3K0YA

Crystal structure of putative toxin related protein (yp_001303978.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
198
Chain Sequence
DIWIAVATVVPEGNNVYYLRLDDGDKLWPAATNYPNYQPKPNQRALVNFTILADSHYIKVNAIHNILTKSIAKNEGAANDSIYGTDPVSIYNNNMWIGDGYLNIYFETLWGGKTAHFINLIQPDAENDPYTLEFRHNAYDDPQYTIGAGRVAFNLSSLPDTKGETVDLVVNYWTSEGKQAYKLKYNSDKTKMNITDMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative TOXIN related protein (YP_001303978.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Toxin
molecule keywords Putative TOXIN related protein
total genus 44
structure length 198
sequence length 220
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k0yA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k0yA02
3K6OA 4PQXA 3K0YA 3NQIA 4J8QA 3QWNA
chains in the Genus database with same CATH superfamily
4GN4B 1OV8A 5J6HA 2SNSA 1OF0A 2GSIA 5E8EB 2A6EC 3HRZC 4PJGF 1JVOA 5IKCA 5GAGC 3GBMH 4PNYA 5IB5B 2XTJC 4JG0L 1ONQA 4FI8A 4GW4A 4LQFL 5BVPH 3QP3A 4W9JC 2I5MX 3QNYA 1S7XB 1AP2B 3DTDA 4N2MA 1MHPL 3W11D 1IGYA 2ESVE 1U93A 3T0AA 4WENB 1EVUA 4QAMB 2IX3A 2W0FB 5IROC 4XOEA 5FW7A 1CN4A 3A4DA 3FQXA 2WUCL 4LLDA 2F58L 3ZTDC 4A2MA 4HG4K 3LKQB 4HJUA 5CFHA 1YJDL 3VX1A 3TZVB 2HJKA 4AW4A 4PJAF 2XN2A 3U4BH 2DPKA 4DPCX 5GGTA 5K39B 1E24A 1TTFA 4XBPA 4KK7A 1KLGB 4X6DB 1MXGA 4BD4A 4DNLA 3R19A 1E3XA 1GJWA 3PGCB 3AB0B 4I9WE 5DTFA 1IJ9A 4PRIA 1HE8A 3QA3A 4GG6B 2KT6A 3DI3B 4UDUB 5LNGA 3ZDXE 1E4XH 2FXQA 1UE7A 1W80A 3BWAB 1M05A 3HPJA 4HKXA 2CDGB 4UQDA 3TZVC 4FYTA 4IRSD 3W39A 5DJYA 4IJHA 3BOVA 3VXMB 4F8PA 4YX2L 4G7YL 2YMXH 4H5SB 4KROD 4TSCL 4QRRE 4C3IH 1T7VA 4WHYH 1IT9L 3S3PA 3BPOC 1G9NH 4LCUB 4NIYE 3I6GA 2ICIA 3Q2CA 2YWYA 1E27B 3N85L 2XXGA 4FXKB 4FQXA 3NUKA 4XMKL 4AITA 4BZ2H 4LOUC 4WTQA 2Z35B 2XTJB 3AABA 3IWVA 3HG1E 3GTTA 4Z3JA 4XN4A 1F9RA 1JGDB 1CKOA 2XTLA 4TUKL 2BP0B 4YHML 1WBZA 2R92G 4PRID 3Q8AA 5E8DL 4OONA 3AS3A 4FQ1L 2B1HH 1W6JA 1ZTXL 1HFGA 4A7GA 4BFNA 3BN3B 3SY0B 3PFUA 1I4PA 4QHLA 5ISZA 2R0LH 1O6TA 2K4AA 4BZ2L 2AQPA 1DDHB 3WFBH 5LGJB 3CC2A 2B63G 2I26N 4I0PC 5E2VH 4NRXB 3QORD 1F2YA 1FNWA 5GS1B 2K6ZA 3UTOA 3ZSTA 2KC0A 5CLZA 4TUKH 5AEAA 2FECI 3HB3D 1GC1L 4MTNA 2ZXQA 4M43L 3B8YA 1WTLA 3HOZB 4P57A 3S2AA 3N40F 3FSAA 2EDNA 4LVNC 4RBPK 3T6VA 1IC1A 2Z34A 4EQ2A 4M03A 4FQ1H 1CDJA 4H44C 5J4MA 3LPPA 3AC0A 1VPOL 5JVH3 1DO5A 3FK3A 4XP4L 1VF7A 5B3JF 5JW5B 3PFQA 4XAKD 1NC2A 2R0LL 4HYTB 4V1DD 5F0PB 2F4VL 1ZXTA 1BX2A 2OTUA 2G75A 2V2XB 3H7BA 4H8WH 4NN5C 1KJ3H 3BP6B 4GS7B 1IM9A 4JRYD 4XVJH 3CXDH 5SWSE 3X14A 1NM9A 4QLRA 4BJLA 5JHDD 2AQ3A 3EFOB 1FJGL 5C5LA 1J8HA 2ZOKB 2J55A 4H13C 3LZLA 3ARSA 2B59A 4LCWD 4TVPD 5C3IA 4OZIB 1DANU 2JEBI 3F7YA 3HVNA 4YWGL 4KZDL 2JJSC 1A25A 2HRGA 4OI9A 3RLFA 2P5WE 2YIHA 4DR1Q 3FDWA 2I7OA 1Q8MA 3TBTA 3MYJB 3MV8A 4RETB 3AYHB 4WI5A 1M2OA 3EJYD 1BYOA 3BSZA 3PU7A 2HT2D 2WQ8A 4AUUA 2OZNA 4JZJB 3R06A 5TE6L 4AOFA 1EY4A 5C44H 3F2UA 1RUML 1YBYA 2R15A 3X17A 2JEAI 2X1OA 4YDKL 3OMCA 4K5WA 2YS4A 3TMEA 2AEQL 2BIHA 3FKIG 1IC4H 1S7SA 2VR5A 4ZMVA 4XPBL 2BX5A 1E9PA 3VD2A 2VDPL 5CFAA 2MNUA 2EKSB 4BK5C 1QLRB 4HZAA 1BF5A 2PP8A 1F56A 4KKAD 2GCYB 1X3PA 3FS9A 4HWBA 2J1XA 5M3MG 1BBJB 1N4XH 1TPXB 4N8CL 2E4FA 3AWFA 3L4XA 4V190 3LZNA 3QDGD 2IHEA 1B88A 1QRKA 1RPQA 3CFIC 3TO2A 4FXTA 4QWWD 5EIVA 1Y1VH 5LO7A 4O02H 4DEWA 4TVPL 1FGVH 4IU2B 3OHXC 1U3NA 1R3LB 1WHOA 2XN0A 3BAEH 3QFJB 3SQBA 3FEWX 2V3FA 3L5HA 3CLEH 3EYVB 3F7KA 1FNSH 3PWPB 1CTOA 1J05B 3N2JA 1EBAA 1MAML 4OO1G 1IQDA 4LSDA 3OLGA 1TTGA 1KYOK 2FVNA 4JV5L 2NY7H 3KOJA 3WSQL 1AYRA 3NIDE 3FO0L 3N55A 4MQ7A 4MA3A 1F5WA 1OP4A 1T4KB 3FFCE 3MA9H 5MERA 3GMNB 4J5VA 1U58B 1M9WA 3DECA 3O4OB 3BMWA 1JMXA 2F19H 1PNCA 5CGYD 4KU1A 4YCVA 1MFEL 3CLEL 2N7AA 4LPYA 3NH7L 5DHVB 3HG1A 4HIJA 3WJJC 5D2LE 5DEZA 1RIVH 1H5BB 2OJEA 3B1UA 3UIZA 1KEGL 2F7PA 3U7YH 5E08H 1NOFA 2QDLA 4NQCA 5HYEA 4W6XB 1C5DB 1YEKL 1FZOA 2GY7B 1WVZA 1YMHA 3A74A 1O5DT 1G9EA 5CJQH 3A67H 2O61A 4HKJB 2BMKA 3W56A 4JC0A 1WZMA 2BHZA 3WIFB 4YXLL 5C0GB 2PXYC 3KL0A 1BCPF 3DX1A 4MJID 3AG1B 2VNUD 1XD1A 1K0SA 1FL5B 3ASWA 1T7WA 3D39D 3QPXH 1HHKA 1KEGH 1RK7A 3EJSA 2NX5B 4QJ5B 4FZ8L 2OTLA 3HI5L 4BZ1L 4JY6B 2AXGB 4UT9A 3CDYA 1UZ6F 4UT6H 3WS6A 1WA0X 1TJXA 3RFZB 1LV9A 3IU4H 3QDJE 3D85D 2JYOA 1HTPA 3MRNA 4CL7A 4S3SA 3BP5B 1KCKA 3RWCA 1F9SA 5HHOB 4GH7B 4YBLC 1Y18B 4NQCD 5I30L 4A7UA 2EAEA 3MFFB 4FN0A 1J8HD 4J1MA 2ZX6A 3MOBH 4OGZA 5MI0C 4HJ7A 2GJ6D 4OF0A 3MRQB 5C0XG 5T33H 3QJQB 1S5IH 1PFOA 5CU9A 3KJ6H 3VI4B 1RJCA 2VXUH 1PKQB 3V6OE 1G1YA 3C6SB 1N3NB 4GKJQ 3DM1A 1Y6NR 3HR5B 4YZWA 3E2HC 4P46D 2F53A 2EVHA 1GGUA 1G0DA 3FUJA 4B7LA 3F58H 2KCMA 3KHQA 4A3FH 5I30H 4JCLA 4EX5A 3ZBMA 1D5IL 2HQLA 4HUKB 3QUXB 3UCQA 3FT2A 5FGCB 1PZSA 4S1DC 2OTWA 3PXLA 3JWOH 4K71B 4DP4X 2YZ1A 5TQ2L 4BCYA 3P11H 5HHNB 5T33L 3NMEA 3RTQB 3C5ZB 5CM1A 4XO5A 4B5ZA 3R4RA 2CIKA 2GTWA 3GC3A 3SOBH 3ZKNC 3ZGHA 1FIGH 4JQXA 1T1ZA 4X80H 2Q76B 4Q9RL 3ABGA 2DNEA 3S37X 3NZSA 4AMWA 1QMUA 1TZIA 5FO8B 4MHHG 4PJHA 4YHHL 3BKCH 3EF4A 3WUWA 2EO1A 2NYZA 4LPTA 5C2BH 5TQ2H 4LFAQ 1S9XA 1PSKH 1VCBC 2DMCA 2DRUA 2EVIA 2J8UB 1N6UA 1FYTA 1EY5A 5GZOC 1PJWA 3JV4B 4J4PC 2ROXA 2Z0BA 3VG0H 4ELMA 1INDL 3OXSA 3PV7A 3QUZD 1UXSB 4XBEL 1ZEQX 4JM2C 5HD8C 4KRLB 4MVBC 3APMA 2YHGA 5DZ9A 4UMSA 2WLZA 5AW1B 1NIEA 1T7ZA 4JFQA 3V4PA 3ULVE 4F7PA 3GKWL 3QRBA 1LTBD 2J2ZA 2IFFH 1SHSA 1SJXA 2BY2A 3OM3B 1B4OA 3P3TA 3QCTH 2K8MA 1OTCA 4PJEB 5EZIL 5AW4B 5EPMA 5GRVK 2OL3A 1PX8A 1AO7B 3ALXA 3CGTA 1DLFH 4P9HL 4Q56A 3AQYA 1STBA 4BBRG 4MD0A 4AEIL 1GJUA 4XBEH 1PEZA 3MV8D 5CGBA 5GAEC 1EIBA 3CFKB 3QO1B 4D3CH 1N0LB 3RWEA 4XPTL 4Z76A 5EKIA 2KUMA 3PJLA 2VC2B 4PGCB 5I6OA 5C0BE 4CSSA 2CALA 3F04A 3GKWH 1U0LA 1QLFA 1F3RB 4NB7A 5DUPL 1U33A 1RIPA 1IKMA 1UA6L 1WEJH 3ULVL 4ICWA 5GGTH 4YK4C 2OTPA 3DURB 3RZCD 4QL5A 3DX3A 2O4EA 3BD5A 5KG9A 3GV6A 1HSAA 4JVPA 1W8OA 3T56B 3QEUB 2TSSA 1P5VB 5I6NA 2WBXA 1KZQA 1PZUB 2LY7A 1JIBA 4LCWA 1GCFA 1KCRL 4OF6A 3ARRA 3PAUA 4AJ0A 1WCMG 1J48A 4LPVA 1EFXA 5FYJU 2DY8A 3DTXB 4PGBB 1F4XH 2IAMB 3EH1A 3GIVB 3ILEA 1I1FA 3OSVA 5GJTH 2H2SC 3U6RA 3UTPE 3WY1A 3VFGH 4X8JA 3J8F7 1XF4A 1T20A 2J20A 1ENAA 3LPOA 4XNMB 2CO3A 5I82A 1E9QA 5ESQA 5SX5H 2HXAA 1NAMB 2CH4W 3GDCA 5H37G 5LB1A 1FNGA 1GKOA 1KCRH 3LNEA 1RZGB 5F7LB 4JOIC 4JG5A 4N8X1 1KB5L 4P59L 3WDIA 1N32L 2JQOA 3L3DA 3CFBA 3HS0C 2L8AA 4HIQA 4XWOD 3G04B 5SV3A 1AXTH 1MHEA 1J12A 2YPLE 2YAPA 3C8KA 5J3BA 5I2IB 4FABL 3WTTA 1SYGA 1PFSA 1VQOA 4ZW7A 5IGFA 2I9TA 4EOWL 4NXSA 4Y9FA 1I8MA 2F5AH 4RCAA 4J8RB 1BFTA 1RZQA 4JUTA 4LKXB 4PJFB 1UWGL 2UXFA 3S2CA 3L5XH 3BGFB 3LQMA 1SJEB 5HJGA 1PAZA 4LDCA 2NY5H 4M5TA 3ULLA 1IAIL 4Z7VA 1QPPA 2F15A 2DJFC 2CXKA 1UWXK 2ZUYA 1A9VA 3ARBC 1U8NA 3O3EA 4TNGA 4PPTA 1FZJA 1RUPH 4IJTA 1KTCA 1VQNA 1R19A 5KBPA 3ZQWA 2VMFA 1OTTD 3Q8EA 1H6TA 4P04A 4GSUA 1U8HA 2Q7AA 3MN8A 1AJ7L 4OUUA 4R90L 1A47A 3QIWB 4DETA 1HZBA 2F1MA 2ZM6L 1R47A 1UM4L 5LMUL 1FLRL 3A6CH 2ITCB 3L95A 1Z9LA 4KK9C 4LARH 3ETBF 1AOZA 3J07A 1G6ZA 1DJZA 3MREB 2IVFC 4PVMA 4LBEA 4E68A 2C3WA 3E8UL 4OLXL 5EPLA 1A6AA 3JTTB 3CNKA 3VH8B 1QEWA 5SWQB 3PIQB 2HTLD 3TREA 4JGUA 3TBSA 1JGVH 4IFDJ 1GJIA 2GSGB 4C58B 3Q5OA 2ZICA 2MRYA 3GSQB 3LHPL 3VRJA 1CA5A 2KZBA 3IGAA 4WW2C 5AWNL 2I5HA 1YN6B 1D7CA 1OAQH 5JJZA 5HDRA 2FR4A 2ALWA 4ZMTA 3A4AA 4PJEF 3ARBD 1CQFA 4L4VD 3LS4H 3L2NA 4YHHQ 4PBXA 1GW0A 1NGZA 4A2DA 4OLXH 1MHCA 1IILE 2R0KL 2ZWSA 3QXTA 4R2GC 1JZ4A 1QBLL 2ZJQA 3IDIB 4DR6L 3K2UL 1BQQT 5IB3B 1AHWC 3OWEB 5EPJA 2GJJA 4OTXL 4P5MB 2HFEA 1TWGH 4A3JG 2OMZA 2PPAA 3TA3C 3TPKA 2AMUA 2OMVB 3S17H 3EIVA 4PH8A 4G8AC 5IT2L 4BXXH 2WGXA 4XPAL 2H1PL 3CZUB 1KPUB 2VLMD 4JANB 5I0DA 1M2VA 3PNWB 4QYOB 3DROA 3N1MC 4LF7L 1CF8L 1ZA3B 1TLMA 3HG5A 2VC2H 2ZUSA 3K5SA 5HGHB 3UG3A 3DUSA 4PJCE 5T3XE 2WLKA 1QFUH 1U3YA 1EHLH 3PF5A 1PZ5A 2R0KH 3WU1A 1R9FA 3F8UB 4MLSA 5A2IH 2CM6A 2IC2A 1BFVL 3K2UH 3MRKB 3V7MA 4S0HA 1WT5A 2UVFA 1W2BA 2L11A 1ED3A 1ZIBA 3V0DA 1S7WA 1A7QH 1UCTA 1J0KA 3TEYA 4C2MH 2JI2A 3PDOA 3SDCB 4E5XG 1XGPB 2IH3B 3FQWB 4Y19E 3JAMc 4ZG1A 1OZTG 1OAYH 3MVSA 1GOGA 4W70A 2DIJA 2OULB 4GIOA 4NQEB 5TGBA 2WVTA 5EKKA 4ZOAA 4YUEH 1T03L 5M95B 2GFBB 1I4FB 1PKQE 2IGFH 4KI0A 2VSKB 2AV7B 2K78A 3UABA 5HYJD 1IUZA 2MNAA 3DETC 1NCJA 3RBGA 4BKLA 1XR8B 2BW5A 2YQBA 1W8NA 3KPRB 4NO2A 2OYPA 4M6NL 1TCMA 2CHXA 1KMGA 2Q87A 1H3UA 3ZYOA 2XN9E 1HQRB 2A9MH 5F8RC 3O9WC 1GZQB 4Y19D 2IY5B 2HLAB 4P5KB 4P5TD 3IFLL 4LT7A 4F37K 3IDNA 2Z91B 1M4KA 3WFEH 5KAQG 4IPHA 2ROYA 1BWMA 3CFEB 1QUPA 1YNKH 3NA4A 3RFZC 3NG5A 2JV6A 2V5SA 3D34A 5C0DB 1D5MC 5C09B 5JTWA 5KYUB 5F6IC 4M6NH 4JM4L 3FF7A 1IBFA 1RH8A 3WDHA 5TF1H 5F3HA 3L1OH 1JK9A 1T6BX 4K0OA 2R92H 3MXNB 2CH4A 3OF6A 4X5QA 4ZTPH 3QRLA 3UCRA 3U82B 5A7BA 5CGKA 2PW2A 2J71A 3ENEA 3KCPA 1UFGA 3TA4D 3T2QA 3RUGB 4KROC 5LBSL 4B3MQ 1I3QH 5GSVA 5JEAG 1U30A 5C3LD 4G42A 3P3UA 4O2CA 1IW7D 4W6WB 3TFKD 2NVTB 4NOBA 1ROCA 5BRQA 3WCYA 3ZT5A 3NSWA 1L3NA 5I5IA 3C2AH 3F84A 3FSOA 1I1AB 4FQIL 1ASQA 1PTOH 2YD6A 5DUBB 2QZQA 4XN9A 4YR6B 1QBMH 3PGDB 3NIDF 3RN5A 3D4YA 3GBDA 3TH2T 1UD2A 2WZ0A 1KQSA 3ZMRA 1KBGL 3SKMB 1F1DA 3PF4A 1NICA 1KAAA 4JKPH 4TSBL 4UT6A 5I6XB 1HEJC 2RCNA 2WUCH 2F58H 3NWTA 3S14B 3QYNA 1RSYA 3L2LA 2NNCA 1FNEB 2GUYA 1IGMH 4FMFA 1AO7A 3Q06A 2OL3B 3C2AL 3MCYA 4FQIH 4EI0A 4WHCA 2MJWA 1ML0A 3DBSA 3OMGA 2ZKMX 1P8LA 2FYYB 3AU1A 3QQ3A 2O5ZH 1EJFA 1RUQL 4XHQA 4D2NA 4EUPG 1UE6A 4RHSA 2NY6D 1FVEA 1KBGH 4S10A 1VQAA 3T4YA 4AQAB 3BPCB 1KJ2A 2AJUH 4XN8A 2KZWA 3FCTB 1P9MA 2BW4A 2YMXL 1ZY9A 5HGHA 3TCLB 2FHBA 3FZUC 1G9NL 1RZKH 4CKCA 4AH6A 4DEPC 1ZHKA 4XO8A 1PD1A 1S9XB 3MFGA 5L2KD 3J81i 2RIKA 3ZJAA 3V4UL 3TURA 1XPOA 1D6EC 1EZ8A 3HZKB 4ZMPA 3BO8B 1UH3A 3NJFA 4PJHB 4OLZL 4K7PL 4TLUA 5M5WH 4P3CH 5F9WB 1SJMA 1FLTX 1SXCA 3H94A 4NQDE 1IM3B 2BJMH 2WLYA 1Z9PA 3NPZB 4JPKL 4R5TA 1KLGD 4DR6Q 2CBPA 3BD3A 3DARA 2BDNA 3HLAA 2Z65C 2H1EA 1BMZA 1ZTXH 4FYRA 1CFVH 3GSWB 4NERA 1SLUA 1MFDH 3QEHB 2FR4B 3OR6A 3RTQA 3UTTD 3WTWA 1MD2D 3VJ6B 3KPQA 3IAGC 4UQ3B 2NY3C 4QHUA 3K5OA 4X6CB 1A3TA 1E3ZA 1NCHA 4J3TA 2R51A 4WSJA 2DQHL 4UM8B 5CXPA 4ILWA 2VR4A 2JA5B 1SFOH 4MDJA 1ZSDA 2F6AA 1N6QL 1F3JA 1DQJB 1LHZA 2IQ9H 2N7BA 5E4EC 2G2RB 5LXVA 3BH8B 3CPFA 2YPVH 1C7TA 1G4MA 1XF3B 5BXFB 4ZUVA 5L4FA 3IS0X 1HZ9A 2SODB 4IYKA 5I66B 4JN2B 3EGSB 5EBWB 1SLVA 5DAUA 1Z5HA 3S35X 4A2EA 3MCKB 4G2AA 1CFTB 3RVVC 4I5BA 5FCSH 1U9RA 2CAKA 2YJLA 1RPUA 2ZT9C 3CW2C 2ASBA 1VGEL 4K8RL 5E1QA 3U0TA 2J21A 4X66L 2D73A 5LGHL 1Y07A 1BZ7B 1B0RB 1TZ8A 5L88L 1XNQQ 1SJEA 3GO1H 2LW3A 4P48A 4L63B 3BAXA 4XXCC 3WGVB 5ESAB 2J5LC 2LKVA 4HS6A 3EJIA 1ENFA 3BN9D 1RSFA 2DD8H 1SNRA 3IYLW 4M1DL 3HOGA 5F7DA 1CSPA 5DMKB 1NBYB 3K46A 4I2XA 3O4LB 4PYHA 1UE1A 1SY6H 4WUUE 4BRJA 2OMWA 2UUAQ 3TA3D 4AIZA 1GOZA 4V1DB 4PJGE 5EBMB 4OFVA 4KLKA 4PJ7B 4R8NA 3NN8B 3MV7B 2DKSA 2CRYA 1L5GA 1JN6A 1OP3H 1ZLUK 2F18A 3CDFA 1H9KA 3VYRA 1DQLH 1RVFH 1E9QB 3VSQA 4UI2A 5D72H 5J1AA 4N0FB 3M1CA 4OCWL 3GMNA 5JW3H 1TMQA 1FNHA 3VGAB 4KHXL 2EY2A 1KIRA 4EPSA 4OZGA 1PRTF 5DHDA 3PWJA 1JGUL 4YSAA 2E8ZA 4LSUL 4GMSH 4TVUA 5FO9A 1BDYA 3Q3GA 4KTEL 1AFVL 2XG4A 3DETD 4DKEH 3VXPB 3X1EA 3TZDA 5C0XH 4CNIA 1OTUC 4TL4A 3J80E 4GBXB 3HOWG 4IJ3B 5C08B 2P49B 3T09A 3AB0C 4TN9A 4PW9A 1DJWA 1RJYB 5I9OA 1P5VA 3QEGL 2BNQE 4BXVA 3KR3L 2F74B 3CLFL 3OR7A 2HT1A 3FU0A 3FH5A 5JW3L 1FNSL 1DVFA 3DMUA 4XP5L 4M7ZB 3KJPA 1SYVB 3UJJL 1K28A 4HUNB 4GKNB 4NQSA 5AKVA 4QGYA 3ZDXF 5FB8B 3LXBA 3ESOA 5M94B 1LNUA 4HW6A 4G6FB 3BZDA 1PFCA 4JR9H 3T4AB 3VD1A 3UDXA 3BEVB 4XCCH 1B6UA 4BY1B 2XZCL 3KR3H 3CSPA 4JZNB 4ZUTA 3UO1H 4RFEB 4WFED 4UDUC 2E4TA 3KYNB 2PO6B 3DPDA 4FKHA 3RLSA 5DS1A 4CKVX 3EJYC 4RKBA 3ZDWA 1AW7A 3K58A 2YSSA 1GYAA 2EP6A 3QHTC 5E08L 1ACYH 1S78D 2HT2C 3FUEA 1FVEB 2WQXA 4U7KA 1B4LA 3B2XA 3U9PH 4FKEA 5TQ0L 4APQB 1CXKA 3VWJD 1GOHA 4MB5A 1J0IA 3CMGA 2FMCA 4Z3EA 4G6JH 4DP6X 4F7TB 5AOKA 4JI3L 1I7UB 3E9HA 2WWNA 4ONOA 3MWYW 2NTFB 3K6SB 2MTAA 4JHZA 3GSXB 3S98A 3EYQC 3L3GA 4RZCA 3RWDB 1P1ZA 1HYSD 4CC1A 2LLLA 3UO8B 3HI5H 4YHZH 3ARGD 1BEYL 1ACYL 2VM9A 2DV6A 4P4KB 1P7QA 3CCHB 3MRBA 1UUNA 1LABA 2LABA 3SQOL 4A3CH 2JA6B 4ODVH 2W9DH 1IGJB 1N32Q 3H9SA 2VDLB 4KDWA 5DEFA 5IWAL 1T1ZB 2WCPA 3BLKA 3EYUH 1AGDB 1CXIA 1JPGB 5EUOF 1PLGL 2VDNB 5FOBB 1VGKB 2YGOA 4ADIA 3BZ4A 5CV6A 3M4QA 1NMAH 2FJUB 3II3A 5KSBE 1A6UL 2YLKA 4U1KB 1S5IL 1BEYH 5CO1A 8PAZA 4X65L 4CDEC 3DX2A 1E6OL 2VLJA 4J4PA 5CZKA 4ODWA 1JZ5A 5ABAA 4B41A 1G6PA 3O11A 2WGNB 5IMKB 5LNDA 1Q94B 1A1NB 1CHQD 1OANA 2KDYA 5CZXD 3JWNC 4R5XA 3MOQA 5BV7H 4TRDA 4XI5C 3NCJL 2OX5B 5EOCJ 1NCDH 3NYKA 4RAHA 1OL0A 2VDQH 1RL1A 2OQJB 3LAFA 3SOBL 2F0KA 5D9SB 1SSOA 4UOZA 1NFKA 2B2TC 3ETTA 3OXRB 3RU8H 1XNQL 4XNZB 1MHCB 2I60L 5DNFA 5AL0A 5E7BA 5CAYB 3CFEA 4Q9RH 2O2LD 1Z1WA 1D6EA 3GKZA 4HHAA 4YHNB 4YDLB 5G4MA 1AEXA 1FZKA 2LSSA 4PMWA 3ESNA 3BWSA 2IANB 3GSOB 3QR1A 1MWAB 4JRXD 3VNZA 5C2BL 4WFEE 2YOCA 3MV9D 3EBHA 1MCWW 3BUPA 4WJ3M 1DN0B 2Z93B 2QKIC 1RTOA 3L1EA 2NT0A 1TTCA 1UT1A 4MX7B 3HOZG 1F86A 3VDYA 1UGKA 4LLWB 2R8SH 5BS0A 4NO0D 1FUNA 2CDGA 1WBYB 4H25A 2NW2A 2Y0SA 4LCYB 2C4XA 5CJXA 1XL6A 2Q9OA 3WTVA 3C5ZD 2W9LA 2XY2A 2KHJA 2G3NA 3E6HB 3HR6A 4ZAKC 1YN7B 4W81A 2IFFL 5B1KA 1BBDL 4U6YA 4GT0A 3MROB 1A02N 3I55A 3IMWA 5FLUA 3HG1B 3OLIA 4HIJB 2HVKA 3NFPB 5MENE 2QDBA 4WW1B 1J8SA 3UTSE 4AEIH 1ZT7A 2EECA 3AT8A 2CKBL 1STNA 2R8SL 3Q22A 1FH5L 2DWXA 2R1XA 4PBVC 3AB9A 1DZBA 4MB1A 1U93B 5B39G 4P2OD 5BNXD 1KCUH 3UZEC 2Z8SA 3UGUA 3T8XB 2VMCA 1TENA 2UZXA 3ML8A 5FEBA 3ATBA 4QRQB 2QGDA 5I16B 1BBDH 5E2TH 4GAAA 3SKNA 5FOJA 3V5HB 5IT9L 1PFMA 3VSTA 2ITDB 5TJWK 3L4TA 2YD3A 2CKBH 3B34A 3RUGE 5E6RB 1BVNT 3NCYP 1YAIA 3GSXA 5K1VA 5I24A 1TU2A 2XPZA 2CO6B 3GMOA 1L1OA 1WUNT 4FFVD 4MS6A 1W16A 4HZLB 3S36X 4YNYB 3ZTNL 4JHBA 4R97B 4EQNA 2JKSA 4RX4A 3TBIB 3WWVA 2KI6A 3MNZA 3KJ4B 4PM1A 4PRHD 2UUBL 4FFWC 5CS7A 1A9EA 2BNUB 4A3GH 3BVXA 4KKRA 2DQFB 3K4AA 4OZFH 4ZYSA 4G71B 5IHZA 4YFLF 2Q2EB 2QQQA 3FQTB 3MBXH 3ZDYE 4DR4Q 4NZJA 1QLRA 4CGUB 5FGBC 1HL4A 4LKCA 2PO6A 4KJWD 1IGIH 4O51A 4X8JB 4I7ZC 2IBZY 2EVGA 4RDQG 5AZUA 2D0PA 1TCRB 1A7NL 5GRJL 4ABUA 5AAWC 4XMXA 3G5WA 1OM3H 1A63A 4M1GH 5ERWA 5ACLA 2BDNL 3T0EE 4PRAB 1K8IA 2PWFA 4Y2OA 2X4UB 4OD1H 4S0TD 4R26L 4OBRA 1WTPA 2F0LA 3EDFA 2FGZA 3U36B 5C4XH 1OKEA 1ZTMA 3C1EA 3BVTA 3HEJA 3RIFK 4AY0A 4IDLA 1UWGH 1IAIM 2JTYA 4N24A 1WZ1H 1TO4A 3DYMA 4PWKA 1ACXA 2GB2A 5F71A 5CEYB 2RCFA 2NY5L 2YKLH 3LXUX 3F7YB 1MWOA 1NFIB 3OJ2C 4QOKD 1NOAA 1QZNA 2A9CA 4MCYB 4AM0A 3ARFC 1AE2A 1PMRA 3D07A 3IDGB 4I1NB 5FA4A 3VXUD 3B3IB 5E2WH 3ZY7A 3NA9L 5G4NA 5GQBA 1UD4A 1H3TA 1V5JA 2YBRA 3C87A 3GI8L 5F8QC 2FWOA 4FXGB 5T3XH 3V95A 1DQQA 3HZXA 3QULA 4NSKB 4PJCB 5FWRA 4A3MG 3LKRA 2VQEQ 1AJ7H 3T53B 3HZVA 4N0FA 1NBZA 2P5PA 1BXAA 1MI5A 1UM4H 3NGBC 4IRJA 5K33A 5DQJA 2YKLL 3CHQA 4H0HB 3ULJA 4PFEA 3VFTA 4GMTL 1NAMA 1HNFA 3VFWB 3OKLA 3UX9B 4GAYB 1I3GL 3UZQB 4OL7A 1WWAX 5D1QB 3IKCA 2JSFA 3L3OC 1S7VB 3LKRB 2F54A 3SDCC 5T3XL 3GSNL 2AQNA 2XVSA 1KIQA 3TBWA 2MPAL 2I5LX 3A8KE 3LHPH 1O7ZA 5JHBA 3B3IA 3EAKA 3QORC 1WWWX 4ORGA 3TBWB 1UEAB 1LT6D 5FFGA 2F7RA 4PWIA 5SWSD 1WO2A 4JPVL 4QAWA 4IGBA 1NEPA 5TSSA 4CRPA 2JJTA 1EUTA 4FP8L 4KJPC 1LP9F 1MHWC 5DD6B 1SMOA 2YEVB 1JGDA 2L7QA 3S1MB 3AXHA 3DURA 3EYOA 3QJFB 2JI3A 4AL8H 4WUKH 5GGRA 3U1PA 3DOSB 5E1HB 1U4RA 4LGPB 1MBYA 2AJSL 3BAYA 3HBZA 1I8IA 1IXRA 3PQIA 2KL6A 4M9PA 2JA7B 1DD2A 3KNBA 5D1QE 3RWFA 2E9IA 3V5DA 1KWKA 2HMID 1CF8H 3CH1B 4K7FB 4EF3A 2VB3X 1F8TL 2WW8A 2GTZA 3F6LA 5DS2A 3MNMA 2DI8A 1QFUL 1KXVA 5D7LA 2YOAA 2LXJA 3HR5A 5JNYA 1EHLL 4N8VB 5KS9E 5J56B 5MEQA 4OF3A 1BFVH 1TYEB 3LSOB 1KXQE 1I1CA 1H8LA 1RU9L 4MJ4A 4TNEA 3PGFH 4FYQA 3EH2A 4PJEA 1G91A 4FNRA 3E3QC 1A7QL 1NQBA 5EBGA 1IEHA 1AG0A 3MLPA 2DQFA 3P77B 1XPUA 3LRHA 2BZ7A 1KTDA 1NCGA 4EIGB 1OK8A 3DYOA 4BSVB 2CXGA 4YUEL 1T03H 1BOYA 2WXHA 2FJ2A 1E8ZA 3UC2A 4A3JH 4R0LB 3SDAB 4MN3A 3FBKA 3PRZA 4XNYL 1VQBA 3MAQA 1JF1A 3WJLC 2NVYH 2CKBA 4ABNA 1S7XA 2VR3A 3RJQB 2JKWA 5KUKA 1K3IA 1L9SA 2QLVB 4JLRA 4QRRD 4ZFOA 2J56A 4A7SA 3JUZA 5T1KD 3EOAB 2JLPA 1WT5C 4LFHG 3G6EA 1EERB 3IFLH 3IFOB 5I71C 3SO5A 4GW5A 4DR5Q 5DQDH 2ZG2A 1DBKH 3GQBA 4QGTA 2K50A 4DXGA 3K74B 1ZHKB 2J43A 3OGOE 1FPTL 1FZOB 5I76B 4WJ5A 4IBTA 4E42A 4XNYH 1ZGLP 4Y4HC 5KSAC 5IB1A 2VKWA 2EYTA 4L4TD 4R4QA 4JM4H 4YHIB 5FM5M 4DKEL 2NQCA 2WFWA 4FTVD 5BRZB 2IOMA 3BKJL 3FTGA 4NENB 3K4ZA 4JI5L 5FLXc 3CVHL 3U7AA 4A7GF 4AC4A 5I1JH 1MQ8A 4KHZA 3ORJA 4JVWA 1GKHA 1XHHA 3PIOA 1XGYL 1QFWM 4UPAA 5TH2B 1VQ4A 1I7RA 1XWEA 5A2QE 3CXHK 5GRUH 5GZNA 1LVEA 1M7DA 1NDGB 4IFDG 4TUOA 1XCXA 4FERA 3SK8A 1A7OL 3ND8A 3L7FB 2CHWA 2H2SD 2DIEA 4IOAA 1AC6A 1ZDQA 1EDHA 3HHSA 4PIBA 5SX4I 4NP4H 1PLFA 3C46A 4ME5A 5LBVA 5I0YA 2ZG1A 3HC3L 1SFHA 5C09D 4KKZA 1ZE3C 2X4OA 3F65A 5E6ZA 1YEDB 1I1AA 1RI8A 2K7QA 4R4FL 4DGIL 1IBBA 4P06A 5IVXF 1ZIAA 5E8NB 4AEHL 1MKFA 3K2IA 4RAUA 3TO2B 1GS7A 5GRUL 4A7VA 3HP3A 3GD7A 3Q8BA 5T1LD 4PJIE 1KELH 1GGCH 4MJJA 4TOYL 4XXDA 2FE0A 4ALAL 3T77B 1CD8A 3Q9QA 4HP5A 5C0BA 2ZTCA 1MJ8H 1FL5A 4HPYL 5GRYA 4IJLA 3P4OB 1R3IL 2VLKD 4N90E 3H9SE 4I88A 3WO4B 1YC7A 4NP4L 1CVSC 5AAPA 1M1SA 5I28A 3JUYA 1PNDA 2ZAGA 3S1RH 4Z7WF 2HUGA 4FG2A 2EUWA 1SDYA 4FQCL 5AALA 1KT2B 4R4BB 1IGTA 4Q58C 1BD2E 5F88A 3POHA 4ODSH 3MDJA 3U46B 3K71B 1F2QA 2DH3A 1H0DB 5B8CB 2JIXB 1MFCH 3VFTB 3MJ7A 1OCWL 2FTAA 4IRZL 3VXSA 1MJ8L 2FO1A 5CV9A 4ETYA 3FQ1A 5DQJB 1T5XD 1VRSA 1A66A 3U4AA 1CHPD 3QJOA 5JDJA 4DOHB 3NBHB 4LDEB 4QRUA 4Y5XB 3WD5L 1I4QA 3BZ4B 3I2ZA 4W9EC 1AKJB 4NO0A 3V4UH 4XE0A 3K8MA 3EUDA 3TNMB 4KVNH 1BCPB 4TTDC 5KJ7E 4B9YA 4YY3L 4O5LH 5FM8A 2K03A 1X5XA 3H9SB 3MV11 1IIKA 5KZCB 3OLEA 1ZTXE 1JNHB 1A0IA 1E5BA 4NAJA 4DN3L 1J8HB 2E7DA 2F61A 2XTJD 2ZOKA 1EUUA 4JM2B 3RX5A 4LHUD 4HFWA 4PV8A 1ENCA 4FVMA 1W6LA 1PCXA 3FU6A 4U0RC 1F58H 3EO0B 3LD8B 2ZSVB 2E5EA 2RSOA 5F0JB 2PABA 2CDEB 1WTOA 3RGVA 4LE8A 4ANWA 1Q9LA 4GQ9L 2VDKB 1H8OA 4P99A 4AQYQ 4NUGL 4MRCA 2VXQA 2EIMB 1ZCRA 2R93B 1U8MB 3CCQA 1KB9K 1R3KA 4GRWF 4YN3A 4BWUA 2HVBA 3F1ZA 4F33A 4NO5A 1ORQA 5BRPA 1LE5A 3D6WA 4IIQC 1WD8A 2FB4L 4P57B 5CIPB 1AGBB 4NYLB 1C8PA 3U50C 1PZ5B 3P9WB 3RHWK 2UZIH 3PP3K 2R1YB 4D0BA 5SWZB 1Q81C 5I1CH 1MJ7L 3RILA 3VGDA 2FX9H 4P0DA 4OZIE 2OV0A 1GS6X 4ID6A 3G9VA 2X4QB 1TWHH 2BSSA 3ZE1F 3VRLE 3NP8A 1S7SB 2B0SH 2CGYA 4PJ9D 3EKCA 4GQ9H 5E1AB 3GNMH 1Z9NA 4NUGH 1F90H 2FBJH 3SY0A 1SDAB 1VGEH 1FGUA 2XIWA 3GHEH 5EFIA 5LGHH 1MFNA 1YEGL 4JEGB 3R06B 1KTLA 5I73B 3HUJA 1XL4A 2TSAA 4HBQA 1J5DA 4FHJA 3H15A 4PGJA 5FIEA 4WQOA 5I1CL 2NMSA 1SXNA 5L2KA 3D4ZA 4UM9A 4BH8B 4XNBA 1UUSA 3G6JE 1K73C 3P9MB 2FH6A 4K7PY 4I3SL 3NSFA 3HHSB 4ZTOH 2XHNA 1DVXA 5FYLD 1SY6L 3NCWA 3A24A 4XT3B 5JPMB 4PG9A 1AHWA 1R5IA 4CNIB 4D9QE 1YEGH 4KRMB 2W9EH 4Y4KD 5H94A 3ISWA 3S35L 1E1OA 3HPJB 3W39B 1DQMH 4ULLA 3EFOA 3MGTA 4HIOA 2A74C 3WE6A 2KUTA 1VKXB 4RGND 5F2FA 1CFQB 4JQIH 4N28A 3A5UA 2VW6A 4MAYA 2Z6FA 4H8WC 2R2BA 3PNRB 2GG1A 4ONFH 4D0CB 1OGSA 5JW5A 1SXAA 2VLLB 4BFEA 4KQ0A 4F8MA 3QUGA 5BS0D 3BYYB 2NLJA 2XZZA 1SMDA 4Q89A 5LAXB 1HILA 4BY1H 2HCZX 2KLSA 3MNWA 4PJ9A 1ZPLA 4X5RA 4DQOH 1PLCA 2JFCA 1B44D 4LSUH 4CJ0B 3OAUL 3Q5TA 4EDXB 2EE1A 2ODHA 3S35H 1U8NB 3O3EB 1OXTA 4HC1L 1SOKA 3Q43A 3C09C 1IGYB 3LZFL 3CUPB 4M3HA 3FFCA 4Z7VB 1EHKB 4YXHL 2F0QA 2FT8A 4GQPH 5I1KL 5IFAH 2NY2B 3DX6B 3KYMA 3TEZA 4EUPA 1JGLH 3WIHA 3QEGH 4K7PX 3BAKA 2AJ3A 5CSBA 4XCNB 1RURH 3LXAA 2YAOA 3P2BA 4L4TA 2R7ZH 4POGA 1JFQL 2NNAB 5JZ7D 1UEMA 5C08E 3OV6A 4WY7H 1VQGA 2F0PA 2VAAB 3STLB 4OZFA 5DJDB 3VXRD 4F3FB 4XP1L 1OAKH 5I2IA 1RZ8B 5D1XE 4WO4C 4GAGH 5AKTA 4E9WA 4JM0A 5DFVC 4Y4KA 2VXWA 5FECA 2HDLA 2FLBT 4G8GA 4N6RB 4MA8H 1RIHH 4DV6Q 1YYML 3V96A 1ZEAL 2IMMA 3PWPD 5DXWA 5EHFA 1GVIA 4YHLH 3TGXA 3BVNA 4PIRF 4DKAA 2Z8LA 1ZMYA 1WJ3A 2YQGA 4LCUA 2X4PB 3R2IA 4DXFA 2ARWA 2CBMA 3KS0H 3VFVA 3HZ3A 4JFOB 5FFLA 3O6FC 3QNZB 4NB3A 3LVEA 5GIRB 1ERNA 2FQFA 4XP1H 2F08A 3BH8A 4KX8A 2XJLA 3IGFA 3WS3A 1BJMA 1J86A 3QDMA 4MA8L 5KN5A 4B53A 5JIKA 3KBXA 1HDMB 3OMAB 4JPWH 1JI2A 1WH0A 1TQTA 2VLJB 1MY5A 2WTRB 35C8L 3ME0B 3QDGA 4NQTA 2C3XA 1WI5A 4HCRA 1IBKQ 3PUZA 5C7XH 4X4XA 1MCLA 1FD7D 4Q0XH 2KECA 2V6HA 4XCEB 4Z7UE 1INQB 3KXFB 5DFVD 3OR6B 3RX8A 4A6YB 5I8CB 5D7LD 3PV6B 4QOKE 2IPKA 1Z47A 3TVMB 2ENQA 2K7PA 5DD6A 1J5EL 4J8QA 3MV8E 5B3SB 2XICA 1N0XL 4NFCA 4XVUD 4YQXH 3GRWL 4MMXB 3DVNB 4KK9D 4PJFF 3PHOA 3TFBA 1AO7E 4PWFA 3CFTA 2V2WB 3QAZB 5A2CA 2AK4A 1UGNA 2CCVA 2OMNA 2X0VA 4P4KA 2WBJC 5LNEA 3QG7L 3FZUD 4PCSA 1JAEA 4ZQ3A 1T21B 4ONHA 1A6UH 2RD0A 5K9KB 3GTJH 2AWOA 2BY0A 2N0KA 1GZPB 1KPVA 3ABKB 3L4YA 1A3RL 4PB0L 4P74A 3JSSA 5F70A 3GTMH 2J2ZB 3PAVA 5JIIA 1FZMB 2CCLA 1EU3A 3QEQB 2QQLL 2RR3A 2MCMA 2DL2A 2EH7L 1D7FA 4YE0A 1A0QH 3RVUD 1YDPA 2VH5H 3F64A 4XNQA 2JKJA 2DQDL 3C5JA 5K9JL 1RIUH 1ZWIA 5JOFB 3LN4B 2CLZA 1ETZA 3MLYL 4BEIA 1RJLB 4K3JH 4X4ZA 1CCZA 1U2CA 3ILQC 4OJYA 1FYTB 4LLQB 3JWDC 1A3RH 2I60H 1AZPA 4UHVA 1Z32X 2V7HB 5A6LA 5B1CA 1B3IA 4CN6A 2WIMA 1JXJA 3FF8A 1B0IA 3RLNA 3VA6A 1OGTB 1DSWA 1DJHA 3HOZH 3MC0A 3PWVA 4JFDE 1KCWA 3WKML 5FB8A 2WVVA 1KDBA 1VB9A 1WGOA 1XH1A 2DWDB 3O41B 3HOUB 2IFGA 4G5ZH 4LLUB 4OSUL 2K01A 3VXOB 3X3GH 2E2DC 3MLYH 3C12A 5GRZA 2EVJA 3E0EA 4S2SA 4KKBC 3B9KB 5HY9A 3QRFM 4KZ0A 4RWYH 4LDLB 4FMVA 3VR4A 4IUPA 5IB3A 3ZKQD 1UFUA 4O2CB 5FJ8G 3G5VB 2WZ6A 2OMTA 3IWUA 1SXZA 1CI3M 4NT6B 3K57A 1DE4A 2GJRA 1PZCA 4X5XB 1Y1VG 2WO4A 4MSWB 4XC1L 5D5MB 2XG4B 4JK0D 2X6LA 2CO7A 5FUCE 3HC4H 1LO4H 3QIUD 4Z7OB 2VO5A 4G5ZL 3ZHFA 2EC9T 1JYXA 4YAQB 2NRDA 4N26A 1LP9B 2PWDA 3U9OA 3LKNB 1PYWD 2X70A 3PUXA 5DFAA 3BT2L 4XIGS 1NLDH 2Y7QB 1BD2B 3QHZH 4GNXB 2JA9A 4C56B 3TN2A 1DVUA 1SLXA 4IPGA 3HOYB 2ICES 4B3VA 1MFMA 1EZLA 3H0TA 4EIBA 4ZFGL 2IH1B 2Q3XA 1WZKA 5D7IE 2JCCA 3DX9B 1LO4L 1S9WA 1FV1B 3ZKND 2DWEA 2NY0B 2C26A 5KBMA 4OB5L 2ZJSL 1CB4A 2H5XA 3B2MA 5CZXC 4PJEE 3QJHB 1II4E 5I9PA 5D5ME 4ZRZA 1OSZA 5LN8A 1IYJB 4PRNB 1U8KA 3IDMA 3VYTA 4OZFG 3SKNB 1K2DA 3QDME 3K5LA 4Y88A 4AK2A 1JWUA 1DVFD 4DAVA 1G7HB 3GMQB 4LEOA 3Q6GH 4UU9A 1IQWL 3KPLA 2CJ3A 5DMIL 5DDHA 3S4SG 1J0HA 5EF0A 2WSPA 2ZJSH 4PQXA 4OO1I 2VERA 2BSDA 2VWEC 4UNTA 3FQ2A 5GS0D 5BN5A 3RB5A 2M26A 5KBNC 5IQ9A 1NEZB 2F0OA 1WAEA 2RHEA 2XTSA 5D4JA 4DPBX 1NGYA 3ISRA 5KYNA 2OT2A 1BAFH 1IGIL 3KPTA 5LAXA 1ZANH 3FT0A 2AV1A 1A2TA 4HCRH 4P07A 4N9GA 4PS4H 1DJYA 5B7FA 1IMHC 1UD5A 3QS3A 1A7NH 5GRJH 1Y6KR 1P4IL 3X3FL 4LRIC 1WBYA 1LK2A 4H40A 5GSRB 1YYLH 4CILA 5I17B 2Y5TB 5AKRA 2K05A 4ZW8A 3K80A 2FEEI 4J1UB 3M17B 4Q6IB 1SHWA 5I19L 5F7KC 1WQVT 2IO5A 2EH8L 4XAKE 3VGFA 5IQ7L 1ZLWK 3GS4A 1HH9A 1HU8A 1ZANL 4MCZB 4BHUI 3L9YA 1VQLA 4MJ5A 2EDOA 4PW4A 3ZJYC 2QGBA 5FK9C 4Z5RB 4A3GG 2IWEA 1P4IH 3Q6FA 4YHNA 4JI2L 3V6FA 4B3SL 3LZQA 4IKJA 2VSCA 2BS9A 4HJ5A 3NCYS 2WQSA 1QUQB 1JZ3A 4XT1C 3BFQG 1MRDL 2VZ3A 3C1FA 1BF4A 5HHVL 1TT6A 4PCTA 2P5WD 3GI8H 4Z7VE 5I19H 1X7QB 2ZCZA 3BO8A 3I3BA 3O6FD 5B4MC 3RPIA 3ZKXB 4OHJA 2BVQA 4NQVB 4HJ8A 4OLVH 3BZEB 2Y23A 3CN4A 1QW9A 1KGXA 3M17A 3QO0B 4NFDA 5HI5D 5I15L 5D4IA 4I0CC 5A2JH 5B22A 4G57A 3OAYK 4M00A 4ZS6D 3JV5A 3NCEB 1J5CA 2UUCQ 2PYED 4GMTH 2R1YA 3UBXA 1I3GH 4PRBB 5DS8A 4DV0L 4D8OA 3QIWA 4X5XA 1I1RA 1NY4A 2QKSA 3V6ZB 4IOSD 4C1NK 4GP8B 4A3LH 3M1OA 4X3UA 1T22A 3AT9A 4M4RB 5DYOB 4PJXE 5IVOA 2JF1A 2Y4SA 1VFMA 3OGCB 2VQ4A 4JZJA 3QORB 3N40P 2FSDA 2CBOA 4KKPA 4XCFL 3O2DA 3VD3A 1OM9A 1P9MC 3S96A 1BQRA 1AS7A 3I50L 3CSBA 2OR7A 3PUVA 2HRPH 4U3SB 3RWIB 4DAPA 1AHKA 2L0DA 5EOCL 5LGKA 4HS3B 4HFWB 4YSCA 2J1YA 4MNOA 4WRDA 4Q0FA 3LKPA 3PWVB 2K9UA 4ZO8A 1NANI 3I4NG 4NJ9L 4OF7A 4E5XA 1SMAA 3CFJB 4X6EB 1I9EA 2Y0SG 1VAHA 1A5FL 3D2UD 4NDMB 3GLDA 4JQXC 1DBBL 3F7LA 3WMQA 4OZIA 4RGNA 1YVCA 1JYVA 2AQ3B 2WUBL 1IZJA 3QWOA 4GI9A 4GRMB 2ESVB 4MMXC 4YXKH 4UNVA 4IFDH 1SXSA 4BQBA 2FNBA 2M2DA 2O6EA 2Q2UA 5F1NA 3MXGA 2JCCE 2XTIA 1OD9A 4JFXB 3QORA 1TJGL 3NBHA 2Y22A 3STBD 2BC4B 1Q0XH 4W9FC 1XV8A 3ARFB 3K8KA 4F2FA 4NPKA 1U4LA 1GJXA 4LP4A 2HUHA 4R8WH 5EO9B 5HPMA 2CNYA 4N3TA 1GMEA 1MDAA 5C9KA 2WUBH 4HEDA 1CXHA 1HFUA 4FQHB 3QZLA 3DGDA 1CUKA 3ULAB 3WHE0 4L2LA 5FKPA 1LP9A 2N01B 1TJIH 4F8LA 2YTYA 2I9LA 1NWPA 1TJGH 4FA7B 3T4AA 4JRYB 1YO4A 5EV7A 2BSTA 1Q0XL 2JCWA 3FUNA 3MNDA 1NKRA 2P8PB 1ASYA 4FFZL 5DCCA 1MNNA 1EFXB 2JTDA 3T2NH 1UACH 3UYRL 2CQOA 1CIUA 2V2WA 1K8GA 3GTMB 1S7QA 5IQNA 3CCRA 3W9EB 2X28A 1AXSA 1PH4A 1A6TA 1AZCA 5JDSA 3U9WA 3DIFA 4CMHC 4XH2B 5C9JB 1J11A 1O9ZA 4YZFF 3F83A 3MLWL 1VENA 2LTQB 1SXTA 2DDQH 2DMKA 1TJIL 2K8QA 1IKLA 2NY4B 3I6SA 1E4JA 3BH4A 5CINL 1WTGT 4X6BA 2BDOA 1CQVA 2D7MA 4HK0B 1I3UA 1FPTH 5C0IA 1C7YA 1IYVA 5EO1B 1GYCA 2DW5A 1N0LA 4DUYQ 1LT5D 1PG7X 4ZK9B 1U36A 5DJYB 2OYKA 2QILA 1KENL 4GO6B 4RISL 2V7NB 1VEOA 4HKXB 4L8SC 4PJHE 2F0DA 3CQFA 4PJ8A 4QYAA 2X9WA 3O8XB 1HZKA 1VSCA 2UYLA 1JZFA 2YD9A 3BKJH 3KGSA 3N6YA 3CVHH 4H20L 2DY7A 2R4RL 4AYBG 5C3EH 4HOWA 1XGYH 2DLFL 1DM0B 3U2IA 3MV7A 3ZKMD 4IQZA 2VJ8A 4OWTB 3CC4A 4Y5VC 4WU5A 1RUAL 2P45B 4A3DG 2KEEA 1DLHA 4G8GB 1AGEB 4MMZA 1A7OH 2ATWA 3K6NA 1NBQA 1ZA3A 3S7GA 3MNVB 5DK2B 3CN2A 1F11A 2HFGH 2AFNA 4G9DB 4HIHB 4X2UA 3TBVA 3WENA 4UOW0 4TTDD 2EY6A 1JPTL 2MPMA 1DR9A 1FVDA 1QZHA 4IU3B 2R4RH 2JKTM 3VXME 4R4FH 3H0GG 2R2HA 4DGIH 2UVEA 3OWEA 1U8KB 2DLFH 3D4WA 2B15A 3L3KB 3VB9A 5AFWA 3Q0AA 4OM1H 3AREC 4JI1L 1XMOL 2DJMA 1Z3GL 4R84A 2MJ8A 1MIMH 4F58L 4RSVA 1EK3A 1YEFH 1G8ZD 4N8PA 1HC1A 2YAQA 1JXFA 3Q6FB 1C1EL 4CADB 4RQQA 2HIVA 1JPTH 1INQA 3KXFA 1Q9WB 3SJVB 3VRJB 3G48A 3X12A 4EXPX 4MNGE 2KHIA 2L55A 3T6WA 4OKVA 3TIDA 3I9GH 5LG6A 2YEZB 4LK4A 1NIFA 1CDCA 5GADC 2BZDA 2OL3L 4MRBA 4QT5A 3W1ZA 4TNFA 2HT4D 4QRTA 2KZKA 2YD8A 2ZP8A 3ECBA 2Q7YA 2NTSA 1ZXKA 2WB1A 2WXOA 4XB7A 4GG6E 3IDYB 1O6SA 3DX8A 5MEQB 1O78A 1QPXA 4LU5L 1F3JB 1FFQA 3BLBA 2FX7H 1Y0LB 1KXTA 3FHWA 4DV6L 3QK0A 3MLSH 3MRQA 4WUUB 5BPPA 3WD5H 2HRLA 4QUCA 1U8HB 1UHVA 2FHTA 1LILA 2ZUQC 2D0GA 4HSVA 2GIYA 2OL3H 4XMWA 4KVNL 2EDJA 1XMWA 3AWGA 1MFAH 4L8BB 1QBBA 1I8IB 2BFVH 3VR2A 1YUHB 3VFMB 1BMWA 1E5CA 4DAYB 3BP5A 3D39B 3IDUA 4I0PA 4XWOC 5HHOA 5KUMA 3PHQA 1RZFL 1JQYD 4N6RA 1BHGA 3GJEB 2XRQD 3OHXA 5L2KB 3MRJA 3OKDB 5FK9B 4LUOA 4G1EA 2O5IC 5DU7A 3UIYA 3V10A 3KAAA 2CWRA 2FJFA 3S1QH 3H56A 3L3KA 4RX4D 3Q13A 4I85A 3PPEA 2FATL 4UINL 4KXDA 3C6LA 4XI5D 2CM5A 5DD0H 5PAZA 3LZPA 3AS1A 4JFDA 4NKOA 3SZ6A 3LEYH 1XSOA 4QUOA 1NCUA 4FHBD 1YY8A 1ZLEA 1FVDB 2BFVL 3IMSA 4P2RB 2DI9A 3ATDA 4O2FB 3DPBA 2A5HA 1HZCA 5AVXB 3KYMB 4BDVA 1JD9A 3D3VA 1BCPC 1KDCA 1MCCA 4QIWB 3CFQA 3QS2A 2XUWA 2EYPA 1Z5LB 2FB4H 1YDPB 5D1QA 3LRLA 2JCCB 1RZ7L 1CLVA 2J0TD 5D6CB 4HKBB 3GJFA 1NMCB 2Z0SA 1TZGL 3UAJA 5BO1H 1MJ7H 2VYRE 3P02A 5ISZD 4JW0A 3NJLA 3U0WH 1HILB 2N7SA 3MNWB 5DC9B 2Y7OA 5TE7L 3W5NA 5I74C 3LEYL 3BZKA 2UV3A 4TKWA 1QE6A 4X6CE 5DQ9A 1PLAA 4Y1AE 5C0FB 4CBZA 4MAYB 3FTUA 3S3CB 3GHEL 2DQTL 4IHOB 4B6ZA 1PH2A 1HVXA 3FQUA 4NUMA 1JHLL 1FF5A 3CN1A 2X0UA 3D0LA 1AQ8A 2X53A 3IDGA 4P49A 4AM0B 5BO1L 1VQ7A 2VRKA 2UXBL 3WO4C 3MJWA 4R4IA 2AI0H 2NX5E 2H2PC 2AK4E 4HMCA 1BQSA 4TLKA 1BV8A 3RGVC 1S3RA 2DKMA 3B5GA 2VE6A 3KYKH 3KPOA 2X38A 3KF6A 3P9MA 4W9KC 2X10A 5KYWA 3KDMA 1JJUA 4NO0B 4R5VA 1OXXK 4DPGA 4XH2A 4YVNA 3VG9B 3BW9A 4BH8A 1XB8A 4UM9B 1U8LB 5JEAH 1M71A 1QLFB 1JGIA 4U4BA 1K8IB 2WTRA 3ME0A 5D70L 3T4AC 2YRPA 3DO4A 5GSVB 3KMDA 4U7MA 2F0NA 4L29A 4XN2A 2G3ZA 5C0EB 4G8FA 4G70B 1A8VA 2C9AA 3VI4E 5DC2A 3A8IE 1BBXC 4RHRA 3FQRB 1N8OE 1YEHH 4XBGB 5EO0B 1NGWA 1EAPA 2AQ1B 4LAQL 1CE1L 4P3DB 5HYSA 1X5YA 1DEDA 2A4CA 1QFWL 3FRUB 5HHPB 4MMYB 1BVLA 1RLBA 3AG4B 3KG5A 3OAUH 4XC3H 3P20A 1I85C 3GSRB 5IHZB 2BNQB 4M5ZH 3IEAA 2EE9A 5ELIA 2CCZA 4DR2Q 4YXHH 2HH0H 3U1SH 5EIQA 4MAZA 1IBHA 5FDYA 4UIMA 3SSGA 5AW8B 5D5MF 2VDOB 5D7JA 1RURL 4ELMB 3NTIA 3S2DB 4RCNA 2ED7A 4YSQA 4NCC1 1CE1H 1JFQH 3OJVC 2PR4L 3BVWA 2ZP0T 4PJXF 2YGVA 4GQZA 3VDBA 1AHMA 2I24N 2NNAA 3B2VL 2QMJA 2ZYIA 4FNLH 2VXSL 1LEIA 2QR0A 1M56B 4HUUA 4GS3A 1I4FA 2GFBA 2DQJL 5HPOA 4FQQA 3M7OA 1XH3B 3MUUA 4BA8A 4YFLI 1ZLUH 3W38A 1ZT4A 4YHLL 4A2GA 1PZBA 1TWCH 1XGPA 2YK1L 3FQWA 4TTGA 3GSVB 5IESL 2IPKB 2VKXA 4RSYA 3ER0A 4FF2A 5B39A 4IFDI 1F2ZA 1RJZA 1P7QD 3GI9L 4KX7A 4NEHB 5BRZA 4EN3B 3TS0A 2NPLX 3B2VH 3VXSE 2J8OA 2NLJB 3BYYA 3FT2B 2D62A 5F7BA 1TTBA 1PGRB 1BOGA 5DVOA 3V6ZA 3KLQA 2FEDD 3MROA 2DQJH 4U6YB 4JFDD 4GUQA 2EDHA 2EEFA 4PJBF 1G7MA 4R4NC 4B9WA 1NCBL 3RJDA 2X9XA 3M8OH 2Z4TA 3NHHA 1RUKL 4YBQC 3U2SA 35C8H 2KJXA 2NUPB 1XAUA 5A16B 3QO0A 4ODTH 3DO3A 4U1SA 1J8HE 1Y1WB 1PV4A 3RNQA 3T04D 4IBQA 4KUZH 3RPIB 5EEXA 1U8PA 2YSTA 1XT5A 3IT8D 4LP5A 4KHPL 3LH8A 3GXNA 1LTGD 1PY4A 4YH6A 5I5JA 1P5UC 3FOMA 3ZE1E 2YD0A 4KO7A 5ID0B 2F4VQ 4QD2E 4EDWL 2WSKA 4PD4J 1WJJA 2AW2A 1NCBH 2FQDA 1U3HB 1BWWA 4K2UL 3TVMC 3VWKA 4F7EB 3MRIB 4IK7A 3HJ0A 4ZAIA 1PJ9A 3OMNB 4F20A 2EPBA 1TFPA 5AVSB 4BFJA 4O2EA 5ITBH 5E4XA 2R2EB 5HYSG 3MTXA 5ID0A 3RX9A 4TQPA 2ZX7A 4U3XA 4NKLA 5FO7A 4DR1L 4P2QD 5JZ7C 2MGSA 2QGQA 4FJZA 4LSPH 4PB0H 1E4HA 1PXUA 4UV7H 2OX5A 5B1AB 1M7DB 4DUZL 1LK2B 1NDGA 1UEYA 5EC2B 1M05B 3BQUB 4A3JB 3H53A 2F1EA 3QJVB 5LBSA 2A6JA 1PQZA 4Z95L 3MOAH 2PP7A 3IJ9A 1EGJH 2WHVA 3PGCA 4B0MB 4HG4J 1I85A 3CH1A 4K7FA 2R69L 3U9UB 1B3JA 3RWFB 25C8L 5CBAB 3JBG7 4JFED 5K1JA 5DHVA 1QRNE 1E3FA 4ANVA 1P4BL 5PCYA 3LEXA 3U6XS 3BX7C 3DHJA 3LMJH 3KBPA 3S4SA 4PSPA 4B9PA 2JI1A 4B5EA 4JI7L 3I6KB 4O4YH 4C3HG 1CFBA 3NIFE 5C6PB 4WJ5B 1B4JH 2PNHA 2IXQB 1XBDA 2GJ6A 2AHOB 2VOTA 3HPLB 1VQDA 3MGTB 5DM63 3MOAL 4IK6A 4MAUL 2AQTA 3VWKD 1LTRD 4GW4B 4OAWA 5DSCA 1WWCA 3NFNA 2ITEA 4EO5A 1TXKA 5J6GA 3HFFA 5HYFA 2JSOA 1DFBH 1E50A 2J8UE 3S8WA 4QHNB 4FNUA 5D2NE 3WAKA 2ZE0A 4LF4L 2P8LA 3ARUA 2YPLD 4YSOA 5DK0A 1U6AH 2BRRL 1JWMB 2DM3A 1CR9L 3P4LA 3QNXA 2ENBA 1RZGA 3FB8A 1TVDA 1QSZA 4YSTA 1OVZA 5J39A 1T7YA 5KYLA 2FJGB 5CD3A 3S34H 4H1LB 2DQMA 1IEBA 1MCJA 4AMXA 1BAGA 2Y2YA 3VXQA 2OZ4A 1R3JB 3BAWA 3CV5A 4ZUUA 3RNKB 5HYSB 3RYMA 2FWOB 4FXGA 1BIHA 2BM3A 1CK0H 1NGWB 5EO0A 1HAWA 3OPZH 1TQWA 3JV6A 1BNZA 1BZEA 4N8VA 3UC0H 2EXWC 4N2OA 2WZPA 3G5YA 3EW3B 4LRNL 1I4RA 5KVFL 1WIOA 1PDQA 1HCYA 1W6KA 1XR9B 3FB7A 1CI5A 4XPHH 5F2DA 5C0BB 4FFVC 4IDJH 4B3RQ 1U4MA 1X44A 2GHWB 3I85A 4OB5H 3QYMA 2BIMA 4WI0A 3ZO0A 3QUZA 3UYOD 4HUCA 1PIFA 3J7HA 1HXYA 1RKRA 2ADFL 4KZEH 1HL9A 1Q9LB 1QYGL 5FXCH 3UGEA 1BQKA 1DBAL 3IJYB 4JFVA 1ZAGA 3CH8A 3VXOA 2ICWA 1K3BC 1JE5A 4Y16B 1RPKA 1CK0L 3O3BA 5F3BB 1WTRA 1Z7TA 1EY6A 1SBSL 3SPHA 2P28B 5E0QA 4KJWC 1F4HA 4PGCA 4A2HA 5T1GA 1PY0A 1ADQL 2XU9A 4GBXA 4OFDA 4XPHL 5C08A 3RY6C 3OW7A 3KYOB 1ZV5A 3BPNB 3F2CA 1WTVA 4Q6YA 5AYUH 3ZHLA 1HHGA 4GB9A 4W1TA 4GLRH 4PI0A 3ZW3A 2YAHA 5ELCA 4KKBD 3VMOA 2BXZA 5I0ZA 1S7VA 4YCWA 3K2KA 4XNQB 4Z7AA 2G9HD 1FRGL 4L9LC 1AACA 4PAZA 3OKLB 5I6KA 1JZ7A 2ED6A 2DWSA 3B9EA 1S40A 5HGBB 4NXKA 5T5FH 2XPYA 4IS6A 2OYMA 3E0GA 4EQOA 3ARTA 4H8QA 2DOCA 4KDTA 1LTLA 4DUYL 4PG2C 1F02I 2PYFB 5IOKA 4GKZA 3C3LA 2E6QA 4NM8L 4F9PC 3S16H 1P4LB 2J6EA 3EBAA 4R4BA 2K28A 2OWOA 1KT2A 4U0RB 4NRXA 5IQ7H 4J15A 1MRCH 1EEZA 1T21A 1L2FA 2Z31D 3BDBA 1NMFA 3DXAE 1SYFA 4GKSB 4HK3N 4ONHB 4X99A 2O5JC 3F12A 2ITDA 3UDWC 5CKGA 2WO3B 4CDCC 4RNRA 2ZXRA 3ULUC 5CJXC 4NI3A 4HX1A 3TN0A 1OB1B 3DVNA 4ZAKA 5CEYA 4ZO6A 5C07D 5HDQL 1UXLA 5KSUB 4J6HA 1MRDH 2NOYA 2PCFA 1I9RL 1Z5YD 1EDYA 1GUNA 2WYHA 5KNCA 5E8NA 1RCYA 4MYWB 5L6YL 4UUJB 3K80C 1L9MA 1JUFA 5D2LB 4DQAA 4NNYB 2OW7A 5I15H 2Z8WC 3Q8CA 2SNMA 2ADIA 2MWCA 3AU7A 4QO1A 3DEOA 4U1LA 1JZ6A 1CSQA 1HR0W 2ZXPA 3GRWA 2JQAA 5B8CC 2E7BA 4XT1B 4WUUA 3EGSA 5GISH 5I66A 4M7KL 1OP5K 1I9RH 3BWAA 4QY7A 1G6VK 4K0KQ 3DVGA 3SDYL 1XF2B 1KXQA 3DV4A 1KY7A 1V54B 4OW6A 4FQLH 5DR5H 5E4IA 1LTTD 1S4IA 5EUOA 1LL1A 2WK2A 4JI0Q 4DVRH 1AGFA 4KNQA 2R1WB 4ZQKA 3EXLA 4RA8A 5DJCB 2DYRB 3V55A 1PAMA 3V2TA 1HHJB 4X3SA 3SR1A 2C7FA 3HMWL 2FIKB 5CJ5A 2GJPA 3SE8H 3TZVA 2HRPL 5MEPA 3OKKB 4WCYL 3RURA 3PO3B 3IPFA 1SRDA 3T51B 4K23L 4NNYA 4NPSA 1FN4A 1QRNB 4GKKQ 4YNYA 1BQ5A 4HZLA 4M7KH 2KCCA 4FDBA 4NPJA 3CC1A 4GFTB 3MRGA 4OQTH 1E5UI 3GDEA 1S46A 1A5FH 1OCZB 4M93C 4PV1C 4XZUA 4DVRL 1JERA 2Y1AA 1A6WH 3O0LA 5FUOL 3QIAA 2YRZA 4XQQA 3PWPE 5CUSL 4EKXA 2R93H 4HUMB 3MVVA 4ZD3H 1U0QA 1YJNA 4NPYB 2J4WL 4JY4B 1PZDA 4N2AA 3UJTL 5LUMA 5J1TC 1BLNA 3K6IA 5CIPH 3O6MH 4JZOB 4B0MM 2OK0L 2J8UF 5CEZD 3FFCB 2Y9RT 1DOMA 2QSVA 4NUJA 3VE0A 3HC2A 3Q5YA 3VX0A 4LLMB 4NQXA 1IEAB 3TLRA 2J57A 1E5AA 3L6FA 1KJ2B 3BPCA 5EU6D 2VW9A 1A6WL 1BZ8A 2D5DA 1H5BA 2OJEB 3DIDA 2ZAHA 5CUSH 3G5ZB 5CC4A 3ZRFC 1KGCE 4I4WB 5C4JB 2O5YH 5B4MD 2CGRH 2RJMA 1V3MA 2WLLA 3Q1SH 3GTGB 5F7FA 3OWFA 3B37A 3JWDL 4XO3A 1OOAA 1SEBA 4C4UA 3R0MA 2OK0H 1JPGA 2MOGA 1EEQA 4KI5D 4X5PA 4WV1C 3VD0A 4CJ1B 1XEDA 2GITB 3BPLC 1FE8L 1KJMB 1QR4A 1XTLA 3UI2A 5FA4B 4RFNC 2H6UA 1D5MA 2PW7A 4FQJL 4WWOA 4N1CA 4ETQA 3TDQA 2WXMA 4M4PA 4MKMA 1EY0A 4RCOA 3QISA 5A6MA 2P8MA 4TUUA 3V52L 4ZKBB 3OZ9H 4XYQA 1XIWC 2ZWNA 3MRRB 4IPCA 2JA5H 1UG9A 4OCNC 5FYLE 3VDAA 2ETWA 3A7LA 1QJOA 4LSSL 3L9AX 2NVQB 4JPSA 3VYSA 3UMTA 3ECWA 3FOLB 1PH8A 4ELME 3CZGA 1SDFA 5BZDB 1KDJA 3A47A 2CA3A 1JNJA 1F77A 2A3TA 4LVHB 4WFGD 2UXBQ 3L4CA 4WFHE 1UWYA 4A66A 4BKSC 5G3LF 1B0GA 2DICA 3I3EA 4R3SB 5BQ7A 5D55A 4MD4B 5IT9E 3CFCL 3QPKA 4LSQL 7CGTA 1J1OL 5CSZA 4U3CA 2CVRA 2B2UC 1R3JA 2QELA 2R0ZL 4ZUUB 3UAEA 1V1PA 1AYOA 3ZHNA 3RR5A 1G9HA 2Z6BA 1B3AA 1RUAH 3SCMD 2LAGB 3T6ZA 2JJTC 4AJVA 1I1AD 3UADA 1HTYA 5A2BA 1ZRUA 5C09A 3V4PH 5FYJD 5IT9c 4MJIB 2ZM6Q 2F0TA 2AJZB 4MTMA 4OIIL 1C0AA 5LMUQ 1SYVA 2YZ8A 1XCQB 4YFDB 4A3MH 4MXVF 5D7IA 3FJTA 3BW9B 4UBDC 1KIPB 4JAMB 3ALWA 4NSKA 2MQCA 1PZJD 1DQQB 3QULB 2A2QT 4KBPA 3EO9H 3WHXA 1BJ1H 3IVKA 4RAVB 2V4LA 3V4LA 5SWZE 1Z3GH 2CLVA 4LUZA 3E3QE 1FNUA 3ZE2F 1IGJA 1PEWA 1YUKB 4OZHA 3TEUA 2AXWA 1WD1A 1AOHA 2JB6B 4G82A 2VUMH 3BAJA 5DSCB 4QRQA 5I16A 2D7OA 3WKQA 3B7TA 4DR2L 4ZSOB 5EU6E 3BWZA 4WW2F 4WI6A 3THMH 2QPEB 4ODGA 4OZGF 4HGKC 3FT4B 4JE4B 4OZGB 4OGYL 4C56E 2E8YA 4F92B 1FFNA 5JYMA 3KL3A 3SCMC 5D1QC 3VFUB 4AXWA 2R7DA 2Z92B 2B2XH 4A7TA 2QV4A 4YDIH 1AIZA 3V6OC 1H95A 1CXEA 4NAQA 1MCBA 1UZGA 4NWTH 1IYUA 4ZZKA 4B3EA 1IBML 1HHVA 2PYEE 3BMVA 3WTUA 1NPJA 3S16B 1JXDA 5DS8B 4R7VA 2YSSB 3MLSL 4IMKA 3P4MA 2PZTA 2C35B 3VCLB 4FXGC 3N06B 4Q4EA 5CP3H 2YC1A 1PH9A 1JNNL 5EULV 4JANA 4LKCB 5BW7C 4WWID 2MO0A 2ADGA 5IEHB 1J10A 1EQTA 2DEXX 1YHAA 3FH8A 4MZIA 4KD3A 2BVOA 5DVMA 2AXFA 2Z4IA 2H3NA 4Y4HA 4X5WB 2KEDA 1ZJBA 2BP0A 2HIXA 1AE3A 4WWKC 4YIQB 1QLEL 2IWGA 2J1WA 4G1EB 1QUQA 3NQTA 2CHZA 3QQ4A 1D5XC 1LEKA 1VFBB 3GJEA 2FATH 4UINH 1TYJA 3JWNE 1Q1JL 3MACL 5I1AA 1NKOA 4K9EH 3J80L 4FQXB 3C6LD 2ED9A 3FTZA 3IGAB 3KGUA 2BP8B 5KSVB 3NIFB 1AZQA 4ETQB 4EQ5A 3HB3B 2W92A 3HOYH 5GZNC 2J7ZA 1HQ4A 3VXNB 3VXTA 3BN9C 1JV2A 3N1GC 2CRZA 1JGEA 3L9EA 1YEZA 3I02A 3MODH 4QR7A 3U2SB 3CE1A 1TZGH 3QJYA 5AVQB 4FNPA 4DEPB 3S8FB 3DX8B 4OZHF 3D0FA 1Z9SA 1SDDA 5AVVB 1CDGA 3HIZA 4HEMA 4YPGA 1EOVA 4JBKA 4HS8H 3LYRA 4N2DA 1P2CB 4CU7A 3QXAB 4JG9A 2YU9B 1DJGA 1G94A 3VGBA 2F0VA 4E9TA 1LYQA 5SWZD 3OD3A 2KCTA 4WJWA 4N25A 5KZCD 2YO3A 5DT1L 1YN7A 3GM8A 4JO2L 2DQUL 4CW1A 2VTFA 4V2CB 2Z64C 5EBMA 2AABH 3S0PA 3PIP3 1BW8A 5I76A 4MLIA 3EF7A 5DJZB 4TQ8A 1INEL 2OMWB 4M8UA 5H2BB 4YHPA 5GGSB 3J7YW 1NR4A 3TH3T 1UOWA 3GPSA 5T3ZH 4E9SA 3WTYA 4LLWA 4NI6A 5IKCB 4PJFA 3CCHA 3MRBB 4LKXA 4EEEA 1BP3B 1H5BC 1LEIB 4PJFE 5CGMA 4AYGA 4KJOA 4UYQA 5DD1H 3MJ9A 2WCGA 4XWGL 2QVMA 4JO2H 4N2IA 4GW1A 1XB6A 3L3IA 3P30L 4LVOB 5GRXG 4KTDL 1FC1A 4OIKA 4PTUA 3WELA 4K3EH 4AC2A 4KK6C 1JCKB 4Z7NF 3O6LH 1H6FA 3U0PA 4A3IH 4N0CC 1TQBB 3T65B 3PUWA 1T04A 3MXUA 1O7DC 1Q1BA 3TYGL 4UQEA 4F57L 4BBRB 2BERA 3T0EA 2F0UA 4PP2A 2H9GA 3CAFA 3S5YA 2NYKA 2R1WA 2L5TA 3OPUA 4LF9Q 4PCYA 4OU3A 3DKHA 4XC3L 4ZQKB 4DK6C 1E67A 1MLBB 2EDDA 4OCRL 3FQNB 4G7VL 4LEXH 3G3LA 1MCFA 4KUCF 4IBUA 1LO0L 4XBGA 4JDZB 2G2RA 3MV7D 5IJKC 3WMPA 1FGNL 1EMTL 4WO4D 1FP5A 3PG2A 1L0PA 2WAQA 1N34L 1JE6A 2ZCKH 4AIOA 1D2OA 5HDBE 4F57H 1ACZA 4RH6A 4UYPA 3S5LG 3F62A 1YPZB 4UQ3A 4X6CA 3WEXB 5I8KH 4G4KA 4YR6A 2RALA 3T1YL 3FSVA 3S15B 4QHPA 2O5NA 1HXMB 4OCRH 2A19A 3RPKA 3GS7A 3APNA 3VWJC 1YECH 2VXSH 3IL8A 4E36A 5KVGL 4MNGB 4DV4L 1A4BA 1IE4A 2XIBA 1CVRA 1YNTA 2B2YA 3MXWH 4RGMC 4MDRA 5BUGA 3REWA 5IR1B 1S2EA 1YMMA 4MASA 4NKDA 3INUH 2ZCKL 2H8PA 2X40A 2YK1H 3FFDA 3MC0B 1OGTA 1OZUA 4AGNA 1TZHB 4Y4KC 3BZFA 3TXAA 4JZJC 4C3HH 3F12B 3DGCR 4V11A 3CFKA 3UE1A 2RHSB 4KJQD 4DP8X 2R29L 3O2WH 2OCFD 4WI3A 5T5NF 2XBTA 3LNNA 4IEFA 3N04A 4F7TA 5IVXA 4P3WA 1HUMA 4AQEB 1L6ZA 3VFWA 3UAAA 3VMPA 4EBQL 3GUTA 1C9OA 1JYNA 1DL7H 1QSFE 1Y14B 2NTTA 1NDMB 2M00A 3ULUE 5ELNA 1L5GB 4BRVA 2V1CC 3ARVA 2A9NH 5MENA 3CCJA 1STAA 4AG4H 1JCKA 3J81j 2FYYA 4JKNA 5F7EL 4F2EA 4XMPH 4KUZL 1EGJA 1HJPA 4ZW3A 3A0OA 4L6TB 3E1ZA 1SMXA 4LFBQ 4FZEH 4RFEA 5JYLA 4JZNA 4GLVB 4O2FA 3BVDB 3S3JA 1EYCA 3D69A 5BO0D 3I73A 3M85A 1WFOA 2VZAA 2YU9H 1DL7L 2XT1B 3P0YH 4I2XE 3VWKC 4BKLB 2RSNA 2X69A 3SKMA 2AS5M 4HS6B 4A7QA 3FCSA 5J13C 1X9UA 1MOEA 2A77H 2A9NL 2FJFB 3CZNA 4F88A 4AG4L 4NW2A 1KFAL 2LAAA 4R2GB 3H3PH 2LLGA 5JMOC 3SK5A 2UU9L 1LO3H 4ZBJA 3SDCA 3RZOB 1V7MH 3AS2A 1KIUA 1I8UA 5HGAA 2L7JA 2X1XR 1CD9B 3JC66 5FV1L 4LSPL 1GYVA 5C5MA 5ERWB 1ILSA 2WVSA 1BJ1J 4LP8A 4G6AD 5IBLD 2P5ZX 3KW8A 4CDHA 4LCIL 4NKMA 3VH8G 1KFAH 2PW2B 4JJ5B 5DHYA 5FGBA 1I53A 1SDDB 2F53B 1Z9SB 3LQAH 1EV2E 4XNAA 5HHMB 5JR1L 1LO3L 1J9TA 25C8H 3QJTB 1IHZA 1OSEA 3NZUA 1E6JL 3IF1B 4DV5L 1CL7I 2GA4B 4OO1H 1YEWA 3LMJL 5C97A 2WTOA 5DM73 4QNPF 1ZHNA 2E46A 5LWYL 3V8CA 3CSYA 5EZOH 5J12B 1Y1WG 1NEUA 5DRNB 3EYSH 2FIRT 5IFJB 1NGXB 5F7HA 3HE6B 4EVOA 5C8JA 2F0CA 1K4DB 1TU2B 2F0FA 1AC0A 2Z91A 4AYFB 2IDFA 3EDJA 4TQUS 1SFDA 3MRDA 4QRPE 2YD4A 4MA1C 2ZXEB 1GZQA 1IBDA 1QHOA 3FT3A 1FL0A 2VDKL 4NN7C 4BY1G 1VJSA 3O4LA 3TBBA 4P2OC 2EDQA 3PHSA 4GBXC 4GSDH 5EU6A 3S37H 3WFCL 5LWYH 2K5WA 5KANI 2R2HB 3S97C 2WXNA 2F53E 2WBJD 1X32A 1EHAA 3NFNB 3BGAA 4ODBD 2SOBA 3TL5A 3HOXH 3LH2L 5IGDA 4QXGL 5FA3B 1R9TB 3VGAC 4JUSA 1STEA 4LF8L 2BK8A 4FO2A 3B6YA 3P4MB 4FULA 1RK1B 3MJ6A 4IBZA 4IRZA 2QCPX 2PWEA 4PY7B 3VCLA 4WU7A 3SB3A 4KHTH 2ZXDA 2RACA 5F89B 2F8VA 4WZ9A 2B1OA 4PJIA 1J0YA 3GF8A 2BZCA 3S3SA 3N43F 5EOTA 3S37L 1K4CB 3WFCH 4DCQB 2EUZA 4WK0B 3PAYA 2PO4A 4P72A 2XQBL 3VI3B 3QXAA 5CR8A 2IBZX 3K6OA 1UZ8B 4QRPB 5AQ0A 5BZWB 2DEYX 1FZJB 2Y06L 3SE9H 5CJOL 2WKDA 4P5TB 3O8XA 5CMDA 3SE4A 3W5OA 4PY7A 1RY7B 4OLUH 3BQUA 4BFKA 5BUPA 1M2VB 3WE6B 5FLVA 5IOPA 5FA3A 1G7HA 4UU9B 5IROA 3GM0A 1SM3L 4PJBE 1QYGH 3UEQA 5I1DB 1DN0A 5JUEL 5L7XH 2J5WA 1HNXL 1DBAH 3IJEA 1M1KC 1I94L 1MW3A 3PWPA 4IMLA 3D2UA 4B9FA 2XQBH 4ZS7H 2UXVA 3FTVA 4O2EB 2CLVB 3LNFA 4PLOB 5C3XA 1ZVSA 3D1MC 4S1DD 5ICXB 1NWOA 2B8GA 4KITB 2HKFH 3FT3B 1FL3B 3GSWA 1C16B 1YNJC 2Y07H 3I70A 3QYCA 5CILL 3T3MB 4GUCA 5JDSB 5JXEA 2NY1D 2QSTA 3UXFA 1RULL 4EZMA 2VSDA 4HBCL 3QZPA 3POCA 2ED8A 4NM4H 5JUEH 4I89A 5EFIB 1TG8A 1T5WB 2VO8A 4GJTB 3RNQB 4OUOA 4NUQA 3ARDC 4ZS7L 5ESQB 3IRPX 2VERN 5HVFB 2K6WA 1C8CA 5T5FA 2OQKA 1AIFA 3PUUA 2DNCA 1IJNA 5IEKB 1KYOJ 5AYQA 3IMVA 1BQLL 4K8IA 5CCGE 4B50A 1EZSA 5IYBG 4S1RH 5GGUA 1KEML 3WFDL 4NT6A 4NM4L 4DR7L 5AOZA 1LJMA 2DTML 1F18A 1NIDA 4IRSA 4ZFZB 5E4WC 3LX0A 1U8MA 1V3JA 1CFNB 2AK4D 3QQ9C 4MB3A 2RMNA 1HSAB 4OR1A 2Z92A 5D8JH 2B7DT 4AQ1A 5IJCC 1HFNA 1JMZA 3HE7C 4JFWA 4C4KT 2BSEA 4PJGA 3QWOB 4DP7X 2Z7YA 3ETSA 1X5LA 5HDQH 3MEFA 2YTVA 3A8JE 3D52A 3FCSB 5ANMA 2BVEA 4JQIA 4HOXA 1DXMA 1D6VL 5T1LB 2DLTA 3KDPB 1DVFC 1QHPA 4K8RC 5CBEA 5L6YH 1IVTA 2IEPA 5IY5B 4G3YL 4NZUL 4J3OF 2GITA 4G6KH 4RAVA 3NABH 4QIWE 4HUVB 2GKIA 4TNVF 3GTLB 3TT1L 4C4KO 4EUPB 3GWJA 2E2IH 2WNKA 4Z0XA 1CFNA 3VUAA 2RFXB 2JQMA 3OGCA 2APVA 3QXVA 3MRMB 3UTQA 4GZYC 3QFJE 1A62A 3OJDA 1NDMA 4XN5A 2F5BL 2RBMA 3S8GB 5F3FA 5LKNA 1F4WL 3I2CH 5JLZA 4LLMA 4G6KL 8FABA 3M3YH 4J2QA 5K9KA 3IMBA 3BFWA 1QA9B 1LDPH 3K1KC 1MW0A 4PB9L 4MXQC 4K8JA 2IW3A 4Z6AT 2EYRA 1HR0Q 2CO2A 1WCMH 2WM0A 4NQVA 5E7NA 1BFOA 4G7QB 1BCPD 4PRDB 4MNQA 4Y1TA 3LQAC 1QG3A 1T5WA 4U6TA 5BQ7B 1KSRA 1XF5B 4L29B 1TZIB 4OQTL 2PNRC 4NKDB 5SWSA 3HTLX 1U8CA 2IJ0C 5IJVB 4QB4A 4DIXA 3V5DB 5FUOH 3NJXA 5EU3A 1MGSA 4P2CB 1OE2A 3BG3A 4HCIA 4DFHA 2PCPA 3CKIB 4WNQB 1W0WB 4ZD3L 1X9NA 1QR1B 1WRFA 4NUPA 4YDZA 3PAZA 2IH8A 4FLHA 4HF5H 1NC4B 4P23A 3D2UB 1E27A 4IMLB 2XXMB 2E59A 3KPRD 4ENEC 2A0LD 4NQEE 2EDMA 1ZYRC 3FYEB 4N1EA 1TVBB 4R97C 4TUOB 4LUVA 3PWJB 5CV8A 2FWUA 4XTCS 1I7RB 3HN3A 4UDUA 5JIQA 1URIA 1DQDH 1HJBC 4TNWK 1DQVA 3L3JB 3Q1SL 3WMSA 1IIIA 1GHJA 3IFDA 2VDNH 1ED3B 2WNGA 2MSPA 3EGXA 5JXAH 5K5YA 2WB1G 3UH8A 4BV1A 3S1RB 5EOTB 5CLTA 2W38A 2APWA 3BVNB 5AZEH 2GW5A 5EA0L 3RWCB 4HV8B 2OXGA 3DSFH 4S1QH 4GP4B 4P8QA 1FL6A 1X3DA 3RVWC 3N50A 4BH7B 3I84A 4PRPB 3PP4L 2XWZA 3QWRD 4FQJH 4KGLA 3JWNG 4KKLD 3PWLB 4AIEA 5KSUA 3QXDA 2J8UA 2FBRA 4JL2A 3UTTE 1U2HA 4IMKC 5ALBH 3D51A 4ZODA 4F15B 1YNTF 2R29A 5C0AE 4AQYL 3HUJF 1VDZA 4Y7NB 4B9JA 4RGOS 1E0BA 2GSIB 4OIBA 4QCLA 4RESB 4RNRB 5E8EA 5EU6B 2G4GA 5EUKA 3S9DB 5L37A 3CBJB 2VDMH 5AZEL 2C1PB 4PD4K 5H2BA 5GXBB 1NGZB 2EXWD 5JVG3 4ATWA 3OHXB 1MW2A 5IZ7A 4FHKA 3U0TB 4ZZFA 3IGKA 4OY9A 3SDAA 1CGSL 3BQUC 2EO9A 4QXUH 5SV4A 3BEWA 3QH3B 4NBXB 3C5ZA 1TY0A 3RD4A 4PCKA 3CFCH 1P6AB 1G1CA 2B2VA 3VTAA 1KTDB 1FNGB 2Q8IB 3WL9A 1E65A 4P2CG 3NSCA 1PYSB 1L0YA 1DEEB 3GZKA 1AMYA 2BCMA 5J0BA 3QRGH 5D7SL 3RKDD 1PS3A 2VITB 2A5UA 2B39A 2EABA 4JFFE 4ZPVA 2E2IB 2VDOH 4CHTB 4P2RE 1N6VA 4J3WA 1ZSDB 1EYAA 3W11C 1PCSA 2XWRA 4OGAD 4CSPA 4B95C 4Z7NB 1AHWB 4F2MA 4LLYA 5I1IL 2K3HA 2D9UA 3HE7B 1C5CH 2RGSA 3EO9L 2F4IA 4P4KD 2ADIB 2NR6A 3ABLB 1Y18A 1II3A 3F6IA 5D7SH 3SQBB 2JA7G 1A3UA 1KTKE 2ENPA 3O3BB 4HIIB 4CADA 3QIUA 4F91B 1VEMA 1A4JA 1MQKL 1R5VB 4F1SA 5LMNW 3W37A 4UWQB 3QUMH 4YE4H 4LLUA 5C4HA 4QJFA 5FYLL 4K5PA 1TITA 2AXGA 4JG0H 2OPCA 4FFWD 4N8VG 4LQFH 1L7TH 5BVPL 4LFCL 3ESUF 1JDDA 1T1WB 1MHPH 1HHHB 4Z76B 2DMHA 2ENYA 1L9TA 3HOVG 2BLFA 4MFHA 1A2YA 3I9AA 5C0GA 3NP4A