3K1LA

Crystal structure of fancl
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
377
structure length
376
Chain Sequence
EDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fancl
publication title The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Ligase
total genus 74
structure length 376
sequence length 377
chains with identical sequence B
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09765 WD-3 WD-repeat region
A PF11793 FANCL_C FANCL C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.457.30 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 3k1lA02
3.30.457.40 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 3k1lA01
3K1LA
chains in the Genus database with same CATH superfamily
4GEQA 2WO0A 2FV4A 2WGQA 2WOHA 1JRQA 1QAKA 5T6JB 1QAFA 1DYUA 1D6UA 2W0QA 3VZ9B 3K1LA 4DZOA 1OACA 1D6YA 5TCSD 1SPUA 1D6ZA 3VZAA 1LVNA 2WOFA 1QALA 2FTXA
chains in the Genus database with same CATH topology
4GEQA 2FV4A 3VZAA 5TCSD 4DZOA 5T6JB 2FTXA 3VZ9B 3K1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1L A; 
#chains in the Genus database with same CATH topology
 4GEQ A;  2WO0 A;  2FV4 A;  2WGQ A;  2WOH A;  1JRQ A;  1QAK A;  5T6J B;  1QAF A;  1DYU A;  1D6U A;  2W0Q A;  3VZ9 B;  3K1L A;  4DZO A;  1OAC A;  1D6Y A;  5TCS D;  1SPU A;  1D6Z A;  3VZA A;  1LVN A;  2WOF A;  1QAL A;  2FTX A; 
#chains in the Genus database with same CATH homology
 4GEQ A;  2FV4 A;  3VZA A;  5TCS D;  4DZO A;  5T6J B;  2FTX A;  3VZ9 B;  3K1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...