3K1HA

Crystal structure of hp1076 from h.pylori
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
FSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
total genus 42
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1hA00
3K1HA 3K1IC
chains in the Genus database with same CATH superfamily
2QLAA 1XZQA 1N1CA 2P1AA 4MVSA 3C18A 1VB5A 3QZCA 3IEEA 4JE9A 2CGEA 5L0GA 4OIRF 3RYLA 3U5SA 1TWAA 4ZLDA 3EQLF 3DJUB 4C3BA 1UG7A 3NG1A 2LCHA 3JTLO 2JD3A 2KQ9A 2Q9BA 4JW1A 4PR9A 5L0HA 3EFOA 4G7OF 1FMWA 3LUTB 1WATA 1QKRA 3G4ZA 1LPEA 3OEOA 4ULWA 5A6BA 1AUEA 2A6EF 4MNDA 5E2QA 1FFTC 3NYJA 1W2WA 2J0WA 3PCVA 5F5HA 1MMNA 5L0JA 1ZU5A 3L8IA 2C04A 2YHSA 4OD4A 3GM2A 5AGFA 3LLIA 2WZLA 1RXQA 1Z63A 1Z5ZA 3FVYA 2CDQA 4MS2A 3ZQVA 4AE4A 3AG2C 4BJ1A 4EBJA 2EPOA 2MWQA 1T6IA 2FGYA 3E70C 5FCLA 1R5ID 4BJTA 1HE9A 4NC3A 4E17A 3GWLA 4IWBA 4GEHA 4WGZA 4JURI 3S84A 1NFNA 2LP4A 3JRTA 4KBLA 4XLPF 4MW8A 3T6BA 2J9VA 4MVZA 1YARO 4LDQA 4P9FA 3RVZA 1J8MF 4J7YA 1OCOC 1JPJA 2Q3TA 2R05A 3QVYA 1SF8A 2OQMA 4O79A 2WL8A 4D4XA 1Z6AA 1JMWA 1FR0A 4C3EA 3B0UX 1G4US 3ASNC 4JTCB 1HMDA 1Q0GA 3UMIA 4AL1A 4CDAA 2WVNA 2HMQA 3LNRA 3M15A 3DJNB 2R7SA 2UUIA 1BR2A 3G50A 4K1OA 3X1OA 3S90A 3NDBB 3LAYA 1QVXA 1GM5A 4C7OB 2XLHA 1HE1A 2VH3A 5L0DA 3EGDB 5KYNA 4EBKA 4PFPA 1HW2A 2AWCA 4LERA 3CSKA 1YZAA 3NMKA 5D92A 4L6RA 3UMKA 4A4AA 3ZIBA 4A2NB 5DLJA 3UGOA 4BJ6C 3GM3A 4Q7CA 1CPRA 2IXMA 2A68F 4JCHA 5DQZA 4EHPA 4BJ5C 5T1DB 5BUOA 2GAQA 2ZXWC 4AK9A 1F1MA 1E86A 4N6HA 3EFOB 4XPXA 4PK4A 5KYUB 4N6CA 3SXMA 4RDAA 5A6KA 2WB7A 2GA0A 2V26A 5L3VA 4O6YA 1O3UA 2J7PA 2RSEB 4J30B 3CAXA 2MHRA 2A69F 3H2UA 3KYJA 1OXKA 1Q0FA 1AVOB 2KJGA 4IGGA 1YDIA 3K1HA 4CDVA 2AWYA 1ORSC 4OIQF 1CGOA 3KL4A 4DXWA 2NG1A 2R7QA 3L34A 1TR2A 2XL8A 1PD1A 3HTKC 4U9EA 3T6GB 3K6BA 4Z9IA 1D0XA 2P61A 3LS1A 3UR3C 3X2QC 2AVKA 4DVZA 2PX3A 1Y6DA 1GS9A 3N2ZB 4G78A 4DRJB 1TWCA 2J0XA 4BJ6A 5B1BC 1IW7F 4CJGA 3RFYA 3G4XA 2J7PD 3W8IA 4BJ5A 2NPUA 4BEMJ 2PX0A 3DD7A 1KU2A 4P9TA 4HE8D 3POVA 1E83A 1E85A 1NU7D 3KH2A 4MVMA 3ABMC 1OW7A 3PMRA 2GDCA 2P7VA 5L0CA 3JT1A 4U5GA 2J46A 4NTBA 3HNIA 3C62A 2G3KA 2W9YA 2B0HA 4PJNA 2CW0F 2IM8A 4ULVA 3DAGA 2KNHA 4Q5SF 2Q9AA 4WABA 1YZCA 1VOMA 3NRHA 4E0IA 1VTMP 2XLMA 4JIOA 4CIPA 2ASRA 4MQ9F 5DS5A 2BE5F 2IXNA 3EGXA 3LEVA 3E9VA 4JKVA 1LKXA 4XEKA 4YL0A 2A6HF 3NMJA 2EIJC 3ZTZA 1LE4A 3U9JA 1A7EA 5COGA 1ZHTA 1JR8A 2Y69C 3B29A 2WZGA 5CI8A 1LI5A 2KSFA 3EHMA 5E33A 4YT2A 1YLMA 3EH1A 3ITFA 3VRCA 2M64A 2P6VA 1OCZC 2YRFA 4RBNA 1V4AA 5D91A 1YAUO 4BG0A 4JTDB 2Q4FA 1PD0A 3RQGA 2VCAA 4U5BE 5DQTA 1L7CA 4LLEA 4Z9JA 1LIHA 1SR2A 3DMDA 3M1CB 4NQFA 4U5DE 3RVYA 5FZTA 3L8JA 3S29A 3W2VA 4KNVA 2DYSC 1VYKA 1D1AA 1WASA 3SZRA 1YA9A 2A1DD 1BR1A 3MFNA 5F5FA 3MBGA 1LS4A 2R7WA 4PJLA 2PBEA 5L0FA 1M2VA 4MVRA 3S28A 4O6MA 3ECSA 3SNHA 3ABLC 1E2XA 2IXOA 3B71A 4IAOA 2ZXPA 3GEHA 3V5YA 5AC4A 1ZW2A 1GGQA 1MNEA 2X51A 2UUHA 3SP1A 2YVKA 1I4ZA 3EHNA 2HJMA 3KMIA 1K40A 1WWPA 5COFA 5A6BD 2C03A 1ZZPA 2PF4E 4EUKB 2XLDA 3FMSA 3VYWA 3TQOA 2I15A 3WG7C 5JT4A 3PDMP 3UGPA 1TWGA 1D0ZA 4BPMA 3HNJA 2GWWA 4NTFA 1ZU4A 4IRUA 3F46A 1K05A 1M57C 4JJGA 1V55C 3R2PA 3R7CA 3U3BA 4AX2A 2LQGA 1CGME 1U6HA 3V5XA 5JRAA 3HNKA 1WN0A 2ZXRA 4LDRA 1D1CA 2XM0A 3NYLA 3SXYA 3T6JA 2R7RA 1EA8A 4OD5A 2L6FA 3F47A 2B0JA 2VCCA 1DOWA 4LLCA 3EG9A 3RQFA 1OCRC 2BL2A 3H65A 3W8HA 1TFOB 1HMOA 3O10A 3S9OA 2OJED 1OCCC 3LLKA 4H4KC 1QSPA 3EGXB 1AEPA 1QQ3A 3NMIA 2NUTB 1VMAA 1Y4CA 3WHNA 2PNOA 4K7BA 4N06A 2XLOA 3M79A 1NG1A 2O9XA 4QI0A 4XQ1A 2LFDA 4E7ZA 3PHF2 2V3CC 2EIMC 4JC7A 2J9BA 5KYYB 4OIPF 1LE2A 1ST6A 2YL7A 1MNDA 3BEHA 4XEFA 3EJNA 3ATPA 5BQIA 5E3AA 1OXBA 2EPLX 2XS8A 3KKBA 3MLGA 2LK4A 1O5HA 1Q0DA 2EPNA 3LJBA 4U5EE 1H9TA 1NBBA 2DI3A 1V54C 2R9RB 2HV6A 3DAFA 2QTVA 4IB4A 3U2LA 2R02A 2G3VA 1T5OA 5B3IA 5A6AA 1YJGA 3N0TA 1CPQA 4AL0A 4O6NA 1A0BA 2JX0A 5T3WA 1NFOA 1YVIA 1I5NA 3L0IA 4CX9A 1S05A 1OW8A 2VC9A 2VCBA 3LEOA 3LNMB 1C03A 1MMAA 4YT5A 3TOMA 4JJFA 3ZSUA 4FAPB 1NZEA 2J9UA 3DE8A 5JVEA 3VF0A 3CEXA 2HS5A 4ONSA 1C17M 2NUPA 3NYMA 3AOUA 2ZD9A 3OWTA 1FAPB 1QPUA 5F28E 4CJOA 3B9QA 3HNLA 4HFFB 1ZHYA 1B68A 4AE4B 1L3PA 4XTKA 4ER9A 3JSEO 5JSLA 4B6IA 4YN0B 1NU9C 3ZVRA 1SMYF 2IXPA 3CQZA 4GYTA 2DB4A 1LI7A 4YJWA 3US6A 2Y3BA 5DS6A 1CGNA 4DRHB 1ZHZA 3FAPB 4DBRA 3U9MA 4I44A 3M4BA 1JAFA 2HZ8A 1H6GA 3K7DA 2HSQA 2JPUA 3EG9B 3FAJA 3S27A 3VM6A 2H8AA 1BZ4A 4YL1A 1OQCA 2J8WA 1ZVZA 2HKVA 4KNWA 3FDQA 1MMDA 3N24A 1Z7Qc 2HSBA 3RQEA 4XEVA 4E7SA 5JUAA 5HV9A 4JTAB 1WGWA 3AG3C 2Y3HA 5E3CA 3TD7A 4U5FE 4XWJA 2AP3A 3RIPA 2L6HA 2QE9A 2Z15A 5L3QA 1U89A 2IYLD 1FNTc 2DYRC 3JCUQ 2Y3DA 1PV3A 1T6QA 4ANJA 2YEVA 3U0CA 3CZ6A 1J8YF 1JPNA 3B0VC 4YL3A 2Y39A 2HV7A 4R32A 2XL4A 2LIGA 1KNYA 3ZC4A 3NKDA 4YT8A 4MTFA 1FMVA 3DXJF 1C02A 2R7TA 2OJQA 3LS0A 4K0DA 2R03A 3I5QA 3C63A 1OW6A 3AG4C 3O6XA 3ZQYA 1LS1A 1EQ1A 3EPVA 3K1IC 3MX3A 1HY5A 4CS9C 2L9JA 2NSGA 2ZPAA 3UNGC 5KYWA 4FWVA 1Q0MA 1ORYA 3V5ZA 3EZIA 4DVYP 4JCZA 5AC5A 1QLEC 2EPMX 2YZSA 1TKNA 3DZAA 4WJ0A 2IOQA 4X0RA 3DE9A 2LD6A 1A7DA 2L6GA 1RKCA 4FX5A 4Q4ZF 4MTGA 3IPMO 3DM5A 3JYHA 1ORJA 1BR4A 4GQHA 2NUPB 3O39A 3JZ0A 5L0IA 1K04A 4YWQA 2MYSA 4CIHA 4H54A 2Q7RA 5EHHA 1XZPA 1V74B 1T6UA 1ZW3A 1R4TA 1YA7O 2GFHA 3T4RA 3T9OA 1RJ9A 5K0IA 4ZLCA 1M56C 4MVUA 4G0HA 1NSGB 4DOZA 1VLSA 4LACB 5DS4A 3ZTMA 3U2MA 2XL6A 3ZWIA 4G7ZF 2H7OA 3H2VA 3K1IA 2CYDA 3SXZA 4CBEA 3W2WA 4CS9A 1FTSA 2J9WA 3S0XA 2HJ3A 4XLNF 2H7VC 1WTYA 2KC3A 3AQCA 3K66A 4F4BA 2KK1A 1JOGA 1D1BA 2CNWD 1XWJA 2XLWA 1M2OA 2YKZA 2R7OA 5KYUA 4W8PA 2FFHA 5BQGA 1BDJB 3HJCA 2OEVA 4D4NA 3GORA 5GPGB 4CSAC 1E84A 1SZIA 1BBHA 2FAPB 2YL1A 1EKYA 3I4UA 2F22A 3IQ6A 5HSWA 2QUPA 3QVZA 3WODF 2KGOA 2HMZA 3SXKA 1H7IA 4RD9A 3RKOF 4E0HA 1G4WR 1VLTA 3JSZA 3GANA 1I4YA 2HFIA 3MYIA 1QZXA 4XPWA 5T3TA 3RF3A 4JEBA 1RKEA 3OA1A 4O7GA 4MVOA 1OR2A 4IJJA 4CS7A 4LDKA 1MMGA 4G7HF 3SYNA 5B1AC 1KTMA 3JYYA 4HFKB 3UMHA 4N4WA 4M63A 1DOVA 4JVSA 3TJ6A 3RW0A 3TJ5A 3I5PA 3ZG1A 2XLVA 2YLGA 5A69A 5KYWB 2OCCC 3FXHA 3GM1A 1YYJA 1Z23A 2KYHA 2QNLA 3GODA 5BQHA 2EPKX 2YL0A 3L1MA 2DGJA 4MVQA 2LFFA 3B0PA 3IQCA 4IAQA 3V7OA 4OIOF 1Q0KA 2BC5A 2PFDA 1IZMA 4PACA 1O87A 1VYIA 2QY9A 2PP4A 4PJJA 3JRMO 4CSAA 4NCQA 1TFKB 3QW0A 5EK0A 1JRAA 1ZHWA 4HEAJ 1M2VB 1OR3A 3FOPA 2W4MA 2OKUA 2W4BA 3Q7LA 1PCXA 2NSFA 4WGYA 2XLEA 2LSEA 4KC9A 4Z9HA 3FOOA 3DWWA 2XSEA 3TK0A 4DJ9A 1G5ZA 1YYXA 1M6TA 1H9GA 2ICWG 1HW1A 1RJ9B 3RH3A 5B3SC 2YLIA 4I3MA 4QDLA 3C8GA 3SEOA 3QW1A 3GWNA 3FHDA 3C7JA 3EH2A 5TJ5E 2H7BA 3VAYA 5CI9A 2TMVP 256BA 5KYXA 5JS5A 5JLIA 1U0BB 4NY3A 1RMVA 3BRJA 3AGTA 4FESA 2R7XA 4DBQA 2XXAA 3EZHA 2X0CA 4I1OB 4DRIB 5EGYA 3KPHA 4I1MA 1Z3IX 1APCA 1TQGA 1A7VA 2EINC 2ETSA 2HUJA 2J45A 2XM4A 3Q6NA 1NLXA 2VB6A 1ZYRF 2E87A 3U8VA 3A9CA 4XPYA 4C3DA 2WVQA 5JP7A 3KYIA 3J06A 2IBFA 3GEEA 2D4UA 2CCYA 4EWCA 4IARA 5CIVA 3ABKC 1TWHA 3C8ZA 4JZAA 3Q6MA 2OEXA 1OKKA 3DM9B 3C8GD 4JRZA 2Y3GA 1FFHA 1SYQA 2WVOA 3DKAA 3IQ5A 1LVKA 3GEIA 4NTAA 5DVWA 4CS8C 3QMKA 2R7UA 4KI2A 2VASA 1RKEB 2D5RB 3TOLA 4UDVA 2ZXOA 2YLDA 4BEJA 3DI5A 2XRHA 4EBBA 1LM3B 3LESA 3NKEA 4J7TA 3TULA 2RD9A 2L81A 3MYFA 2P0NA 3ASOC 2A0BA 2Q00A 2L7AA 3IHUA 4W8KA 3AGUA 3IQTA 1OKKD 2OU6A 4MW3A 2EILC 1G8XA 5COMA 3U8PA 4PJMA 1RCPA 3AJMA 3HKKA 2OG2A 4EIYA 4QI2A 1T01A 4OINF 3A11A 3K33A 2YWAA 2EIKC 4P6IC 1A41A 2I8BA 4E18A 4YT4A 3M4CA 1EI7A 5IY5C 4EKWA 4PFOA 2YQYA 1GQAA 2Q9CA 3Q7GA 3QTHA 1S7ZA 2OOCA 1VK5A 3WAQA 4CS8A 4YK5A 3HLZA 3AG1C 4CDYA 4U9DA 4U5CE 1MQVA 3U3FA 2AU5A 3C8GB 2NUTA 2G62A 1UFBA 1T9KA 1ZHXA 2XS1A 2YL3A 2CNWA 3AQBA 4J32B 4MTOA 4U5HA 3ZDLA 5A6JA 3W4YA 5KYXB 4JEAA 5KYYA 2R25A 1D0YA 2WZFA 2XXAB 1WOLA 2A0UA 2KW3C 2W45A 3O55A 4C7OA 2R7VA 3EGDA 2M4EA
chains in the Genus database with same CATH topology
1N1CA 3QZCA 3IEEA 2CGEA 4OIRF 3RYLA 1TWAA 4ZLDA 3EQLF 3DJUB 4C3BA 3NG1A 5L3VA 2JD3A 2KQ9A 2Q9BA 4JW1A 3EFOA 4G7OF 1FMWA 3OEOA 4ULWA 2A6EF 4MNDA 5E2QA 1FFTC 3NYJA 1W2WA 2J0WA 5F5HA 1MMNA 1ZU5A 2C04A 2YHSA 4OD4A 3LLIA 2WZLA 1Z63A 1Z5ZA 3FVYA 2CDQA 4AE4A 4BJ1A 3AG2C 2MWQA 2FGYA 3E70C 5FCLA 4BJTA 4IWBA 4GEHA 4JURI 3JRTA 4KBLA 4XLPF 3T6BA 2J9VA 1J8MF 1OCOC 1JPJA 2Q3TA 1SF8A 4O79A 2WL8A 1Z6AA 4C3EA 3B0UX 3ASNC 3UMIA 2WVNA 3LNRA 2R7SA 3DJNB 1BR2A 3NDBB 3X1OA 3LAYA 4C7OB 2VH3A 3EGDB 5KYNA 4PFPA 4LERA 3CSKA 5D92A 3UMKA 3ZIBA 4A2NB 5DLJA 4BJ6C 4Q7CA 2IXMA 2A68F 4JCHA 5DQZA 4BJ5C 5T1DB 5BUOA 2ZXWC 4AK9A 3EFOB 5KYUB 4PK4A 4RDAA 2WB7A 2V26A 4O6YA 2J7PA 4J30B 2A69F 2KJGA 3K1HA 4OIQF 3KL4A 2NG1A 2R7QA 3L34A 1TR2A 1PD1A 3HTKC 3X2QC 3K6BA 4DVZA 1D0XA 3LS1A 3UR3C 2PX3A 3N2ZB 1TWCA 2J0XA 4BJ6A 5B1BC 1IW7F 3RFYA 2J7PD 3W8IA 4BJ5A 2PX0A 3DD7A 1KU2A 3POVA 4HE8D 3KH2A 1NU7D 3ABMC 3PMRA 2P7VA 3JT1A 4U5GA 2J46A 2G3KA 2W9YA 4PJNA 2CW0F 3DAGA 2KNHA 4Q5SF 2Q9AA 3NRHA 1VOMA 4MQ9F 5DS5A 2BE5F 3LEVA 2IXNA 3EGXA 3E9VA 1LKXA 2A6HF 2EIJC 1ZHTA 2Y69C 2WZGA 5CI8A 5E33A 4YT2A 3EHMA 3EH1A 3ITFA 2P6VA 1OCZC 4RBNA 5D91A 4BG0A 1PD0A 4U5BE 4LLEA 3DMDA 3M1CB 4U5DE 3S29A 3W2VA 4KNVA 2DYSC 1VYKA 1D1AA 3SZRA 2A1DD 5F5FA 1BR1A 2R7WA 4PJLA 1M2VA 3S28A 4O6MA 3ECSA 3SNHA 3ABLC 4IAOA 2IXOA 2ZXPA 1MNEA 2X51A 3SP1A 3EHNA 3KMIA 2C03A 2PF4E 3VYWA 3UGPA 3WG7C 1TWGA 1D0ZA 1ZU4A 4IRUA 3F46A 1M57C 4JJGA 1V55C 4AX2A 2ZXRA 3T6JA 2R7RA 1D1CA 3NYLA 4OD5A 3F47A 2B0JA 4LLCA 3EG9A 1OCRC 3H65A 3W8HA 1OCCC 3LLKA 4H4KC 3EGXB 2NUTB 1VMAA 4N06A 4K7BA 1NG1A 2O9XA 4QI0A 3PHF2 4E7ZA 2EIMC 5KYYB 4OIPF 1ST6A 1MNDA 3EJNA 5E3AA 3MLGA 3KKBA 1O5HA 4U5EE 3LJBA 3DAFA 1V54C 2HV6A 2QTVA 2G3VA 3N0TA 4O6NA 5T3WA 3L0IA 3UGOA 3ZSUA 4YT5A 1MMAA 4JJFA 1NZEA 2J9UA 3NYMA 2NUPA 3OWTA 3B9QA 4HFFB 1ZHYA 4AE4B 4XTKA 4B6IA 4YN0B 1NU9C 3ZVRA 1SMYF 2IXPA 3CQZA 4GYTA 4YJWA 5DS6A 2Y3BA 1ZHZA 4DBRA 4I44A 3K7DA 3S27A 3EG9B 3FAJA 4KNWA 3FDQA 1MMDA 3N24A 4E7SA 1WGWA 3AG3C 2Y3HA 5E3CA 3TD7A 4U5FE 4XWJA 3RIPA 5L3QA 2Z15A 2IYLD 2DYRC 3JCUQ 2Y3DA 4ANJA 2YEVA 3CZ6A 1J8YF 1JPNA 3B0VC 2Y39A 2HV7A 3ZC4A 2XL4A 3NKDA 4YT8A 1FMVA 3DXJF 2R7TA 4K0DA 3LS0A 2V3CC 3I5QA 3O6XA 3AG4C 1LS1A 3EPVA 3K1IC 3MX3A 4CS9C 2L9JA 2ZPAA 3UNGC 5KYWA 4FWVA 3EZIA 4DVYP 1QLEC 2YZSA 1TKNA 3DZAA 4WJ0A 2IOQA 4X0RA 4FX5A 4Q4ZF 3DM5A 3JYHA 1BR4A 2NUPB 3O39A 4YWQA 2MYSA 4CIHA 5EHHA 3T4RA 2GFHA 1RJ9A 4ZLCA 1M56C 4G0HA 4DOZA 4LACB 5DS4A 4G7ZF 2H7OA 4CBEA 4CS9A 3W2WA 1FTSA 2J9WA 3S0XA 4XLNF 2H7VC 3AQCA 4F4BA 3K66A 1D1BA 2CNWD 1M2OA 2R7OA 5KYUA 2FFHA 3HJCA 4CSAC 1SZIA 3I4UA 5HSWA 3WODF 2KGOA 4RD9A 3RKOF 5T3TA 3JSZA 3GANA 1QZXA 3OA1A 4O7GA 4IJJA 4CS7A 1MMGA 4G7HF 3SYNA 5B1AC 4HFKB 3UMHA 4M63A 4JVSA 3I5PA 3ZG1A 5KYWB 2OCCC 1Z23A 3GODA 2DGJA 3B0PA 3V7OA 4OIOF 2PFDA 1IZMA 1O87A 1VYIA 2QY9A 2PP4A 4PJJA 4CSAA 4HEAJ 1ZHWA 1M2VB 2W4MA 2W4BA 3Q7LA 1PCXA 2LSEA 4KC9A 2XSEA 3RH3A 1RJ9B 5B3SC 4I3MA 4QDLA 3SEOA 3FHDA 3EH2A 2H7BA 3VAYA 5CI9A 5KYXA 4NY3A 4FESA 2R7XA 4DBQA 2XXAA 3EZHA 4I1OB 5EGYA 4I1MA 4YT4A 1Z3IX 4PFOA 2EINC 2J45A 3Q6NA 5DQTA 2VB6A 1ZYRF 2E87A 4C3DA 2WVQA 4EWCA 3ABKC 1TWHA 4JZAA 3Q6MA 1OKKA 3DM9B 2Y3GA 1FFHA 2WVOA 2R7UA 1LVKA 5DVWA 4CS8C 3QMKA 4KI2A 2VASA 2D5RB 2ZXOA 4BEJA 2XRHA 4EBBA 3LESA 3NKEA 2L81A 3ASOC 4W8KA 1OKKD 2EILC 1G8XA 4PJMA 2OG2A 4QI2A 4OINF 3K33A 2EIKC 4P6IC 2I8BA 5IY5C 2Q9CA 3Q7GA 1S7ZA 4CS8A 1VK5A 3HLZA 3AG1C 4U5CE 2NUTA 2G62A 3AQBA 1ZHXA 4J32B 2CNWA 4U5HA 5KYXB 5KYYA 1D0YA 2WZFA 2XXAB 2W45A 4C7OA 2KW3C 2R7VA 3EGDA 2M4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1H A;  3K1I C; 
#chains in the Genus database with same CATH topology
 2QLA A;  1XZQ A;  1N1C A;  2P1A A;  4MVS A;  3C18 A;  1VB5 A;  3QZC A;  3IEE A;  4JE9 A;  2CGE A;  5L0G A;  4OIR F;  3RYL A;  3U5S A;  1TWA A;  4ZLD A;  3EQL F;  3DJU B;  4C3B A;  1UG7 A;  3NG1 A;  2LCH A;  3JTL O;  2JD3 A;  2KQ9 A;  2Q9B A;  4JW1 A;  4PR9 A;  5L0H A;  3EFO A;  4G7O F;  1FMW A;  3LUT B;  1WAT A;  1QKR A;  3G4Z A;  1LPE A;  3OEO A;  4ULW A;  5A6B A;  1AUE A;  2A6E F;  4MND A;  5E2Q A;  1FFT C;  3NYJ A;  1W2W A;  2J0W A;  3PCV A;  5F5H A;  1MMN A;  5L0J A;  1ZU5 A;  3L8I A;  2C04 A;  2YHS A;  4OD4 A;  3GM2 A;  5AGF A;  3LLI A;  2WZL A;  1RXQ A;  1Z63 A;  1Z5Z A;  3FVY A;  2CDQ A;  4MS2 A;  3ZQV A;  4AE4 A;  3AG2 C;  4BJ1 A;  4EBJ A;  2EPO A;  2MWQ A;  1T6I A;  2FGY A;  3E70 C;  5FCL A;  1R5I D;  4BJT A;  1HE9 A;  4NC3 A;  4E17 A;  3GWL A;  4IWB A;  4GEH A;  4WGZ A;  4JUR I;  3S84 A;  1NFN A;  2LP4 A;  3JRT A;  4KBL A;  4XLP F;  4MW8 A;  3T6B A;  2J9V A;  4MVZ A;  1YAR O;  4LDQ A;  4P9F A;  3RVZ A;  1J8M F;  4J7Y A;  1OCO C;  1JPJ A;  2Q3T A;  2R05 A;  3QVY A;  1SF8 A;  2OQM A;  4O79 A;  2WL8 A;  4D4X A;  1Z6A A;  1JMW A;  1FR0 A;  4C3E A;  3B0U X;  1G4U S;  3ASN C;  4JTC B;  1HMD A;  1Q0G A;  3UMI A;  4AL1 A;  4CDA A;  2WVN A;  2HMQ A;  3LNR A;  3M15 A;  3DJN B;  2R7S A;  2UUI A;  1BR2 A;  3G50 A;  4K1O A;  3X1O A;  3S90 A;  3NDB B;  3LAY A;  1QVX A;  1GM5 A;  4C7O B;  2XLH A;  1HE1 A;  2VH3 A;  5L0D A;  3EGD B;  5KYN A;  4EBK A;  4PFP A;  1HW2 A;  2AWC A;  4LER A;  3CSK A;  1YZA A;  3NMK A;  5D92 A;  4L6R A;  3UMK A;  4A4A A;  3ZIB A;  4A2N B;  5DLJ A;  3UGO A;  4BJ6 C;  3GM3 A;  4Q7C A;  1CPR A;  2IXM A;  2A68 F;  4JCH A;  5DQZ A;  4EHP A;  4BJ5 C;  5T1D B;  5BUO A;  2GAQ A;  2ZXW C;  4AK9 A;  1F1M A;  1E86 A;  4N6H A;  3EFO B;  4XPX A;  4PK4 A;  5KYU B;  4N6C A;  3SXM A;  4RDA A;  5A6K A;  2WB7 A;  2GA0 A;  2V26 A;  5L3V A;  4O6Y A;  1O3U A;  2J7P A;  2RSE B;  4J30 B;  3CAX A;  2MHR A;  2A69 F;  3H2U A;  3KYJ A;  1OXK A;  1Q0F A;  1AVO B;  2KJG A;  4IGG A;  1YDI A;  3K1H A;  4CDV A;  2AWY A;  1ORS C;  4OIQ F;  1CGO A;  3KL4 A;  4DXW A;  2NG1 A;  2R7Q A;  3L34 A;  1TR2 A;  2XL8 A;  1PD1 A;  3HTK C;  4U9E A;  3T6G B;  3K6B A;  4Z9I A;  1D0X A;  2P61 A;  3LS1 A;  3UR3 C;  3X2Q C;  2AVK A;  4DVZ A;  2PX3 A;  1Y6D A;  1GS9 A;  3N2Z B;  4G78 A;  4DRJ B;  1TWC A;  2J0X A;  4BJ6 A;  5B1B C;  1IW7 F;  4CJG A;  3RFY A;  3G4X A;  2J7P D;  3W8I A;  4BJ5 A;  2NPU A;  4BEM J;  2PX0 A;  3DD7 A;  1KU2 A;  4P9T A;  4HE8 D;  3POV A;  1E83 A;  1E85 A;  1NU7 D;  3KH2 A;  4MVM A;  3ABM C;  1OW7 A;  3PMR A;  2GDC A;  2P7V A;  5L0C A;  3JT1 A;  4U5G A;  2J46 A;  4NTB A;  3HNI A;  3C62 A;  2G3K A;  2W9Y A;  2B0H A;  4PJN A;  2CW0 F;  2IM8 A;  4ULV A;  3DAG A;  2KNH A;  4Q5S F;  2Q9A A;  4WAB A;  1YZC A;  1VOM A;  3NRH A;  4E0I A;  1VTM P;  2XLM A;  4JIO A;  4CIP A;  2ASR A;  4MQ9 F;  5DS5 A;  2BE5 F;  2IXN A;  3EGX A;  3LEV A;  3E9V A;  4JKV A;  1LKX A;  4XEK A;  4YL0 A;  2A6H F;  3NMJ A;  2EIJ C;  3ZTZ A;  1LE4 A;  3U9J A;  1A7E A;  5COG A;  1ZHT A;  1JR8 A;  2Y69 C;  3B29 A;  2WZG A;  5CI8 A;  1LI5 A;  2KSF A;  3EHM A;  5E33 A;  4YT2 A;  1YLM A;  3EH1 A;  3ITF A;  3VRC A;  2M64 A;  2P6V A;  1OCZ C;  2YRF A;  4RBN A;  1V4A A;  5D91 A;  1YAU O;  4BG0 A;  4JTD B;  2Q4F A;  1PD0 A;  3RQG A;  2VCA A;  4U5B E;  5DQT A;  1L7C A;  4LLE A;  4Z9J A;  1LIH A;  1SR2 A;  3DMD A;  3M1C B;  4NQF A;  4U5D E;  3RVY A;  5FZT A;  3L8J A;  3S29 A;  3W2V A;  4KNV A;  2DYS C;  1VYK A;  1D1A A;  1WAS A;  3SZR A;  1YA9 A;  2A1D D;  1BR1 A;  3MFN A;  5F5F A;  3MBG A;  1LS4 A;  2R7W A;  4PJL A;  2PBE A;  5L0F A;  1M2V A;  4MVR A;  3S28 A;  4O6M A;  3ECS A;  3SNH A;  3ABL C;  1E2X A;  2IXO A;  3B71 A;  4IAO A;  2ZXP A;  3GEH A;  3V5Y A;  5AC4 A;  1ZW2 A;  1GGQ A;  1MNE A;  2X51 A;  2UUH A;  3SP1 A;  2YVK A;  1I4Z A;  3EHN A;  2HJM A;  3KMI A;  1K40 A;  1WWP A;  5COF A;  5A6B D;  2C03 A;  1ZZP A;  2PF4 E;  4EUK B;  2XLD A;  3FMS A;  3VYW A;  3TQO A;  2I15 A;  3WG7 C;  5JT4 A;  3PDM P;  3UGP A;  1TWG A;  1D0Z A;  4BPM A;  3HNJ A;  2GWW A;  4NTF A;  1ZU4 A;  4IRU A;  3F46 A;  1K05 A;  1M57 C;  4JJG A;  1V55 C;  3R2P A;  3R7C A;  3U3B A;  4AX2 A;  2LQG A;  1CGM E;  1U6H A;  3V5X A;  5JRA A;  3HNK A;  1WN0 A;  2ZXR A;  4LDR A;  1D1C A;  2XM0 A;  3NYL A;  3SXY A;  3T6J A;  2R7R A;  1EA8 A;  4OD5 A;  2L6F A;  3F47 A;  2B0J A;  2VCC A;  1DOW A;  4LLC A;  3EG9 A;  3RQF A;  1OCR C;  2BL2 A;  3H65 A;  3W8H A;  1TFO B;  1HMO A;  3O10 A;  3S9O A;  2OJE D;  1OCC C;  3LLK A;  4H4K C;  1QSP A;  3EGX B;  1AEP A;  1QQ3 A;  3NMI A;  2NUT B;  1VMA A;  1Y4C A;  3WHN A;  2PNO A;  4K7B A;  4N06 A;  2XLO A;  3M79 A;  1NG1 A;  2O9X A;  4QI0 A;  4XQ1 A;  2LFD A;  4E7Z A;  3PHF 2;  2V3C C;  2EIM C;  4JC7 A;  2J9B A;  5KYY B;  4OIP F;  1LE2 A;  1ST6 A;  2YL7 A;  1MND A;  3BEH A;  4XEF A;  3EJN A;  3ATP A;  5BQI A;  5E3A A;  1OXB A;  2EPL X;  2XS8 A;  3KKB A;  3MLG A;  2LK4 A;  1O5H A;  1Q0D A;  2EPN A;  3LJB A;  4U5E E;  1H9T A;  1NBB A;  2DI3 A;  1V54 C;  2R9R B;  2HV6 A;  3DAF A;  2QTV A;  4IB4 A;  3U2L A;  2R02 A;  2G3V A;  1T5O A;  5B3I A;  5A6A A;  1YJG A;  3N0T A;  1CPQ A;  4AL0 A;  4O6N A;  1A0B A;  2JX0 A;  5T3W A;  1NFO A;  1YVI A;  1I5N A;  3L0I A;  4CX9 A;  1S05 A;  1OW8 A;  2VC9 A;  2VCB A;  3LEO A;  3LNM B;  1C03 A;  1MMA A;  4YT5 A;  3TOM A;  4JJF A;  3ZSU A;  4FAP B;  1NZE A;  2J9U A;  3DE8 A;  5JVE A;  3VF0 A;  3CEX A;  2HS5 A;  4ONS A;  1C17 M;  2NUP A;  3NYM A;  3AOU A;  2ZD9 A;  3OWT A;  1FAP B;  1QPU A;  5F28 E;  4CJO A;  3B9Q A;  3HNL A;  4HFF B;  1ZHY A;  1B68 A;  4AE4 B;  1L3P A;  4XTK A;  4ER9 A;  3JSE O;  5JSL A;  4B6I A;  4YN0 B;  1NU9 C;  3ZVR A;  1SMY F;  2IXP A;  3CQZ A;  4GYT A;  2DB4 A;  1LI7 A;  4YJW A;  3US6 A;  2Y3B A;  5DS6 A;  1CGN A;  4DRH B;  1ZHZ A;  3FAP B;  4DBR A;  3U9M A;  4I44 A;  3M4B A;  1JAF A;  2HZ8 A;  1H6G A;  3K7D A;  2HSQ A;  2JPU A;  3EG9 B;  3FAJ A;  3S27 A;  3VM6 A;  2H8A A;  1BZ4 A;  4YL1 A;  1OQC A;  2J8W A;  1ZVZ A;  2HKV A;  4KNW A;  3FDQ A;  1MMD A;  3N24 A;  1Z7Q c;  2HSB A;  3RQE A;  4XEV A;  4E7S A;  5JUA A;  5HV9 A;  4JTA B;  1WGW A;  3AG3 C;  2Y3H A;  5E3C A;  3TD7 A;  4U5F E;  4XWJ A;  2AP3 A;  3RIP A;  2L6H A;  2QE9 A;  2Z15 A;  5L3Q A;  1U89 A;  2IYL D;  1FNT c;  2DYR C;  3JCU Q;  2Y3D A;  1PV3 A;  1T6Q A;  4ANJ A;  2YEV A;  3U0C A;  3CZ6 A;  1J8Y F;  1JPN A;  3B0V C;  4YL3 A;  2Y39 A;  2HV7 A;  4R32 A;  2XL4 A;  2LIG A;  1KNY A;  3ZC4 A;  3NKD A;  4YT8 A;  4MTF A;  1FMV A;  3DXJ F;  1C02 A;  2R7T A;  2OJQ A;  3LS0 A;  4K0D A;  2R03 A;  3I5Q A;  3C63 A;  1OW6 A;  3AG4 C;  3O6X A;  3ZQY A;  1LS1 A;  1EQ1 A;  3EPV A;  3K1I C;  3MX3 A;  1HY5 A;  4CS9 C;  2L9J A;  2NSG A;  2ZPA A;  3UNG C;  5KYW A;  4FWV A;  1Q0M A;  1ORY A;  3V5Z A;  3EZI A;  4DVY P;  4JCZ A;  5AC5 A;  1QLE C;  2EPM X;  2YZS A;  1TKN A;  3DZA A;  4WJ0 A;  2IOQ A;  4X0R A;  3DE9 A;  2LD6 A;  1A7D A;  2L6G A;  1RKC A;  4FX5 A;  4Q4Z F;  4MTG A;  3IPM O;  3DM5 A;  3JYH A;  1ORJ A;  1BR4 A;  4GQH A;  2NUP B;  3O39 A;  3JZ0 A;  5L0I A;  1K04 A;  4YWQ A;  2MYS A;  4CIH A;  4H54 A;  2Q7R A;  5EHH A;  1XZP A;  1V74 B;  1T6U A;  1ZW3 A;  1R4T A;  1YA7 O;  2GFH A;  3T4R A;  3T9O A;  1RJ9 A;  5K0I A;  4ZLC A;  1M56 C;  4MVU A;  4G0H A;  1NSG B;  4DOZ A;  1VLS A;  4LAC B;  5DS4 A;  3ZTM A;  3U2M A;  2XL6 A;  3ZWI A;  4G7Z F;  2H7O A;  3H2V A;  3K1I A;  2CYD A;  3SXZ A;  4CBE A;  3W2W A;  4CS9 A;  1FTS A;  2J9W A;  3S0X A;  2HJ3 A;  4XLN F;  2H7V C;  1WTY A;  2KC3 A;  3AQC A;  3K66 A;  4F4B A;  2KK1 A;  1JOG A;  1D1B A;  2CNW D;  1XWJ A;  2XLW A;  1M2O A;  2YKZ A;  2R7O A;  5KYU A;  4W8P A;  2FFH A;  5BQG A;  1BDJ B;  3HJC A;  2OEV A;  4D4N A;  3GOR A;  5GPG B;  4CSA C;  1E84 A;  1SZI A;  1BBH A;  2FAP B;  2YL1 A;  1EKY A;  3I4U A;  2F22 A;  3IQ6 A;  5HSW A;  2QUP A;  3QVZ A;  3WOD F;  2KGO A;  2HMZ A;  3SXK A;  1H7I A;  4RD9 A;  3RKO F;  4E0H A;  1G4W R;  1VLT A;  3JSZ A;  3GAN A;  1I4Y A;  2HFI A;  3MYI A;  1QZX A;  4XPW A;  5T3T A;  3RF3 A;  4JEB A;  1RKE A;  3OA1 A;  4O7G A;  4MVO A;  1OR2 A;  4IJJ A;  4CS7 A;  4LDK A;  1MMG A;  4G7H F;  3SYN A;  5B1A C;  1KTM A;  3JYY A;  4HFK B;  3UMH A;  4N4W A;  4M63 A;  1DOV A;  4JVS A;  3TJ6 A;  3RW0 A;  3TJ5 A;  3I5P A;  3ZG1 A;  2XLV A;  2YLG A;  5A69 A;  5KYW B;  2OCC C;  3FXH A;  3GM1 A;  1YYJ A;  1Z23 A;  2KYH A;  2QNL A;  3GOD A;  5BQH A;  2EPK X;  2YL0 A;  3L1M A;  2DGJ A;  4MVQ A;  2LFF A;  3B0P A;  3IQC A;  4IAQ A;  3V7O A;  4OIO F;  1Q0K A;  2BC5 A;  2PFD A;  1IZM A;  4PAC A;  1O87 A;  1VYI A;  2QY9 A;  2PP4 A;  4PJJ A;  3JRM O;  4CSA A;  4NCQ A;  1TFK B;  3QW0 A;  5EK0 A;  1JRA A;  1ZHW A;  4HEA J;  1M2V B;  1OR3 A;  3FOP A;  2W4M A;  2OKU A;  2W4B A;  3Q7L A;  1PCX A;  2NSF A;  4WGY A;  2XLE A;  2LSE A;  4KC9 A;  4Z9H A;  3FOO A;  3DWW A;  2XSE A;  3TK0 A;  4DJ9 A;  1G5Z A;  1YYX A;  1M6T A;  1H9G A;  2ICW G;  1HW1 A;  1RJ9 B;  3RH3 A;  5B3S C;  2YLI A;  4I3M A;  4QDL A;  3C8G A;  3SEO A;  3QW1 A;  3GWN A;  3FHD A;  3C7J A;  3EH2 A;  5TJ5 E;  2H7B A;  3VAY A;  5CI9 A;  2TMV P;  256B A;  5KYX A;  5JS5 A;  5JLI A;  1U0B B;  4NY3 A;  1RMV A;  3BRJ A;  3AGT A;  4FES A;  2R7X A;  4DBQ A;  2XXA A;  3EZH A;  2X0C A;  4I1O B;  4DRI B;  5EGY A;  3KPH A;  4I1M A;  1Z3I X;  1APC A;  1TQG A;  1A7V A;  2EIN C;  2ETS A;  2HUJ A;  2J45 A;  2XM4 A;  3Q6N A;  1NLX A;  2VB6 A;  1ZYR F;  2E87 A;  3U8V A;  3A9C A;  4XPY A;  4C3D A;  2WVQ A;  5JP7 A;  3KYI A;  3J06 A;  2IBF A;  3GEE A;  2D4U A;  2CCY A;  4EWC A;  4IAR A;  5CIV A;  3ABK C;  1TWH A;  3C8Z A;  4JZA A;  3Q6M A;  2OEX A;  1OKK A;  3DM9 B;  3C8G D;  4JRZ A;  2Y3G A;  1FFH A;  1SYQ A;  2WVO A;  3DKA A;  3IQ5 A;  1LVK A;  3GEI A;  4NTA A;  5DVW A;  4CS8 C;  3QMK A;  2R7U A;  4KI2 A;  2VAS A;  1RKE B;  2D5R B;  3TOL A;  4UDV A;  2ZXO A;  2YLD A;  4BEJ A;  3DI5 A;  2XRH A;  4EBB A;  1LM3 B;  3LES A;  3NKE A;  4J7T A;  3TUL A;  2RD9 A;  2L81 A;  3MYF A;  2P0N A;  3ASO C;  2A0B A;  2Q00 A;  2L7A A;  3IHU A;  4W8K A;  3AGU A;  3IQT A;  1OKK D;  2OU6 A;  4MW3 A;  2EIL C;  1G8X A;  5COM A;  3U8P A;  4PJM A;  1RCP A;  3AJM A;  3HKK A;  2OG2 A;  4EIY A;  4QI2 A;  1T01 A;  4OIN F;  3A11 A;  3K33 A;  2YWA A;  2EIK C;  4P6I C;  1A41 A;  2I8B A;  4E18 A;  4YT4 A;  3M4C A;  1EI7 A;  5IY5 C;  4EKW A;  4PFO A;  2YQY A;  1GQA A;  2Q9C A;  3Q7G A;  3QTH A;  1S7Z A;  2OOC A;  1VK5 A;  3WAQ A;  4CS8 A;  4YK5 A;  3HLZ A;  3AG1 C;  4CDY A;  4U9D A;  4U5C E;  1MQV A;  3U3F A;  2AU5 A;  3C8G B;  2NUT A;  2G62 A;  1UFB A;  1T9K A;  1ZHX A;  2XS1 A;  2YL3 A;  2CNW A;  3AQB A;  4J32 B;  4MTO A;  4U5H A;  3ZDL A;  5A6J A;  3W4Y A;  5KYX B;  4JEA A;  5KYY A;  2R25 A;  1D0Y A;  2WZF A;  2XXA B;  1WOL A;  2A0U A;  2KW3 C;  2W45 A;  3O55 A;  4C7O A;  2R7V A;  3EGD A;  2M4E A; 
#chains in the Genus database with same CATH homology
 1N1C A;  3QZC A;  3IEE A;  2CGE A;  4OIR F;  3RYL A;  1TWA A;  4ZLD A;  3EQL F;  3DJU B;  4C3B A;  3NG1 A;  5L3V A;  2JD3 A;  2KQ9 A;  2Q9B A;  4JW1 A;  3EFO A;  4G7O F;  1FMW A;  3OEO A;  4ULW A;  2A6E F;  4MND A;  5E2Q A;  1FFT C;  3NYJ A;  1W2W A;  2J0W A;  5F5H A;  1MMN A;  1ZU5 A;  2C04 A;  2YHS A;  4OD4 A;  3LLI A;  2WZL A;  1Z63 A;  1Z5Z A;  3FVY A;  2CDQ A;  4AE4 A;  4BJ1 A;  3AG2 C;  2MWQ A;  2FGY A;  3E70 C;  5FCL A;  4BJT A;  4IWB A;  4GEH A;  4JUR I;  3JRT A;  4KBL A;  4XLP F;  3T6B A;  2J9V A;  1J8M F;  1OCO C;  1JPJ A;  2Q3T A;  1SF8 A;  4O79 A;  2WL8 A;  1Z6A A;  4C3E A;  3B0U X;  3ASN C;  3UMI A;  2WVN A;  3LNR A;  2R7S A;  3DJN B;  1BR2 A;  3NDB B;  3X1O A;  3LAY A;  4C7O B;  2VH3 A;  3EGD B;  5KYN A;  4PFP A;  4LER A;  3CSK A;  5D92 A;  3UMK A;  3ZIB A;  4A2N B;  5DLJ A;  4BJ6 C;  4Q7C A;  2IXM A;  2A68 F;  4JCH A;  5DQZ A;  4BJ5 C;  5T1D B;  5BUO A;  2ZXW C;  4AK9 A;  3EFO B;  5KYU B;  4PK4 A;  4RDA A;  2WB7 A;  2V26 A;  4O6Y A;  2J7P A;  4J30 B;  2A69 F;  2KJG A;  3K1H A;  4OIQ F;  3KL4 A;  2NG1 A;  2R7Q A;  3L34 A;  1TR2 A;  1PD1 A;  3HTK C;  3X2Q C;  3K6B A;  4DVZ A;  1D0X A;  3LS1 A;  3UR3 C;  2PX3 A;  3N2Z B;  1TWC A;  2J0X A;  4BJ6 A;  5B1B C;  1IW7 F;  3RFY A;  2J7P D;  3W8I A;  4BJ5 A;  2PX0 A;  3DD7 A;  1KU2 A;  3POV A;  4HE8 D;  3KH2 A;  1NU7 D;  3ABM C;  3PMR A;  2P7V A;  3JT1 A;  4U5G A;  2J46 A;  2G3K A;  2W9Y A;  4PJN A;  2CW0 F;  3DAG A;  2KNH A;  4Q5S F;  2Q9A A;  3NRH A;  1VOM A;  4MQ9 F;  5DS5 A;  2BE5 F;  3LEV A;  2IXN A;  3EGX A;  3E9V A;  1LKX A;  2A6H F;  2EIJ C;  1ZHT A;  2Y69 C;  2WZG A;  5CI8 A;  5E33 A;  4YT2 A;  3EHM A;  3EH1 A;  3ITF A;  2P6V A;  1OCZ C;  4RBN A;  5D91 A;  4BG0 A;  1PD0 A;  4U5B E;  4LLE A;  3DMD A;  3M1C B;  4U5D E;  3S29 A;  3W2V A;  4KNV A;  2DYS C;  1VYK A;  1D1A A;  3SZR A;  2A1D D;  5F5F A;  1BR1 A;  2R7W A;  4PJL A;  1M2V A;  3S28 A;  4O6M A;  3ECS A;  3SNH A;  3ABL C;  4IAO A;  2IXO A;  2ZXP A;  1MNE A;  2X51 A;  3SP1 A;  3EHN A;  3KMI A;  2C03 A;  2PF4 E;  3VYW A;  3UGP A;  3WG7 C;  1TWG A;  1D0Z A;  1ZU4 A;  4IRU A;  3F46 A;  1M57 C;  4JJG A;  1V55 C;  4AX2 A;  2ZXR A;  3T6J A;  2R7R A;  1D1C A;  3NYL A;  4OD5 A;  3F47 A;  2B0J A;  4LLC A;  3EG9 A;  1OCR C;  3H65 A;  3W8H A;  1OCC C;  3LLK A;  4H4K C;  3EGX B;  2NUT B;  1VMA A;  4N06 A;  4K7B A;  1NG1 A;  2O9X A;  4QI0 A;  3PHF 2;  4E7Z A;  2EIM C;  5KYY B;  4OIP F;  1ST6 A;  1MND A;  3EJN A;  5E3A A;  3MLG A;  3KKB A;  1O5H A;  4U5E E;  3LJB A;  3DAF A;  1V54 C;  2HV6 A;  2QTV A;  2G3V A;  3N0T A;  4O6N A;  5T3W A;  3L0I A;  3UGO A;  3ZSU A;  4YT5 A;  1MMA A;  4JJF A;  1NZE A;  2J9U A;  3NYM A;  2NUP A;  3OWT A;  3B9Q A;  4HFF B;  1ZHY A;  4AE4 B;  4XTK A;  4B6I A;  4YN0 B;  1NU9 C;  3ZVR A;  1SMY F;  2IXP A;  3CQZ A;  4GYT A;  4YJW A;  5DS6 A;  2Y3B A;  1ZHZ A;  4DBR A;  4I44 A;  3K7D A;  3S27 A;  3EG9 B;  3FAJ A;  4KNW A;  3FDQ A;  1MMD A;  3N24 A;  4E7S A;  1WGW A;  3AG3 C;  2Y3H A;  5E3C A;  3TD7 A;  4U5F E;  4XWJ A;  3RIP A;  5L3Q A;  2Z15 A;  2IYL D;  2DYR C;  3JCU Q;  2Y3D A;  4ANJ A;  2YEV A;  3CZ6 A;  1J8Y F;  1JPN A;  3B0V C;  2Y39 A;  2HV7 A;  3ZC4 A;  2XL4 A;  3NKD A;  4YT8 A;  1FMV A;  3DXJ F;  2R7T A;  4K0D A;  3LS0 A;  2V3C C;  3I5Q A;  3O6X A;  3AG4 C;  1LS1 A;  3EPV A;  3K1I C;  3MX3 A;  4CS9 C;  2L9J A;  2ZPA A;  3UNG C;  5KYW A;  4FWV A;  3EZI A;  4DVY P;  1QLE C;  2YZS A;  1TKN A;  3DZA A;  4WJ0 A;  2IOQ A;  4X0R A;  4FX5 A;  4Q4Z F;  3DM5 A;  3JYH A;  1BR4 A;  2NUP B;  3O39 A;  4YWQ A;  2MYS A;  4CIH A;  5EHH A;  3T4R A;  2GFH A;  1RJ9 A;  4ZLC A;  1M56 C;  4G0H A;  4DOZ A;  4LAC B;  5DS4 A;  4G7Z F;  2H7O A;  4CBE A;  4CS9 A;  3W2W A;  1FTS A;  2J9W A;  3S0X A;  4XLN F;  2H7V C;  3AQC A;  4F4B A;  3K66 A;  1D1B A;  2CNW D;  1M2O A;  2R7O A;  5KYU A;  2FFH A;  3HJC A;  4CSA C;  1SZI A;  3I4U A;  5HSW A;  3WOD F;  2KGO A;  4RD9 A;  3RKO F;  5T3T A;  3JSZ A;  3GAN A;  1QZX A;  3OA1 A;  4O7G A;  4IJJ A;  4CS7 A;  1MMG A;  4G7H F;  3SYN A;  5B1A C;  4HFK B;  3UMH A;  4M63 A;  4JVS A;  3I5P A;  3ZG1 A;  5KYW B;  2OCC C;  1Z23 A;  3GOD A;  2DGJ A;  3B0P A;  3V7O A;  4OIO F;  2PFD A;  1IZM A;  1O87 A;  1VYI A;  2QY9 A;  2PP4 A;  4PJJ A;  4CSA A;  4HEA J;  1ZHW A;  1M2V B;  2W4M A;  2W4B A;  3Q7L A;  1PCX A;  2LSE A;  4KC9 A;  2XSE A;  3RH3 A;  1RJ9 B;  5B3S C;  4I3M A;  4QDL A;  3SEO A;  3FHD A;  3EH2 A;  2H7B A;  3VAY A;  5CI9 A;  5KYX A;  4NY3 A;  4FES A;  2R7X A;  4DBQ A;  2XXA A;  3EZH A;  4I1O B;  5EGY A;  4I1M A;  4YT4 A;  1Z3I X;  4PFO A;  2EIN C;  2J45 A;  3Q6N A;  5DQT A;  2VB6 A;  1ZYR F;  2E87 A;  4C3D A;  2WVQ A;  4EWC A;  3ABK C;  1TWH A;  4JZA A;  3Q6M A;  1OKK A;  3DM9 B;  2Y3G A;  1FFH A;  2WVO A;  2R7U A;  1LVK A;  5DVW A;  4CS8 C;  3QMK A;  4KI2 A;  2VAS A;  2D5R B;  2ZXO A;  4BEJ A;  2XRH A;  4EBB A;  3LES A;  3NKE A;  2L81 A;  3ASO C;  4W8K A;  1OKK D;  2EIL C;  1G8X A;  4PJM A;  2OG2 A;  4QI2 A;  4OIN F;  3K33 A;  2EIK C;  4P6I C;  2I8B A;  5IY5 C;  2Q9C A;  3Q7G A;  1S7Z A;  4CS8 A;  1VK5 A;  3HLZ A;  3AG1 C;  4U5C E;  2NUT A;  2G62 A;  3AQB A;  1ZHX A;  4J32 B;  2CNW A;  4U5H A;  5KYX B;  5KYY A;  1D0Y A;  2WZF A;  2XXA B;  2W45 A;  4C7O A;  2KW3 C;  2R7V A;  3EGD A;  2M4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...