3K1LA

Crystal structure of fancl
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
377
structure length
376
Chain Sequence
b'EDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fancl
publication title The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Ligase
total genus 74
structure length 376
sequence length 377
chains with identical sequence B
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09765 WD-3 WD-repeat region
A PF11793 FANCL_C FANCL C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.457.30 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 3k1lA02
3.30.457.40 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 3k1lA01
3K1LA
chains in the Genus database with same CATH superfamily
1JRQA 1OACA 2FV4A 1QAFA 4GEQA 1D6UA 2WOHA 1DYUA 1LVNA 1QAKA 3K1LA 1D6ZA 2FTXA 1D6YA 4DZOA 3VZ9B 3VZAA 5T6JB 2WO0A 2WGQA 2WOFA 1SPUA 5TCSD 1QALA 2W0QA
chains in the Genus database with same CATH topology
2FTXA 5TCSD 4DZOA 3VZAA 3VZ9B 2FV4A 3K1LA 5T6JB 4GEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1L A; 
#chains in the Genus database with same CATH topology
 1JRQ A;  1OAC A;  2FV4 A;  1QAF A;  4GEQ A;  1D6U A;  2WOH A;  1DYU A;  1LVN A;  1QAK A;  3K1L A;  1D6Z A;  2FTX A;  1D6Y A;  4DZO A;  3VZ9 B;  3VZA A;  5T6J B;  2WO0 A;  2WGQ A;  2WOF A;  1SPU A;  5TCS D;  1QAL A;  2W0Q A; 
#chains in the Genus database with same CATH homology
 2FTX A;  5TCS D;  4DZO A;  3VZA A;  3VZ9 B;  2FV4 A;  3K1L A;  5T6J B;  4GEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...