3K0YA

Crystal structure of putative toxin related protein (yp_001303978.1) from parabacteroides distasonis atcc 8503 at 2.16 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
198
Chain Sequence
b'DIWIAVATVVPEGNNVYYLRLDDGDKLWPAATNYPNYQPKPNQRALVNFTILADSHYIKVNAIHNILTKSIAKNEGAANDSIYGTDPVSIYNNNMWIGDGYLNIYFETLWGGKTAHFINLIQPDAENDPYTLEFRHNAYDDPQYTIGAGRVAFNLSSLPDTKGETVDLVVNYWTSEGKQAYKLKYNSDKTKMNITDMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TOXIN related protein
publication title Crystal structure of Putative TOXIN related protein (YP_001303978.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution
rcsb
source organism Parabacteroides distasonis atcc 8503
molecule tags Toxin
total genus 44
structure length 198
sequence length 220
ec nomenclature
pdb deposition date 2009-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3k0yA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3k0yA02
4PQXA 3QWNA 3K6OA 3NQIA 4J8QA 3K0YA
chains in the Genus database with same CATH superfamily
4PMEA 1QW9A 1PZJD 4J6RL 3HOUH 4ZUJA 5K9QG 1T7WA 1PFMA 5IW6A 3L95B 1JP5A 3SQBB 4JFUA 4IOSD 2B1OA 2J8UE 5L4MA 4UV7H 3HHMA 1PNCA 1ZDQA 3I84A 4CRPA 2AJUH 1I9JL 1JWSA 1IMHC 4YIJA 3HC3L 1DJIA 5AKVA 4B7IA 4L5FE 1BFSA 1XB8A 4F7EA 4NQEB 1D5ZA 2QVFB 1LEIB 4XIGS 5CV5A 1EU3A 4K2UL 1R9TH 2FB4H 3Q7JA 3U46A 4F8TA 5C0GB 4A3IB 2HG5B 3B2VL 1NBCA 2QDBA 2NY3D 3NIDB 3MRMB 4S1RL 1MFAL 1RTNA 3H0GH 1MUJB 3QRGL 4KNUA 2ID0A 2HQLA 2IQAA 4UB0L 4ZZFA 3BLBA 1CU4H 3PHSA 3DURB 5BPPA 2W60A 4JY5H 4C3IG 1T3FA 1JMXA 2QQQA 3D50A 1XEDA 1TZAA 1RMFH 3FQ1A 1NC2D 2KH2B 4NP4L 1BBDL 3ILEA 5LWYL 3NTHA 1IAIM 3GIZH 2VQUA 1KIPB 3U4EB 1AI1L 1DVXA 1YEGH 5L8KB 1MPAL 4J39A 2WUCH 3WHXA 5BRZE 5K36G 1KJ2L 1RZFH 1VADB 3M86A 4Y9CA 3SYAA 2P28B 4MNQB 2YGNA 4Y19D 1UUNA 2AQNA 3UOAB 1M3IA 3IGKA 2NNCA 1DQTA 4MDJB 2HTKD 2OAAA 4HR7B 4JK1C 1R5IA 1OCZB 2OMZA 1QEWB 4Y1AE 5K1JA 4DNTB 4X7SH 4IRSA 4PJHB 1I3QH 5F71A 3DECA 1TVBB 1WTRA 3P2BA 1V7NH 3UO1H 1MLCB 3AQYA 4YHHQ 1AIFB 3QHZL 3QQ3A 1STEA 2EVBA 4KKRA 5LCVL 2DQGH 4I0PA 1NAML 3O4LD 4WJ3M 2Y2WA 3B34A 5EA0H 5FYLL 1F4XL 2CBMA 4IBLT 4HMJA 2OZ4A 2CBQA 5D7SH 4JRYE 2NY6C 1YY9D 2WBKA 4GXUM 2DJUA 3WDNA 1TWAB 1P0SE 5IIEB 4A75A 3FT2A 1HEJC 2Z8RA 3I56A 2G9HB 2RALA 4PWHA 3S7GA 1HL8A 3Q23A 4MA3B 3WNMA 1PDKB 1GGBL 2OL3H 1CFBA 1T83C 2X4SA 1EIBA 4C55A 2SOBA 2OS7A 4UAIA 4JQIH 5HHQB 3TN0A 3RWCB 1EUUA 4O2FA 4LAQH 1O6TA 2JN4A 3NN8A 5MEPA 4XHQA 4ZMZA 4TPRL 3GQBA 1PV4A 4G43B 3SKNA 4IFDG 3QJQB 4GO9A 5DTFB 5I8KH 1BA9A 2VQEL 4X98B 5D5MF 3I2ZA 1QTSA 1XGQA 3ARYA 5LXGL 2DW5A 1DQLH 4CVUA 3S4SB 1RHHA 3T8MA 1HNWQ 3V5KB 1UEAB 1MWAB 1AJ7L 1T1WB 4DERA 4R7XA 5K9OA 4C2MH 3T65A 4ZNEA 2WC7A 4AK1A 3VXRA 3GUTB 2MOVA 3PNWA 4MYPA 3RVXC 1M8AA 3H0TB 3QDGB 4XBEH 4LLUB 4FA6A 2XIBA 3UXFA 4FNQA 5E2UL 3H55A 2VXUH 1G6RA 1HHGA 4H88H 2XZQH 3WCYA 1HL4A 1WHOA 4RZCA 3ZOAA 4KI5E 4QY7A 4I3GA 2UUAQ 1ZD6A 3NCXA 2KLRA 2D62A 3DSNA 3QIWB 1DSYA 2QADC 3GHBL 4GUQA 3MJ8A 3TVMC 4BWUA 1S72A 4YK4C 4DV1L 3P0YH 4JRWA 4XVJL 2EVIA 1U92A 2GCYB 1MGSA 3BAJA 4L4TA 4JM2C 1CXEA 5GROA 4NO3A 3X3FL 4BZ1A 5CS7A 1DCLA 4N0YL 5BMFL 2OULB 2KLSA 1QR4A 2K78A 4XNXH 4RCAA 4CVXA 1V7ML 5LGHL 3CFDA 4MAYD 1RTOA 1F58H 1V3KA 3BFQG 4Z95L 5AD0A 3TIDB 5IP4A 1WAAF 3S1NH 3FO0H 1MFCH 4A63A 3UTTE 3WTTA 1T0OA 2FO4B 3R0MA 5DSCB 1UOLA 3NCYS 1QBBA 4HJGA 2OZ4L 2JJSC 1UWEH 3PL6C 2Y0SG 1R4XA 4MD4A 2XICA 1TQSA 4CW1A 3EFDL 2FVNA 3BEWB 1OK0A 4B27A 4X4YB 1ZK5A 2ZX5A 2VIRB 3S14H 2N01B 3ECUA 1B90A 4HHGA 4CUCA 3VFWA 1LO0H 4G57A 4XMKH 3NIGF 1HTLD 1COBA 3HS0B 1GUGA 3HC2A 1LNUA 1SBBA 1ZLDA 3CN2A 2OM5A 3S3CB 2W94A 4CC4C 2CJSA 1HSAA 1OM9A 1WLHA 1A5FL 3ARRA 1UZGA 4PS8A 4EIBA 5EBMB 2FDBP 4ABUA 1MJUH 1AACA 4NGHL 5C0EA 3EJRA 3FHAA 2SEBD 1KCSH 2UZYB 4XRCA 4C83A 1RZKC 2MOGA 3F7KA 4Y4KC 5I2IB 1K4DA 4P74A 2YGQA 5IT2L 1G0YR 1E8XA 3L4UA 1ZLWK 5E23A 4NPKA 2W5PA 4OLYL 1EYCA 3CD6A 3AU1B 4H8WH 3DRTA 2FSEB 5I0WA 1RJYA 4E9VA 3B7UX 1IEBA 1EEID 1ENFA 2WQ8A 3BE1L 4G82A 3NSDA 4OKDA 1QPXA 1ZTMA 3JWOL 1G7IA 1G6RL 1GIGL 1FVDB 3F04A 3B43A 4K5XA 1LO3H 2CMRH 1MREL 4Z7VB 1KT2A 3NE5B 2J4WL 2K5NA 3GSUA 4J28A 2XXGA 3VD9A 3J7ZC 1DEEB 2DIBA 1UEBA 3KD4A 1XPUA 2WWMC 4JREC 4KH9A 2R8SH 1A9EB 1WJ3A 4X8CA 4BZ1L 3K5LA 1KSRA 2AHIA 4LASL 3SY6A 4X5XA 3AW5A 4XMWA 4UCFA 3T3MB 1HKLL 2F19H 1U91B 2P8LA 2WXGA 5K9KB 43C9B 4BSWA 1UE1A 1V5JA 4B9CA 3OWEA 3K7AH 5CV8A 2A19A 3LWEA 3HUJF 1T83A 3WFDH 2AV1B 4ENEC 2XYCA 4JRXD 3CH8A 4JI8L 1NGXB 1M7XA 3N40F 4FYQA 4J3OC 3VJ6A 4QOKE 1TT6A 4Y2LA 2C34A 3MRNB 2R2HB 1A4BA 3NP3A 2EECA 1ZVYA 4U6XA 5C07E 3GMLA 5GRUL 4K9EH 3HB3B 4J3VA 4YHML 4AIXA 4AIOA 1L0PA 2X0VA 2NUTA 1AE6H 4HBQA 4PJDA 3UTSD 2R9HD 1TCRB 2PW7A 4P9MH 1CO1A 3NQTA 4OZIA 2K4AA 3KR3L 4I2XA 2CCWA 2CM6A 3ELQA 4OM1H 3VGEA 1H3PL 3BDYH 3CN3A 3KL3A 4QXUH 4XNAA 2CVRA 3HOWH 5T1IA 2H9GA 4DR1L 1LV9A 1IGYB 5JNYB 5KVDH 1U8QA 1SXCA 2ATPB 2I5YL 4GQRA 3C5ZC 3VX0A 3GTJB 2C3WA 2XWCA 2NY0B 2GC4C 2ZUSA 3OF6A 2HDMA 4WFN3 4R1JA 2W81C 3APMA 4RCNA 1YN7A 4NEHB 1X5HA 4GKLA 4NNYB 4U2ZA 5FHAL 1UD8A 1WFMA 3BAYA 4GY4A 4MXVE 3X14A 2ZOUA 3OD3A 2L15A 2RDGA 3CSTA 2HLAB 4FNTA 3TS2A 4CSZA 5L2KB 1T22A 5AVRB 4YHOL 4JM2A 3VQ2C 5F7KC 4QLWA 2WBJD 1KDJA 1FO0A 2W9LA 2GC7C 3DGGA 1FUNA 2E86A 1MW3A 1RK7A 4F2EA 1DSFH 3SKJL 1X44A 1TZ8A 1Z0MA 3N85L 5L9DH 4MMXC 4GI9A 4LF6L 1Q82C 3N1FC 2Z93B 4W4OC 5EN2B 1XCTA 4BQBA 4F1ZA 4ZMTA 4OZHF 1Q46A 3E2HC 2YKLL 1QRNE 1UCBH 1O5PA 4ZQKA 1GC1H 1G7PB 3Q1SH 1MZZA 4Z7UB 4AGQA 2JJSA 2QFRA 2B2UA 3T09A 2Y24A 2DBLH 3I2CH 1STAA 1CGUA 4R4OA 1B4JH 4PB0L 1ADQA 3P1VA 3QUXB 3J81L 1U3NA 4P2RE 5FKAC 2CKBB 2P44B 4P5TC 4YXKL 1A6UL 4JKWA 4N0FB 1LEKA 1CFQA 4HLEA 4FZEH 2W92A 4PHXA 4OZFH 4ZKCB 2ADGA 4K55A 5B1JC 5IQ9B 4CC4A 3QYNA 4TUKH 2Z7UA 3AABA 1QFWH 3LPFA 4NBZB 2BY1A 3E8VA 1N70A 3H7BB 3P4OB 4X7FC 3X12B 4F27A 4QL5A 1I3RA 1EANA 1U30A 2AI0L 4PLKD 4NYLB 1J5EQ 5C9JA 4PJGF 2F5BH 4L3EA 4IGBC 1CGSL 3EADA 5JPMA 5J1TC 1PTOD 3GMOB 1CFMA 1J05B 4RKLA 1JGUL 2O4EA 3DYMA 4OZGE 5DRWB 4YR6A 1NMBH 1BG1A 4O2DA 1XGYL 1NKOA 1XD1A 3IDXH 5KANG 5D7JC 3GZQA 1FYTA 1XNQL 2UX6A 1L5GA 4APQD 2OLDA 2Y23A 2TMPA 2AQTA 3BISA 5A6IA 1PZKD 4PJ7B 5KJRH 1W16A 4UZSA 1DYZA 4K7FA 3ARPA 4FO2A 4IKJA 3M88A 3VSTA 4LCYB 2EYFA 4HUVA 1ZLUH 1PD1A 1A2UA 4TRDA 1XGRB 3BJLA 4NN6B 3BLPX 3DBXB 5K9QI 3N06B 1CT8B 4C3JB 5LGYA 1FO0L 2A9AA 4R83A 5EDXA 5CU9A 3ZHFA 1TWHB 4F24A 4M5ZL 3U25A 2A7BA 2VDPL 3N55A 4GRWE 5E8NB 4NPYA 2XCMC 3I50L 5CUSH 4PJCF 1V10A 5E1IA 2VR5A 1Y0LB 2EDTA 3SEPA 5FOBB 4WFGE 2CQVA 2J43A 3SDDB 1H15A 3VI3B 5F9JA 2MSPA 1ZYRD 1NCNA 3S35X 4UQ3A 4A7VA 2CRMA 4IIQB 5MEOB 3V9EA 1ADQL 1MFBH 2LSSA 4NO0B 2DYPA 4XN5A 5DD3L 4O2EB 5E9DB 3WKMH 2O6DA 3NQKA 4XXDB 3EJJX 3HN3A 1SDAB 4AYMC 4K3DH 2YRZA 1F9SA 4Q5VA 1EX0A 1YQVL 2FJHB 5IGFA 2HKFH 1YNTF 32C2A 3JV4A 2WP3T 4GXVH 3VWJA 5HYJD 2FQGA 2EEBA 4QY8A 5D93C 3OAYK 1YN6A 4XVTL 2MP1A 4HVBA 4B7LA 4FLQA 2VMDA 5D1QC 3RKDD 1OSPH 4AGOA 4XNMB 1XTCD 2A6HD 1HL9A 1TFHA 4WCYH 4BFIA 5IQ7L 2EDXA 1X5XA 4JC0A 2YZ1A 2Z7YA 1Z2KA 2VDML 3C5ZA 1RZKL 3MRDB 3PP3H 4K07A 4MAZA 2RKSA 4NUPA 5F7YC 1M57B 4AQAB 5ESQB 1H9DA 5I6OA 3MGTA 1PTOH 1ES0B 2AJ3A 1BF4A 4PY7B 4K6DA 2ZONA 4ZFFA 3FTGB 3STZB 2MHVA 2RQ8A 2E27H 5J8OA 2PCPA 2EKSB 1HNYA 2VN7A 4JHUA 2F0IA 4Y5XB 4D9QE 4ONGH 1AG0A 3RPKA 3WNOA 4PU2A 2Z31C 5J1AB 4E41D 5H1SE 3GSOB 2VQ1A 4L4VD 3D3VB 3VD0A 5E6UB 5JXAL 4O58H 4G7OC 2NXZD 5BZZA 1I3GL 3C8DA 1WTGT 4RFBA 3DTXB 2HKAA 2WLLA 3EFOB 1A8JH 3CCSA 4GN4B 3FN3A 5K39A 2Z9TA 3R06A 1TS5A 3QXUA 1E9QB 2QVMA 3BCDA 5TF1H 1T1YA 3CVHL 4L5QA 1QZNA 1BJMA 3OKKA 4HWZA 3FQTB 1WZ1L 1JWMD 4BXSV 4XXEA 5TE7L 2RB8A 1S78C 3MBEC 5BRQA 4QCIB 1I7RA 1IV8A 4CMHB 2HT3D 1HSBA 2CIIB 2MPVA 4OKVB 2E5LQ 3BPOB 1EFQA 5FKAA 1VESA 5AW0B 2UUBL 2G2NA 2XY2A 1QOHA 4P5TA 3AB0C 4ZD3L 4APXB 5AW5B 4GN3B 2XXMB 5IVXA 1G7MA 2OEOA 4IFDI 4H25A 4R8WL 2D8KA 4IQHA 4HIIB 4MQ7B 1XWVA 2G3XA 2UZXA 1C12A 1ZEAH 2J44A 3BFWA 4PJIB 2DKMA 1EFXB 1TCMA 3VYTA 2X3AA 2YN5A 5B21A 5LNGA 3N43B 1ZLVH 3DXAA 2K03A 3K2IA 2JI3A 3GMPA 4XO8A 5EBLB 3QJOA 4X4ME 2NZ1D 3MLTA 4U3SA 4MCZA 5EZJA 5L8LB 3WMPA 2VMEA 4URKA 3MA7B 4Z0BL 3IETA 4JFVA 4QHLA 5GZNA 3RL2A 3D4RA 5TQ2H 2HT4C 3TBCA 4CKVX 4JI0L 3LRSA 3TGXA 1YBYA 1EZLA 4IBSA 5G5DB 2KEDA 2A6JB 4UTBA 2NY4B 3H3VH 4HUMB 4K3EH 1XIWC 4JDVB 3FO1B 2VY3A 3NCCB 1PG7L 3HZVA 4LPUA 5D7JA 2FJGB 4DQOL 5BW7C 4CGTA 4QB4A 1ML0A 4JI3L 4UQAA 3VCLB 4HJTA 1VJSA 3B2UC 2PO6D 1YEFL 2K04A 1TSRA 4JL2A 2FX8L 4HSCX 4G72B 3D0FA 4XPHL 3WIIL 2NR6C 3NEXA 1D7DA 3GBDA 1RSFA 2AJYL 2YD5A 1KTLB 3PUWA 1GRWA 1BVSA 3CZGA 3FFDA 3FUDA 2ZOLB 1WWAX 3F58H 4YHIB 5FLVA 1G9EA 4FF1A 1JD7A 3F7RA 4BFKA 1GHFH 5DWUH 1GZPA 1ZK9A 2LXKA 3TBWB 1NKGA 1LO4L 2IBZX 3LX9A 3HC4H 3RLNA 4N5UA 1UURA 3HC0B 3UBFA 3N1MC 2R1YA 2IMNA 3CCRA 3KUPA 2IH8A 3JV6A 2X7LB 1Q12A 3EO9H 3QS3A 5EIIA 5GGSB 4A67A 4DP9X 4FN0A 3U30C 4ZUWA 5GS0D 3U4BH 3HE6C 1W8EA 2OMYB 4L1BA 1AQKL 2FHBA 1DVFD 1KIQB 5KW9H 5C3EH 1M4KA 5CJXC 1WBXA 3D4DA 1A9BA 3CLEL 5GRJL 3IWVA 2H1LM 5IVZB 5LMNQ 4U1SB 2X3CA 4H8HA 5L2JA 1QAWA 4D9RD 1NTDA 3CDZA 1HRJA 3RWDA 4X3TA 3SDYL 2WLMA 4DUWA 4ELKB 2YPKB 2L5TA 3LIZA 5D1QA 5ICYA 1IGTB 3FONB 1FDLL 3NSYA 5HY6A 2N59A 4L48A 1U8IA 3EGXB 4EQ3A 3EJUA 2QZQA 4MXWL 5IHUH 4YLQT 4F92B 2IXQA 1EEZB 4AEIL 3OKOA 1UZ8A 4XVOA 1J5CA 5IKCA 3KPRB 5C0ND 5IB1B 2DQFB 4UTBL 4D0CA 5I4DA 5AVSB 2C7UB 3BSZH 3P77B 4MB1A 1KDBA 1KB5A 4LLQA 3X1BA 2NY5C 2UY6B 2YPLD 3CK0H 3ZUNC 1IAII 1G6ZA 3WKNA 1B3QA 1CGVA 1D5MB 3B2MA 4OCNC 3PIPA 1E4XL 3L0OA 2YFOA 3TCTA 4CNIB 3ZDXF 1WFNA 3FUFA 3VXQB 3PJNA 4ZW5A 4Z9CB 1CFVL 3PFUA 1CD8A 1I4FA 2VXQA 3MV8D 3VI4B 2ZUTA 2DI7A 4IMKA 4XOBA 1EWCA 4PJAB 3IT8D 3GLEA 5F9OL 3L4TA 2BDNA 3ZE1B 1T04B 4M5SA 2E7BA 2K1MA 5HYJE 4P2AA 3MBEA 1QSFD 4JFEA 4MXQC 4BH8A 1G7QA 1A4CA 2PNRC 2I24N 4WEUD 3NPSC 3D0VB 2X2YA 4QRRB 2FWOA 2Y7OA 1Z5LB 4PGJA 1WEJL 1ZMYA 1MI5B 5TQ0L 4E9RA 5DK3A 3SOBH 3TMEA 1KXQA 1A6ZB 3PYCA 4GQ9H 5DEGB 5DJ8B 2ICWI 5GJSH 5JR1L 4YXLL 1K8IB 5EU6D 3W3AA 5F7FA 5I30L 4FNUA 5GS3A 2WZAA 5M7QA 3L2MA 5GS0H 1IKFL 5DF0A 1G7HA 3HA0A 4WJ4A 2ERJC 4AC4A 1JGVL 4YHLH 4A3CG 2BHFA 2CNYA 2RGSA 5M5XH 1U8NA 3E9HA 3EQLC 2B4CL 3B8SA 3QO0B 4HP5A 8FABB 3T1WA 3CFCH 2BP8B 2YD3A 4LESA 2BJML 2JELH 4HKXA 5DRXB 1JS4A 1TXKA 4GUCA 4FQLH 3ZMRA 1WAEA 1XIWA 3LIZL 4JMXA 5DHVA 1I4RA 4LCUB 3QI9C 2NSXA 5GSRA 1HCZA 4L5TA 4N8CH 4U6VL 2Q6WA 3NMEA 1N0LB 1JVOA 1JRHL 3VXPB 1BZ8A 1HC1A 3F7YA 4X0KA 5C4HA 3OPOA 2G5BA 4QYOB 2R7FA 1MCSA 1E27B 4RNRA 4O2CB 1OAQH 1UC6A 1WA0X 3BYTA 2I46A 2P26A 5IBTH 4B96A 5BV7H 4UQ2B 4DN4L 4Z8FH 1SMYD 1KB5L 4ZT1A 1GXEA 4LNVA 1N18A 2I9LA 4WAFA 2SNMA 4FLOA 4RGNB 4WWPA 4HS3A 5HHOD 4TRPL 4QNPF 4YSUA 3L9BA 4K0OA 4ZUUA 1G0XA 3UABA 1C16A 1KYDA 5JOPD 5MP6L 2VR6A 5D1XC 1QZ1A 4WUUB 3CIAA 3DYPA 1D5XC 4I85A 1ZLSH 1RV6X 4HULB 2FJSA 2PP7A 3S3PA 2VXQL 2J21A 3KDFB 3GTMH 4UT9A 3HKFA 3RUZA 3D0LA 1ZANL 2GTWA 3E5SA 4ATTA 1FFPB 5B1AB 3VFOA 2C26A 3OIPA 2VL4A 5CGYD 1BF8A 2BDNL 1WYJA 2ZNWA 2V3FA 3NZ8A 2E2IH 3O4OC 4AEEA 4HIJB 1FL0A 4ALPA 1A6AA 1W0WB 3HE6A 4NQDA 2GJ6D 5T3XD 3E6HB 2WVTA 2WXQA 1YUHB 4GG8A 5KVFE 4D94A 1CGWA 3P0GB 3KPNA 1XSJA 2P43B 1TJGL 4EUPH 4JO8A 3KCWA 1QSEB 2KZKA 1X3QA 1QBML 1WZMA 3L3DB 4N3UA 4U1HB 5T3ZD 5J11C 4I65A 1CF1A 1A3RL 2DLTA 3H6AA 3HHSB 5EU3A 4JZNB 4ONHA 4PBXA 4OX9L 4X99A 3WE6A 3FUEA 3G7TA 5DMIL 1VHPA 3HTLX 2JA7B 4UIKH 3T08A 3O8XB 4D0BA 3QUYC 5KSAB 1EO8L 4BRVA 4R5TA 1HQRD 1E9PB 1A14H 2P5ZX 1U8HB 5I16A 1AHWB 5KANI 1RZGA 2V7HB 1KEGH 3BQUB 2NVXB 3C09B 3L48A 4Q6IA 2YO3A 4A3EG 4PG9B 3J8F7 2WKLA 4A3DB 3MSPA 2P46B 3PFQA 4FNFA 4C1NI 1FNEB 4AYFB 3FT4B 4BXXH 1CDYA 4GIOA 4FULA 4ZMLA 5FA4A 3TFKD 4L8SB 2YMXL 1X5AA 2WXOA 3HZKB 3CSFA 1T0MB 1MCRA 8CGTA 3SJVA 3GGWB 1MF2L 1MY7A 4PRNB 3Q6FA 5E56A 4A7SA 4ONFH 1Y1VG 4XWGL 3FQRA 5C0AA 2CCVA 2CDEA 1EXHA 2ENPA 4RWHA 3M1BB 4Z3JA 2PR9A 2F53E 4MHHG 1CICC 1ESOA 4K0KL 2B2VA 2O6FA 4LSSH 3RFZC 2N78A 4IOAA 4D9RE 4O1NA 2E5EA 4JO4L 2Z0SA 1U8KB 4PCTA 3FHWA 1UHVA 1UD3A 4L2LA 3VQLA 1EFWA 1R0AH 3PP4H 4UT9L 1FH2A 3KJ6H 2PWGA 2WAQB 3QEQD 1NBZB 3K3QA 3JC66 3VXUD 2A4ZA 2PZTA 3R93A 2VDNL 1N4XH 3F2UA 2H26B 4LGPB 3UGEA 3CCMA 4NQCD 5ICUA 3IU3B 4A7GA 4GQPH 1BYOA 2GB2A 4ODSH 2I7SA 4KI5C 4MB5A 5D55A 5J12C 1QBLH 1LO5D 4GAJL 1MCOL 3AVEA 4UNTA 1ACZA 2WBXA 3CZSA 4WO4B 2QJDA 2PMZE 3TX4A 2FH6A 5E6ID 5T3ZH 4JI7Q 2IAND 1STYA 4FQ2L 4HOWA 4RFNB 4PGBB 1UE7A 3UBHA 1BZ7B 4J3SA 3PUYA 4ILDA 5DQJB 4QTHA 3IPFA 1AE3A 1OB1A 3BEVA 2WBWB 3BN3B 3DO4A 3QI9A 1PZ5B 2Q3XA 5FYKL 2QHLA 2WM0A 4XZUA 3QIBB 1II4E 4Z7WA 1KB9K 3TP5A 4YBLC 3K6SB 5IEHA 1HN1A 2E2JB 4UI2A 1MQKH 4H0LC 4V2CB 2BZCA 2Y4SA 2A6EC 3I90A 3BKML 3CSYA 4JV5Q 1WWCA 2AQQA 3OWFA 2BWQA 4OWWB 3DBSA 5HGAA 2QFPA 4F33A 3OKMA 2DEWX 4MVBC 4ZMYA 1FH5H 1U41A 4PBVC 4PRHE 5HDWA 2NY5L 2WTRB 4XE0A 3QWOB 4L9LC 4OZ4A 5IBUB 1M2VB 3HBGA 4G4KA 2DMBA 2X0WA 5ISZA 4L8BB 5D1XA 1P4LB 3GSRA 3ZL2A 3BWUF 4JGUA 5FA3B 2Z92B 5D7LD 4X83A 1U36A 4RDBA 4PGEA 5EUOB 3EJIA 5CR8A 5I71C 5I9PA 3J80E 2A9NH 5HJ3A 5TH2A 4OIFA 3PUVA 5AYQA 3W9DA 3K2UL 3EJSA 2P5WD 3KGRA 1M05B 2W0KA 2EUWA 1D6EB 5IYBH 3NWSA 1N59A 4IHOB 1R3JA 1MCNA 1J0HA 3ML9A 4QO1A 5DEFB 4LQFL 5ERWB 1VQ8A 4JG1H 5IP9G 1WWWX 2GBUA 3SDCB 2MHAA 3V10A 5K9JL 1I31A 4UINH 4WSJA 1NDMA 1QBAA 5GS2D 5KUMA 1N6QH 3ND9A 5FPIA 1RUAH 4NQEE 3TZUA 5C0XH 1IQWL 1FORL 5IM7A 4G8GB 2APFA 1NEPA 2CQOA 4F87A 2FX7L 4QMGA 3NSFA 5CSGA 4IOFD 3DEPA 2Q7YA 3RJDA 5J89A 3HI1B 2ZWZA 3NIDE 5F0JB 2ITFA 2BIIA 4MS8D 3FCTA 2OR7A 2XBDA 5FGSA 4PJXF 5FYJD 2YTYA 1JHTB 5KZCB 3HEJA 1IYJB 1PRTB 4WU5B 4JVPA 5ANME 2HA1A 3QARA 3QO2A 2D4FA 2XTJD 4IS6B 5DQDH 3DX6B 1UEYA 3GS4A 4AENB 2E6JA 3GMNA 5FO8A 4NT6A 4OZIF 1DGSA 5A7BA 1Q9WB 1XMQL 2WB1G 3X3NA 3BN9D 1OQOA 1X7QA 2NY3C 2OPCA 4KMLB 4E6IA 2PP8A 1JGLL 3IRBA 1V8QA 5CZXC 2O30A 1OXUA 5CEYB 3VA7A 3NK4A 2AITA 2NW2A 5IMOA 5IHZB 4MNQE 1NFIB 3HG1D 3RWEB 2JB5H 4IKNA 4RAUB 1A1MA 2QPEB 5C0CB 2O4XA 1PKQA 1SLXA 2OQJA 3CGTA 3IS1X 5T3XE 2WUBH 1JGEB 3SE9H 4JFOA 3FUKA 3WL9B 4PYHA 4NQSB 3P73A 5B8CB 1QWUA 3O11A 2DEXX 3CU1A 4JM2F 2DBJA 2F5AH 2W8CA 3HOZH 1R3IL 5JYMA 1AGEA 5FO7B 2MNJB 2AKWB 3RFZA 5H4ZA 5IHWA 5LG6A 1P9MA 2HTKC 4WTXA 1IFRA 2HPOA 5I5MA 3K72B 1BXAA 2KBNA 1HEZA 2JIXA 4Y16B 2VR9A 1JZJA 1MH5B 4X64Q 2VDOB 1U8PA 3J80c 4KJYB 4GZYC 1SN2A 3NUKA 2F2HA 5M5YB 4P5KA 4XPFL 1GZQA 2VLRA 1OZUA 4RZKA 4WNSA 4XYQA 2J25A 5DU7A 4K8RC 5C0DA 1KWGA 3ARVA 2WXHA 1ORSB 1CTOA 2X5PA 3ISYA 1YY9C 4YDNA 5EPMB 1AZRA 3PGDB 5GS2H 2EDWA 5FLXc 4K71B 1E90A 3U0WH 1MRCH 3MNVA 2R1XA 1VQBA 4LFAL 1ONQA 3GSVB 2FT7A 1JOQA 1Z9NA 3BGFC 3PHQB 1G1YA 3MOAH 4B9ZA 3M1OA 4G3YH 4S10A 3H1ZA 1CQFA 4FQHB 5C44H 4PAZA 1KGIA 2XOTA 2JJTC 1OAUL 3EYVA 3CPLB 1KXTA 4JKKA 4E5XB 4PS4H 4NCC2 4UYPA 3TDQA 1J9QA 4CDDC 5FYJH 2UXCL 2F8VA 1S5HB 2VABA 2XWTA 1LILA 3MR9B 3W38A 1KENH 2RAMA 3FCSA 3LZRA 4QXGH 1OP3K 2CRIA 3QEUB 3RZCB 3WEMA 3IFPA 2KUMA 4HF5H 4NKOA 3VFTA 3F7PC 2RHSB 2DQHH 4I3RL 4KHPQ 5EULV 1FL3A 1HI6A 4WFEE 2ZOWA 3KBFA 5ACZB 4LKCA 4PJ5A 4R8NA 1JI2A 3AACA 4Y2DD 4NS0A 5L88L 3HG4A 4B9IA 1TLMA 2EXWD 2ZSVA 1JE5A 5EOQH 5JIHA 4L9LA 3MROA 3RB5A 3HCVA 1LDPH 1RZIA 1EEUA 3L2PA 2D9CA 3MXWH 4NQCE 3L5WA 5HDBF 2NUCA 2AUJD 1KC5H 5DRNB 2OJZL 3EDEA 4KMUC 4LEXL 4JFDA 4QHNB 5DUBB 1A4JA 1OHZA 1SNQA 3BUBA 1FZOA 1F42A 3MU3A 3SPJA 2H8PB 1CFTB 3BZCA 3TP6A 4QRAA 2X4TA 4WRLA 1OZTG 2HRPH 1NH6A 4RGMB 2HT1A 1R4QB 1U95A 2IANE 3F05A 3LN4A 1DD2A 5DUJA 3VRIA 1L1OC 4NENB 2WMPA 4ZMAT 3AU0A 3ARFC 2ED8A 5DJ0B 5C0IB 1J8IA 2Z0UA 3QZMA 4JM0A 3H9HA 2X6BA 5JO5A 3ERQA 1KV7A 1Z7JA 4NKMB 3T0XA 1UXSB 3LKRB 4TS6A 3I75B 4OVUA 2OL3A 4S0HA 2R93H 1AE2A 4UV7L 4IOSA 4ATWA 5ELNA 2EYOA 4JQIA 1T5WA 3OPUA 4OD3H 4PJ8D 4A2HA 3BZKA 5DJAA 3BT0A 1K8MA 4URTB 5CHNA 4K9EC 4AY0A 2BSCA 5I18H 3CWGA 5C3XA 4XNYL 3WO4B 4X42A 2YTVA 4DR4Q 4DO5A 1K9TA 3AZUA 3CMOL 5FF6A 1AZUA 1GOGA 3ULVH 3JTTB 4ISVA 3AB9A 2CJTA 5ICZB 3CXFA 1CU4L 1JWUB 1PH4A 3W5MA 2AXGB 3V0VA 1UD4A 4AM0Q 2PF6A 4L0ZA 3VRLE 3WFEH 3AWGA 2MO1A 1Z9OA 1GUNA 1NC2A 1ASQA 3C5JB 4WI5A 2VQFL 4AIEA 1RUMH 4FQQB 4BDVB 3A6CH 1G9MH 2HVBA 4TUOA 5C2BH 2WUCL 4RMUA 1RZFL 6FABH 3G6JA 4LU5H 4LARH 5T1LB 4ILWA 5FK9C 2N7SA 5KYNA 2AXFA 2OKMA 1JV2B 1PY9A 2HFTA 1TITA 1FAIH 4N1HB 4X2UA 3O45A 4FZ8H 3R7RA 1B4OA 2AEPL 2APWA 5EC2A 2ZKYA 1EOVA 1M53A 1Z32X 1B70B 3L16A 5IESL 3ZIMA 2UY7A 3QUKB 3CBKB 3MRPA 5G4OA 3T3ME 1JXKA 1P2CB 3RY6C 2Y22A 5CBEB 5C6AA 2JKLA 3UO1L 1F13A 5I17A 4I8DA 1E43A 4LRIA 1N5YH 1B0GB 4DA2A 5GS1B 1OQXA 1NUNB 2BZ7A 3WFHB 4OCXH 3I73A 1K73C 1R5WB 2DQGL 3MV7D 4XODA 4ZPTB 1AR1B 5EA0L 3O4LA 3FOMA 4JM4H 1WZAA 5FKPB 1WCBB 1FC1A 2KCTA 4QTIH 5D7SL 4RISH 2ZCKH 2QEJC 5AJ3L 1O75A 2EUXA 3U0TA 1ULVA 5IVXF 4NAMA 1HUNA 4J2XA 2JB6B 2XGTA 1NCOA 2WOYA 3MRJA 3E3QE 5D9SA 5FW7A 4E9XA 5KYXB 1H8NA 4NDXA 3UG5A 3HOXG 25C8H 4QDGA 4P59H 3T4YA 1QWYA 1HILB 4LPXA 4OV5A 2JJTA 4ZFZB 4PRAB 4JQIL 2J4XA 2E7MA 2RSNA 2QSTA 3IJYA 4JJ5B 5FUZL 1PQZA 1Z9SA 2WLNA 1NGQH 2IWGA 1MVUB 4LAQL 5J13B 2ZXPA 2EC9T 4YPGA 1IBKL 1YMMD 4E0RA 1PJWA 1IVTA 4L8CB 1H9VA 3CC1A 5I8KL 4TLSA 2P9RA 1OAKL 2WHVA 3ZQ9A 1H95A 1S5IH 1DVTA 1DQLL 2OBGA 2PTTA 2YEZB 3SKOA 2B63B 2EVGA 1AQDB 3PPEA 2R9HC 4NQTA 4O02L 3AG3B 3RVTD 4M61B 1ZE3H 1S9WA 5BZDA 4N2DA 4N2LA 3DVNB 5JUEL 3STBD 1QLRB 2VN3A 3KXFD 3ECWA 1BVLA 1PZBA 2KMWA 3QH3B 5L2KE 4P57A 4KY2A 4XBEL 4DW2H 5IY5B 4HMDA 2HRLA 3U9PL 1A7RL 4F7MA 2VXUL 1NCHA 1C8PA 4H88L 4BK5A 2K4WA 2XZQL 4KVCH 3LN5B 4NC1C 3EBAA 5I73B 4ME5A 5D2NE 2LW3A 3QDJD 2MJ8A 4KJQC 2VDLL 4EZLA 1R6VA 3P0YL 3UO8B 1ACYL 4NUGH 1DDHA 2BH2A 1UA7A 1L1OA 2BOCA 1ZSDA 4Z7UE 4CBPA 1A4KB 1IEAB 2Q20A 2WBJC 2X4RB 4OFDA 4XAKE 1Y6KR 4NFCA 1J11A 2NPLX 3I4NB 2WWKO 2ES2A 4N8PA 1BEYL 1IU1A 4NQVB 3HFZB 4BQ6A 4FXLA 5IG7B 2J6WA 1W9XA 4P99A 2FCBA 4POZC 1RZ7L 1VQJA 3S98A 2VXWA 1F58L 4MAYA 1EO5A 3TA3D 2WFWA 4KNSA 1MFCL 5J6HA 1VB9A 2NYYD 4UQEA 5I6YA 4KNTA 1YY8A 4M5TA 2XWRA 1H3XA 5DC0A 3TO4D 4L5FH 1M6OB 3RUGB 1LEGA 5JXED 2DQDH 1FFNB 2EILB 5F3BA 5E1AB 2L0DA 1GGYA 4YH6A 3BHBA 4XMKL 2ZWYA 2Z8VC 5DMYA 1UASA 4QLRA 2IY5B 2MMXA 2BPBA 5KS9F 2IDCA 1I4XA 2W0FA 3QUHA 4FXDA 3DUSB 1CSPA 4PJFA 4FMKA 1TTFA 4JI5L 5F7NC 4HZAA 1VKXA 3RURA 4V1DA 1JN6B 3SGJC 3WIHH 2OTUA 5IB3B 4OL7A 1KCSL 2EC8A 4PLKC 2SEBA 3L1FA 3RILA 4PY8I 3MUUA 1IBYA 4KKAD 1SVBA 3ROOA 3SPIA 5BR8L 1A1OA 4HPYL 4HUKB 1VQHA 2EJGC 3RIKA 4ZFOA 4BZYA 4PJ9B 1RD9D 1O7DE 1NCUA 1J8HE 4KDVA 3OLGA 5GIRB 1RHPA 3MTSA 2MTPA 1I8KB 1YSOA 1ASOA 1GH7A 4RFOH 1BZOA 5FK9A 5C0FA 4F15B 3P4NB 1KYFA 5I1KH 1I7ZB 1ZA6A 1CE6A 3VFGH 1JE6A 2IGLA 4APQC 1JPFA 1XGUB 1U8MB 2V17H 4M6MH 4UOZA 2GPZA 1EZUA 4PRID 3TPUA 3VMPA 4UQDA 5DC2A 3RWJA 1A7QH 4HZLA 4IUQA 3LMJH 2CMRL 4EIGB 4OO1G 1N36Q 3X3MA 1GJXA 2OMUA 2W65B 3SGEI 2GA4B 3HBQA 1EEYB 2R8SL 1TTAA 1H3UA 1ZHLB 5A6LA 1NIAA 3BD3A 2QEJA 4PIRF 5CORA 3IJEB 5CSBA 4LPCA 2F19L 4BEIA 1MCWM 3Q5YA 1TIID 2LGNA 5E9DE 1H19A 1NMCC 2C9PA 1HFGA 2FBOJ 5K1VA 2BNQB 4U7MA 1P5VA 4HUWA 4JDEA 3MRRB 4OZFA 2Y5EA 4PWKA 3WFDL 1OF2A 4DUVA 5DJDB 2ZG1A 4JRXA 4UPAA 2BSRB 1PH6A 2EE6A 2ZOTA 1F56A 5BN5A 4XN1A 4CN1A 4BY7G 4HJUA 1MJJB 4LSQL 4WI7A 2EKJA 5CEZD 2AMCB 2EICA 2XWJA 4K9EL 2A0LD 5B3NA 1WFJA 1AO7D 3L2NA 2CFMA 3NSJA 1CC3A 3MUY1 3U7YL 2WACA 1AE6L 5DGRA 1YDPB 3UTSA 5HHXH 4P9ML 5TPWL 5IGDA 1QA9A 1QLFA 3H3VC 3TNMA 4RGOH 4OM1L 5HHVL 2DQTL 3BDYL 2V2XA 4PRPD 2R7ZH 2G9KA 3HBPA 1UFUA 3N42F 4HV8A 4JI2L 5KVDL 4M6OH 1YEKH 2PN5A 2A6HC 2X4UB 1WVLA 1CVRA 1PBYA 2WQVA 3D3VE 4WVRA 4Z0XA 1JVLA 3I3CA 1BJ8A 1U21A 3PWVB 3IJ9A 1S7WB 5KJ7E 4BBRH 4E42B 3K5MA 3GM0A 3APCA 2CXKA 3MMEB 4KV5F 5CNHA 3FB7B 4YWLA 4QRUB 3GDBA 4ZFOL 5HHPA 2VMCA 2ZKHL 3LZQA 4A2GA 4W9EC 4FLRA 3ZL1A 2RF4A 5BVPL 4Z3HA 3QRFM 4UTAH 2WBJA 3NPZB 1IYVA 2HKHH 4NOBA 1DSFL 3V05A 2AHOB 3L3IA 4WI9A 1ZOXA 5H2BB 2LAAA 4HGWA 4TNEA 4A3BG 4IU3A 4PJGB 5T5FH 5L9DL 2B77A 4GSXA 3WFBH 1XL4A 2CPUA 1OGAB 1HR0L 4P2OD 1AANA 1UCBL 4YCWA 2ICEB 2YXVA 4ODVH 4EKXA 1GC1L 1LGVA 3Q1SL 4ENZA 3PGZA 4PJIE 3RL1B 5TTRA 4DAVA 5HYEA 2N7BA 3GMRB 3T0AA 4FXKC 1H9SA 2DBLL 1B4JL 2FBRA 2O26U 2ALAA 3D39B 2HT3C 2R92B 1WC7A 1MNUL 1BCPD 3ALWA 2DOCA 3B8YA 3WD5H 1KNAA 3KJPA 1QMUA 4FZEL 1QTYT 5KVMC 2YS4A 4A3KH 1MHCB 4EVNA 3HKZB 3TJHD 5E8PB 3TV8A 3T51B 4CU6A 2NZOA 2ZNXA 3QDJE 3IPEA 4HK0B 1QFWL 4QI3A 2DS4A 3O3AA 3S3SA 3GLDA 4YO0A 2R1WA 3WSQL 4PBWD 4KGJA 4FLSA 3BG3A 2NCMA 4GXFA 4X6DB 4ERSH 1SDYA 4HUXA 3WAKA 3IPBA 3UDGA 1WCMB 4PVBA 1ZA3B 4MSWA 3AGVA 3EA6A 2H1XA 2OR8A 3QUGA 1NMBL 3M8OH 1A6TA 1UD2A 1WS8A 2AUKA 2WKCA 3L9AX 1OT2A 4QPEA 2FGZA 1W8OA 2NNRA 1J9OA 5CSZB 3SD5A 1KRSA 3IDXL 4MQSB 4B9GA 1KFAH 1QI4A 4KQ4H 4B3TL 4KNQA 2IAMB 5KJRL 3QJFA 4MMZB 5DD1H 3L1GA 5DRZA 1DJGA 2HCZX 1CLYH 5FGCB 4XAWH 2GK0B 3RIAK 3FUHA 4YFDB 1KPVA 3LNIA 3SY0A 5J1ZA 1RFDL 1OEZW 1X5YA 4H40A 4M8VA 1ZGLA 3OZLA 1PD6A 5F70A 3GI9H 1K83H 4CJ2C 1HNXL 3GXTA 4JCMA 5CJOH 3ZMEA 3IRCA 5HD8D 1OCRB 1ORQA 4YGVA 2HVJB 5EIIG 3UIYA 3S5LA 1H0DA 3WNPA 3ARUA 5M94B 5H8DA 4M9OA 5CUSL 1JGDA 1GMIA 3ORJA 2KZWA 5DS8A 1XYIA 4A7GF 3Q6SA 3S0PA 2X87A 4OF8A 5KVEH 4KZDL 3H8NA 3IJSA 1KYOJ 4ODHH 4YHYB 4K14A 3E8UL 1TQBC 3GMMA 4HS8H 1E22A 3DOSB 4GNXB 5GS0C 4HAGA 4CHTB 1FGNH 1I7UA 4QRSB 4P46B 1WD1A 1OTSD 1MFBL 1DLHB 5E5UB 2VITB 3VU1A 4XNQA 1DVFC 3WKML 4UNUA 4DFHA 1PH1A 3MZGB 4K3DL 1K2DB 1NINA 2JKSA 1K8AC 1TO5A 3KPRE 4GXVL 4JHWH 4R26L 3O6MH 1CA5A 5C4XH 1U2HA 1D3CA 4GMSH 4GW4B 4NRXB 1YPZB 4WW2C 4WFFD 2OYLA 4BFFA 2J88L 4NZJA 4YSEA 4FYTA 4FL4B 2IDQA 5BJTA 3Q2CA 1NUGA 4Z7WF 1OSPL 2VUOA 2JYOA 3PUXA 3MV9B 3DLLA 3QFDB 3GXUB 3LQZA 2L11A 3AAZB 2QHRH 2EPBA 4N9GA 4X4ZA 4FKKA 3OV6A 1XH3B 3EW3B 4NP5A 2Y07H 5D7IB 1P69B 5C0NC 4YEEA 2HH0H 2D5DA 2DL9A 5JZ7D 2E27L 1STBA 3QNYB 3C5SA 1QQDB 3QWQB 2IDUA 5CILH 3UGUA 1AGCB 4ONGL 2OTLA 1DANU 2EINB 3OHXC 1BKBA 1WF5A 3RWGB 4E41A 4XMLL 4L4VA 4O58L 3QXAA 5FDWB 1I9RH 5C5LA 5HURA 4QRRE 3I3DA 3BI9X 2A6KA 2C3HA 2LFNA 3LKQB 2FXQA 3U4ZA 3KLSX 5TF1L 1KDCA 3KLWA 2XQYA 2IWFA 3GBMH 4O9HH 2XWDA 5C7ZA 1JWMA 3KBPA 1BREA 5GRVL 4YHHL 2WVUA 4FXKA 2E4FA 5BCAA 4XN4A 5CGBA 2XT1B 5ADPH 3OQRA 4C56B 3GDEA 1GGTA 2LABA 3UJJH 5HXMA 3MBWB 3L3OB 1D1IA 1U3ZA 4M43H 1IKMA 1WUZA 2V2WA 3OJMB 1ZEAL 1DOKA 3HFFA 1E3PA 1O0VA 3FTXA 3BH8B 4JZJC 5M3MB 1CLVA 1HQMC 3CXCA 3QXWA 4DAPA 4R4BA 5DJYB 2H4OA 4HAEA 2PQAB 2NZ1A 2KPWA 1DUZB 3PCYA 1F41A 2BERA 5INDA 4C3IH 2DGYA 2Y7NA 3B37A 4ZOEA 5TQ2L 5IZ7A 2DJ4A 4GRLD 2WLIA 3QZWA 3Q6GH 1J0ZA 5DHYA 5DQ9A 1ED3A 4JBMA 4MIUA 2X3BA 3OR6B 3TEXA 3OJVC 4KTEH 4TNFA 4K3EL 4UZUA 3BSZA 1DZ1A 3GRWH 3P3SA 3QDAA 1WOCA 1KG0B 2O5ZH 1LT3D 1HNWL 2YWYA 4ZNCD 3ARTA 4PI2A 1S7TA 3HNVH 3T3PB 5C71A 3WLBB 1UZ6F 4Y7MA 3WHE0 2PO6A 3ARDB 4NC0B 1HAWA 4IBVA 1P1VA 1NCDH 1P4BH 2PLTA 2Z34A 5TGBA 5IMKB 4D9LH 4ZLTF 2K7QA 4Q9CA 1W6JA 2C9RA 1SMYC 1HXKA 5IB5A 4AH6A 4DUXA 3ZYJA 1L9SA 4JFHD 2VNCA 4AQEB 4ZUTA 2UUAL 4IM8A 3F58L 3SPHA 3IKJA 1AD0A 3LPWA 4PJEE 1GHFL 5DWUL 3VWKD 4HCRL 2KENA 4GRWH 3G5VB 3UJTH 5G3LF 3ZDWA 1BBJA 4BY1G 4KU1A 3JWNE 3PQYB 4TUJB 1QSEE 5D1ZB 3Q2NA 4MNHB 3MRKB 1X4XA 2GUOB 1KJ2B 3EO9L 1KPRA 5CGYC 3WI9A 5HPOA 4ZXBD 4K5WA 4L8JA 4FNSA 3WNJA 3P4LA 2X1XR 1N7MH 1OGTB 2P24A 3GTOB 3LEYL 3GWJA 1UD6A 1R3KA 2RSOA 3NIFE 1ZWIA 4U4IA 4HJIA 4HJSA 5KW9L 3VXSD 2OCFD 5CMAB 4IFDH 5J9PB 2FJUB 3H85A 2PXYD 2X6GA 2BIQA 4F5CE 4LFHD 1P4UA 1X3DA 1NAMB 3NZHH 1RJLA 5F3HB 3RTLA 4WW2A 2VERA 1RI8A 1CFNB 3K6DA 1RIVH 4ZTPH 4GW1A 1KJVA 5IB2A 3H6JA 3GJFB 1RK1B 3EBHA 4QQBX 1VQ4A 1XVSA 5CN1A 1C8CA 1CI3M 4I1PA 1Q1EA 1MVFA 4R9HA 1IBGL 4AL8C 3FAXA 4FF2A 5I82A 2FUTA 3E38A 5ABDE 5IHUL 3G6AB 3CH1A 1Q0XL 3CSGA 5HHNB 4WHDA 3CFQA 3SPCA 2O93L 2DM3A 1QG3A 5IW6B 3WLWD 2R2CA 4JPKH 3KPSB 3BSZL 4P23B 4B5ZA 1RP9A 4GG6A 4Y7NB 4X5WB 1JWSB 1BO0A 3UTPE 4XVUD 3CK0L 5ICXA 2YPLA 1D5ZB 3ZHLA 2MCAA 3RWHA 2VAAA 4AZ8A 1KN4L 1ZV2A 2KQNA 4KDWA 1VQCA 4AJYV 3MV01 4YNYA 3REWA 4LF7L 5HI5C 2IFGA 3MV8A 4ANKA 4YMPA 1TJMA 3C6LD 1V05A 2KCCA 4ZQTA 1RLWA 2WAQE 4M48L 1WIUA 3MFGB 3FCBA 5SWQA 1SJED 3K46A 5HVFB 1OWWA 4KTDH 2YXMA 3D09A 2W60B 1T3FB 2W38A 5JORA 4XC3H 4NP9A 4A3JH 1OXXK 4WFFE 3IL8A 2X10A 3RVWD 1EERB 2FRGP 4I4WA 3L5IA 1ZGLP 4EUPA 1I7TA 2WQXA 4GSRA 4HHAA 3SOBL 3WHXB 4X6EA 3DNKA 1W91A 4Q6KA 4FTDA 2IDFA 5GJSL 2BE5C 5DC4B 4RHRA 2N1TE 5EU6A 3ZO0A 4UM8B 2H0EA 4ZSOE 2YIHA 3UC2A 3V5DA 5GS0L 4RMBA 1QUNB 3G3LA 1G291 3GV6A 3PP3K 4IRSB 2Z4QA 4YHLL 3MLSH 5JOEA 3GSNH 4XO5A 1DLFH 1MD2D 3EOTH 2JELL 3QQ3B 1H8LA 4UHVA 3DDGA 3IMRA 3S3DB 4I0PB 4Y1SA 4BCXA 3K71A 1ZHBA 2SDFA 1MHPH 3IRPX 5KAQF 2V9RA 4P4RA 2JQAA 4N8CL 5AG8A 4ODUA 2WVSA 3PV0A 4HMIA 1E6JH 3FT2B 5ALCH 4E2OA 5C7XH 3HZYA 3OKDA 3RKPA 2XZCH 3UAFA 1OAQL 4WNQA 1SE2A 5IBTL 5A1AA 3FKIG 4O5LH 2X4SB 5BV7L 3UI2A 4Z8FL 2YRLA 2Y9RT 1SQ2N 1LP9E 5JHDD 3SDAA 2CLVA 5HHOA 4O2FB 5GRVK 2DQ6A 3NN8B 5MEPB 4C58B 1IAIH 1Y1WH 3NRFA 2JEAI 3SBRA 2YPVA 2QKIA 1TEFA 1ZLSL 3TH2T 1ET9A 3LEXA 4G6JH 3SSGA 1D5RA 4NAJA 3T1FA 4YFLF 1YNKH 2NVQB 2WIIA 1ETA1 4LEOB 3S36X 2V8MA 3T65B 4FQPA 4RHSA 3EYQD 3BO8A 5B1CA 4NKDA 3NAAH 1ROWA 4HOMA 3FQWA 3H9ZA 4PCYA 4NM8L 1A8ZA 2FD6H 4TV3A 2YD6A 4P3DA 3LWUA 2GJ6A 1G6RB 1HHGB 5F7AA 1QVFA 3AY2A 5AW9B 2AWOA 4RZCB 3CJJA 2GITA 3I3BA 3GB7A 2A9BA 4R7LA 5AW2B 2WXIA 3QG6A 4IOFC 1SN5A 1DQQA 3WENA 1GJWA 2CO4A 4MBRA 1CIUA 4L4TB 5DJXA 2K52A 3K81A 4NO3B 3HI6H 1HFNA 1IGJB 3DC0A 1DEDA 4NUJA 4OD1H 3O13A 3O3UN 2JJQA 3B9AA 4Z7OF 2FLMA 2KHSA 4CVXB 4ZMVA 1A14L 5AVQB 3MRLA 1KEGL 2AK1H 1NOAA 2LR4A 4QRPB 5C0CE 5AD0B 2HFGH 3B9KD 2E59A 5FGBA 5A6MA 1R17A 2WWKT 3BN9C 4K7PX 3T6ZA 5KG9A 2YAFA 4HJGB 1J5EL 4NKLA 4P06A 4ZCKA 2EDKA 1GY2A 3CVBA 2X4NA 5BOJA 4Q14A 4MD4B 1KTKA 1FLTX 4L5SA 4CW1B 4JJHA 4W9JC 1P4IH 4GW5A 1AGBA 2B2XH 3VFWB 4ONFL 5CV7A 4U6HA 2Q76B 3ZYOA 1MHWC 4AH2B 2XQYK 2IADB 3BZFA 5J7CC 3SBWC 1GAFL 1HSAB 4HC1L 2NN6I 4G5ZL 4EQNA 1OP4A 3B7RL 4NXML 4IIZA 2H45A 2UWEA 3K6OA 4CDEC 4QKXB 4JW3A 5C0EB 3O9WD 2YPVL 4OI8A 4XRCB 3R8BA 5EIQA 2YA2A 4R2GD 5I28A 2C3XA 5EMYA 1K4DB 2K45A 3PP4L 3KJ6L 3IDUA 2MPAH 4ZX6A 1JJ2A 1TWGB 3F12A 3QEQA 5F1OB 3SEBA 4IJLA 1VACA 1N4XL 3VXUA 3GZKA 4BSVA 2XRQD 3PSIA 1RJYB 3U6RA 3F6LA 2R0KH 1IEBB 1T21A 4G7HC 4RLDA 5CWSA 4QJ5B 3MXPA 4W9HC 3CCLA 5T3XL 5E95B 1G7IB 4FC3E 5D2NC 2WVVB 4XTRC 4EF3A 1WTQA 2JWYA 1QBLL 3JAML 1LO5A 4LE8A 2J8HA 4DV5Q 1JZDC 1IGFH 5T3ZL 3FVQA 3GSUB 5E6IA 3UC0L 4GKJQ 4PJFF 1N67A 3R7QA 3BPCB 4YDLC 4TQUS 3FSAA 1BQRA 3TBVB 4GLRI 3WYRA 3HMWH 1P7QB 2NY6B 4YUEH 4X5XB 1YEDA 2FEDD 5EU7E 2P8LB 4UUJA 2ADIB 4WJG3 4AL8L 4FJZA 1MQKL 1J0KA 4XPGL 4BSWB 1OALA 3BKCH 5HPMA 3VGHA 3FW6A 3OWEB 1M4VA 5D6CB 3T0EE 1Y7VA 1S7QA 5F7UA 3EGSA 4ODWA 1MHHA 2EXWC 3N9GH 2HX8A 3MRBB 3HOXB 1OE2A 3AXLA 1D8LA 3UDXA 3GMLB 2L8AA 4Z7NB 1XNRQ 4L1SA 1PZ2A 4UWQB 1S7RB 3TT3L 1BX2B 2NUTB 5D7LA 4AYBB 4PJDB 3N0AA 2A9NL 4JVUA 4MJHA 3SQRA 4FMFA 2P5WA 4ACPA 2IGFH 1T0PB 2QSVA 3VRJA 1CURA 4Y4FD 1J0IA 1EIGA 3CF5A 1G6PA 2F7RA 4MDIA 4EDWH 4NJ9H 3ES6A 1FZMA 1KGJA 3HLAB 3CDGA 2XIDA 4UINL 4BGDA 4MTKA 1N6QL 2VL5A 2F0NA 1RUAL 1IFHH 4M4PA 4YAQA 1OAYL 3S17H 3B1TA 5MHSD 5C8JA 2JI2A 1O7DC 1UXWB 2QADB 1ILUA 2IPKB 3HOVB 1XF2B 4NC2B 4YK4B 3BCFA 1S4IA 2X28A 3X14B 4PTTA 3HRZA 2E5LL 1RERA 3L5XH 1YMHA 4JM2B 5CZVL 2W07A 2JE8A 4RIRA 1FO0B 2LVCA 1HJCA 2O5IC 1SRDA 3DGGB 4PJ8C 5I6XC 2A5UA 3T4AC 1TU2A 2VDPB 4OCYH 5DQDL 4I0CC 1EH9A 4JFFD 2Q2HA 1YO4A 3IFLH 1H5BC 4FQXC 4PRBA 4FAAB 4BFNA 4OI9A 1B4TA 2FUQA 4ABWA 1RZ8A 1GXDC 1IM3D 1AKJB 2Y5QA 4GKZA 4ZQKB 3W57A 4A3MB 5KAQG 5KSBA 2F7IA 1JC7A 3CHBD 4XQJA 1YAIA 5JPNC 1ZS2A 4JS7A 3PL6B 5HGDA 1KYAA 1H6FA 3HKSA 1CPUA 3EYSH 1S9VA 1QR1A 1UM4L 2JB5L 3HG1A 1PX4A 2VC2L 4MJJA 5LAXB 1NEZB 4UF7C 4FFYH 1LEKB 3NCWA 4XBGA 1OOWA 4R8IA 1QLEH 2WUBL 4HUUA 1NJ9A 5KIXA 2ZYRA 4LL1A 3SE9L 5CBEE 2BNUA 4LXFA 2AVGA 1RP8A 3BDXA 3FKUS 2F5AL 4HIEA 3W56A 4JGNA 3GTKB 3UBXA 1OT1A 2C1PA 2ICWJ 3HN5A 4G9FB 4ELMA 3L4VA 1I3RB 1HH2P 2XNAA 1YCSA 1BSIA 1S7VA 15C8H 1RSYA 2G0KA 4L3EB 4UAOC 4Y4KB 5JPMB 2FR4A 5I2YA 3NJIA 3GIVA 4YR6B 2DTSA 4LUOA 4DP7X 4M7LL 4WI0A 2PNDA 3ZE0B 3TCLA 1GO3E 2KERA 1EIYB 2GJJA 1V27A 3D69A 1HHHA 1M1KC 3B7SA 4FI7A 3F65A 1YEEH 1F90H 2W91A 3U0WL 1MRCL 4A3GH 3L13A 4HUVB 3ZTEA 2IT1A 1FZKA 1NE3A 4G3YL 3LNFA 4YDVA 4IURA 3FB8A 3CVHB 4JB9L 2VLMD 3UAEA 5I75C 1ONLA 2P42B 3C2PA 4JREB 2F0SA 2NOYA 4U1KA 5I8EA 5FYJL 3QJVB 4GS3A 4PJBA 1E8WA 1KCUH 2JV6A 4XP5H 4QF1A 2RCNA 1KENL 4PZ7A 2ASBA 4NPYB 4QXGL 3ULAB 1PTOF 5I9QC 2CO7A 5T1DH 1V1PA 3M4OB 1QACA 3CZFA 4FTVD 3GV3A 4KY5A 4HF5L 2VLKA 4OFKA 2DQHL 1GGUA 2KT6A 2AERT 3X3GH 4MJIB 3KYAA 3GSQB 1EO7A 4LEBA 2YBGA 3PIP3 4DTGH 2ZOOA 1YEJH 5IK3A 4P3WA 3NIGE 4Y2DA 4JFPA 5F9JB 3STBC 2XA8H 3GRBA 4UQ3B 5EOQL 4M3JA 4PD4K 2GI0A 3L4WA 1ZVHA 3MHZA 1GS6X 1LDPL 4PRDA 3MXWL 2DYPB 1ZHNA 3NOIA 2OMBA 2BNRD 2IHFA 4FP5D 4LUZA 1KC5L 3MRIB 5IFJA 4JI1Q 2E9GA 1NY4A 4ZMWA 2ENYA 1Q94A 4NRZA 5T8IA 2VZAA 4QY8B 4NB3A 4OLXH 2MTAA 5DO2D 1LD9A 2FBJH 1T66D 4BHUI 5EPLA 2QR0A 4LHUA 5CLXA 4TTGA 1VZHA 2X2HA 4J3XA 3EKCA 3EG9A 2OQKA 5CFHA 4BFIB 4GKNA 1VFUA 3JV5A 3C5ZB 4BKTC 4KC3B 1AC6A 3CFUA 4HIMA 3A8IE 1JDDA 3RUGE 2XWZA 3MGTB 2F0VA 1AY1H 1BCIA 2D0HA 3NYKA 2WIMA 3M46A 4Q0XH 3TA3C 4DAGL 2WKOA 1T6WA 5SWZE 2NT0A 1NPUA 1AOZA 3TBIB 1A47A 3VXMD 1CDJA 1PYWB 1CB4A 2NYYC 1A6WH 2R23A 3C60D 4OD3L 2OSYA 3UMNA 2VQ1B 4PJ8A 3OL2A 2DMHA 1JBJA 3TO4C 3DO7B 2PKDA 3IMUA 3RVVD 5I18L 4Z5RA 5JA8B 4MMXB 1EJ6A 1F86A 4LPVA 5K39B 2XYBA 3HOWG 3R06B 1C5DA 2PP9A 3E2HB 1T1YB 5CBAB 4JMNA 3VH8A 4D7BA 4HWZB 3VFMA 3JQOB 4PLJC 4NKQB 3RGVD 5JPNA 4ONOA 2F74B 5BXFB 3HUJE 2JK5A 3MGAA 3NTKA 1EZSA 1I7RB 4KY6A 2MQGA 2HPTA 1HSBB 1UB5A 4MD0A 3A74A 3P20A 2R2BA 5FKAB 4FA7B 4P5TB 4S11A 3WFEL 4PG2C 5IGXH 2JJWA 5IVXB 1G7MB 2E4TA 5ECGA 4DK3C 4KKAC 3MJ9H 1SYSB 4FJ6A 4AYID 5IQOA 3KFUA 3A6CL 2UZXB 4W9KC 1C12B 3RD4A 1I8LC 2KI6A 4KGLA 5JQ6H 2IPUK 4JN1H 1NCCH 4LU5L 4JFWA 3CG8A 1XBDA 2M2DA 3GMPB 1WD8A 3VYOA 1FAIL 3WJLC 3NP8A 4U3SB 2B2WC 3MREA 4FZ8L 3BP4B 4MCZB 1KCVL 5EZJB 1KUMA 4QT5A 4RH4A 5HHMB 3IETB 3TBYA 2EIFA 3BSHA 2RCSH 1WQVT 1KQSA 4IGBB 4MCYA 4GPVA 4G6FB 1TLKA 4X8GA 5D3DA 5ESVA 5TDOA 3GPEA 3CRKC 2BNQE 1N5YL 2GVAA 4WJKB 2ZYIA 4NM4H 3APDA 1VQFA 3K8LA 3WKQA 3WDIA 3MV7A 5D7JB 4JM4L 4TQPA 1VEMA 4QTIL 1DQIA 2QGBA 4RISL 5J22A 3D05A 4OZFG 4C8XA 3PGCA 5EKLA 4DR1Q 5E99H 1A3LH 5KVGE 1SR3A 4P2YA 25C8L 3VFPA 3UIZA 3IGLA 1GOZA 1X6OA 4P59L 1NFDA 4RMWA 5JLZA 2PPAA 2A73A 4KRPD 4HOXA 2RQEA 3EN2A 3FFDB 2APBA 5CKGA 1B3AA 4OZHE 3IMBA 3VR2A 3VSUA 1GTFA 1NGQL 2QLVB 1A9VA 1HXMB 2VW6A 1YMMA 1S5BD 3WIHA 3DSFH 1JVKA 1RULL 2A0LC 3IDIA 4WI2A 4JAMA 1I82A 5DJ2A 1S5IL 2BFVL 5HJBA 4JG0H 2R1YB 1T03H 4BZ2H 3S24A 1SLVA 1EAJA 3SXHA 4A3FB 1Z5YD 5H4YA 3SE3C 3W1GA 2FZ3B 3AROA 2ZG2A 5D4JA 5GRXG 4LF6Q 3FPYA 3V0GA 4X50A 3KXFA 3STBA 2EE9A 3L3JA 2XN9D 4QD2E 2J57A 3S1RB 4DW2L 5KBPA 3I6LD 1RK0A 1ZRUA 2LT9A 2ITDA 2ZCZA 1EWHA 4KXAA 2DF3A 5AUMA 5F7EL 1WBXB 3DPBA 1CQKA 1A9BB 2ISDA 4K3JL 2I60H 1S9XA 4PJGE 5L2JB 2VM4A 5D93B 2IQ9H 3B9VA 2Y2TA 1OGAE 3CDZB 1X3PA 4NUGL 2JA6B 2WPGA 5D1QB 5ICYB 4LUVA 1STGA 3B3IA 1MHEA 3OMZA 4ZO9A 3PF5A 2OMTA 3DX0A 1AZPA 1U8IB 3EJZD 4KQ3H 3WUWG 1H8SA 1LTRD 4I48B 2FECI 4IU2A 2NMSA 1L0WA 1M1XB 1UZ8B 1OPGH 5IKCB 3AQZA 4FQJH 3B7TA 1P84K 2O1AA 2YA1A 4IW4C 4MJ6A 1RQ5A 3TA3A 1KB5B 4LLQB 5FYJU 2XJKA 3TTYA 3D08A 1ZHKA 1HYSC 2Z31B 3QQ4B 3TONA 2VLJD 2WNXA 3OB8A 3NG5A 1LMKA 3QDMB 4NQXA 1CKNB 2CU9A 1GOFA 2HG0A 3O3EA 2EXYD 1THCA 4FFTA 2DQDL 1I4FB 3TO4A 5JXEA 4XBPA 3ULUH 5IROD 1U93A 4X6DE 2PPBC 4KK6C 1WA2X 3X2QB 4F3FA 4HDIA 3ZLQC 3TJHC 3KMDA 2OF1A 4OCLC 3CQQA 4PJCE 4HWNA 2LVEA 1MFEH 1TUPA 1PMRA 1PEZA 5ENWA 3EYOB 3MBEB 4U4BA 3KM2A 1KY6A 4BH8B 1G7QB 1OLZA 3VFRB 4AGPA 3RLOA 1NIBA 1AXSA 1CGXA 3WIHL 4BELD 2BP0A 2AJZA 1EHNA 3EBEA 3AB0B 3KYNA 3B3BA 1DBKH 2Q7AA 3U4VA 4AGMA 5CZKA 4DK3A 1L0XB 1NCBH 3L6FA 4GG6F 5FGCE 2N49A 3B7YA 3CHSA 4F8OA 3ZDYB 5KRUA 2BSTB 3C8HA 4WEEA 2EVHA 4LKXA 1BPVA 1NWOA 2P8MB 3NUCA 5I26A 5KBNC 2QELA 4JV5L 1CZ8H 5I1KL 1DQMH 4M1GH 3WJLA 4UTAA 2KCNA 2B2WA 2WGNB 4HLZH 4LSPH 3NA9H 2V17L 4M6ML 3MV11 4PRIA 5IE8A 4JI4Q 2JFCA 3FRPB 1A7QL 3LMJL 1B9NA 4RFEB 3PWJA 5T5FA 4FADA 2KQMA 4LL9A 5IP7H 3S5LG 1VMPA 1XIWB 1XGTA 4M7JH 4XP1H 4PHZA 1DQDH 2ZXAA 1PAMA 3DETD 5BN4A 2NQDA 3A7AB 5I6XB 1Z9MA 5HD8C 2K5VA 4X0KB 5IWLC 3K8AA 2DLFL 2G5BB 5E08H 1I9IH 4RNRB 4FNRA 3VFSB 3A8JE 3QZOA 5B39A 3CC5B 4XN9A 3ZMNA 4TVPD 3DJSA 4MYWB 2VZ1A 4EOWH 4BWTA 3ZL4H 3FCUB 4DNRB 1TJIH 1PNDA 4CBZA 1STNA 2XI9A 3X11A 1LMIA 1WUNT 1YPZE 3IDMA 3G5YA 4C4BA 1JPTH 2ZCHH 3CFMA 4KAQH 3EO1B 3V9CA 1OTSC 3ENEA 3MV9E 2ZF8A 2AQPA 4OF5A 1MEXH 4CA4A 3C5XA 4DH2A 3Q0HA 4H0HB 4L29A 3UROR 1AO7A 3H9SD 5I1LA 3NJFA 3GTJH 4R4TA 5E4WC 1MJEA 2ZUQC 3D0LB 4LVNC 3LXAA 1SNCA 5HHXL 3S6CA 2RFXA 3NZ8B 3UZQB 3TH4T 2EDRA 4RGOL 1KTBA 1YEIH 3AS0A 1S9KC 4YL4A 1A6AB 3U30B 1TQWA 3B83A 3CDCA 1I4QA 4NQDB 2PYEB 3HE6B 4PRPA 4WK4B 3BZEB 4YBHA 1H9MA 4NBXB 4UQCA 4GG8B 1URZA 2EE3A 4M6OL 1GHJA 1YEKL 1NIFA 2D3VA 5PAZA 2AJXH 3KPNB 1VPOH 4UDTA 1T2QL 3M7GA 2RD0A 2ARJB 3B1UA 3S37X 1H3WM 3I85A 4OGZA 5FO9A 3QR8A 1I1FA 1T7YA 5EU3B 3F2CA 4ONHB 4X99B 5F72S 3WE6B 2EDBA 2AK4B 5H35A 5JZ7C 2ORBL 2UYLA 1CF8H 1ANUA 2VERN 5I0ZA 1LUZA 3QIUD 2DWTA 4X5RA 3IAGC 4D0BB 1B8AA 4OUUA 1BVKA 1REIA 2ZUXA 3QIBC 4H0IA 3PS6A 1NM4A 5TK4A 3STLA 4PV1C 3RLFA 4UTAL 1ROCA 5I16B 2EY1A 2NZ9C 1RZGB 3DM1A 5E2VL 2HKHL 3LKOA 2ESVD 5IP9H 4K3HA 1PH8A 4YN3A 1QZGA 5FB8A 1JZGA 5IW1A 2KKQA 4U6YB 3EF4A 5DO8A 5FDYA 2CKBH 2G3MA 3K4ZA 1NGWA 2P7TA 4PVNA 1WGVA 2JKIS 3GEWB 3WFBL 1DN0B 4C56E 4B9PA 4IBZA 2WXMA 3SGEH 4P2OA 3G9AB 3MLXH 5MERA 4WHTA 3ZRCC 5C0BD 4X64L 1FNSL 4CVZA 2VMFA 1N33Q 3EGDA 3MXGA 1SUHA 3Q6FB 5EOTB 5J3BA 4XE5B 2C4FU 1OTCA 3TEWA 3S16B 4P8QA 3WD5L 4XB8A 3UPRA 1KTJA 1ACXA 1D6VH 2WQSA 4YBQD 1YITA 3MPCA 4AYSA 2ITCA 4ZW6A 1NBYA 3WOVA 4FXTA 1M7IB 3NSWA 3BJUA 1QZHA 1I3UA 3QZWG 3ARSA 2V4DA 4UTCA 5G4NA 3VFNB 5I9OA 3SK4A 5CEZL 5KN5A 3NPSB 3T3PE 5L8JB 3KWXA 4ERSL 5DLLA 3MACH 1UWGH 4F93B 4GRLC 3O3DA 4BK8A 4IBQA 2V33A 2ZWNA 3CQFA 4DR2Q 4AM0A 2UZIH 1HH9A 3AUWB 3CVDA 3QHFH 5JQIB 4KFZC 1VA9A 1KFAL 1SYDA 1AFVH 2ZZUT 4KQ4L 4KHPL 1UH3A 1F00I 3U2JA 2ERJB 3J81j 2V5YA 5DD1L 4U3CA 1UT2A 2VLJE 1TWHH 4EQPA 4XAWL 3GINA 2D7NA 5GZOD 1NAKH 1PFOA 3QUZC 3DVIA 1NFAA 1NIDA 2CLZA 4J1UA 2UWEF 2WO2B 4QTHB 2DN8A 2J1WA 3L7ZC 3T71A 1NAPA 2FINB 1UADC 2UV3A 3QI9B 4Q8BA 3V0DA 1R75A 4XZUB 5CAYB 1EY9A 4DR5Q 5CLWA 5CJOL 3VWKC 3RWIB 5IWLA 1JYXA 2DYSB 1TVHA 2CAKA 5DYOA 3CSYB 2OT2A 5E1GA 1LJMA 4YGAB 3T53B 4WY7H 5HGAB 3D87B 2O6PA 3WTXA 2GSMB 1HX0A 3J7AV 5KVEL 4HJJH 1R3HA 3GXMA 2WOBA 4P9HC 4L37B 4KK8C 4ODHL 4ZXBC 4IKLA 1WT5C 2EYTA 2Q8IB 4HS8L 5FYLE 3DMMD 1WS7A 2NY4D 3S2AA 1FGNL 2UXTA 5D1XB 3QT2A 1SMXA 2E2HH 1D5XB 3OZ9H 1YNND 4PGEB 1YJNA 1WISA 5TH2B 3LH2H 2IIJA 3W9DB 5EOCH 3BESR 1KYOK 3W5NA 3ATEA 1YHPA 1LYQA 2IMMA 2PXYC 4JHWL 1JSYA 5JHMA 1RKRA 2WKGA 3O6ML 4GMSL 4IMLB 4R3SA 4B3MQ 3IGAA 2PNHA 4XPTH 3KPSE 4LPWA 1K6QH 3JTBA 2K4KA 1NGYA 1A1NA 1RAMA 1NDMB 5JJZA 5DC9B 2L7EA 3IDJB 2GSGB 4IKKA 4PS3A 3L1OH 4LLDA 5DS2A 5IM7B 5IBLD 5BRZB 3T0WA 3REVA 1WFUA 2Y07L 5J11B 4EZJA 5DZ9A 4DP4X 4I88A 2HH0L 3N50A 3WLWC 1SAPA 4DXGA 4TVPE 1BM7A 3FT1A 4RMQA 3FCTB 4TLTA 4OLEA 5CILL 3DOHA 3QUYB 4XVUC 4K8IA 5EBCA 4LMQI 3L5HA 5F9AC 4HX1A 1KCLA 2LLGA 3BH9A 3NCMA 4KI1A 4OSUH 3GMNB 2J55A 1ERNA 1I9RL 2VDRB 4K2LA 3V8CA 3JV0A 3C6LC 1X7QB 2BVPB 3GF8A 2CSPA 1OGSA 3IMTA 4AT6A 1EBPA 4JRYB 1UOVA 2XBZA 3GBML 4EUPG 5JW4R 5TF0A 5EU7C 4JDZB 5IMOB 4O9HL 1TIUA 3L4YA 2CIKA 5JHLL 1C4QA 4TQ8A 3RVWC 1EXUA 2OQJB 2YC1B 3KH3A 1CG9A 3T0EC 4QNPE 1AOHA 1D9KC 3CC7A 4JFOB 4K2KA 3ULPA 4HJ7A 5ADPL 3J07A 3P73B 3DRQA 5ELDA 3O11B 3FT0A 3KBHE 4PY8J 5EO9B 2Q2TA 4RDQF 1D7BA 5D4IA 3SE8H 3L7EB 4NW2A 2B9BA 4M43L 4WKZB 1DL7H 4R7DB 4NI3A 3FB6B 3FU5A 4IBTA 4MA1C 1AGEB 1I8MA 3PIOA 1NBVH 4OIIH 3RFZB 3VE0A 4FRWA 1ZT4B 3APNA 4ZPVB 2BOLA 1HEZB 3LX0A 1XZ0A 5E6RB 3M3YB 4BXXG 3WN5C 3P9LA 4JHBA 2X6CA 4P71A 3S35L 2C35B 1JFQL 3HOUB 4YSAA 4P5KB 2ZJSH 2VLRB 2EP6A 3FQXA 4AK2A 2AFNA 4NRYB 4HSAC 4EZKA 1FBIH 3OJDA 2X42A 1JOOA 5HYQA 1FIEA 1E5ZA 4I1RA 2O5ZL 2D03H 4MNGA 4U3XA 3ASNB 3HNVL 3BU2A 2ALWA 2XG5A 2XKSA 3MNVB 4Y0GA 3RNKA 5J12B 1ONQB 4ANUA 1C08A 1IAOA 1NCDL 5B7EA 4F7KA 4KO9A 4TNWF 4D9LL 3K2MC 1EY6A 2HFEA 2HUEA 4XX1G 2QDVA 4KMQA 3PF4A 3EYVB 3ARWA 1KXTB 3H0GB 4HEDA 3VXTA 3OKEA 2IEPA 2X05A 4ELMF 1JCVA 5SWSA 4ZNEE 1QASA 5EUKA 1VCAA 3VXRE 3LIUA 1E2VA 1RZPA 3C2SA 2XWTB 5GAEC 3EH1A 3LZNA 3FCSB 3HE7D 3ITPA 4MKMA 4YBLB 1HXYD 3VWKA 2RTTA 2Y0SA 4NKOB 2QGEA 3UTTB 3CKIB 1HI6B 4FNLH 1DJZA 1VENA 1XSKA 5JIPA 4LKCB 4PJ5B 4WNJA 2WY3B 1B4LA 2ZSVB 4H8VA 3TPKA 4L9LB 4ZXBA 1WT5A 1SHMA 2R0WH 3GBEA 3K74B 4GEJA 4L4TE 2V2TB 3LB6D 2Y7QA 4XP9H 3L5WB 4H44C 4HCSA 2PTVA 1DO6A 5CIPA 3D34A 3FEWX 4W81A 5D7KE 1I3QB 1A4JB 5I71B 1FZOB 3ZE2F 3AJ7A 4QRPE 3A6BL 3GSNA 2HT2D 1L7IH 2X4TB 3VXSA 4M93C 3ULVF 2KA7A 2E56A 4K94C 3WU1A 3EFFA 5AVZB 4M8QB 1N6UA 1T4WA 2PXYA 3NGBB 1U95B 1QD0A 3LN4B 5AZEH 2YA0A 2JCCA 3NZHL 4PJBF 3VRIB 5IMLB 5B38G 3T56B 1NGPH 2P3YA 3VYNA 3H3KA 1RIVL 2ZG3A 1RJZA 4ZTPL 3OWRA 3IK2A 4YSPA 2P45B 3JYBA 3KWWB 4LOFA 4RGND 5LL6S 2ENSA 3ZO9A 1SDDA 3EOYG 2K75A 4K0KQ 5AYTA 3H9HB 4WZ9A 5GGVY 3VB9A 3GK8H 5JO5B 1ZEQX 4WUUD 2AMUA 3FU7A 2BSED 1QKZH 1LTGD 3QQDA 4I77L 5KYUA 3WMQA 3G5WA 3B9KC 2QTVA 1SMAA 4XMPH 2Q8TA 2EZ0D 5J13C 1SF3A 5C08D 3IB4A 4ZJ9A 2GT9A 1T5WB 1I4HA 2RCFA 4Y52H 2V3EA 4KHVA 2MQCA 4LAJH 5DJAB 3S88H 5T1JA 5E8DH 3F2LA 2NY7H 3G48A 5IMMA 1CL7I 4ZMOA 2XSKA 1KC8C 3ABKB 3HG0A 2IPUG 1BQKA 1PLBA 2W95A 4XPBH 5FF6B 4O02B 3C6LA 2NY3B 1EHKB 2BY3A 3ERXA 3H3PL 3MGOA 5EOCJ 3PV7A 3PJLA 4R84A 3QS2A 5EU5A 1FL5B 4RCOA 5C0XG 1SJEA 3KBEA 3SDXA 4HYTB 4XNZC 3EYUH 4XC3L 4GNKB 3HFMH 3ECQA 4XC1H 3O9WC 2GTZA 2YGVA 3NQIA 4R2GC 4NAQA 3KAAA 2V8LA 1NC2B 4KKLD 3GS7A 1YQ2A 1MQ8A 1Y18A 4Q6YA 4TUOB 4YLBA 1WICA 1LVEA 2VDLB 4LSDA 3BQVA 3G6JB 4P9HL 1YYMH 3C6SA 2ICWA 2O6CA 4UT6L 2AXFB 1G4MA 3CC2A 2DI8A 4RA8A 4Y19B 5FJ8H 2F7PA 3O45B 5LBGA 2X70A 2CDGB 4IPGA 4DWHA 4KD3A 1U8OA 2X89A 3DTDA 4KJPD 4DGWC 2ZXRA 2IX1A 2HJKA 3MLSL 3J81E 3GXPA 2WYTA 3BKYH 3GSNL 4LLVA 5I0DA 1DLFL 4Q2ZA 5J57B 3CFBA 3S1NB 4LWCA 4R4QA 4PSRA 1Y14B 4BBSH 1BAWA 2XZAH 3NJJA 4X5LA 5EBWB 2FGWH 1CZGA 3FOMB 1N6VA 3O4LB 4LOEA 4M5YH 1LE9B 3NBIA 2BCOA 5ITFA 4GAGL 3DIDA 1KGWA 2BVQA 2JA8G 2FEDC 3U0TB 2E7LC 1RZJC 1F1AA 2VQ4A 2Z7WA 1E6JL 1QEXA 4PGZA 5ALCL 5C7XL 3VM5A 4Z7NE 1HCFX 4LZKA 5CR3A 3HOZG 1FFRA 1NANH 3BGFB 3D2UD 4B53A 3K91A 5C3LD 4PJDE 2F0DA 1YIJA 4KROC 3VVVA 1QWHA 1ZXKA 4OV5B 1F4YH 1QABA 2HTLC 1P8LA 1E5YA 1ECZA 1WO2A 3FJTA 3IRZA 4I2XE 1XXGA 1QVOA 2QSCH 4FF9A 1ET5A 3IJYB 1NC4D 4HXAH 4N2EA 4ZS7H 4WHYH 2CGRH 4F7XA 1D7CA 1VEOA 2PYFA 1IAIL 4G7RB 4DZ8A 5ELOA 3QJYA 2NB0A 4AKPA 2CA3A 5FC9A 2EIJB 4G6JL 3SKOB 4Z7QB 4HIPA 1YNKL 5F97E 2GAZA 1EBAA 3MJGX 4Q56A 2J8UF 2K70A 3DXAD 4ECNA 2LY7A 5A3IC 5CLZA 4N9TA 3F62A 1X6LA 1BVLB 4Y4FC 3NAAL 1T89A 4RSVA 3LKSA 2FD6L 4DK6C 5GZND 4F7MB 2JA7H 4E9YA 1QILA 1OOAA 3BUYA 3M85A 1PZDA 2MH4A 4G7YL 4KPHH 4RDQG 1NFDF 3CZKA 5AKSA 5D5MA 4LRNH 1ZPLA 4N2AA 1L6ZA 3ET9F 3MJ6A 2FHTA 4DKAA 3S2HH 4A3DH 1DDHB 2ZUUA 1TEGA 1EYDA 1L1OB 2BOCB 2LAGB 2I5HA 4C47A 3HI6L 2PETA 1ZXTA 4WJWA 5C09D 3PWUB 3ARFB 5MEND 3CMAA 3SK6A 1ZVSA 2AS5M 5CGTA 4OZGB 1B0RA 2AK1L 3E9TA 4YHZH 5AOZA 4UP9A 3J81c 1T0NB 1XGPA 1RH8A 5J6SA 2HZHA 1Z5HA 3JTSA 2PW2A 3B9KA 5J6HB 3RG1C 4DK0A 3VUAA 1GKHA 1MCJA 1DVSA 1YY8B 3E0JA 1L9QA 1P7KA 3H3BC 1RPUA 2MUYA 4TULH 2YGOA 4HPOH 3U36A 3ZRSA 4EGVA 1JFHA 5BRPA 3L2LA 3GI8L 4KZEH 3OB0H 1P4IL 4XP6L 3UBXG 4AWJC 4DGYH 4F1SA 4EI5D 4L3EE 3IDGA 2L3BA 4X6BB 5HJDA 3A55A 4R96B 5C5MA 4KZCA 2C9UA 4LFAQ 1WAAA 4D7PA 5AW8B 5LGJA 3UE1A 3HMXH 4W4NA 2EH7H 2W0FB 3ZE0E 1BYPA 4KRMB 5BQ7B 4PJFB 1TVDA 3INOA 3MUJA 2OI9C 3TS0A 4ETQA 3HOWB 4F8NA 1FYTE 2R4SL 1VKXB 5M5WH 3SPGA 3KE0A 4PP1D 4W9LC 3TBTB 1BQSA 3O9WA 3BDOA 5IY0A 3U2SA 5I1GH 2SEBB 1DE4B 2W0LA 3QFGA 1G9HA 1PRTD 5AVYB 4KKPA 3ROOB 3QBTB 5HDBE 2G5RA 1A1OB 1IVLA 2WV6D 5GGUA 2IH1A 5CD5D 2X4QB 4L8DA 4IYKA 3INUL 4XCNA 5FK9B 3RDTD 5ES4B 1ODAA 2JK8A 3VXOA 1XMEB 4JFZL 1ZA6B 1CE6B 4CSTA 1XR8A 2WJ5A 3U82B 4JE4B 2Y36L 1P1ZB 2CJ3A 4LGSB 3S36H 3TPUB 4PCSA 4HZLB 2Q8BL 2Y5TA 2YAQA 4OLWH 2XPGA 1IGFL 4K94L 1FL6A 1E24A 4NMZA 4BFGA 2ICEC 4EN3D 5IJKC 3LPGA 4JK0D 3KH4A 4N6RA 2H2PD 4UNIA 1S7UA 4I87A 4YFEA 2NYZD 3MBXH 4MNOA 1Q8KA 1M56B 2D0PA 1SHWA 4PNYA 1Q0EA 4YHNA 1KBGL 4LDLB 3RI5K 3LPOA 4ZK8A 3FUIA 4FFYA 1D2OA 3BKCL 4J5VA 4NZTH 3LRMA 1P5VB 4HUWB 4JDEB 2E9JA 4QEGA 4Y16D 5D96C 3RVUD 5ID0B 4PFEA 1EAPA 1OF2B 4JCLA 1OP9A 4JRXB 4JFED 2B29A 3BWZA 3JVGC 2OJEB 3N9GL 4OIJA 4JUSA 2J6EL 5LHDA 4OJFH 3OXRA 2CGZA 2XN0A 4K7PH 4GT7A 1ESRA 5IIFA 3QORA 1ILPA 3U0PA 4LHUG 3LJ3A 3WTWA 5T1GA 3PHOB 3U58A 3EFXD 4DUZQ 2CHWA 1QLFB 3MCKA 5IR1B 3EIVA 3TNMB 1QTPA 2CHXA 5DO2C 2V2XB 1T66C 2NN6H 3QB7C 1I1AA 1HZBA 1P5UC 4HV8B 1TETH 1F9RA 4NJ9L 4EDWL 3DM3A 5J4MA 3Q3GA 3O2DL 4LDOB 4M29A 1BLIA 1IBHA 3ECBA 2BH8A 4N22A 5EZLB 4DK6A 4Z0XB 2B2TA 1IFHL 5EO1A 4FX5A 3EROA 1XR9A 5F7WC 3RE0A 3BZ4B 4U1IA 3KPPA 3AG1B 5HHPB 3UJIH 5L7XL 4JO5A 2AAVA 2R7DA 3NCFB 3P9MA 3SE4A 3RZCD 1G1OA 4EI6B 1IL1A 2OXGA 2XN1A 5CCKH 3IFOA 3P3UA 3C60C 1F2YA 2WBJB 2VE6A 5IVNA 5GQOA 3DX4A 4PQXA 3VH8G 4JUTA 1JK9A 3NABH 1UB6A 4OCYL 4TMPA 4FQCH 3RVVC 3IFLL 4UDUC 5KNDA 1CVSC 4HGWB 4JFFA 5C6WH 4JQVC 1M9WA 5IVXE 1ILQA 1CQYA 2A6DA 4W9ZA 1A7BA 4ODXB 1BVNP 5FHBH 5J06A 1BR9A 4C4KO 1EJOH 1X7TA 5IHBA 1CXIA 1IM3A 1TS4A 3URYA 1T4KA 1I5FA 2VLLA 3P0VL 4GQQA 4IJ3C 4NHCL 5IF0A 1JNNH 3CRLC 3MWYW 3RGVC 4GLRH 5HI3C 5EEWA 4A37A 5BZWB 3WY2A 1DQVA 3DXAE 3EYSL 3H42L 4GO6B 1TDQA 5DEHA 1RZJL 2VDQB 1MFDL 3O0RH 2J0TD 3OVUB 3K8KA 4FFYL 3LV3B 4HK3J 4PVLA 5DHDA 5AJ3Q 4AW7A 1QLEL 2F68X 4TUUA 4EVNB 3TT1L 3OC5A 4H4NA 3MTXA 2VM9A 4H5SB 1TJHH 3J80i 2VDOH 2VAJA 4M4RB 5E8EA 1R19A 1YEZA 5M5YH 3O3AB 4YO0B 1N34Q 5KYYB 2BSSB 3HP3A 4JEGB 2AP2A 3DMUA 1CXLA 3BP5A 4EIZC 4MA8H 5FW6A 3BSGA 2UUDK 2JXMA 15C8L