB 2CHWA 2X6VA 3R2IA 2WANA 1CDGA 1J12A 1M6OB 4XN9A 1ES0B 5IBLC 3V2AR 4A3EH 4CVUA 2J12B 2H26B 5BW7A 5JW4R 5MENB 2AK4B 5ACMA 3K74B 5CSGA 2R3ZA 1IT9H 4H1LA 4L3AA 4KO7A 3IK2A 1AW7A 4X80L 1M3JA 2UZXA 3GWJA 3M7FB 3A56A 1FH2A 2E7LA 2XVLA 1AKPA 9CGTA 2WTOA 4Q9CA 4JFXA 1JZIA 4O5LH 1MHWC 5GGSA 3S36L 1B90A 1IIKA 2GTZB 3KYKH 1JV5A 3T0EA 4HHAB 3V6ZB 4Y2DD 3PS6A 2K5DA 1F1GA 3W56A 4I48A 2GITB 2WKLA 5CU9A 1D5XB 2A6IA 3JSSA 1TTRA 5C0XG 2XV2A 3QUML 5LCVH 1NLDH 3I75B 4Y4HA 3AB0C 1A2UA 1AANA 1DQLL 2ZUVA 3D4ZA 4B3TL 2FSDA 1UM4L 2E7HA 3EH2A 2FL5A 1X7QA 1AD9B 2K9FB 4GW4A 4K2KA 3CDZA 2ARJB 3FTUA 4OZFG 1K85A 4D9LH 3ZZQA 1OT2A 3I72A 3LCYA 2C3VA 2ZYHA 3EOBB 5E94B 4XPHL 4BDVA 4DEPC 5JW4Q 5FYLD 2W60A 1NCWL 2V37A 1BLNB 5FC9A 3SYOA 3SE8L 4LCWD 2XNAC 4FKKA 4UTBA 4F20A 1DJSA 3RPIA 1A3UA 3O0LA 3O41A 1MHCB 3IS1X 1CUOA 4GSXA 1LMIA 2XVGA 2Q2HA 3QAQA 1CLYL 2MNJB 1DP0A 4UDUA 4FLSA 1SFOB 4BZ2H 2F1BA 2W0FB 4R97C 5A16A 2PZTA 1BBUA 3WTVA 4G8GB 1DJWA 4JPVL 1GVIA 2YV5A 2VMJA 5I1CH 3PQYE 4Z7QE 4DTGH 3DXJC 4KKLD 4CW1A 3EFFA 1FE8H 3FCSA 1CMOA 2DN8A 2K6AA 3QI9C 3ARED 1SQMA 1PSKL 4JHVA 2YPLB 4JG5A 4YUEH 3MRBB 2DQDL 4HJJH 5DGQA 4BSVA 1MRDH 3O11B 4N20A 1SNRA 3P30H 4A3CH 1A7NH 4IRJB 1Z3GL 3IXAB 4JN1L 35C8L 5J89A 5I30H 1CXLA 4P5RA 3ELQA 5CBAE 3GO1H 4Z5RA 1EJOH 3BAJA 5I1AB 3CRKC 2DM4A 3OTOL 5ADOH 3BAWA 4XXDB 4GUOA 2NUTA 5BS0D 4KZDL 1P4LB 2FT7A 2WWOA 1WA0X 3MRMB 3V5KA 5L8JB 4U6VL 1O0VA 1OLLA 1DUZB 1ZDQA 4PRBA 5FFOA 4X6DF 4MB5A 1TVDA 3ALPA 3BI9X 2ICWJ 1KXTA 1I1AD 1Q9OB 1ND0B 2WGNB 2UWEB 4FFWD 5TK4A 2IPKB 1OHQA 5KSUA 2VS1A 4WNQB 3LKSA 1QACA 2VSMB 4LF3B 4YWKA 1MF2H 3I4NH 1RUPH 3FQTA 3RA7L 1E5YA 1RIUL 4D8OA 3JAML 4P5SA 1O7IA 2UU9Q 3RZOB 1J8HD 2Z0BA 4K23H 4EIUA 3DX6A 3KPMB 4U1SB 3NTCH 1S9VA 5HXMA 4S11A 1X56A 4UM8B 5IVXE 3WFZA 5J6SA 3WUZA 4X4YA 4MA3B 2EH7L 1NLBH 3EGDA 2ZX5A 3MTSA 1PKQB 1U3JA 5JUEH 5E7FA 4MLIA 1LO5A 5C0FB 2QMKA 3AG3B 2HRPL 1SJHB 3MJ8B 4NUMA 3LPGA 4XVSL 2Y5TA 2J7ZA 5ESVB 4ATWA 4K0KQ 3QG6A 1CHQD 4M43L 2VNCA 1UCBL 1FUNA 4QHUA 2FYYB 2GJ6A 5HPMA 3J80i 3VFUA 1R3IL 2RDGA 2OZNA 2CW0D 1NINA 3ROLA 4NQEE 4UT9A 4ZLTF 1M1XA 5LDUA 2UY6A 1VEMA 2CNYA 4LFHG 3F7VB 3RZCA 4WU7B 5DSCA 1K4CA 2HLAB 3MSPA 3QDJD 3BXNA 1EFXA 4K94C 1BDOA 3T8VA 4IEFA 4M48L 2ADYA 3P4NB 1AKJD 3D34A 4IHBA 5EF2A 2PR4L 1HOEA 1HQ4B 4Y2DC 4R4FH 3D39A 4X3TA 5D6DC 2OQKA 3GSVA 3H2PA 1ZLUK 4I5BA 1D6EA 2D2OA 5DEGB 5LBGA 5BR8L 1ACYL 1OARL 1A3RL 2PNRC 1AAJA 3GI8H 3MFFB 4XH2B 3L1OL 4HMEA 4LHUA 3CCVA 5K39B 3UEQA 3FUDA 3QFGA 4NERA 4DN4L 5IIEA 1KB5L 3UTTA 4P46B 4YX2H 3RAJH 4F9LA 4A3DG 5BVJB 1MLBB 2N88A 2DPKA 1VQ4A 4NFDA 1MREH 3H54A 1Q8KA 4JPKL 1KEMH 1JHLH 2WUCH 3JV6B 4JRYE 3SDYH 2V9QA 2BP5M 3FH5A 1AGCA 1IGJB 2CO4A 1OIOA 3BPLB 3A74A 1ZV5A 5KNBA 4P74A 1CGYA 4KHXH 5DZPA 4GS7C 2EDYA 5DYFA 1OM3H 2HVJA 4BFIA 1SYBA 2YPVA 4QRRB 1G9NC 4NNPL 1FNGA 4G9FE 1UOVA 2H1PL 4J4PA 4I2XB 4LIQE 2EKJA 1SYSB 5I5RA 2DYPA 2DWDA 1Y0LA 5FV2A 2HIXA 3STZA 3GRGA 3J27A 1PH8A 1FGVL 5ES4B 3HOWH 1EGJL 2VR8A 3Q23A 1J6QA 2OI9B 2MHVA 4RFNB 3ZE2E 5LAPA 2OX5B 2C7UA 3QEUB 4FLHA 4TPRL 4YC2C 1BA9A 2QTEA 3OLDA 2ILLA 3P3YA 4KHPL 4JDEA 4BWTA 4MZ2A 4E68A 5KBKA 3ETBF 5KVDE 4LFAL 1WTXA 4A93G 2Z7YA 3EOAA 4L9DA 3IAGC 4KKLC 1NIFA 4BBSG 2ESVB 4RDQF 4GBXB 2D0FA 2WLIB 3AREC 3NIFE 4JPSA 4TQ8A 4GOSA 4EMZA 5D72H 5IHZA 3H6MA 3GMLA 3BAKA 3Q8EA 3UDFA 4H7VA 4Y2OA 5GGTA 4NO2A 4WJ4A 4APXA 1AH9A 4XAWH 1F9SA 3T9WA 1M7DA 2I9TB 1OAUL 2YN5A 4NQQA 2PYEA 1HE7A 5I15H 4HISA 4PCYA 1S9XB 3GMMA 4U3CA 3IEAA 2B14A 4FYSA 4AEIL 1LABA 4S1RH 1QG7A 2MQHA 4JRXB 1D5BB 4Z7NE 3HI1B 2K52A 1NGPL 1VF7A 2IX1A 3B6SB 4XVJL 4GEJA 5BV7H 5I9OA 5D71L 3CMOL 3AAZB 5HYSG 5DD3H 2VZVA 5C0JB 2XTJB 1SMXA 1QLRA 3VMPA 5GHWH 5SX4I 3QO0B 1I1AC 4HBCH 2PQEA 1WYJA 1YDPB 2AEQH 2OMBA 3CFKA 4WY7H 3IF1A 4FFWC 5DK2B 2IHEA 3H9SD 2B4CC 1DFBH 3QDME 1DBJL 3HEJA 4BK8A 1GUWA 4M8RA 1HZHL 4W81A 3P73A 4CU8A 5CLWA 3PWLB 3QZNA 1E30A 3P75A 3L3HB 4XXEA 1KQSA 3L3OA 4JZOA 5LQBL 4KD3A 2NBFA 4PS3A 1NZRA 4Y16B 4XMLL 3GS7A 3UC0L 1OTSC 3T3PB 3W1GA 3V96A 5C7ZA 4NXSA 5JEAG 1U3YA 2W5PA 1EQVA 4BY1H 4OGYL 5CINH 3FFOA 4OO1G 4C4KT 1DCZA 3BZ4B 1CGSL 1L0YA 4FNPA 4FTVE 4HS8L 1YEIL 3VW3H 2C3WA 4DGVH 2V17L 3QUZC 2F54E 5CR1A 1GYUA 2JELL 1MDTA 3DIDA 4MNHA 1SR3A 3O8XA 1H8SA 4GNXA 1LTRD 4FZEL 1WF5A 5DCCA 5BMFL 1WSST 4L9LA 4BWUA 1NBVH 5C9JB 2VLKB 4B3SL 3VXMB 1KTJA 1SZNA 3HNSL 4GO8A 2KH2B 4U6TA 4TL5A 5D70L 5AVSB 4XCNA 1TYJA 2XRSD 4A3LG 2ATKB 5H4ZA 4L8CB 3HZMA 3O6MH 1INDH 3B9EA 5ELDA 3S97C 3ARXA 2F0QA 4WSJA 5HTSA 4YHHQ 4OIKA 4Z95L 3V0AC 3K0YA 3MREB 2D7TH 1MCCA 3KPRE 3MR9B 4K9EC 3PPSA 1W0YT 3PDDA 5KS9B 4EUPB 4IUPA 4OSUH 4RGTA 4UINL 2R6GA 4R5TA 2QGEA 1KNEA 1MWAA 2O4EA 4HJ9A 3D09A 3WKMH 1I85C 1RUAH 4NUQA 1RD6A 1ZHBB 3V9FA 4JLRB 4H8WC 2VRQA 3C1FA 2CLZA 1XCQA 4ZXBD 1IIIA 4J3OH 3ZTJG 1YC7A 3V6OE 3NXWA 1G6PA 4H0LC 1ENAA 3BVWA 1QFWI 2DQTL 4R8WL 2P8LB 3VQ2C 3CZJA 3A0JA 4JM2D 4H8QA 4JFVA 4DO4A 3T53B 3SOTA 3T2LA 3NSYA 5TPWH 4OFYA 4LF6L 1N33L 3HC2A 4OGXH 5C0IB 3KDFB 4XNZC 5AENA 4X0KA 4Q4EA 4OM1L 3CZNA 1QMUA 3V7AE 2KC0A 3WNKA 5KVMC 2WLLA 4YLQT 5DK0A 1C7YA 1FYTE 4PMWA 1QHQA 4OV6F 5J12C 2J8UA 1RULH 1JZ5A 3AT9A 3UAJA 3PUZA 1TZGL 3J7A5 2LU4A 3MODH 3FQWA 4LESA 5FX3A 4DV2L 1A3LL 1P4BH 1NBZA 2ZSWB 4Y8AA 1F4WL 5DF0A 3UBXG 5IMKB 3MRQA 3NCFB 1XF4B 1WT5A 1E90A 3SE6A 3SZ6A 2BSRA 3KLAA 2K70A 1AACA 4GAJL 1LK3L 3KDMB 2FHCA 1D6VL 2LFEA 1F4HA 2V9RA 2VQEQ 5CSBA 1KN4H 4X9BA 5D1QA 3EGXB 4RCAA 1HYSD 3Q44A 1QSFE 4OLYL 1VPOL 2NMSA 4A3FH 1WGVA 4RAVA 4B7LA 2X09A 5LGHH 1HXMA 5PAZA 2E2HB 4WLCA 1LTBD 1RVFH 2NLJA 5SWQB 2WQWA 2WIMA 1P1ZA 3RUGA 3F7YB 2D8KA 1QNKA 3ARPA 1BHGA 1CN4A 2LU3A 3ARFD 2XZQH 4G42A 5EU6E 2F18A 1ETA1 2J2ZA 1YEHH 3VXTA 5I1IL 2LU5A 3HE7B 5IQMA 1A6AA 3P9LB 4UAOC 5EOCJ 3BU2A 3O4OB 3QXUA 1S5HB 1K5WA 1FIEA 3MV9E 2IWHA 2WP8J 4JKNA 5FO9A 5JYMA 1IX2A 3JUZA 1QBMH 3K8MA 1R34A 3NN8A 1A21A 2OMTB 3C6SB 3A8KE 4JFHE 5TFSL 3UO1H 1TKWA 1MFUA 2A9NL 3QCUL 1GD7A 3DVIA 4DAGH 3SQOL 1HKLL 2YXFA 2X9XA 3FO2B 4JO5A 3F2BA 1TZHB 1Z0MA 2O6EA 2D03L 2BW5A 2N0KA 3ISWA 4YK4C 5I75B 4QMGA 4JW3A 1B50A 3NFSL 2R4SH 2WXNA 2YUVA 3BZEB 4MKMA 4QRTA 2ZP8A 3ARDB 1L1OC 1KTBA 3U7WL 1BDYA 2CXKA 1JDAA 2V3FA 3ZRFC 4N0CD 2H1XA 1OB0A 5DAUA 1I7UB 4XAKE 3T2PA 4JCVE 4TYUA 3UDIA 4NFCA 5IJDC 1UCTA 1N4XL 4XBMA 4YL4A 3NTIA 2DWEB 3KPLB 3MLPA 4EVNB 2PYFA 2VLRD 4KH9A 3V9EA 1ZXTA 3H1ZA 3NOIA 4JE4B 3JXAA 3ARYA 1TQBC 1KMGA 4LCUB 4P9HL 3ZDZF 5MHSD 2L4NA 2CWAA 3LXBA 5IYBG 5EKIA 4HV8B 4PY7B 5C92A 1BVKA 3NCBB 1RHFA 2VM3A 5FA3A 4I77L 2A6DA 3QNFA 2R69L 3S5LB 2PQAA 3R18A 3NAAL 2JA9A 4HSQA 4HJ5A 3L7FB 2JTDA 4ZW3A 1UQSB 3VFPB 4Z7WE 1B6UA 2WVVA 4LF4L 4JB9L 1KGIA 3PQYB 5EZPA 4Z7QB 1KRTA 4L8SB 3L5HA 2VXSH 3J7AV 4IRZH 3APMA 2Q76B 1WG3A 1JF1B 3LHPL 4WFFD 1NMCC 3NZUA 2CLRB 6FABL 1FJ1A 2AXJA 3LYRA 1H95A 2XKUA 2Y36H 3MA7A 3CAMA 1P2CA 1RK0A 2MHAB 1I3QH 5H35B 2X6AA 3PHSA 3MRFB 4RGOH 4ZXBC 1N5AA 3P7JA 4S0TD 2E3VA 2J88L 1F5WA 3BMVA 3P0YH 1UEAB 5EG6C 3GXDA 5CBAB 2IXQB 5MEPB 5FM4A 3EJZD 1BUVT 4F24A 4P2CG 4A3IG 5E8DH 2IANB 4UUJA 4K5LA 4GOPA 4PJ7E 1NMBH 3CDFA 2I69A 2FEEL 1IEBB 2BP8A 1X4XA 3K8AA 1RPQA 2ED6A 3QR8A 2NY0D 4ANXA 3DSNA 3EBIA 5E6IB 2UY7A 4ZFFA 1JZHA 4UMSA 4FS0A 1AGBA 2IHFA 1G94A 2G60H 2VDMB 1C48A 4URKA 2AAVA 3DRTA 2APWA 2I0QA 4LFHD 3MOQA 4X6CF 3NSWA 2Z92B 4U68A 3IJ8A 4HH9A 4E42A 3S1NH 4GSDH 4TSSA 1B70B 1PMRA 1JGLL 5IB4A 2H6UA 3CBRA 2F3WA 2FLRT 4ODWA 4Q6IA 5ENWA 3T2OA 3IPEA 1PDKA 1WS8A 2XIWA 1DVXA 1ZTXE 4HC1A 4QJ3B 4P8QA 5I74B 3U6RB 5DJ6A 4ZX5A 3T8XB 5IVXB 4PLNC 1KIUA 1HYSC 1S4ZA 2D7QA 5G3LF 4PUBH 5ELFA 4CGYB 1KJMB 1P53A 3FQ4A 3I74A 2UXDQ 3L2MA 3RL2B 3P02A 4LU5H 4WHTA 4F7MB 3IDYC 1IEAA 2L55A 2B08A 3H0GB 3PUWA 2A77L 4DV1L 4G43A 1TMCB 2EO9A 4QHMA 3T5WA 5FK9C 1X4YA 2VRAA 5IWAQ 1E1TA 1I4RA 1E5ZA 1U8NA 3QUYD 2VDQH 2F58H 4MAUL 3GSNB 3FMCA 2JVUA 4NPJA 4DZ8B 5KVEH 5L9DL 3W38A 1S5FD 3RY6C 3CLEL 1A6UL 3N9GH 2XPZA 4NQEB 5K9KB 1IM3A 3MTXA 3KLDA 1UXWA 3BSZL 4J15A 2ZWSA 3M45A 3M85A 3I6KB 1GJWA 4G7YL 3MX0B 1EERB 5JMRA 1FLTX 2X0VA 1KBGH 1QNZL 3UG3A 3KG5A 3LS4L 4MX7B 1KHIA 2GJ6E 1GVPA 3DX8B 1SNDA 1PAMA 2F7IA 3HLAB 3ATAA 4MNOA 4ANVA 5EBDA 1VRSA 3QC5X 1QTYT 4YDKL 4GLVB 3G5YB 5DHVB 3SPGA 5AB2A 4ZNEA 1J9SA 4U3SA 4XP9L 4XPTL 2VXWA 3O13A 2X89A 2OSYA 1S5IL 5EPMB 3HMXH 2IBGA 4BKLA 3VXOA 1DJIA 3HZ3A 1SLUA 1U93A 2F15A 2VN7A 4Z0XB 3PIOA 4FFZL 4M3HA 1L3NA 4KJYB 5KSAA 4HUWA 2J6EL 3SQBB 3GTMB 5FLXc 1HHHB 4MWFA 2K5VA 3ZMEA 1U33A 3C60B 5DI8B 2A4ZA 2CMRH 4P2OA 5G55A 3HPJA 3A4EA 2D7MA 4I1RA 4N0CC 3LN4A 4QIRA 5SX4H 1EQTA 4JRYB 1NUCA 5LMNW 1SY6H 4FQCH 5L0QB 1FFOB 4GSRA 2N01B 3QHZL 1HAWA 1SLVA 3TWCL 5B7EA 5EIIG 2FGZA 2JCCA 5IFHL 2DEXX 3C5XA 4ELMA 4HETA 1W2BA 1DQJA 2PNDA 2ZF9A 3CC5A 4PV9B 3T0AA 1EY9A 1JNLH 3O6FA 1LGVA 1M90C 4DA2A 4AGQA 4N6RB 1DEEB 3ES6B 3V52L 3QRLA 4NI3A 3FCUB 4FQ2L 1X6OA 3DM1A 4NZTL 3TDQA 3FU7A 5A2LH 3AG2B 3FF7A 1Y1WH 4C58B 2XJLA 1GR7A 4NPSA 1MXDA 1QFOA 4PM1A 4Q0XH 4QY7A 2R2HA 4ZUWA 2RFXA 3UYOD 3ZE2B 3T3ME 5JXAH 4A3CG 1X9UA 4LL4A 1UXLA 4QLRA 2IW3A 2Z31A 1F90H 3RWIA 5I24A 4XMVA 4L1DA 3BDYH 1S5BD 4OTXH 1B3QA 1EL0A 1YQ2A 1GIGL 3NRPA 4J3SA 2ORBL 4HCRH 4OX9Q 2JLPA 3NIFB 1U8PA 2XQ0A 4JO2L 4DUWA 4O2FA 1TWFH 1UKTA 1IYUA 3VU2A 3T8MA 4M3KB 4N1HB 4EQ2A 5AG9A 5B8CA 3Q22A 4QRPA 2FMMA 3GJFB 1AZBA 4LAAA 4AV4A 2R8SL 2F8IA 2WSPA 2WXIA 3TO4B 4NBZB 1NC2B 5IIFA 3GMOB 3U9PH 4GMSL 5JW4N 4BY7B 1H6UA 4KAQH 4BS9A 2R93G 4KXBA 5C3LD 3WY2A 3A3YB 3EJZC 4Z7NB 1S7SA 3LRLA 3E0GA 2PYEE 2VDOH 3PDOB 3I4NG 1DUYB 4JFEB 4FG2A 3LN5B 4PJBA 4M93B 3NBIA 2DLHA 2NY0C 3IFLL 2E46A 3KWWA 1IILE 2KQNA 5A35A 1EAJA 3HRZC 4I0PD 1RDPD 3LEVH 3TYGL 4DH2A 4NKDB 3GTKB 1GZQA 4JFFA 4YHML 1W0VA 3PUCA 3QDMB 3MXVH 4KHTH 4F80A 4FP8H 4U1MA 3DLLA 1HVXA 4GLAC 3PWJB 5A2AA 5DJ2A 4P5TD 4RX4A 4U3XA 1CD1A 1TJGL 3BDXA 3L3KB 3U4AA 1IEHA 4MCZA 1B9KA 3LZNA 1H0DA 1VQNA 4S1QH 1AXIB 4WK2B 3HG4A 4QUOA 4ALPA 1GKOA 4IMLA 1KEGL 4BH8B 1EOVA 1Q81C 3GK8H 5JOEA 5F9DC 1IL1A 4N9GB 5D7IA 1P5UB 3VD4A 1LTSD 2J25A 1JI2A 5T3XH 4OJYA 5C97A 2ZKHH 5L4MA 1FNLA 2F54B 4RAHA 2CQAA 5GS1C 4X7FC 1V5JA 3NEXA 5IP7H 3QUYC 3M4OH 4L3CB 4Q2ZB 4WI3A 1MI5E 2FBJL 2X4NA 1CXIA 3RWGB 4NXKA 3JZYA 3HZYB 1I6VC 3GIVB 2I5LX 5DVPA 1DZBA 1UXMA 3PXJA 3ZW3A 2VLME 2IV8A 5CJQL 4WI4A 2A8VA 2YKLH 1UWEL 4NP4H 1NGYA 4Y88A 1IC7H 4GKJQ 2J5WA 3KPRB 4IU3B 4DR4Q 2XIDA 4DK6C 3QA3A 1XCXA 3MGAA 4CUCA 4YDJA 2H2SD 2ZUTA 3RJQB 1MFEH 4IBYA 4M9OA 3VG9C 1FGBD 4LCCC 2QDWA 4LRIA 3WO4B 4LPVA 1PBYA 4J6RL 2AJZA 2Z35A 2CO6B 4L5FE 4E5XG 4DUVA 5T1KD 2NNFA 1SOXA 3R8BA 4M1CD 1PLGH 4MMXB 1WEJL 4YBLB 1HXYA 5DS2A 1CTNA 1MIEL 4CL7A 2PW2A 1IBGH 1AS8A 2DQJH 1A4BA 3OL2A 4Y8DC 2BERA 1M42A 1CJYA 3SGJA 1IL8A 5DUMH 3W0WD 5B3SB 4AQ1A 3UZQB 5D4IA 4P4KB 3CU7A 4N8CH 3HOWG 1N18A 5F3HA 1I3VA 3IJSA 3SOBH 5I9QC 1TTAA 3O3DA 5DD5L 3CRLC 4MJ2A 3C6LD 1LM8V 5JQ6H 3M17A 1R3LA 3ERQA 4M5ZH 4M29A 4R0LA 5CEYA 3LS5H 1UKSA 1OP9A 2UZIL 4WEEA 3CSGA 4RNRA 3BZFB 3VXNA 3VTTA 2UXVA 1CG9A 1FI8C 4MCYA 5ELEA 1J0HA 1QX1A 2G75A 1AOZA 4KDTC 2F8VA 2KHAA 2NYYD 1OXUA 2J8UE 2HFEB 2ASBA 4Y1SA 2ZPKH 1AI1L 4HIHA 2P52A 5F70A 5BQ7A 2NX5A 1XMOQ 1AQHA 1ZHKA 5J8OA 4FF3A 1M9SA 2C9AA 1S7VB 4TKWA 2RHSB 1FO0A 1MPAL 1NGQL 4JI0L 4C59B 1JE5A 4FHKA 1U0QA 3B4NA 3BQUB 1OTCA 1KLFA 3WYRA 5HHXH 3BKCH 1AY1L 4Z1PA 2Y6SD 4LWCA 2XG5A 4HALA 4MMYA 4QNPF 3A5VA 2NTTA 5K9QI 3QUHA 5GJTH 1FR3A 1TPXC 3L81A 3BFOA 3MYJB 2ZOWA 4J8QA 5DJZA 5FHAL 4NCC1 5KAQG 4Y4FB 4ODXB 5K9JH 2N56A 1DDHB 4RFOL 5FKAC 2JSFA 3HOVH 4WWID 4NUJA 4HGWA 5AJ3Q 4JBKA 3CFIC 2CFMA 2FJGA 1AJ7L 3JWDH 4H1LB 3RUGF 1I4GA 1U3HB 2EH8L 1SBSH 3PF4A 2QHRL 2UZXB 4I0PC 5HY9B 3LZFL 3NFNA 2DEYX 2EDHA 2ENBA 2IJ0C 4JFXB 1OW0A 5I17A 5I1HL 1XNRL 4PVMA 4YDLC 1X3DA 3WFEH 4B9GA 1JV5B 1UEBA 1B4LA 2B2VA 4CKBA 4O2EA 1O9VA 1BXVA 3GSOA 3QCTL 1YY9D 1TZOA 4FXTA 2E56A 2A6IB 1W80A 1MJUL 2X38A 2ZOOA 3WTXA 4LBAA 3ZGIA 1NCVA 1JFHA 3FK3A 1N9WA 4MJID 1TVXA 3K6DA 5TQ0H 5CEXB 4POUB 2FL5B 3WOEA 4ABUA 2DUDA 4GW4B 1URIA 1JTPA 1S3RA 3I6SA 3TX4A 1L9OA 3GIZH 1Q1BA 1W8OA 2C3VB 5MEQA 4BDVB 3GXNA 3ZL2A 3WIHL 1OWWA 4MA1C 1NR2A 2X1XR 1D9KD 1M7XA 4JFOA 1AHKA 3BGAA 4NN7B 4YXLH 1A6WL 2YD3A 4KO6A 5I2XA 1ZGLA 4ZBJA 3RPIB 3U58A 3FCTA 5INDB 3O41B 4HJEA 2R83A 2ICWA 1E65A 4Z7WB 1CQVA 2WVTA 1NDGA 1KPVB 3X3FH 2B5IC 4PJAE 5JJKA 3DI2B 5DUBA 3ECUA 3ATDA 1PW3A 2BO0A 3EYSH 3VXQA 1Q86C 5I6MA 4P72A 4L8BA 1FIGL 4UDUB 3C08L 3RDJA 4BFOA 4HCIA 4PEEA 2OYPA 3DGGB 4E41E 2VXTH 1ID5I 2H2SC 3JT0A 3JWNE 4QGTA 2G9HD 2ZKYA 4N2HA 4K2LA 3A4AA 1OGAD 2C1PA 5DVNA 3OMGA 1MY5A 4JO8A 5F72S 2FX7L 2Y5EA 4KPHL 1SE2A 2BNQD 5D2NE 4CW1B 1E6JH 3C09B 3FCSB 3KE0A 2X4UA 3VNZA 4M1CC 3W3AA 3JYCA 2MFIA 4BSVB 3LWEA 3N42F 2QVTA 1XGUA 3EBAA 2AERT 4TVPL 3CTTA 3VWKD 3F8TA 1HNWQ 4M7JH 1KXQA 2EPBA 2DTML 4PJIA 2NR6D 1KLGA 4PJ7B 3HE6A 4PD4K 1Z5LB 5DEFA 3WL9B 1CFMA 4DP5X 4Z5RB 3OPOA 3B7UX 3C6LC 4O2DA 2NUTB 2WJ5A 1ACZA 5C08A 2WUBH 3ZJYC 5D2LE 2AJVH 3AXIA 4A66A 4IYKA 3CBJB 3BVUA 4BFRA 4PRBB 5IV2A 5IVOA 4A75A 3RL1A 1ACXA 2X1OA 5I8OH 2IH1A 2F3VA 1KXTB 1W8NA 2IGTA 3H56A 4JREB 5J7CC 3EH5B 4LUZA 3N40P 1TTUA 2NYYC 2XXGA 5KSUB 2F19H 2R2BA 3BDOA 3EO9L 4WEBH 3VMOA 1A3TA 5JHMA 3O45A 3RY4A 3ZDXE 5L4JA 1EV2E 4OT1L 1GGCL 1A7OH 2UV3A 2DQEL 2B8FA 1JPSH 3FQTB 1TTBA 1E27A 1IV8A 3O2WL 4GKLA 5GZND 1FSKB 3DX6B 3IWUA 3I9PA 1XQ4A 3PCYA 1V7MH 1VLXA 3RMHA 1S9VB 2DM7A 2JKTM 5E4EC 3TV8A 5BN3A 2OMYA 3CVCA 2Y6SC 4RH6A 12E8H 3EGDB 3NCWA 4WUUD 5DJCA 5ACLA 4UOJA 1Q9LA 2X70A 3BRFA 3PV0A 1FF5A 2PCYA 2B3GA 1ADQL 1PJWA 3DMMD 2A9DA 3WD5L 2DQFA 2AQPA 2M26A 4GSQA 2Y5TB 4M1GL 5IHUL 4G2AA 3QG6B 2GCYA 5MENE 3I4MG 4QHUB 3ZL4L 4IJ3B 5T1DL 2GJ6B 5HPMB 4HIJA 1CVRA 1UZ8A 2GIMA 2OCEA 4WFGE 3ROLB 5HYFA 4UYQA 5HGTA 1M1XB 4WWPA 1XGZA 1XMWA 2OSLA 4WK4B 3RZCB 1Z7TA 5DSCB 3GBMH 4MS6A 3GHBL 3BXNB 1EFXB 4JBMA 3RNKB 3U0TA 1N6VA 3KMDA 3ZT7A 4IEFB 4YFLI 3RKDD 3BYYB 4DR7Q 3I6LE 4L3EA 5ELOA 1DQLH 5C4JB 1QPKA 3PLYA 4ZNEE 5K1NA 1GUNA 2N8NA 3WWVA 2JA6H 4EQPA 2JK5A 2B63G 3CVBA 3D39B 4K55A 3A24A 3GSVB 1PAZA 3I3BA 1D6EB 1YY9C 1JNNL 2DLGA 3TF7C 4HD5A 1TQCC 4XPHH 3M7NA 4FJZA 2EXYD 1NCWH 4FNLH 4FQHA 5C44H 1VERA 4QOKE 3OLGA 4Z7IA 5IIEB 4U1GB 4M6OL 2MNWA 4NKMA 3SE8H 4DF9A 1W2KT 4TSBH 3ZOAA 4AC4A 5JPNC 3AUVA 3MFGA 4UQIM 3M4PA 5FLXL 2A5UA 4CSTA 5CUSH 4LMQD 5DQDL 4GI9A 3I55A 4XBPA 3S6CA 5EWIH 1S8DA 3MLWL 1AE3A 1CLYH 1D9KC 2AKRA 1NCAL 2JCCE 2VQ1A 2HVJB 3AW5A 4LVOB 4G7SB 4PJ8A 4ELME 1YI2A 3LH8A 4F7CA 3CZFA 1E8WA 2XWXA 3BAYA 4JPVH 5GRYA 2X05A 3FFCE 1NKOA 1D2BA 2DYPB 2DWDB 1Y0LB 2Z3FA 3FQXA 4PV8A 1IBZA 4JKMA 4ZI8A 1CE6A 2NY5C 5L88L 1GYCA 2XJKA 3PV6A 1HHJA 2RKSA 1OANA 4L4TD 3QIBA 1TSRA 1HSBA 3C8DA 5TGBB 1PSKH 4MKTA 2DQDH 4KI5F 5BV7C 5HI4D 5I6XB 4JDEB 2OM5A 1Z3GH 4JN1H 35C8H 2PMZA 3SKJL 2RHEA 1GO3E 3EOAB 3BVNA 4NQSA 3WFCL 1QWYA 1OT4A 4Y5VA 4AK1A 2ZCHL 2TAAA 5DVKA 3P11L 2IDQA 5IHZB 3GMLB 4JY6A 3I02A 3ESMA 4PVBA 4LLMA 4Y2OB 3VWKC 2HRHA 4NO2B 1ZVNA 5ADPL 3PO2B 3LH2L 1PZDA 1KPRA 4U6VH 1VQGA 1M7DB 5AOMA 4APXB 1I4QA 3AFLA 4F7KA 2NR6C 2PYEB 3WEXB 1FWXA 4HPOL 5AEAA 4NO3B 3GMMB 4D94A 4GAYB 1LP9A 5C2BL 1QRNE 4ZFOA 4DOHE 3WNJA 4D8PA 4XO8A 4EE2A 2APXA 3DMUA 2K8MA 2DRUA 1SF3A 3GYRA 4QEGA 1DSFH 1HC1A 3UP6A 4JI1Q 2ZUUA 2A74A 4K8IA 1UASA 4PJBE 3HKFA 2PYKA 1P6WA 3VDAA 2EQDA 3FT2B 1UGNA 3K80A 4NN5B 1LK2A 5CCKH 1RSFA 1QLRB 5F2FA 3B2DC 3V0EA 1WC7A 2EABA 3CFKB 4JFFE 3IF1B 3D87B 3KPSD 1B4JH 1KB9J 2DLIA 5IG7B 2D7OA 1F2LA 4ZDHA 2EH7H 3P73B 2ATAA 3SD2A 3VFSA 4X5WA 3O6KH 2NSQA 2WACA 4B08A 2VITB 2WNKA 3KWXA 1F58H 3L0OA 3M88A 4PHXA 4PIRF 3L3OB 4YHZL 2HRPH 5GZNC 4HUVA 3EO0A 3C2AL 4XVSH 5CR8A 3MLYH 5JO5B 5F7MC 3PNRB 4LDEB 1BXAA 4M43H 3MLZL 1NDTA 4P5MA 1R3IH 1WZ1H 5E1FA 2OQJA 3E2HC 4LARL 4PB0L 1MI5B 3VI3A 1L0YB 1VEOA 2X2UA 3DMMC 1YMMA 3EFXD 2CIIA 4YVNA 4XRCA 1ZA3A 2FNWA 3O8XB 4GNXB 4B3RL 1DCEA 1GMEA 4JQIA 3TURA 5GGSY 5D7IF 4M48H 4L9LB 3EIFA 2F0VA 1I3GH 1GZPA 3IRZA 3BN9D 3EOTH 2PR4H 5M3MH 1PTOF 1UURA 3HZMB 1KTRL 4ILDA 2FEEI 3MV8D 2FR4A 3B34A 3H7BA 1OARH 1ACYH 5DRNA 4AQZA 1A3RH 2YAMA 1L9QA 1YQVL 4JFWA 2WO4A 1K4DB 4P2QE 5J3BA 3RKDC 4DN4H 1KB5H 4BA2I 1U2YA 4NGHL 3RILA 4RGOS 2UZYA 3ZT6A 4R2GD 4BCZA 2W07A 1XSOA 1VQDA 1MWAB 1JXJA 4JPKH 1WBZA 5MP6L 4XHJD 3UG5A 2XV6B 4IBQA 3CAFA 4MAZA 1XCQB 3I9AA 1D7FA 4TQUS 3HBGA 4QTHA 4RKLA 5CFAA 5I0XA 3ZRCC 2PWEA 3AM8C 1I8MA 1W6KA 1Y1WG 4FQLH 1V3KA 4PD4J 4XI5D 5T1LA 4NNPH 1VQHA 5CN1A 2YD5A 2LR4A 3DUSB 1IRAY 3ZKSD 1LEKA 4ZUUA 4X0KB 4NZUL 1YEZA 2FGWL 3CFUA 1FGVH 3HOZB 1EGJH 4WAFA 2WLLB 3V5DB 3PL6D 5DK0B 4LAJH 1J5DA 1IU1A 4TPRH 4R7VA 3A22A 3WTYA 5DJ0A 1IM9D 2J8UB 3CFBA 1RZ7L 1UTDA 3N44F 4RGMB 4HPHA 5IGCA 3KLHD 1FNVA 2I9LB 3TBSA 2G2RA 1NBZB 4K71C 2CCVA 4JM4L 4KO9A 4YSAA 4U7KA 2RGSA 2VDPB 3EGSA 2HLFD 4MAYD 2VE6B 4R4BA 3KLAB 5FW6A 2R1XA 5HHME 5HYEA 3P3RA 4TNVK 1GOHA 5D1QB 4TNEA 4IHOB 5E2VH 3GHEL 4JRLA 4PREA 3L4CA 1OAUH 5AAMC 2Y24A 4R4NC 5AYQA 1E5BA 4PTUA 4B3VA 4PGBB 1ESOA 2YPVL 2NLJB 1P4UA 2HFFA 5AW0B 2VLJE 1NGPH 3WFHA 1GMIA 2PWFA 3NJKA 2W91A 1VKXB 2IADA 4G42B 2XPYA 2J2ZB 3VXTB 2IY5B 1BQKA 3CMOH 1A6AB 4XP4H 1S7XB 1EY7A 1AFVL 4WNSA 1B88A 2J72A 2OBGA 3RWJB 1DM0B 2FJHB 4IBZA 3FU5A 1VAHA 2XN1A 2E27L 1A7RL 3HW7A 3F85A 3K2KA 4TSCH 4PJGF 2VW4A 5FO9B 4FL4B 1DBJH 1FQ9C 2B2UA 3D25A 5E0QA 1K3RA 1M6UA 1WAAF 1JZJA 3NN8B 1IBML 2FDBP 5AOZA 5FM8A 3ZHDA 3DNKA 3W11D 4N87A 4DP6X 2XLLA 4PG3A 1J0IA 1QFWM 1J9TA 3UTZA 4KWUA 1T7XA 4WFHD 5SWSD 4XMLH 4NXMQ 3TA3A 4CILA 3TBYA 2IBZY 3BYTA 4OGYH 2EDJA 1FGNL 4QRTB 4FQJL 1ZT4B 2VM9A 1CGSH 1QVCA 2H41A 3CJJA 5CEZL 1PLCA 3EYFB 2V17H 5F3BA 1TITA 4FERA 4FJYA 4FZEH 4PCKA 4B97A 3WS6C 3GZQA 3TEXA 3N1QC 4KY2A 2PYFB 1W9XA 4UM9D 3MRIA 3HNSH 4JRWA 1CQYA 4MXQD 2NNAA 3RZOH 3PV7A 3FKUS 3FT4A 3QJXA 4JHZA 5D70H 2WAQG 2IAMA 2FO8A 4DNLA 7CGTA 5LXGH 4OV5A 2XV0A 4NCDA 4X65L 2Q8BL 3SY0B 2K1MA 4D9QE 2B2WC 1BVKB 4E9QA 2X5PA 3Q6GL 4PJAB 5FA3B 4P07A 1FLRH 2ZUYA 5FYJE 4UINH 5FA4A 4AMKH 3KWUA 2PABA 2Y4SA 2TSBA 4H5SA 1S5DD 1I7TA 3VO0A 4JW0A 3LDBC 4TQEL 4G6FD 4GYBA 1PG7W 5EHFA 5C5LA 2DLEA 2QEXA 2JIXA 2OK0L 3V0JA 3RWEA 5HDBE 3FTWA 1X3QA 2DQTH 4JFQA 2GJZA 2JKJA 3QJVB 1UWYA 4JI7L 3I9IA 3H9YA 3MA7B 3TCXA 4HUNB 5AVVB 4DPBX 4QYOA 5JDSA 4XHJC 1RK0B 1P2CB 2XWRA 1JZDC 1N2RA 1P1VA 3S24A 3IL8A 4HJSA 4HJ8A 1CFSA 1N5AB 4UWQB 3H94A 3EBHA 1SYFA 1PFMA 4GXUM 4OM1H 2XRQD 2BHZA 2QQKL 3HLKA 1MCKA 4Y7NB 4ANUA 4XI5C 3UJJL 4DKEL 1XEUA 1XZ0A 2EJ1A 1MIUA 2GTWB 2OMXB 2JWYA 3AS3A 1I8AA 3B7RL 3DWQA 3FB7A 4GI6A 3WV0A 1KXQE 4IUTA 2B8OT 4ZNCD 2B2XL 4PJIE 4UUJB 1TZGH 3BVDB 4WFED 4GOPB 4GRLD 1WV7T 4XPBH 5FKPA 3F2CA 1EYCA 1TO5A 4KQ3L 4L5FL 2JI3A 4ZFFB 3JVGC 1BWWA 4HULB 1YEEH 4R4CA 1O80A 4ZUSB 4DGUA 1OT1A 2FIKA 5C08E 2EO1A 1LK3H 5CV5A 3DRTB 1A9EA 1D6VH 2R15A 3KGTA 3PL6C 4GAJH 1JZ3A 5AVZB 1FG2A 1CDHA 1X5YA 2VMFA 1IZ6A 2RA4A 4HH9B 3ZDXB 4E42B 2QVIA 4FNQA 5B3JE 5AKTA 4PRHD 5IB4B 2HLFC 4MAYC 4DV0L 2AABL 1EZ8A 4MRBA 4ODWB 4Q6IB 3NIDE 4Q74A 3TRZA 1PDKB 5JHLA 4XHQA 3T0BA 1KCSL 3DGDA 5DJ6B 4XC1L 1KIUB 3X2QB 5BPPA 3BVGA 1BZDA 4MBOA 1MJEA 2UUCQ 5DURB 4ORGA 5DMKA 3SJVA 4WHTB 2CH8A 2QR0A 4H44C 2OEOA 4G43B 1CM9A 4QHMB 3B56A 4ES9A 2A1WH 1S9KC 1U8NB 2BVTA 5I73C 4LFCQ 2LOEA 5BOJA 3FTXA 5F7DA 5EZJA 2VDPL 1VHPA 3MAWA 3VXSD 5F93C 1ZT7A 3MCYA 3R1GL 1D5IH 1IM3B 2VH5H 2DWXA 2K4WA 4Y7MA 5LN4A 2A9NH 2GHWB 2FXQA 1JVKA 1J5EQ 1TY2A 3M4QA 3HFZB 3PU7A 4K3DL 2HCIA 1UUNA 3BEWA 4C56D 4G71B 1HKLH 3WNNA 4NENA 3R4DA 4B9ZA 5EBCA 3HOXB 1XL6A 3K81A 2EYTA 3QJTB 3MGOA 4I0KA 3NFSH 4YHPA 1FJGL 3SZKC 4Y19A 3W11C 4U3SB 5J13C 5I28A 5JIPA 7PCYA 2GBVA 2F0WA 2YAPA 4OLVL 4FQIL 3ULUE 5HHOD 4FRWA 3QRFM 1HINH 3SY6A 3VXOB 3WSQL 2Q2TA 5K59F 1U93B 2BY3A 4A3KG 1IC5H 3NDZE 4L3EE 5HJ3A 1SOQA 1GGUA 4HUWB 4JFPA 2I07A 5D93C 2EQSA 5KSAB 3FOMA 1ZVSB 2DD8L 4MWFB 4I3SL 1N12A 4FI6A 3MUY1 3K2IA 4P2OB 4P9HH 1YN6A 3AY4A 3THML 3HPJB 4FP5D 1XX9C 3LN4B 3OZ9H 3ZQXA 3FQUA 1KDBA 3WDHA 1STAA 2Y69B 2R0LL 3VUAA 1HZLA 2CH4W 1BAWA 2JCCB 4MXQC 5TD4A 4ELMB 1DQJB 3FAWA 5D55A 3CC5B 1T5WA 3VD3A 2AQTA 2P5WE 2G3XA 1HR0W 3QFDA 4HHGA 4KTGA 2IDFA 4H8VA 2WNGA 3FFCB 3W1ZA 3FH7A 4M6NH 2H1EA 3LAFA 4JDZA 4X4KA 4GKZA 3VE0A 4LW1A 1L2FA 2PP8A 4TUOA 1NMAH 3U30C 1U8KA 2XFGB 1S72A 4RHRA 6FABH 3WXVL 5F6HI 1OWRM 2VQFQ 2R2HB 1VCBC 4ZUWB 3MRKA 4PGEA 4RA0C 3FRPA 4EPSA 2X7LA 2E9IA 3B3BA 3F3HA 2NZOA 5C4XG 3HI6H 2Z31B 3T0XA 3RWIB 4DGYH 2Y0SG 5ESAA 3UX9B 1BF5A 3QS3A 2ISDA 1BW8A 2G4EA 2EDEA 3N91A 1WCMG 1U8PB 5CBEA 3ZYJA 1FAIL 2BSDA 1A47A 4O2FB 1RJTA 3CXFA 4O51B 5B8CB 3H3BC 3N6RA 2PMZE 4YHLH 4QRPB 3HG3A 4HIEA 4XMTA 4EUPH 1LWRA 1QZNA 5CNHA 3U9SA 1RXLA 2XN9D 4AK2A 5D7JA 1WOCA 1BZOA 3FOLB 4DOHB 5C5MA 1F8TL 3RPKA 3HS0C 4C3JH 1T1ZA 4JO4L 3VFRA 4HX1A 1X5IA 4FYDA 1QA9A 1LDPL 2J44A 4IBTA 4DFHA 3KXFA 4GRLC 5FUCC 4TTDD 4C57C 3WS3A 4PJBB 3Q2NA 3P69A 4AQYQ 4EZLA 1LP9E 4MDIA 4PWFA 1JGLH 3WKPA 4CRPA 3IDGB 2XXCB 3EJUA 1G9MC 1OAQL 1JJUA 3SVMA 2WXOA 1GGBH 4JFFB 3O6LL 2R7ZB 4L5QA 4HIQA 1THCA 1YJDL 2IPTL 4ZG1A 4S2SB 3LX0A 4DGIH 4U1MB 5EU4A 1WTGT 4WW2A 5DJ2B 3I70A 1CD1B 1EAPA 3QI9A 1BZ9A 4MCZB 4GKKQ 1H0DB 3DTUB 2A77H 1F1DA 3IDNA 1HRJA 2VISA 3BWUF 4IMLB 4ZK9B 1BBDL 1RZJL 4OZGF 4JDTL 2VDRB 2KCCA 5L9DH 3BWZA 4OWTB 4MAUH 4OUUB 1IL1B 1EIFA 3FMGL 3OKKB 4W6XB 3IMSA 3ZLQC 1A6UH 3L8QA 1J05A 1Z1WA 5C3EB 3T2NL 3BSZH 3X14A 4G7YH 2X6BA 4KJPD 5HSFA 5ISRA 4X6BA 4X2UA 4HS6A 3LV3A 1OEZW 3MCKB 1MY7A 1WBXA 2X4NB 5DLML 3ZVVA 2CCWA 5I6NA 4YDKH 4ERSL 2JA6G 2N1KA 4JK0D 3PUXA 1YMME 4BFFA 1ACCA 2BJMH 3B3IA 4XP9H 1XF5A 5DQ9B 1QLEL 3A6OA 4RHSA 3GLEA 3MU3A 4HC1L 3F64A 3RE0A 4C56C 1UVQA 5IP9G 4HEPG 3S7GA 1JN6A 4LSQL 5FYJU 4PJHA 3VI3F 1U8QA 1KTKA 2EEDA 3KYNA 4MJHA 4FFZH 3MPCA 5C44G 3G6JF 3H6JA 4P2QB 3F7RA 1RJLA 2J6EH 3QA3B 4LL1A 1MAML 3RDTD 3W57A 1P6AB 4YDJB 4JFDD 2OV0A 3N5AA 4NRXA 5DJXB 2YLHA 2OXGA 3LX9A 1J48A 3X11A 4ZAKA 2AJZB 1F13A 4XP1L 2PO6D 5D8JH 3TWCH 1G7LA 4GQQA 3TPUB 3R8BB 3P3UA 3ULJA 1Z9LA 1U30A 3WIIL 2LLLA 5IFHH 1HXYB 2ID5A 1T3FA 1NANI 1P7QD 3K5SA 1RUKL 5D96B 4FADA 5KW9L 1EUJA 4UT6A 3D9AL 2FJ2A 1QD0A 2O5ZL 2VZOA 5ITBL 2H1LM 4QHNA 5FXCH 5T3ZL 3V52H 4YHYC 1RERA 1E4KA 1GS7A 1R5IB 2W1NA 4FQ2H 4NZTH 4U0QB 3CIAA 3KW8A 2QZ5A 5F3HB 3IJSB 3O3DB 1MVYA 4AQEA 5L2KE 4U4BA 1P6FA 2P4AB 3M17B 2V33A 4HF5L 2F0EA 2ADFH 1UT2A 4R0LB 5CEYB 3CZKA 1SMYD 4N8VA 1CS6A 1MFNA 4RNRB 5J3HD 1SE8A 4R4OA 3VXNB 3CCEA 1T0MA 5HDWA 3BE1L 5A2IH 1CG9B 4MCYB 4OLWH 1A4JA 2FTAA 4BRJA 2G75B 1QUQA 1ONQA 5HHMB 4JO2H 2C1OA 5T3XD 4M8VA 5KVGL 4HIHB 5D6DA 5BQ7B 2NT0A 2GEEA 4MRCA 1RUML 1U6AL 3NRFA 4AUYA 2BP0A 1ZHKB 1YBYA 2QDVA 4G6KL 3ZKXC 2R8SH 1EEYA 1KIPA 1DVFD 4U0RC 1RZGA 4KZCA 4FOMA 4ALAL 2PW7A 4GMSH 5JYLA 2X2IA 3IMUA 1IYJB 1KLFB 3DHPA 3BEVB 2FD6H 1AR1C 2VLJB 3R19A 4F92B 5LJYH 4CJ2C 2XG5B 1GSMA 4MMYB 1TJIL 3IU4H 5CD5D 5JJLA 4LPTA 5H94A 4G4KA 1KC8C 1PH5A 3MRLA 5DJZB 3SD5A 4NM8L 5BZZA 1UD2A 4ZPVA 4WF7A 1K28A 5F3FA 5IHWA 2QA4A 2XN9C 1PL3A 4IBVA 3WN5A 4KN4C 3IN0A 3H3PL 3QJRB 3S2HB 4QXGL 4YHMH 2H32A 1UZ6F 2PXYA 2YD2A 4H88L 4J39A 4NUJB 4HGWB 5BRQA 3NZHL 5LNDA 4Y9GA 3D4GA 2FJGB 4LOEA 2QW7A 4R4TA 1WZMA 1BZQK 4Z7OF 1XSJA 2BE5D 4EZJA 1JJCB 1JV2A 4ODBD 1WH0A 2B7DT 2NCMA 4NPYA 1FVDA 4L3FA 3NFNB 5JXEA 3D52A 5M5XB 3IBEA 1OD7A 4KRNA 5I17B 5ID0A 1XB3A 3SR1A 4FEIA 2NY2D 1P9MC 4N5ED 1KJVB 3ZDYF 2RD0A 3BUYA 2Q20A 1BIIB 1AO7E 4KQ0A 2IF7A 1XCTA 2ZKXA 1J0YA 4ULLA 4O2EB 4HFUH 3HNTL 2VDMH 1OSEA 1CFVH 3GSOB 3D0FA 4DP2X 1KLUD 5FHBH 3VYUA 2P5PA 4YR6A 4GG6F 4Z8FH 2UU9L 1T21A 5HHNA 5A2QE 1OTTD 3G08A 1TJXA 1TOXA 2FCBA 3NUCA 3ZT5A 5K9QG 3F7QA 2UUAL 1YYLL 4MNQD 2E2IB 5CJQH 4OBSA 5MEQB 1A6TA 3FN0L 1UWEH 1QNUA 4EQNA 1Z5YD 4JFOB 4K0KL 4XCEA 3SBWC 1RU9L 1ZGLB 5GS0L 2APBA 3S3JA 3FCTB 3H0GH 1O5DT 4L4JA 1U58A 5H2BB 2JK8A 1SEBB 1I1AA 3HN3A 1JZFA 4IGBD 2D73A 5LHY1 1NDGB 2FT6A 2LQRA 4TNFA 1G4MA 1TWGH 4OLUL 5DUBB 3T1YQ 1IGML 4KV5F 3GSNH 3ZDZE 4AGNA 4J6RH 3VXQB 5JHDA 4L8BB 1Z32X 4HSVA 1NTGA 4MJ5A 2PW1A 3D3VE 3RDTC 3WJJC 1WEJH 5HDBB 3EDKA 1MIEH 4AKQA 3S2CA 3VI4A 3ABMB 2EUZA 4DN4M 3DWAA 3ENEA 3RN5A 3M86A 1E6OL 3DC0A 4HT1L 2AK1L 1AIZA 3C5ZB 1ZANL 3D2UB 2PO6C 4UQCA 5DHVH 4C4KO 2WZ6A 1DQML 1H6TA 4LCIL 1ZXQA 3RIAK 1AXSA 3PAYA 4XOCA 3OSKA 1XGUB 1NH6A 4X64Q 4WWKD 1WIUA 3QUZA 4K8RD 4PJIB 4PJ9D 5FLMH 1KLGB 4Z7AA 4G59C 4FEMA 4NJAL 1Y1VB 3HE6B 5I19L 3QJFB 1I9IL 3UJIH 4O42A 3PP4L 4NS0A 5IF0A 3DOHA 5AWNH 4U6HA 3O3UN 3DX3A 4HK0B 5DDHA 4G7RB 4C83A 1HJCA 5CV6A 3OBAA 2Y7LA 4X7CC 4KY7A 2A69D 5LUMA 1MNNA 5C08B 2FVNA 4KMTH 2YGPA 1KGUA 5EORL 3EF4A 3IAQA 3OKLB 5J3HC 3TT3L 2BP3A 15C8L 4OD2B 3RL1B 3M9BA 1UXSA 2IH1B 4U2ZA 1MPAH 4X8JB 4M7ZC 1NGQH 2EACA 1S9WA 1QZHA 2X3CA 3MBED 3V4PB 3NELA 2XETA 3NIDB 3RYMA 1A1NA 1N64L 1Q8MA 2A4EA 2IH3B 3AXHA 3K5NA 2CXGA 1PZBA 3O45B 4TVAB 1I85A 1AY1H 2X4TA 3KEDA 3HBPA 4PRDB 4RLDA 3RTQB 5A3IC 3GBLA 3SBQA 3QJOA 4Y89A 3N1MC 3RVVD 1DVFC 4BXXH 1E27B 2R27A 5FYKL 1KXLA 4FMFA 4GQ9L 2LGNA 2GIYA 2YAFA 3KAAA 4KOBA 5IQ9A 2AXFB 2HT3C 1HE8A 1R3HA 2OMYB 3EG9A 1EDHA 4XP6L 5DJCB 5KVDH 5CD5C 5HJBA 1Q9LB 2X70B 4LPXA 2GC4C 4JI3Q 1GC1L 1K8MA 3TN2A 3GSRA 3ATEA 4M7LL 4AYSA 2DQFB 2EH8H 2QHRH 1OAXL 2Z8RA 3FB5A 3JV5A 3FKIG 3EHBD 2GCYB 1H9SA 3OKOA 1AP0A 3ECBA 1FV1B 5I1HH 4LSDA 4IDJH 3GJFH 1EU4A 1RY7B 5T33H 4HIJB 1FO0L 1YG9A 1MHHB 1N34L 5CIPB 3RFZC 4BY7H 2BE5C 5ALBH 2CALA 3QCTH 3U0TB 2ZT9C 1VCAA 1CZWA 2VB3X 4MDJB 1EY4A 2BY1A 2FX8L 3ESVF 1MHPL 3HAEG 5F8RC 2WTPA 4A3JB 2NY2C 3BZDA 1TNMA 4N5EC 3S17B 4L3EB 2A4CA 3CQZB 3PABA 3SE0A 2JK5B 5AVXB 5CJBA 1WJ3A 3V6FA 4UP8A 3MRDA 2GKIA 4MXVF 4CDCC 4Q7DA 5EULV 3VFVA 3GTKH 1N0LA 1EHXA 1C7SA 1CICD 1G6RA 1IKLA 2DI7A 2BHYA 3T4YA 4PLOB 2C9RA 3B43A 3FH8A 1F56A 3QZWG 4FABL 5A40E 3SDXA 2XSCA 3D7PA 4FQHB 5IWLA 1P4IL 2HFGL 4NKMB 2RCFA 1OTTC 4AT6A 3VSUA 2VUMG 1A6WH 3KBPA 1KTLA 3MFGB 4CMHB 4POGA 1WZKA 2CBTA 2AJXL 4L0PB 1VFAA 5HVHC 1B0RA 4XBPB 1RI8A 5LGJA 1KCLA 2AUKA 1S8DB 3Q48A 2VQ1B 1I4HA 4F7CB 1IBLQ 1FIGH 2MPAL 4UP7A 4PJ8B 2C34A 1DANU 3C08H 3CZFB 5EU5A 4YL9A 5LAXA 5C07E 1NGWB 1ASZA 1GY1A 1IE5A 4HZ1A 1YEFH 1AE2A 4IGBC 5FUOL 3MRHA 3G9AB 2CWPA 2MMXA 4KU1A 1CE6B 4KPHH 4IJLA 2EIZA 2GBTA 5GRJL 4UU9A 1HHJB 4YHHL 2D4FA 4JFZL 5BUPA 2HWZL 3QIBB 3CUPA 5KSBA 3CCMA 2IG2H 1GPOL 2IWKA 3BP5B 3CPLB 3L2LA 2F0SA 3QHFL 4WV1A 5HHVL 5B38G 1VFMA 3MV7D 4OCYH 4HCRA 2QPEB 3S16B 1E9QA 5C0AD 4M5TA 5EOTA 2DTMH 2PMZB 3BPNB 5SV3A 1HCYA 4NQSB 4B53A 1ZEAH 2E2JB 4GT0A 4Y5VB 2ARJQ 3IVKA 4WKXA 2OTLA 1EEZB 1XHHA 3MXNA 2J57A 3STBC 1JPFB 1UM6L 3JWDC 3I02B 4HKJA 1WUZA 3N43F 4JY6B 4C3IB 2XUWA 4AYBA 2ZXCA 2MCMA 2F0PA 4K8RC 3AEVA 2D0OA 3KL5A 4PJ9C 1SRUA 1TETL 5EB9A 5KZCD 5FM5M 1ODAA 1QSVA 4NKQB 4DNRB 1LP9B 5JOFB 4ZFOB 1G6VK 4RQQB 4D8PB 1GJXA 4Y0GA 2ADJA 2A69C 3F2UA 1WWCA 3NPZB 3HS8A 2XV3A 3EO9H 4R7NA 1DJXA 5HDOA 3WOFA 1NANH 1WFOA 4B96A 1F6LL 4OT1H 1RL2A 1GGCH 2VZAA 2PW5A 1LK2B 2HPOA 3REVB 2YAOA 3A54A 4IKJA 3D4DA 1WC7B 1N3NA 3MBEC 1N7MH 4YVUA 3VGAB 4G5ZL 2B1AL 3PIO3 1WUNT 2YPKB 3LD8C 4CDGC 4MSWA 3X1GA 2VQEL 3UO8B 3U0PA 4K7PL 3PWVA 3VFSB 4DV3L 5AVYB 4L6TB 4G7ZC 1TS3A 1IBKQ 4NUGL 5D9SA 4MJJA 1KYOK 1XWEA 3W1BA 4LVHC 3OB8A 4HUVB 3CH1A 1L9SA 3EFDL 1D5RA 3APFA 3CCLA 4BBRB 1KCRL 2ZONA 4M1GH 4JANA 5IHUH 5IFJA 1SNPA 4WW2F 1DOKA 2L7EA 3FO1A 5T1DH 1S7UA 4P5MB 4CJ1A 2OQJB 1N59A 1YEGL 2EJFC 3CK0H 1LTID 5IMOB 2VABA 4EI0A 1YMMB 2ZICA 4LKCA 4NQCE 3EHBC 4XRCB 1ZA3B 2YEZA 4YE4L 5J57B 2DKUA 1GAFH 3F7PC 3TBVA 1HA5A 5EMYA 1WTVA 2QSQA 5EUOE 4OLEA 5AW2B 2JA5B 4RGND 1GZPB 4BQCA 2Y07L 3J80c 1PRTD 2E75C 1L7IL 1JMCA 3NA9L 3LIUA 2DQCL 1VQFA 4YO0A 2QDLA 2VGLM 2FR4B 3H7BB 5DRNB 4AGOA 4JFUA 1JNNH 3HKSA 1KTKE 3DKHA 3HG5A 5DVLA 4ZQKA 4NWUH 3DJRA 4ODTL 2RSNA 2CUHA 4ENED 1AGEA 1UE6A 4H1LH 5CMDA 4LHQB 4CHTB 1AGDB 2E5LQ 1RJZB 3LZLA 5E6ZA 2C9XA 5NUCA 1XR8A 4PJHF 5DS1A 2CLVA 2JA8B 4NC0B 1N32L 1JJGA 1CICC 1RZFL 1FRGL 3LKOA 4CNIA 4GI8A 3ECQA 3MLWH 5FGSA 1PZAA 4W9HC 2F7PA 5IESH 1I8MB 3A5ZB 1OGPA 4A3GB 2RH0A 5T1LB 1NC4D 3MLUH 3UL4A 2HMID 2QSCL 3RY6A 1CDUA 5E8NA 3VB9A 2AVFA 1LEKB 2IMMA 2NVTB 1DLFH 4PJDA 5FFLA 2EE1A 4J3OF 1C08A 5B1AB 1WFTA 5L88H 3HG1A 4KJNA 1PFCA 4PRAA 5GQOA 1OCOB 1LTTD 1UH4A 4LOVA 2KENA 3GJFK 3U1QA 2R7DA 4OIAA 5DJ0B 4QXTA 2EDOA 3CFBB 1F4AA 3FF8A 4JI4Q 4UDTA 3TBSB 3GMQA 5FLUA 1A4CA 5GRVL 4MYPA 4Y2LA 4W4OC 1JYWA 4JKPL 4EUPG 4UTBH 4R4BB 2R1XB 4JL2A 3RFRA 2ENPA 2JE8A 4C3JG 2QFRA 3NBNA 2CO7A 2BDNA 4P23A 1CUKA 1UH3A 5ADPH 2YGVA 4GP5B 2IX3A 3V95A 4LSSL 3QPQD 2MNAA 4K7PY 5DQJA 2C4FT 1J0KA 5D4JA 5D6CA 3FTYA 4PTUB 2V8LA 4AENA 2IQAA 1TZAA 5C2BH 2Q1EA 3OAWA 2HFFB 4OF3A 3TZDA 5GSRB 3ZMNA 1VQ7A 4LSVH 1D5ZC 3CN4A 1CSPA 4JM0A 1G1KA 2IADB 2ZD0A 4X4ZA 1PYWD 4L0ZA 5KYIA 4HAGA 2GUYA 5FYLE 1A65A 2XDHA 5IHHA 2BZDA 2AK4D 3QUGA 4OJDH 5T1JA 1HU8A 3DECA 4Z7VA 2X9ZA 3TP5A 2CZNA 4LF5L 3QJUB 4GXVL 2WOYA 4Y9CA 2F0KA 3D25B 3G9VA 1HL4A 3RU8L 4QDGA 3AQZA 3QWNA 1FFPA 2D9UA 2YR3A 3WXWH 2LXKA 2Y7SA 3VFNA 3KBEA 4WJ3M 4IRSA 3GB7B 4XQNA 1AO7B 4N2BA 3U4EA 3CW2C 5F1SA 2F53D 1G87A 4YHZH 1KSRA 3UTZB 4KO5A 1HQRA 3TA3B 2JEBI 5KSVB 2BRQA 2Y06L 1FAKT 3MLZH 2XGTA 1I50B 3BYTB 1N36Q 5HDRA 4PLJD 4PB0H 5DM63 4Z23A 3V4UH 3CKIB 2CRZA 2EIMB 5C0RL 3PNWA 2XCMC 2BRRH 1ZTXH 3W5NA 1QZGA 3QJHB 4B5ZA 1T1WA 1M4VA 1DJHA 2VRKA 3MRIB 1U9RA 5EBLA 5IWAL 2NNAB 4YHIA 1GXEA 4HIIA 2IAMB 4ADGA 1QBBA 4V33A 2MJ8A 1NJ9A 1PZSA 3HFFA 3CCUA 4DJMA 5BS0E 3NT0A 2IWFA 2ZCLH 3BWSA 4AYGA 5KSBF 4PG9B 4RGNC 1DGSA 3TBTA 4ODSL 2NUPA 5GXBB 4W6WB 1PRTC 1NJIC 4NGHH 1CDYA 3ARGB 2H8PA 4TQHA 3D3VB 5FA4B 3TP4A 1ZLVH 1RJCA 4RZKA 1J1PL 1B53A 4N2AA 3KCWA 4G8GD 4H5SB 1I7TB 5MP6H 4KKNA 1T2JA 3BDBA 3NEMA 1SOKA 2DI9A 3C6EA 3VWJD 2JIXB 1D1IA 5I5JA 4ENEC 1I4FA 1YUHA 4UT9H 4EO5A 1KRSA 1TEFA 4W68A 3RWEB 1FNWA 5I1LA 3OR6A 4JFQB 5B39G 2E4FA 1J8HE 3UTSD 4BCYA 1HSAA 4QYOB 5JDSB 2YD9A 4JQIL 1N2RB 2BK8A 4IRJD 1CFSB 3ZHKA 2LHAA 3PO3B 3VDYA 4NZUH 2FGWH 5C4JH 3HZVA 5ELCA 3RX9A 2AJ3B 5CLTA 3SDDC 3VI4F 2HMIC 4MB3A 1XZ0B 3LQAL 1T5XA 1JWUB 4HUXA 3JWOH 2SODB 5LG1A 4H8PA 1CYWA 5DD1H 1KYDA 1RZ7H 3L9AX 1U8MA 4BKTC 2PPAA 1I7RA 3W9DA 1QBLL 1MJ7L 5FKPB 1ZSHA 4JM4H 3VR3A 5DA4A 1KIXA 1NL0L 5TDPA 3L9YA 4ABQA 3WNOA 4GLXA 4ZZKA 1MCPH 1UATA 2FIKB 1LO2L 3MCLH 5ELIA 1A9EB 5JHAA 4J28A 3KPPB 1FG2B 3QDJE 4OGZA 1SDDA 2NY6D 1AGFA 3AT8A 1YNXA 1NFAA 1PZCA 4KJQD 1NAKH 4LCCA 3KM1A 2QLYA 2YPVH 5I6KA 4OQTA 2Z9HA 1E22A 3H3VC 4DN3L 1SBBB 4E9YA 1T7YA 4FQPA 1BSIA 1QEWA 4PU2A 4CN1A 4OX9L 2C4XA 4N2DA 4X5PA 2WZPD 4LCVA 4Y1TA 3UP1A 2YHGA 3H4HA 3QPQC 2H4OA 4DSYA 1RK1A 4IDLA 3UPCA 1J0JA 4ORGB 4N4YB 1AFVH 2KQ3A 1ULVA 4OONA 1KCUL 2EY2A 2YZ8A 1GOZA 1UT1A 3GLAA 3B83A 1CYGA 1OCZB 1VQIA 2P24B 4B0MM 1HNFA 3G5VA 4HJTA 4UZUA 1S9YA 2IAAC 4LGSB 4UNVA 4HOZA 3JTTA 3F04A 1A6XA 5BVPH 1JRHL 1VQEA 2X12A 5IB1B 1X65A 1CCZA 1UOWA 4M7KL 4A7GA 2GVYA 5AKVA 3QQ9D 5GGTH 4KDTA 3BEWB 3GTTA 3PHAA 1K8GA 3PO2H 2CKBA 2XZCL 3GGWA 4TUJB 4UT7L 2EYTB 4LLDA 3MGOB 4N2KA 4DAVA 4ZOEA 5ABAA 2H6PA 1B44D 4A4IA 3G04B 4GRWE 1EJ6A 3BVTA 4RISL 2X4QA 1VFOA 3SYAA 3PYCA 5IY5B 5CEZH 1HWWA 1A9BA 2F4VQ 3KR3H 2CRIA 4QWWD 3VCLA 4DNTB 4MYWB 3SPIA 1RZQA 1D5XC 2Y7QA 4PJFA 5HJ3B 3OX8A 2B3IA 1F6AB 2Y9RT 2AMUA 3NJJA 4JFPB 1LTLA 4DK1A 3FOMB 4ODUA 3U36A 4LEXL 3ZYYX 3H0GG 4QT5A 1HUMA 1BQHA 1YN6B 3JWNC 4FXGA 1E9OB 5K36G 3QOLA 1FNSL 4LPUA 4AVJA 1SXCA 3FQUB 3LKNA 5FKAA 5B7FA 4OWWB 3NA4A 3QQ4A 3KYKL 3QFJA 1DVQA 1KBWA 4W1TA 1JNHB 2YD8A 4XN1A 2K7PA 4IQZA 3WIFB 4E6IA 1KBPA 5C07B 4AQOA 3QFDB 4I0PA 3PGFH 3SDXF 4GXFA 1HZAA 3AWGA 1P69B 3VTAA 4JDZB 4BINA 3VE0B 1ASOA 2GK2A 4JG1L 5LCVL 3GXUB 3H53A 4U1LA 4EN3D 4TUOB 1U8KB 1DQDH 2YRZA 1XWVA 2FNBA 1IBYA 4GKJL 1G7MB 4I0CC 4DR4L 4PGEB 1XD1A 3MRKB 2W88A 4DV6Q 3FRPB 1T89A 2YMTA 2X7LB 5GJSH 3H9SE 1QHOA 3N43B 3MUJA 5DHYA 1S78D 1Q12A 2EDBA 5E9AA 1URZA 1SYCA 3VWJC 1Z2KA 4NC1C 2JA7B 4N2LA 2QQKH 1ZGLP 2ESVD 3AB0B 3O4LA 1ZE3H 4ZW6A 1YNLL 3UJJH 2MPMA 4NQCB 5CBEB 1DQVA 4G6MH 2RDHA 4PVNA 1XF3A 2ZCZA 1X9NA 3GO5A 1MSHA 4HIEB 1EX0A 2DNCA 2I60L 4IRJC 2OW6A 2YAQA 2HUEA 5IBUG 4DEPB 3TESA 4L5FH 1J0ZA 3QUXD 1E24A 3FRUA 4JFYA 5E6RB 4F2MA 1PZ3A 1JTOA 2BVQA 1JCKA 1MWAH 2VKWA 5DC0A 5I1GH 2FHBA 3VFRB 1T1ZB 3ZXAC 2WLHA 4JK1C 4HX1B 4PWGA 4HIKA 1FDLL 1QA9B 3NJIA 5D1XD 2VDKB 3ILEA 5EN3A 2EDQA 5I1CL 3S37X 3PF5A 3WS3B 2IDTA 4AVHA 1T4WA 1GW6A 4YPGB 1Z6HA 2OA9A 2AABH 2D3JA 2XTJD 1G291 3L3IB 4RDQG 5EU3A 4ZTEA 4R97B 4YUEL 4HJJL 2KVMA 4AYID 3SO3C 3NK3A 1MRDL 3AQDA 4JKKA 1A7PL 1NAMA 3WLBB 2NY6C 1IGIH 3CXDL 4XO3A 1YUKB 5DJ8A 4JX0A 5EU4B 4WW2B 4ZX6A 4KJQC 3HOZH 5CGMA 1KNAA 1M1KC 4IJTA 5CN2A 4G7QB 1JWSA 3BVXA 4H20L 3QI9B 4LAQL 4CJ0A 3GO1L 3OKEA 5JLZA 4UI2A 1EJOL 1CIDA 3OG4B 3CZUB 4OM0H 5IGXL 2JCWA 4QMEA 1JZ4A 3B5GA 3OW7A 1J1OH 3EYVA 2BSED 4M00A 3UZVA 3CVHA 4JBSA 3ZR5A 4YN3A 2VDPH 2FSEB 3GSQB 1R24A 5AL0A 3W0WA 3R1GH 2LY7A 1J05B 4KH2A 4NEHB 1C16A 4K3DH 3X14B 2WB1G 3UYPB 3GM8A 5H8DA 4ZFZA 3C6LA 4XE0A 2OF1A 2EDKA 1YAZA 4TTGA 5JVG3 2COQA 5I6PA 1BVZA 2AS5M 4X6BB 3TGXA 4HS6B 3LV3B 2XWTA 5EUOB 1MF2L 1WBXB 3NGBC 3PWPA 1O9ZA 2VLKD 1BEYL 4I9WD 2GVAA 2N3SA 2OPCA 3BH4A 3B3IB 2R1WA 4YXKH 1X6LA 2N7BA 4K23L 5JHLL 4AVIA 2JH2A 3C5SA 1UVQB 3NTCL 3Q13A 1JN6B 3WSQH 5DRZB 4NYLA