3K1HA

Crystal structure of hp1076 from h.pylori
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
FSRDMKNINESVGALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAINDEIFSMIVVNPLDLLENVGEFQAYLEEKLNEIKELLGYLSESLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interaction of flagellar export chaperone FliS and cochaperone HP1076 in Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Chaperone
molecule keywords Putative uncharacterized protein
total genus 42
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1890 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3k1hA00
3K1IC 3K1HA
chains in the Genus database with same CATH superfamily
4W8KA 2KW3C 4JTAB 3NRHA 3GEEA 1EI7A 2QY9A 3T9OA 3U8PA 3TOMA 1E85A 2R7RA 1R5ID 1MMAA 2YQYA 4XPYA 3ZTMA 3S28A 4E17A 2Q9CA 5JT4A 1TWGA 2XRHA 1O5HA 3HJCA 3JYYA 3LLKA 4X0RA 1E2XA 4PACA 3R2PA 1YVIA 1PCXA 2W4BA 3L0IA 4C3EA 1C03A 1D1CA 1QSPA 1E84A 3QW1A 2YKZA 3NDBB 4XQ1A 3U2MA 1TWAA 3EGDA 4JVSA 1ORSC 2J9UA 2MYSA 2XLVA 4KNWA 4IAOA 3SXYA 3T4RA 5KYXB 2A69F 4A2NB 2PX3A 1W2WA 2A0BA 2YWAA 4K1OA 3HNKA 3C7JA 4U5DE 4OIRF 1Z7Qc 2OEVA 1JR8A 3DZAA 2VCBA 3EZHA 2TMVP 3OA1A 3Q6NA 4CBEA 3WG7C 1I5NA 1KTMA 2NPUA 2Q9BA 2VASA 1GQAA 1JPNA 2A6HF 5JRAA 4DBQA 3AG4C 4IB4A 4JRZA 4MVQA 4ULWA 4IJJA 1H7IA 3ASNC 3BRJA 4O6MA 4IWBA 4G78A 1ZHTA 3JT1A 1LI5A 4ANJA 5KYYB 1D0YA 3EFOA 1LVKA 1PD1A 4P9FA 1D0ZA 5A6BA 5FZTA 1U0BB 1J8MF 2YZSA 2J46A 2CW0F 5EHHA 3EGDB 2X0CA 1HMOA 4YL0A 3T6BA 2A0UA 3K7DA 4E0IA 3IQTA 3ZSUA 5T3WA 3VRCA 2IXNA 5KYUB 3RIPA 1IZMA 2VCCA 1FFTC 5BQIA 3LJBA 2VC9A 2EIJC 2HS5A 2YLIA 2BL2A 4DRIB 2OG2A 5COFA 3RFYA 3E70C 5F28E 2KYHA 2Q7RA 1OCCC 1RKEA 2HSQA 1AUEA 2XLEA 3VF0A 3ZQVA 2Y3GA 3EJNA 5FCLA 4J7TA 2PP4A 3Q7LA 4MW3A 3EG9A 2J0WA 3S9OA 3MYIA 2XXAA 3AQBA 3JYHA 5A6JA 2XLHA 4L6RA 5COMA 1N1CA 1TR2A 4BJ6C 3MYFA 4ZLCA 2Y3HA 2CGEA 2CNWD 1ORYA 1T01A 1Q0DA 2P7VA 2IOQA 3HNIA 2OKUA 2VCAA 4FX5A 3NMJA 3DAFA 2IM8A 4QI2A 1OCRC 1OR2A 4R32A 1K05A 4ER9A 4MQ9F 5DS6A 1XZPA 4MVOA 3H2VA 3T6JA 4WJ0A 1E83A 1Z5ZA 2J9BA 2W9YA 3TULA 5BQGA 3B0UX 2YL0A 4U9EA 3EH1A 4WABA 1H9GA 1CPRA 1YZAA 2EIMC 4XTKA 3KPHA 3ASOC 4PJLA 3S29A 2QLAA 2Z15A 4DXWA 1M56C 2JD3A 5CI9A 2WZGA 4YT2A 1ZW3A 1IW7F 2O9XA 3IHUA 4JIOA 4PJJA 2R02A 3RQEA 4C7OA 4CIHA 5D92A 3U0CA 2MWQA 1MQVA 2R7QA 4FWVA 2XLDA 2DYRC 2OJED 3KYJA 2LSEA 3QZCA 4P6IC 1TFOB 3J06A 1WTYA 2X51A 3SYNA 4U5CE 1OR3A 3LESA 4I44A 4WGYA 3C62A 4YL3A 3CQZA 4IRUA 3TOLA 1RXQA 2XLOA 1NU7D 1SYQA 1ZU4A 3GM3A 4PR9A 1O87A 3CSKA 4QI0A 1BR2A 5GPGB 4BJ6A 1NU9C 2P61A 3O55A 3U2LA 3FXHA 3K33A 4G7ZF 5KYWA 1V74B 1HY5A 3PDMP 3FAJA 2LP4A 3TJ5A 3R7CA 3I5PA 5KYUA 3OEOA 1DOWA 5L3VA 1EA8A 4FESA 5A69A 4CSAC 4GEHA 5F5HA 4J30B 1RCPA 1YLMA 3QMKA 4JCHA 4EBJA 3OWTA 4BPMA 4Z9HA 3EHMA 4CDVA 4EHPA 4CSAA 3DXJF 4PFPA 2Y39A 4XPWA 1L3PA 1JMWA 2EPMX 1HW1A 2PNOA 3C63A 3ECSA 2P1AA 3FHDA 1A7VA 3M4CA 3B71A 3NMKA 4IAQA 3ZWIA 3O39A 4PJMA 4J32B 3EG9B 2R7UA 2H7OA 3KL4A 4N06A 2YL1A 2QUPA 3KKBA 5E33A 3S84A 1M6TA 3LEOA 1HE9A 2P0NA 2WVOA 3SXMA 3W8HA 1MNEA 1YZCA 4G0HA 2KSFA 4JC7A 3GORA 4K7BA 3M4BA 4U5EE 3EH2A 2FFHA 3M15A 1MNDA 1TWCA 2MHRA 2OOCA 5KYWB 2W4MA 1VLTA 1XZQA 4HE8D 2GAQA 1I4ZA 3EPVA 4I3MA 5EK0A 2VH3A 3UMKA 1PV3A 3MBGA 4O79A 1HW2A 1A7EA 2LK4A 2R9RB 5T1DB 4DRHB 5BQHA 2NSGA 4NY3A 1LPEA 1QVXA 4OINF 2EINC 1A7DA 3N2ZB 3GWNA 3TQOA 3ABLC 3EGXA 1VYIA 3DM5A 4CS8A 5L0DA 2H8AA 3JRMO 3EGXB 3G4XA 3PMRA 4MS2A 2YVKA 3W8IA 1LE4A 1LKXA 3B0PA 3S27A 3UNGC 1YJGA 2ASRA 3GM1A 2YEVA 2D5RB 3DAGA 1D1AA 4I1OB 5JLIA 3C8GD 2QE9A 1SF8A 1S05A 3V5YA 1V4AA 4Q5SF 1T6IA 3IEEA 4HEAJ 4MVZA 1LM3B 3ZIBA 2L7AA 3NYLA 1A0BA 4BJ5A 2WB7A 1TQGA 3POVA 2CCYA 2KGOA 3AG2C 4N6CA 3L8IA 2V3CC 1L7CA 3QVZA 1SMYF 2WZFA 4JCZA 3C8ZA 4KBLA 3H2UA 5EGYA 1NBBA 2QTVA 3KMIA 3MLGA 2KJGA 3A11A 5AC4A 1JOGA 2Q00A 2A6EF 2G3VA 4H4KC 5COGA 3NKEA 3AQCA 1YYXA 3DE9A 1FR0A 4JJGA 2P6VA 2RSEB 4N4WA 4MVRA 4CDAA 2HSBA 4MTFA 1BDJB 4JEAA 1CGNA 2LFDA 3NYJA 3DWWA 4NTBA 1NSGB 1Z63A 1RJ9A 3ZG1A 4KC9A 3VM6A 1OCOC 1RJ9B 4D4NA 3JRTA 5L0FA 1OXKA 5HV9A 2D4UA 1OKKD 3G50A 1YARO 1FNTc 1R4TA 4I1MA 1D0XA 3I4UA 3UMHA 2IXOA 2R7XA 3DKAA 3LUTB 4Q4ZF 5E3AA 3FAPB 3UGOA 1H6GA 3JSEO 3L34A 3IQ6A 2EPNA 2L6GA 1HE1A 2XM4A 3Q6MA 3KYIA 3RKOF 2EPLX 1GGQA 1VMAA 1TWHA 2EILC 4OD5A 3US6A 1DOVA 3HKKA 4U5FE 1TKNA 1D1BA 4JTCB 4LLEA 2ICWG 3M1CB 2H7VC 4MVMA 1XWJA 3GEHA 1Q0KA 3EFOB 2AU5A 5DLJA 1AVOB 4XPXA 4YT4A 4CS8C 2XL4A 4PJNA 3HLZA 3X1OA 1QZXA 2EPOA 4O7GA 2KC3A 1H9TA 2WVNA 4F4BA 4W8PA 4DOZA 2I15A 3DM9B 2HV6A 3NG1A 2CNWA 2FGYA 3IQ5A 4U9DA 3B29A 2W45A 4OIQF 4O6NA 4P9TA 2XLWA 1OXBA 3E9VA 4YJWA 2YLDA 4RDAA 4BJ5C 2XL6A 4AL1A 1K04A 5B1AC 3SXKA 2GWWA 4YWQA 4YL1A 3MX3A 1M57C 3HNJA 3C18A 3LNMB 1UG7A 1KU2A 2H7BA 4G7HF 2DYSC 4XLNF 5DS4A 5CIVA 2C03A 3QVYA 3RYLA 3O6XA 2JX0A 1FMWA 4NC3A 4EKWA 2R7TA 5AC5A 5K0IA 2OEXA 4NTAA 2NSFA 5A6BD 2OQMA 4LACB 2FAPB 2HJ3A 2V26A 4MVSA 2C04A 4AE4B 3ATPA 4E0HA 5A6AA 4XEKA 3FVYA 2M64A 3C8GA 2DB4A 1NFNA 1GS9A 2XLMA 1VB5A 2ZXWC 3AOUA 4U5HA 3LEVA 3FOOA 4XEFA 2ETSA 1AEPA 3U3BA 2LIGA 2L9JA 2YLGA 1CGOA 3RVZA 2IBFA 2KQ9A 3PCVA 1Q0MA 5IY5C 1LIHA 2ZPAA 4HFKB 3U5SA 2HMQA 3LAYA 3U9MA 3W4YA 3SP1A 3IQCA 2JPUA 1OW6A 5BUOA 2DI3A 1ORJA 2WL8A 1ST6A 2XSEA 4BG0A 3DJUB 3TK0A 4OD4A 2XS8A 2WVQA 1PD0A 3ITFA 2A1DD 1G4US 2HUJA 1T5OA 4CX9A 4UDVA 3C8GB 3UGPA 1ZVZA 2F22A 4GYTA 3FDQA 1Q0GA 2NUTA 3JSZA 3AG1C 1G8XA 1RMVA 1MMNA 2UUHA 4MNDA 4BJTA 1E86A 4NCQA 3RQFA 1OCZC 2XM0A 5JVEA 2IXPA 2HZ8A 2NUPA 1VOMA 3K1IA 2IYLD 4OIPF 1ZYRF 4U5GA 4IGGA 3V5ZA 1OQCA 1ZHWA 2AWCA 4JKVA 2J7PA 3S90A 2R7SA 3ZC4A 3F47A 3AJMA 3K1IC 4LDKA 1BZ4A 5F5FA 2KNHA 3WAQA 5L0HA 2OCCC 1LI7A 1V55C 3W2VA 3LNRA 3ABMC 1FFHA 2R25A 3DMDA 3RW0A 3K1HA 2Y3BA 4JTDB 2J9VA 1WOLA 1NZEA 1WASA 4EBKA 1CGME 5L0GA 2Q9AA 5DVWA 2L6HA 4CS7A 1QKRA 3NMIA 2Q4FA 3K6BA 3U3FA 2ZXRA 3N24A 3O10A 2L81A 5TJ5E 1LE2A 4DBRA 4MTOA 2NG1A 1T6QA 2CYDA 4JZAA 2OJQA 3I5QA 4IARA 4YT8A 1C02A 2GA0A 4LLCA 5HSWA 3ZVRA 1ZZPA 2YRFA 2NUPB 3KH2A 3K66A 2ZD9A 2R7WA 1HMDA 1GM5A 1Z23A 3EQLF 3L1MA 5JUAA 4Z9JA 4HFFB 4DJ9A 3MFNA 3N0TA 4RBNA 2HV7A 1F1MA 3UMIA 3AG3C 2B0HA 4BEMJ 4CS9C 2ZXOA 1OW7A 1OW8A 4N6HA 5DQTA 2GDCA 2AP3A 2OU6A 1APCA 5JP7A 4CJOA 4CS9A 5KYXA 1J8YF 2GFHA 4AX2A 3PHF2 1VLSA 4KNVA 4YN0B 1VK5A 1QPUA 4B6IA 1O3UA 3ABKC 2I8BA 2BE5F 3U9JA 2J8WA 4JURI 2DGJA 5B1BC 5JSLA 3T6GB 1NLXA 2XXAB 4O6YA 3QTHA 3RVYA 2M4EA 4EIYA 1WWPA 4MVUA 2PBEA 3LS0A 5D91A 5A6KA 5JS5A 3B9QA 2PFDA 3CEXA 3DJNB 3ZQYA 5DQZA 4ZLDA 4DVZA 3W2WA 5E3CA 3GODA 4PK4A 4AL0A 2EPKX 256BA 2LFFA 3V5XA 4MTGA 3RQGA 1JPJA 3EZIA 4MW8A 5L0JA 4ONSA 3VAYA 2QNLA 2PX0A 1G5ZA 2XS1A 5B3SC 1V54C 4C3BA 3QW0A 3RF3A 3SXZA 3V7OA 1QQ3A 3Q7GA 3S0XA 4K0DA 1YAUO 3L8JA 4RD9A 2Q3TA 3A9CA 3GM2A 4ULVA 4YT5A 4E7ZA 3FOPA 3NKDA 1M2VA 3NYMA 1Y4CA 3FMSA 4EBBA 1G4WR 1M2VB 1LS1A 2YL3A 1U6HA 2Y69C 3HTKC 5DS5A 1OKKA 4WGZA 5L3QA 1ZHYA 1FAPB 3B0VC 1RKEB 1BBHA 3GWLA 3LLIA 4Z9IA 5KYNA 1YA9A 2R05A 2XL8A 3VYWA 3EHNA 3F46A 1TFKB 2LQGA 4PFOA 2G3KA 4JE9A 1EQ1A 4C3DA 2KK1A 1BR1A 2R7OA 2ZXPA 3GANA 3WHNA 1M2OA 1SZIA 2CDQA 3JZ0A 5AGFA 4EWCA 2R7VA 3H65A 4NTFA 3M79A 4LDRA 1T9KA 4LERA 1MMDA 2PF4E 3LS1A 2LCHA 1BR4A 4AE4A 2J0XA 2R03A 4J7YA 3DD7A 1SR2A 1LS4A 1WN0A 4XEVA 5CI8A 4BEJA 2L6FA 4NQFA 5T3TA 1B68A 1ZHXA 4AK9A 3HNLA 4GQHA 1WATA 3RH3A 1YDIA 2J45A 5B3IA 1A41A 2Y3DA 1Z6AA 4CJGA 2UUIA 3ZTZA 4DRJB 2YL7A 1ZW2A 2HFIA 4E7SA 4OIOF 5L0IA 1VTMP 1S7ZA 3DI5A 1NFOA 3U8VA 4JEBA 2NUTB 4XLPF 1Z3IX 3SZRA 4CIPA 2VB6A 2IXMA 2HMZA 3UR3C 3G4ZA 4M63A 3AGUA 4Q7CA 4QDLA 2G62A 1CPQA 3TD7A 2BC5A 4EUKB 1Q0FA 3GEIA 1JRAA 2RD9A 1FMVA 1I4YA 5KYYA 4LDQA 4FAPB 1ZHZA 2A68F 1YA7O 3ZDLA 4BJ1A 2HKVA 4JW1A 2B0JA 1RKCA 3BEHA 2YHSA 3CZ6A 1JAFA 3JCUQ 4YK5A 3SEOA 2J9WA 1U89A 1NG1A 2AVKA 5L0CA 2HJMA 4E18A 1C17M 1VYKA 1ZU5A 3CAXA 1Y6DA 4C7OB 4DVYP 1EKYA 3AGTA 2WZLA 4H54A 2LD6A 3JTLO 3SNHA 1WGWA 2J7PD 3WODF 2E87A 3IPMO 4A4AA 4U5BE 4G7OF 4XWJA 3TJ6A 4KI2A 2EIKC 1T6UA 1YYJA 2AWYA 4JJFA 1FTSA 4D4XA 3X2QC 1MMGA 3DE8A 1QLEC 1KNYA 5E2QA 1UFBA 1K40A 4CDYA
chains in the Genus database with same CATH topology
4W8KA 2KW3C 3NRHA 2QY9A 2R7RA 1MMAA 3S28A 2Q9CA 1TWGA 2XRHA 1O5HA 3HJCA 3LLKA 4X0RA 3L0IA 1PCXA 2W4BA 4C3EA 1D1CA 3NDBB 1TWAA 3EGDA 4JVSA 2J9UA 2MYSA 4KNWA 4IAOA 3T4RA 5KYXB 2A69F 4A2NB 2PX3A 1W2WA 4U5DE 4OIRF 3DZAA 3EZHA 3OA1A 3Q6NA 4CBEA 3WG7C 2Q9BA 2VASA 1JPNA 2A6HF 4DBQA 3AG4C 4ULWA 4IJJA 3ASNC 4O6MA 4IWBA 1ZHTA 3JT1A 4ANJA 5KYYB 1D0YA 3EFOA 1LVKA 1PD1A 1D0ZA 1J8MF 2YZSA 2J46A 2CW0F 5EHHA 3EGDB 3T6BA 3K7DA 5T3WA 2IXNA 5KYUB 3RIPA 1IZMA 1FFTC 3LJBA 2EIJC 2OG2A 3RFYA 3E70C 1OCCC 2Y3GA 3EJNA 5FCLA 2PP4A 3Q7LA 3EG9A 2J0WA 2XXAA 3AQBA 3JYHA 1N1CA 1TR2A 4BJ6C 4ZLCA 2Y3HA 2CGEA 2CNWD 2P7VA 2IOQA 4FX5A 3DAFA 4QI2A 1OCRC 4MQ9F 5DS6A 3T6JA 4WJ0A 1Z5ZA 2W9YA 3B0UX 3EH1A 2EIMC 4XTKA 3ASOC 4PJLA 3S29A 2Z15A 1M56C 2JD3A 5CI9A 2WZGA 4YT2A 1IW7F 2O9XA 4PJJA 4C7OA 4CIHA 5D92A 2MWQA 2R7QA 4FWVA 2DYRC 3QZCA 2LSEA 4P6IC 2X51A 3SYNA 4U5CE 3LESA 4I44A 3ZSUA 3CQZA 4IRUA 1NU7D 1ZU4A 4QI0A 4BJ6A 1O87A 3CSKA 1BR2A 1NU9C 3K33A 4G7ZF 5KYWA 3FAJA 3I5PA 5KYUA 3OEOA 5L3VA 4FESA 4CSAC 4GEHA 5F5HA 4J30B 3QMKA 4JCHA 3OWTA 3EHMA 4CSAA 3DXJF 4PFPA 2Y39A 4KBLA 3ECSA 3FHDA 3O39A 4PJMA 4J32B 3EG9B 2R7UA 2H7OA 3KL4A 4N06A 3KKBA 5E33A 2WVOA 3W8HA 1MNEA 4G0HA 4K7BA 2NUTA 4U5EE 5KYWB 3EH2A 2FFHA 1TWCA 1MNDA 2W4MA 4HE8D 4I3MA 3EPVA 2VH3A 3UMKA 4O79A 5T1DB 4NY3A 4OINF 2EINC 3N2ZB 3ABLC 3EGXA 1VYIA 3DM5A 4CS8A 3EGXB 3PMRA 3W8IA 3B0PA 1LKXA 3S27A 3UNGC 2YEVA 2D5RB 3DAGA 1D1AA 4I1OB 1SF8A 4Q5SF 3IEEA 4HEAJ 3ZIBA 3NYLA 4BJ5A 2WB7A 3POVA 2KGOA 3AG2C 2V3CC 1SMYF 2WZFA 5EGYA 2QTVA 3KMIA 3MLGA 2KJGA 4H4KC 2A6EF 2G3VA 3NKEA 3AQCA 4JJGA 2P6VA 3NYJA 1Z63A 1RJ9A 3ZG1A 4KC9A 1OCOC 1RJ9B 3JRTA 1OKKD 3UMHA 4I1MA 1D0XA 3I4UA 2R7XA 2IXOA 4Q4ZF 5E3AA 3UGOA 3L34A 3Q6MA 3RKOF 1VMAA 1TWHA 2EILC 4OD5A 4U5FE 1TKNA 1D1BA 4LLEA 3M1CB 2H7VC 3EFOB 5DLJA 4YT4A 4CS8C 2XL4A 4PJNA 3HLZA 3X1OA 1QZXA 4O7GA 2WVNA 4F4BA 4DOZA 3DM9B 2HV6A 3NG1A 2CNWA 2FGYA 4OIQF 2W45A 4O6NA 3E9VA 4YJWA 4RDAA 4BJ5C 5B1AC 4YWQA 3MX3A 1M57C 1KU2A 2H7BA 4G7HF 2DYSC 4XLNF 5DS4A 2C03A 3RYLA 3O6XA 1FMWA 2R7TA 4LACB 2V26A 4AE4B 2C04A 3FVYA 2ZXWC 4U5HA 3LEVA 2L9JA 2KQ9A 5IY5C 4HFKB 2ZPAA 3LAYA 3SP1A 5BUOA 2WL8A 1ST6A 4BG0A 3DJUB 4OD4A 2WVQA 1PD0A 3ITFA 2A1DD 3UGPA 4GYTA 3FDQA 3JSZA 3AG1C 1G8XA 1MMNA 4MNDA 4BJTA 1OCZC 2IXPA 2NUPA 1VOMA 2IYLD 4OIPF 1ZYRF 4U5GA 2R7SA 1ZHWA 2J7PA 3ZC4A 3F47A 3K1IC 5F5FA 2KNHA 2OCCC 1V55C 3W2VA 3LNRA 3ABMC 1FFHA 3DMDA 3K1HA 2Y3BA 2J9VA 1NZEA 2Q9AA 5DVWA 4CS7A 3K6BA 2ZXRA 3N24A 2L81A 4DBRA 2NG1A 4JZAA 3I5QA 4YT8A 5HSWA 4LLCA 3ZVRA 2NUPB 3KH2A 3K66A 2R7WA 1Z23A 3EQLF 4HFFB 3N0TA 4RBNA 3UMIA 2HV7A 3AG3C 4CS9C 2ZXOA 5DQTA 5KYXA 4CS9A 1J8YF 2GFHA 4AX2A 3PHF2 4KNVA 4YN0B 1VK5A 4B6IA 3ABKC 2I8BA 2BE5F 4JURI 2DGJA 5B1BC 2XXAB 4O6YA 2M4EA 5D91A 3LS0A 3B9QA 2PFDA 3DJNB 5DQZA 4ZLDA 4DVZA 3W2WA 5E3CA 3GODA 4PK4A 1JPJA 3EZIA 3VAYA 5B3SC 2PX0A 1V54C 4C3BA 3V7OA 3S0XA 3Q7GA 4K0DA 4RD9A 4E7ZA 2Q3TA 4YT5A 3NKDA 1M2VA 3NYMA 4EBBA 1M2VB 1LS1A 2Y69C 3HTKC 5DS5A 1OKKA 5L3QA 1ZHYA 3B0VC 5KYNA 3LLIA 3VYWA 3EHNA 3F46A 4PFOA 2G3KA 4C3DA 2ZXPA 1BR1A 2R7OA 3GANA 1M2OA 1SZIA 2CDQA 4EWCA 2R7VA 3H65A 4LERA 1MMDA 2PF4E 3LS1A 4AE4A 1BR4A 2J0XA 3DD7A 4BEJA 5CI8A 5T3TA 1ZHXA 4AK9A 3RH3A 2J45A 2Y3DA 1Z6AA 4E7SA 4OIOF 1S7ZA 2NUTB 4XLPF 1Z3IX 3SZRA 2VB6A 2IXMA 3UR3C 4M63A 4Q7CA 4QDLA 2G62A 3TD7A 1FMVA 5KYYA 1ZHZA 2A68F 4BJ1A 4JW1A 2B0JA 2YHSA 3CZ6A 3JCUQ 3SEOA 2J9WA 1NG1A 1VYKA 1ZU5A 4C7OB 4DVYP 2WZLA 3SNHA 1WGWA 2J7PD 3WODF 2E87A 4U5BE 4G7OF 4XWJA 4KI2A 2EIKC 4JJFA 1FTSA 3X2QC 1MMGA 1QLEC 2XSEA 5E2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I C;  3K1H A; 
#chains in the Genus database with same CATH topology
 4W8K A;  2KW3 C;  4JTA B;  3NRH A;  3GEE A;  1EI7 A;  2QY9 A;  3T9O A;  3U8P A;  3TOM A;  1E85 A;  2R7R A;  1R5I D;  1MMA A;  2YQY A;  4XPY A;  3ZTM A;  3S28 A;  4E17 A;  2Q9C A;  5JT4 A;  1TWG A;  2XRH A;  1O5H A;  3HJC A;  3JYY A;  3LLK A;  4X0R A;  1E2X A;  4PAC A;  3R2P A;  1YVI A;  1PCX A;  2W4B A;  3L0I A;  4C3E A;  1C03 A;  1D1C A;  1QSP A;  1E84 A;  3QW1 A;  2YKZ A;  3NDB B;  4XQ1 A;  3U2M A;  1TWA A;  3EGD A;  4JVS A;  1ORS C;  2J9U A;  2MYS A;  2XLV A;  4KNW A;  4IAO A;  3SXY A;  3T4R A;  5KYX B;  2A69 F;  4A2N B;  2PX3 A;  1W2W A;  2A0B A;  2YWA A;  4K1O A;  3HNK A;  3C7J A;  4U5D E;  4OIR F;  1Z7Q c;  2OEV A;  1JR8 A;  3DZA A;  2VCB A;  3EZH A;  2TMV P;  3OA1 A;  3Q6N A;  4CBE A;  3WG7 C;  1I5N A;  1KTM A;  2NPU A;  2Q9B A;  2VAS A;  1GQA A;  1JPN A;  2A6H F;  5JRA A;  4DBQ A;  3AG4 C;  4IB4 A;  4JRZ A;  4MVQ A;  4ULW A;  4IJJ A;  1H7I A;  3ASN C;  3BRJ A;  4O6M A;  4IWB A;  4G78 A;  1ZHT A;  3JT1 A;  1LI5 A;  4ANJ A;  5KYY B;  1D0Y A;  3EFO A;  1LVK A;  1PD1 A;  4P9F A;  1D0Z A;  5A6B A;  5FZT A;  1U0B B;  1J8M F;  2YZS A;  2J46 A;  2CW0 F;  5EHH A;  3EGD B;  2X0C A;  1HMO A;  4YL0 A;  3T6B A;  2A0U A;  3K7D A;  4E0I A;  3IQT A;  3ZSU A;  5T3W A;  3VRC A;  2IXN A;  5KYU B;  3RIP A;  1IZM A;  2VCC A;  1FFT C;  5BQI A;  3LJB A;  2VC9 A;  2EIJ C;  2HS5 A;  2YLI A;  2BL2 A;  4DRI B;  2OG2 A;  5COF A;  3RFY A;  3E70 C;  5F28 E;  2KYH A;  2Q7R A;  1OCC C;  1RKE A;  2HSQ A;  1AUE A;  2XLE A;  3VF0 A;  3ZQV A;  2Y3G A;  3EJN A;  5FCL A;  4J7T A;  2PP4 A;  3Q7L A;  4MW3 A;  3EG9 A;  2J0W A;  3S9O A;  3MYI A;  2XXA A;  3AQB A;  3JYH A;  5A6J A;  2XLH A;  4L6R A;  5COM A;  1N1C A;  1TR2 A;  4BJ6 C;  3MYF A;  4ZLC A;  2Y3H A;  2CGE A;  2CNW D;  1ORY A;  1T01 A;  1Q0D A;  2P7V A;  2IOQ A;  3HNI A;  2OKU A;  2VCA A;  4FX5 A;  3NMJ A;  3DAF A;  2IM8 A;  4QI2 A;  1OCR C;  1OR2 A;  4R32 A;  1K05 A;  4ER9 A;  4MQ9 F;  5DS6 A;  1XZP A;  4MVO A;  3H2V A;  3T6J A;  4WJ0 A;  1E83 A;  1Z5Z A;  2J9B A;  2W9Y A;  3TUL A;  5BQG A;  3B0U X;  2YL0 A;  4U9E A;  3EH1 A;  4WAB A;  1H9G A;  1CPR A;  1YZA A;  2EIM C;  4XTK A;  3KPH A;  3ASO C;  4PJL A;  3S29 A;  2QLA A;  2Z15 A;  4DXW A;  1M56 C;  2JD3 A;  5CI9 A;  2WZG A;  4YT2 A;  1ZW3 A;  1IW7 F;  2O9X A;  3IHU A;  4JIO A;  4PJJ A;  2R02 A;  3RQE A;  4C7O A;  4CIH A;  5D92 A;  3U0C A;  2MWQ A;  1MQV A;  2R7Q A;  4FWV A;  2XLD A;  2DYR C;  2OJE D;  3KYJ A;  2LSE A;  3QZC A;  4P6I C;  1TFO B;  3J06 A;  1WTY A;  2X51 A;  3SYN A;  4U5C E;  1OR3 A;  3LES A;  4I44 A;  4WGY A;  3C62 A;  4YL3 A;  3CQZ A;  4IRU A;  3TOL A;  1RXQ A;  2XLO A;  1NU7 D;  1SYQ A;  1ZU4 A;  3GM3 A;  4PR9 A;  1O87 A;  3CSK A;  4QI0 A;  1BR2 A;  5GPG B;  4BJ6 A;  1NU9 C;  2P61 A;  3O55 A;  3U2L A;  3FXH A;  3K33 A;  4G7Z F;  5KYW A;  1V74 B;  1HY5 A;  3PDM P;  3FAJ A;  2LP4 A;  3TJ5 A;  3R7C A;  3I5P A;  5KYU A;  3OEO A;  1DOW A;  5L3V A;  1EA8 A;  4FES A;  5A69 A;  4CSA C;  4GEH A;  5F5H A;  4J30 B;  1RCP A;  1YLM A;  3QMK A;  4JCH A;  4EBJ A;  3OWT A;  4BPM A;  4Z9H A;  3EHM A;  4CDV A;  4EHP A;  4CSA A;  3DXJ F;  4PFP A;  2Y39 A;  4XPW A;  1L3P A;  1JMW A;  2EPM X;  1HW1 A;  2PNO A;  3C63 A;  3ECS A;  2P1A A;  3FHD A;  1A7V A;  3M4C A;  3B71 A;  3NMK A;  4IAQ A;  3ZWI A;  3O39 A;  4PJM A;  4J32 B;  3EG9 B;  2R7U A;  2H7O A;  3KL4 A;  4N06 A;  2YL1 A;  2QUP A;  3KKB A;  5E33 A;  3S84 A;  1M6T A;  3LEO A;  1HE9 A;  2P0N A;  2WVO A;  3SXM A;  3W8H A;  1MNE A;  1YZC A;  4G0H A;  2KSF A;  4JC7 A;  3GOR A;  4K7B A;  3M4B A;  4U5E E;  3EH2 A;  2FFH A;  3M15 A;  1MND A;  1TWC A;  2MHR A;  2OOC A;  5KYW B;  2W4M A;  1VLT A;  1XZQ A;  4HE8 D;  2GAQ A;  1I4Z A;  3EPV A;  4I3M A;  5EK0 A;  2VH3 A;  3UMK A;  1PV3 A;  3MBG A;  4O79 A;  1HW2 A;  1A7E A;  2LK4 A;  2R9R B;  5T1D B;  4DRH B;  5BQH A;  2NSG A;  4NY3 A;  1LPE A;  1QVX A;  4OIN F;  2EIN C;  1A7D A;  3N2Z B;  3GWN A;  3TQO A;  3ABL C;  3EGX A;  1VYI A;  3DM5 A;  4CS8 A;  5L0D A;  2H8A A;  3JRM O;  3EGX B;  3G4X A;  3PMR A;  4MS2 A;  2YVK A;  3W8I A;  1LE4 A;  1LKX A;  3B0P A;  3S27 A;  3UNG C;  1YJG A;  2ASR A;  3GM1 A;  2YEV A;  2D5R B;  3DAG A;  1D1A A;  4I1O B;  5JLI A;  3C8G D;  2QE9 A;  1SF8 A;  1S05 A;  3V5Y A;  1V4A A;  4Q5S F;  1T6I A;  3IEE A;  4HEA J;  4MVZ A;  1LM3 B;  3ZIB A;  2L7A A;  3NYL A;  1A0B A;  4BJ5 A;  2WB7 A;  1TQG A;  3POV A;  2CCY A;  2KGO A;  3AG2 C;  4N6C A;  3L8I A;  2V3C C;  1L7C A;  3QVZ A;  1SMY F;  2WZF A;  4JCZ A;  3C8Z A;  4KBL A;  3H2U A;  5EGY A;  1NBB A;  2QTV A;  3KMI A;  3MLG A;  2KJG A;  3A11 A;  5AC4 A;  1JOG A;  2Q00 A;  2A6E F;  2G3V A;  4H4K C;  5COG A;  3NKE A;  3AQC A;  1YYX A;  3DE9 A;  1FR0 A;  4JJG A;  2P6V A;  2RSE B;  4N4W A;  4MVR A;  4CDA A;  2HSB A;  4MTF A;  1BDJ B;  4JEA A;  1CGN A;  2LFD A;  3NYJ A;  3DWW A;  4NTB A;  1NSG B;  1Z63 A;  1RJ9 A;  3ZG1 A;  4KC9 A;  3VM6 A;  1OCO C;  1RJ9 B;  4D4N A;  3JRT A;  5L0F A;  1OXK A;  5HV9 A;  2D4U A;  1OKK D;  3G50 A;  1YAR O;  1FNT c;  1R4T A;  4I1M A;  1D0X A;  3I4U A;  3UMH A;  2IXO A;  2R7X A;  3DKA A;  3LUT B;  4Q4Z F;  5E3A A;  3FAP B;  3UGO A;  1H6G A;  3JSE O;  3L34 A;  3IQ6 A;  2EPN A;  2L6G A;  1HE1 A;  2XM4 A;  3Q6M A;  3KYI A;  3RKO F;  2EPL X;  1GGQ A;  1VMA A;  1TWH A;  2EIL C;  4OD5 A;  3US6 A;  1DOV A;  3HKK A;  4U5F E;  1TKN A;  1D1B A;  4JTC B;  4LLE A;  2ICW G;  3M1C B;  2H7V C;  4MVM A;  1XWJ A;  3GEH A;  1Q0K A;  3EFO B;  2AU5 A;  5DLJ A;  1AVO B;  4XPX A;  4YT4 A;  4CS8 C;  2XL4 A;  4PJN A;  3HLZ A;  3X1O A;  1QZX A;  2EPO A;  4O7G A;  2KC3 A;  1H9T A;  2WVN A;  4F4B A;  4W8P A;  4DOZ A;  2I15 A;  3DM9 B;  2HV6 A;  3NG1 A;  2CNW A;  2FGY A;  3IQ5 A;  4U9D A;  3B29 A;  2W45 A;  4OIQ F;  4O6N A;  4P9T A;  2XLW A;  1OXB A;  3E9V A;  4YJW A;  2YLD A;  4RDA A;  4BJ5 C;  2XL6 A;  4AL1 A;  1K04 A;  5B1A C;  3SXK A;  2GWW A;  4YWQ A;  4YL1 A;  3MX3 A;  1M57 C;  3HNJ A;  3C18 A;  3LNM B;  1UG7 A;  1KU2 A;  2H7B A;  4G7H F;  2DYS C;  4XLN F;  5DS4 A;  5CIV A;  2C03 A;  3QVY A;  3RYL A;  3O6X A;  2JX0 A;  1FMW A;  4NC3 A;  4EKW A;  2R7T A;  5AC5 A;  5K0I A;  2OEX A;  4NTA A;  2NSF A;  5A6B D;  2OQM A;  4LAC B;  2FAP B;  2HJ3 A;  2V26 A;  4MVS A;  2C04 A;  4AE4 B;  3ATP A;  4E0H A;  5A6A A;  4XEK A;  3FVY A;  2M64 A;  3C8G A;  2DB4 A;  1NFN A;  1GS9 A;  2XLM A;  1VB5 A;  2ZXW C;  3AOU A;  4U5H A;  3LEV A;  3FOO A;  4XEF A;  2ETS A;  1AEP A;  3U3B A;  2LIG A;  2L9J A;  2YLG A;  1CGO A;  3RVZ A;  2IBF A;  2KQ9 A;  3PCV A;  1Q0M A;  5IY5 C;  1LIH A;  2ZPA A;  4HFK B;  3U5S A;  2HMQ A;  3LAY A;  3U9M A;  3W4Y A;  3SP1 A;  3IQC A;  2JPU A;  1OW6 A;  5BUO A;  2DI3 A;  1ORJ A;  2WL8 A;  1ST6 A;  2XSE A;  4BG0 A;  3DJU B;  3TK0 A;  4OD4 A;  2XS8 A;  2WVQ A;  1PD0 A;  3ITF A;  2A1D D;  1G4U S;  2HUJ A;  1T5O A;  4CX9 A;  4UDV A;  3C8G B;  3UGP A;  1ZVZ A;  2F22 A;  4GYT A;  3FDQ A;  1Q0G A;  2NUT A;  3JSZ A;  3AG1 C;  1G8X A;  1RMV A;  1MMN A;  2UUH A;  4MND A;  4BJT A;  1E86 A;  4NCQ A;  3RQF A;  1OCZ C;  2XM0 A;  5JVE A;  2IXP A;  2HZ8 A;  2NUP A;  1VOM A;  3K1I A;  2IYL D;  4OIP F;  1ZYR F;  4U5G A;  4IGG A;  3V5Z A;  1OQC A;  1ZHW A;  2AWC A;  4JKV A;  2J7P A;  3S90 A;  2R7S A;  3ZC4 A;  3F47 A;  3AJM A;  3K1I C;  4LDK A;  1BZ4 A;  5F5F A;  2KNH A;  3WAQ A;  5L0H A;  2OCC C;  1LI7 A;  1V55 C;  3W2V A;  3LNR A;  3ABM C;  1FFH A;  2R25 A;  3DMD A;  3RW0 A;  3K1H A;  2Y3B A;  4JTD B;  2J9V A;  1WOL A;  1NZE A;  1WAS A;  4EBK A;  1CGM E;  5L0G A;  2Q9A A;  5DVW A;  2L6H A;  4CS7 A;  1QKR A;  3NMI A;  2Q4F A;  3K6B A;  3U3F A;  2ZXR A;  3N24 A;  3O10 A;  2L81 A;  5TJ5 E;  1LE2 A;  4DBR A;  4MTO A;  2NG1 A;  1T6Q A;  2CYD A;  4JZA A;  2OJQ A;  3I5Q A;  4IAR A;  4YT8 A;  1C02 A;  2GA0 A;  4LLC A;  5HSW A;  3ZVR A;  1ZZP A;  2YRF A;  2NUP B;  3KH2 A;  3K66 A;  2ZD9 A;  2R7W A;  1HMD A;  1GM5 A;  1Z23 A;  3EQL F;  3L1M A;  5JUA A;  4Z9J A;  4HFF B;  4DJ9 A;  3MFN A;  3N0T A;  4RBN A;  2HV7 A;  1F1M A;  3UMI A;  3AG3 C;  2B0H A;  4BEM J;  4CS9 C;  2ZXO A;  1OW7 A;  1OW8 A;  4N6H A;  5DQT A;  2GDC A;  2AP3 A;  2OU6 A;  1APC A;  5JP7 A;  4CJO A;  4CS9 A;  5KYX A;  1J8Y F;  2GFH A;  4AX2 A;  3PHF 2;  1VLS A;  4KNV A;  4YN0 B;  1VK5 A;  1QPU A;  4B6I A;  1O3U A;  3ABK C;  2I8B A;  2BE5 F;  3U9J A;  2J8W A;  4JUR I;  2DGJ A;  5B1B C;  5JSL A;  3T6G B;  1NLX A;  2XXA B;  4O6Y A;  3QTH A;  3RVY A;  2M4E A;  4EIY A;  1WWP A;  4MVU A;  2PBE A;  3LS0 A;  5D91 A;  5A6K A;  5JS5 A;  3B9Q A;  2PFD A;  3CEX A;  3DJN B;  3ZQY A;  5DQZ A;  4ZLD A;  4DVZ A;  3W2W A;  5E3C A;  3GOD A;  4PK4 A;  4AL0 A;  2EPK X;  256B A;  2LFF A;  3V5X A;  4MTG A;  3RQG A;  1JPJ A;  3EZI A;  4MW8 A;  5L0J A;  4ONS A;  3VAY A;  2QNL A;  2PX0 A;  1G5Z A;  2XS1 A;  5B3S C;  1V54 C;  4C3B A;  3QW0 A;  3RF3 A;  3SXZ A;  3V7O A;  1QQ3 A;  3Q7G A;  3S0X A;  4K0D A;  1YAU O;  3L8J A;  4RD9 A;  2Q3T A;  3A9C A;  3GM2 A;  4ULV A;  4YT5 A;  4E7Z A;  3FOP A;  3NKD A;  1M2V A;  3NYM A;  1Y4C A;  3FMS A;  4EBB A;  1G4W R;  1M2V B;  1LS1 A;  2YL3 A;  1U6H A;  2Y69 C;  3HTK C;  5DS5 A;  1OKK A;  4WGZ A;  5L3Q A;  1ZHY A;  1FAP B;  3B0V C;  1RKE B;  1BBH A;  3GWL A;  3LLI A;  4Z9I A;  5KYN A;  1YA9 A;  2R05 A;  2XL8 A;  3VYW A;  3EHN A;  3F46 A;  1TFK B;  2LQG A;  4PFO A;  2G3K A;  4JE9 A;  1EQ1 A;  4C3D A;  2KK1 A;  1BR1 A;  2R7O A;  2ZXP A;  3GAN A;  3WHN A;  1M2O A;  1SZI A;  2CDQ A;  3JZ0 A;  5AGF A;  4EWC A;  2R7V A;  3H65 A;  4NTF A;  3M79 A;  4LDR A;  1T9K A;  4LER A;  1MMD A;  2PF4 E;  3LS1 A;  2LCH A;  1BR4 A;  4AE4 A;  2J0X A;  2R03 A;  4J7Y A;  3DD7 A;  1SR2 A;  1LS4 A;  1WN0 A;  4XEV A;  5CI8 A;  4BEJ A;  2L6F A;  4NQF A;  5T3T A;  1B68 A;  1ZHX A;  4AK9 A;  3HNL A;  4GQH A;  1WAT A;  3RH3 A;  1YDI A;  2J45 A;  5B3I A;  1A41 A;  2Y3D A;  1Z6A A;  4CJG A;  2UUI A;  3ZTZ A;  4DRJ B;  2YL7 A;  1ZW2 A;  2HFI A;  4E7S A;  4OIO F;  5L0I A;  1VTM P;  1S7Z A;  3DI5 A;  1NFO A;  3U8V A;  4JEB A;  2NUT B;  4XLP F;  1Z3I X;  3SZR A;  4CIP A;  2VB6 A;  2IXM A;  2HMZ A;  3UR3 C;  3G4Z A;  4M63 A;  3AGU A;  4Q7C A;  4QDL A;  2G62 A;  1CPQ A;  3TD7 A;  2BC5 A;  4EUK B;  1Q0F A;  3GEI A;  1JRA A;  2RD9 A;  1FMV A;  1I4Y A;  5KYY A;  4LDQ A;  4FAP B;  1ZHZ A;  2A68 F;  1YA7 O;  3ZDL A;  4BJ1 A;  2HKV A;  4JW1 A;  2B0J A;  1RKC A;  3BEH A;  2YHS A;  3CZ6 A;  1JAF A;  3JCU Q;  4YK5 A;  3SEO A;  2J9W A;  1U89 A;  1NG1 A;  2AVK A;  5L0C A;  2HJM A;  4E18 A;  1C17 M;  1VYK A;  1ZU5 A;  3CAX A;  1Y6D A;  4C7O B;  4DVY P;  1EKY A;  3AGT A;  2WZL A;  4H54 A;  2LD6 A;  3JTL O;  3SNH A;  1WGW A;  2J7P D;  3WOD F;  2E87 A;  3IPM O;  4A4A A;  4U5B E;  4G7O F;  4XWJ A;  3TJ6 A;  4KI2 A;  2EIK C;  1T6U A;  1YYJ A;  2AWY A;  4JJF A;  1FTS A;  4D4X A;  3X2Q C;  1MMG A;  3DE8 A;  1QLE C;  1KNY A;  5E2Q A;  1UFB A;  1K40 A;  4CDY A; 
#chains in the Genus database with same CATH homology
 4W8K A;  2KW3 C;  3NRH A;  2QY9 A;  2R7R A;  1MMA A;  3S28 A;  2Q9C A;  1TWG A;  2XRH A;  1O5H A;  3HJC A;  3LLK A;  4X0R A;  3L0I A;  1PCX A;  2W4B A;  4C3E A;  1D1C A;  3NDB B;  1TWA A;  3EGD A;  4JVS A;  2J9U A;  2MYS A;  4KNW A;  4IAO A;  3T4R A;  5KYX B;  2A69 F;  4A2N B;  2PX3 A;  1W2W A;  4U5D E;  4OIR F;  3DZA A;  3EZH A;  3OA1 A;  3Q6N A;  4CBE A;  3WG7 C;  2Q9B A;  2VAS A;  1JPN A;  2A6H F;  4DBQ A;  3AG4 C;  4ULW A;  4IJJ A;  3ASN C;  4O6M A;  4IWB A;  1ZHT A;  3JT1 A;  4ANJ A;  5KYY B;  1D0Y A;  3EFO A;  1LVK A;  1PD1 A;  1D0Z A;  1J8M F;  2YZS A;  2J46 A;  2CW0 F;  5EHH A;  3EGD B;  3T6B A;  3K7D A;  5T3W A;  2IXN A;  5KYU B;  3RIP A;  1IZM A;  1FFT C;  3LJB A;  2EIJ C;  2OG2 A;  3RFY A;  3E70 C;  1OCC C;  2Y3G A;  3EJN A;  5FCL A;  2PP4 A;  3Q7L A;  3EG9 A;  2J0W A;  2XXA A;  3AQB A;  3JYH A;  1N1C A;  1TR2 A;  4BJ6 C;  4ZLC A;  2Y3H A;  2CGE A;  2CNW D;  2P7V A;  2IOQ A;  4FX5 A;  3DAF A;  4QI2 A;  1OCR C;  4MQ9 F;  5DS6 A;  3T6J A;  4WJ0 A;  1Z5Z A;  2W9Y A;  3B0U X;  3EH1 A;  2EIM C;  4XTK A;  3ASO C;  4PJL A;  3S29 A;  2Z15 A;  1M56 C;  2JD3 A;  5CI9 A;  2WZG A;  4YT2 A;  1IW7 F;  2O9X A;  4PJJ A;  4C7O A;  4CIH A;  5D92 A;  2MWQ A;  2R7Q A;  4FWV A;  2DYR C;  3QZC A;  2LSE A;  4P6I C;  2X51 A;  3SYN A;  4U5C E;  3LES A;  4I44 A;  3ZSU A;  3CQZ A;  4IRU A;  1NU7 D;  1ZU4 A;  4QI0 A;  4BJ6 A;  1O87 A;  3CSK A;  1BR2 A;  1NU9 C;  3K33 A;  4G7Z F;  5KYW A;  3FAJ A;  3I5P A;  5KYU A;  3OEO A;  5L3V A;  4FES A;  4CSA C;  4GEH A;  5F5H A;  4J30 B;  3QMK A;  4JCH A;  3OWT A;  3EHM A;  4CSA A;  3DXJ F;  4PFP A;  2Y39 A;  4KBL A;  3ECS A;  3FHD A;  3O39 A;  4PJM A;  4J32 B;  3EG9 B;  2R7U A;  2H7O A;  3KL4 A;  4N06 A;  3KKB A;  5E33 A;  2WVO A;  3W8H A;  1MNE A;  4G0H A;  4K7B A;  2NUT A;  4U5E E;  5KYW B;  3EH2 A;  2FFH A;  1TWC A;  1MND A;  2W4M A;  4HE8 D;  4I3M A;  3EPV A;  2VH3 A;  3UMK A;  4O79 A;  5T1D B;  4NY3 A;  4OIN F;  2EIN C;  3N2Z B;  3ABL C;  3EGX A;  1VYI A;  3DM5 A;  4CS8 A;  3EGX B;  3PMR A;  3W8I A;  3B0P A;  1LKX A;  3S27 A;  3UNG C;  2YEV A;  2D5R B;  3DAG A;  1D1A A;  4I1O B;  1SF8 A;  4Q5S F;  3IEE A;  4HEA J;  3ZIB A;  3NYL A;  4BJ5 A;  2WB7 A;  3POV A;  2KGO A;  3AG2 C;  2V3C C;  1SMY F;  2WZF A;  5EGY A;  2QTV A;  3KMI A;  3MLG A;  2KJG A;  4H4K C;  2A6E F;  2G3V A;  3NKE A;  3AQC A;  4JJG A;  2P6V A;  3NYJ A;  1Z63 A;  1RJ9 A;  3ZG1 A;  4KC9 A;  1OCO C;  1RJ9 B;  3JRT A;  1OKK D;  3UMH A;  4I1M A;  1D0X A;  3I4U A;  2R7X A;  2IXO A;  4Q4Z F;  5E3A A;  3UGO A;  3L34 A;  3Q6M A;  3RKO F;  1VMA A;  1TWH A;  2EIL C;  4OD5 A;  4U5F E;  1TKN A;  1D1B A;  4LLE A;  3M1C B;  2H7V C;  3EFO B;  5DLJ A;  4YT4 A;  4CS8 C;  2XL4 A;  4PJN A;  3HLZ A;  3X1O A;  1QZX A;  4O7G A;  2WVN A;  4F4B A;  4DOZ A;  3DM9 B;  2HV6 A;  3NG1 A;  2CNW A;  2FGY A;  4OIQ F;  2W45 A;  4O6N A;  3E9V A;  4YJW A;  4RDA A;  4BJ5 C;  5B1A C;  4YWQ A;  3MX3 A;  1M57 C;  1KU2 A;  2H7B A;  4G7H F;  2DYS C;  4XLN F;  5DS4 A;  2C03 A;  3RYL A;  3O6X A;  1FMW A;  2R7T A;  4LAC B;  2V26 A;  4AE4 B;  2C04 A;  3FVY A;  2ZXW C;  4U5H A;  3LEV A;  2L9J A;  2KQ9 A;  5IY5 C;  4HFK B;  2ZPA A;  3LAY A;  3SP1 A;  5BUO A;  2WL8 A;  1ST6 A;  4BG0 A;  3DJU B;  4OD4 A;  2WVQ A;  1PD0 A;  3ITF A;  2A1D D;  3UGP A;  4GYT A;  3FDQ A;  3JSZ A;  3AG1 C;  1G8X A;  1MMN A;  4MND A;  4BJT A;  1OCZ C;  2IXP A;  2NUP A;  1VOM A;  2IYL D;  4OIP F;  1ZYR F;  4U5G A;  2R7S A;  1ZHW A;  2J7P A;  3ZC4 A;  3F47 A;  3K1I C;  5F5F A;  2KNH A;  2OCC C;  1V55 C;  3W2V A;  3LNR A;  3ABM C;  1FFH A;  3DMD A;  3K1H A;  2Y3B A;  2J9V A;  1NZE A;  2Q9A A;  5DVW A;  4CS7 A;  3K6B A;  2ZXR A;  3N24 A;  2L81 A;  4DBR A;  2NG1 A;  4JZA A;  3I5Q A;  4YT8 A;  5HSW A;  4LLC A;  3ZVR A;  2NUP B;  3KH2 A;  3K66 A;  2R7W A;  1Z23 A;  3EQL F;  4HFF B;  3N0T A;  4RBN A;  3UMI A;  2HV7 A;  3AG3 C;  4CS9 C;  2ZXO A;  5DQT A;  5KYX A;  4CS9 A;  1J8Y F;  2GFH A;  4AX2 A;  3PHF 2;  4KNV A;  4YN0 B;  1VK5 A;  4B6I A;  3ABK C;  2I8B A;  2BE5 F;  4JUR I;  2DGJ A;  5B1B C;  2XXA B;  4O6Y A;  2M4E A;  5D91 A;  3LS0 A;  3B9Q A;  2PFD A;  3DJN B;  5DQZ A;  4ZLD A;  4DVZ A;  3W2W A;  5E3C A;  3GOD A;  4PK4 A;  1JPJ A;  3EZI A;  3VAY A;  5B3S C;  2PX0 A;  1V54 C;  4C3B A;  3V7O A;  3S0X A;  3Q7G A;  4K0D A;  4RD9 A;  4E7Z A;  2Q3T A;  4YT5 A;  3NKD A;  1M2V A;  3NYM A;  4EBB A;  1M2V B;  1LS1 A;  2Y69 C;  3HTK C;  5DS5 A;  1OKK A;  5L3Q A;  1ZHY A;  3B0V C;  5KYN A;  3LLI A;  3VYW A;  3EHN A;  3F46 A;  4PFO A;  2G3K A;  4C3D A;  2ZXP A;  1BR1 A;  2R7O A;  3GAN A;  1M2O A;  1SZI A;  2CDQ A;  4EWC A;  2R7V A;  3H65 A;  4LER A;  1MMD A;  2PF4 E;  3LS1 A;  4AE4 A;  1BR4 A;  2J0X A;  3DD7 A;  4BEJ A;  5CI8 A;  5T3T A;  1ZHX A;  4AK9 A;  3RH3 A;  2J45 A;  2Y3D A;  1Z6A A;  4E7S A;  4OIO F;  1S7Z A;  2NUT B;  4XLP F;  1Z3I X;  3SZR A;  2VB6 A;  2IXM A;  3UR3 C;  4M63 A;  4Q7C A;  4QDL A;  2G62 A;  3TD7 A;  1FMV A;  5KYY A;  1ZHZ A;  2A68 F;  4BJ1 A;  4JW1 A;  2B0J A;  2YHS A;  3CZ6 A;  3JCU Q;  3SEO A;  2J9W A;  1NG1 A;  1VYK A;  1ZU5 A;  4C7O B;  4DVY P;  2WZL A;  3SNH A;  1WGW A;  2J7P D;  3WOD F;  2E87 A;  4U5B E;  4G7O F;  4XWJ A;  4KI2 A;  2EIK C;  4JJF A;  1FTS A;  3X2Q C;  1MMG A;  1QLE C;  2XSE A;  5E2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...