3K1NA

Crystal structure of full-length benm
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 88
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1nA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA03
1WODA 2GWRA 3ELKA 1B1HA 1IN6A 4EJOA 3MCZA 1PBPA 5K2YA 1PDNC 4NF5B 2Z5UA 3GF2A 4KR5A 2X7QA 4BDQA 1BI0A 1FQFA 1Z05A 4NF8A 4XRFA 1MXZA 1LBCA 3V89B 2OWSA 4AB5A 3PUVE 2I48A 2NOOA 1JEUA 1URSA 1VFDA 2PEXA 4KQPA 3S2WA 4OZ9A 3KJ7A 3FVKA 2H6CA 1RYXA 1FOKA 3HO7A 1S8NA 2FNPA 4MQ9F 1G6NA 1WKMA 1F1ZA 3TCHA 4GWOA 1B9MA 4NB5A 2Y48A 4EM0B 4DXCA 5H8FA 5HPQA 1Q35A 2A5SA 1B5JA 1MPBA 1IIWA 3PQJA 2DWJA 2QS2A 2K27A 2DPUA 2ONSA 3S9LC 4EQ9A 4IGRA 3MVXA 1MXUA 1IN4A 4RB3C 2XAFA 4OIOF 3IOWA 5ICEA 1J5YA 4LP2B 4LZ8A 2EJRA 3F8BA 1UQWA 4ESFA 1P4WA 3G3HA 1B32A 4F7ZA 2D21A 4ZEDA 1ZHFA 2P7CB 3WGHA 2H25A 1XCVA 2HKOA 2IVMA 3KP3A 4EQ7A 3HIFA 2FEZA 3QPHA 5ILUA 2I3VA 1FSEA 4I98B 3IL1B 4OIRF 3GFIA 2IPQX 3BWGA 2IW5A 2UXXA 4GGGA 1JW5A 4XKQA 4H67A 3E5QA 1BM9A 3FJ7A 3ZMDA 4JWXA 4O3AA 4A0XA 4H5GA 2XXWA 5H8HB 3L00A 5ICCA 3Q28A 3K6WA 3K9TA 3PUZE 5CBSA 3ZKKA 1FSHA 3BOQA 5DEXB 2QQAA 3M3KA 4I62A 4BHPA 1LAHE 2NXOA 1XMAA 1VFEA 4HOBA 4JBZA 2F34A 2Y84A 1K78A 3ZPLA 1X3UA 1XGMA 4QFLA 4OIPF 4HBLA 3T22A 5AA2A 4KA4A 1B4AA 3G3KA 4ZECA 3SKPA 4KN4X 1IAWA 3JW4A 1B52A 1R23A 4RB1A 4YB6A 3V4GA 4QHQA 1B1BA 1EH3A 3FX3A 1QUJA 4LG0B 2L02A 3TDZC 3LAPA 4U1OA 2GAUA 4NF5A 3VXCA 4N13A 3IC7A 1YW8A 2XKOA 2F6PA 1I6XA 1O3SA 2RCAA 3H6WA 1EZOA 2XIGA 5AA3A 3LWFA 3R6SA 4HTGA 4F39A 2RC4A 5JK4A 1I27A 4YG2F 2UYEA 3KSXA 5ITOA 2L4MA 3S9MC 2UXNA 4M6YA 4JWOA 1QKBA 1P4XA 2K4JA 1B1XA 1R22A 1R7JA 4NWDA 4ONYA 4IO5A 4HQMA 2IEEA 3HHFA 4GO1A 3HSTA 1MH4A 3MP8A 4ELRA 3OOPA 4F3SA 1I69A 2V3UA 2L4AA 4U22A 2WC2A 2XAJA 4PDKA 4IB2A 2V9VA 1QNTA 5LHHA 4RK9A 2Y7KA 3C9HA 1D3KA 3ZS6A 1QO0D 1LFGA 3FASA 2JZYA 2VOPA 3GW2A 3HOSA 2YSRA 1N84A 1GGGA 2QL3A 1S7YA 2DK5A 2HAVA 3GZGA 4HDUA 3MP6A 2O3FA 4JBAA 1B6HA 4JB7A 4G4PA 3BJOA 2QQBA 3MP1A 5J1DA 4R6YA 4LK0F 1A7LA 2DXRA 5DYHA 4QWQA 2W57A 3PGFA 2P6TA 1EV7A 3TDUC 4R6KA 5KZTA 1EH8A 3L2CA 3HRUA 1W5TA 2GHBA 1OIBA 2VHAA 2EWNA 4YKIA 1LAXA 2X7PA 3IRRA 4NTLA 1B05A 3RUMA 4CZZA 2DI3A 4I0AA 3RKWA 1POTA 3IOVA 2JT1A 3KCCA 1TXFA 2ZJ2A 1UHWA 2HWVA 5JTYA 5IAIA 3GLXA 4ZZDA 2MLKA 3EHTA 4U7DA 1TLHB 4WEDA 4A12A 5CVUA 4CDGA 2YLNA 4HS7A 4G8HA 3FV1A 4YKPA 3FVGA 1FTOA 4TLMB 4YFNF 1I6BA 4YU0A 3C3WA 3DM0A 4WXJA 4LG0A 1ZBMA 4Y17A 5KDTB 3ONMA 2OBGA 3T8RA 4NF6A 1JHFA 4NWCA 1BC8C 2Z8FA 4RXLA 3WE3A 2A5TA 4HF1A 5E8IA 4EF2A 2Q89A 1P99A 5A5XA 3MBPA 3F6OA 3KZGA 1SD5A 1NL5A 5FTIA 1USTA 2XX8A 4M4GA 1R5GA 5JFRA 3I5OA 2GIVA 4WF2A 5CVJA 3LQRA 1BTJA 2AXLA 3V5AA 3KP6A 4OIQF 2HFHA 1VE4A 2Q2AA 3CUOA 3TGNA 2DQRA 3D4GA 2ONKE 3SZPA 4LB6B 3U9GA 1A8FA 4FJPA 3JTGA 2I6EA 3IJOB 2STWA 1IN5A 5CI5A 1AOYA 3DP8A 2DS9A 4GQOA 4L18B 5I57A 5H8NB 3Q27A 4XBFA 5F6FA 1M5FA 4G68B 3PPQA 3F8FA 3FM3A 4L9TA 4DDDA 3ZP5A 1GR2A 2DT5A 2F7CA 3I4PA 1P1UA 2AYSA 2KJBA 4OXVA 4RGXA 2CO5A 1B3FA 1PDAA 3GBBA 2Y7IA 4WCGA 1YAEA 1N3WA 1U5TA 5DCMB 3NEUA 1J0RA 4DXBA 1R1VA 2MA3A 4HX8A 1P1OA 1DTZA 3K1NA 1FQEA 3T5XA 1BOAA 4AD9A 1HKSA 1MY0A 4DXUA 3ABTA 2ZXJA 3Q9SA 4I2OA 1I6QA 2REGA 4Y13A 1OMPA 1PB9A 1MJAA 4ZZLA 2VD2A 4P0GA 2O51A 4EUOA 4PGHA 1YG2A 4M9XA 4MF3A 3N97A 5DVFA 2BEOA 2FA7A 5CYVA 5HOOA 3ILTB 4RPNA 3CUQA 1B2HA 1QKAA 1HSEA 1UHMA 3K00A 4L0YB 4X1BA 1USSA 3I59A 1SMYF 2F5EA 4ISUA 1Z7NE 4UA8A 1MJ9A 3KE2A 3T66A 1JE8A 1PP7U 3NRVA 1W5SA 1IF1A 4EGYA 1S50A 3JSPA 3DV8A 3C35A 3SERA 3L9FA 1WVJA 1SW1A 3LA3A 1HQCA 2YX4A 3FMQA 4BAYA 1H3DA 4R75A 1KQ0A 2IA4A 3H7MA 2QYOA 4E70A 3LSWA 2RINA 4OWDA 5DT6A 4WWCA 4MBPA 2EFOA 4OU0A 4L17A 5EEGA 2PJPA 1LDKB 5AA4B 4DNCA 1Q1KA 3OMBA 1ZIUA 4GVOA 1RYOA 5EHMA 2OU2A 3W6KB 3SESA 3IJXB 3G3IA 3U93A 2ISYA 1Y4TA 4Q30B 3QYTA 4BHBA 2K4BA 4U88A 2H5YA 4OERA 4H8JA 2HAUA 3PD9A 3KP2A 4G8XA 3RYRA 5CC2A 5BUUA 2B65A 2CYYA 1II5A 3F72A 3WG9A 1IXHA 3GX4X 5HS9A 3MPLA 1TQMA 5B70A 2GHAA 3EF7A 2XAGA 3F21A 2CWEA 1XDSA 2MH9A 3PPRA 4I9DA 4RA1A 4F3PA 1AL3A 3CVGA 4KI0E 4JXIA 1N3XA 4BDMA 2YPRA 2B3BA 1VSOA 1JVXA 3WTSC 2FXAA 2M8CA 1RUNA 5DCFA 3GZ6A 3C33A 3RPWA 2X4HA 3VV5A 3TUSA 3ECHA 3RIRA 3UK4A 2FOKA 3N94A 3O6IA 1JNFA 4P11A 1JGSA 4FE8A 1YPNA 3VLUA 2M45A 3OO8A 4KMFA 3GWZA 1KQ9A 3N5LA 5DDGA 2UVGA 1RUOA 2FNAA 3T0YA 2MBFA 1DTGA 4A0ZA 3FV2A 4YIIA 3E3KA 4OMZA 5D5WB 5JI6A 4EDPA 2RKHA 3PMVA 2A6HF 1MDQA 2FMYA 4ESWA 1G3YA 5CLSA 3B6QA 4H6DA 4LK1F 5JR3A 5TRDA 1CE2A 2KKOA 4XIGQ 3LQQA 3SDFA 4DIGA 4GYIA 1L3LA 2E1CA 1OYYA 4ZEIA 2PYYA 2A69F 2F36A 3R60A 1L5TA 3H3GA 5LHIA 3A3CA 3OO9A 2HZKA 3I71A 4ENKA 2HCAA 1AIVA 2B0LA 2QS1A 1T0KA 2ESNA 2H09A 2VBWA 5FLXK 3KG2A 1DDNA 3MAJA 3C32A 4QF9A 3FZVA 2F5XA 1FC3A 1QUKA 1G4DA 1MDMB 3OSRA 2OZUA 2KIMA 3K1PA 3IAZA 2IA0A 1MY3A 5E17F 1B5HA 3THIA 3CO7C 5L9OA 3ZQ7A 1H45A 2A68F 1YTVA 2L3DA 3J7AO 2IRFG 3P9IA 4G8NA 4IVNA 3MZBA 2LAOA 4CHUA 1FTLA 5F64A 3BZ6A 1B7UA 4PGGA 3DPTA 2NAZA 2IT0A 2QLZA 3ZMZA 3HOTA 2NVUB 1TNTA 1KA8A 3IKTA 3DELB 4F31B 4IGTA 3SHFA 4DCXA 2HXWA 3CI8A 3AXFA 1B46A 2LKPA 4KYDA 2PMUA 2IP2A 1NH7A 4G8MA 4YMBA 3DFGA 3FMSA 5D8LB 2ZXTA 2OWTA 4YFXF 1J1NA 2ABHA 3M3FA 2DO7A 4QRZA 2Q88A 2FNCA 1Y20A 2J5PA 5I59B 1RKMA 4JQFA 4KCDA 1QZYA 5AE4A 4IY6A 2WV0A 3MUQA 3EUHA 1FTJA 4ON0A 2D45A 2XXVA 4JSDA 4PFUA 3JSOA 5EEHA 4EM1A 1LLSA 2NNNA 1BIAA 3TCFA 3QIMA 2Z8EA 5L8DA 4G68C 3QP6A 3BJ6A 2O03A 1F9NA 5K5OA 3E6DA 1LFHA 1KWHA 1TBXA 2CGPA 1USYE 4HF2A 2QJEA 3LBSA 1UTBA 3TFLA 4KN7X 4Y15A 1FQDA 1W7PA 2AIXA 2HYFA 4I09A 3CG1A 5CMMA 3WGIA 3WTTC 2X0LA 2E7WA 4F1YA 1KU9A 4P96A 5L3CA 3K6VA 5I2KB 4M73A 1D9VA 1M5BA 2PBWA 2UXAA 3HPIA 1TQPA 2A6EF 5J8FA 2EFPA 3IOTA 3LSLA 4Q5TA 3TO9A 2QBYB 2Q9TA 5IT3A 4C1UA 4MEXF 4IO6A 2R6GE 3UORA 2HEUA 4UVCA 3LR1A 4RB2C 4O3CA 2ZO4A 3HN0A 3TKDA 2L01A 1SVXB 3SZTA 1FQBA 1A04A 2Z99A 2OZZA 2PFBA 1HXDA 1DPUA 2W24A 1YW9A 1Y3QA 3TODA 4TQUQ 3QUFA 1SYIA 1RIOH 3G3FA 4QSCA 4ELQA 5J8CA 3KEQA 4I8CA 2Q2CA 5ILSA 4MTEA 3ROUA 1A40A 1IRFA 3I6VA 1FP1D 1D9YA 1KYWA 5F1QA 5KCJB 4UUVA 3D5LA 4LLNA 2DVZA 2HZLA 4MFIA 4ZYEA 4POXA 5K2XA 2HEOA 2HDCA 1B59A 4B8XA 1XGNA 2F2EA 3TKYA 1O57A 1HSLA 1GVCA 4L5JA 3PPPA 4CICA 4BYYA 1D8JA 2AL5A 2YX7A 3Q29A 1XGSA 4IF4A 1US5A 5HLGA 4D0PA 4RAZA 5A2QK 1P1QA 4ZE8A 3WTUC 1IW7F 2STTA 4XXUA 2VE9A 1PB8A 1R5HA 4XLNF 3CR9A 2L54A 1LAGE 3PUYE 3RPUA 3U8QA 2HZTA 1N04A 3S9EA 2G9WA 4I02A 2OQGA 2DBBA 3M9AA 5HBCA 2HKXA 3CDHA 1IXIA 2DK8A 4KDPA 2ZNSA 4EVIA 3FIRA 4H1XA 4LUBA 4IPAA 3ECOA 3KOSA 1MQHA 3GEZA 1MM6A 2FBKA 5LEKA 2ONRA 3OO6A 5DEQA 1SAXA 4A5MA 3IWZA 4ZZEA 3K0LA 2HQNA 5IT9K 2VODA 3UGWA 1DSNA 3MC2A 5H8QA 3PU5A 1BBYA 4LLLA 5FHMA 4RGUA 2DPDA 3M8UA 1G3WA 1YS6A 5TPAA 2DTRA 1XDUA 3F3XA 2QPQA 2XASA 1POY1 4QSEA 1FTKA 3SETA 1VTNC 2EA4A 3M7GA 3PUXE 5CM6A 3RTRA 2TDXA 1P6RA 1MJBA 1TFDA 5BQTA 1QJMA 2XXIA 3JTHA 4XLPF 3OOAA 3F8NA 4UVAA 1IN7A 3TYHA 2XUBA 2BYVE 3DP7A 4OMYA 4MLQA 3K01A 3TMGA 3HRSA 2OZ6A 3UN6A 2A3SA 5LEJA 2ESHA 3J81Z 4IO7A 4EQQA 2P2AA 2ZYOA 2H9BA 2ZBKA 1O3QA 1O7FA 2VOOA 2O68A 3ZKLA 2LF8A 4FHTA 3GYHX 1UTHB 2O1MA 3KSJA 2ETHA 3MZYA 3H92A 1K6OA 2P5LC 5D4SA 3IR1A 3OELA 2K02A 4CGZA 1D3YA 2XXQA 3GXAA 4HX7A 3BPXA 1JQFA 5CBRA 4F3BA 2E0SA 1REPC 1FTMA 4R9FA 3KBRA 4MH5A 3SEVA 2FF4A 2DWAA 4FX0A 5ISUA 3E5XA 1BIBA 4HV6A 5F7VA 2R3SA 1U6GA 2COMA 3FD3A 3TQLA 3VFJA 3PD8A 4KYEA 3W9WA 1LCTA 4FX4A 2QS4A 3W9VA 4HDVA 2RN7A 4Q4ZF 4P9UA 4ZE9A 4EV0A 2A5YB 5KVRA 3JYRA 4F1VA 1DOTA 1NKXA 2W7YA 3GVAA 2P5KA 2DSFA 4HV5A 3H3ZA 5KK1A 3JV9A 1MS7A 5A2QZ 3MZ1A 1QPMA 4HX4A 4EJWA 1TNSA 3RGYA 3TO7A 1MQIA 3GZ5A 5DYMA 1P1WA 2VONA 2P1SA 2J5OA 1BJAA 4H0WA 4HCWA 5ICTA 1UIUA 1YLFA 1N7WA 3BP8A 1LBBA 3ZMVA 3O97A 2PBIA 2WWYA 2R71A 2PQ8A 3VODA 4TV7A 2OLBA 3FGSA 5H8HA 4F22A 1G3SA 4IHTA 1SD7A 4GCVA 4YB7A 3U72A 5IT9Z 2KIUA 3RT8A 3R7XA 3AAFA 1B9JA 1VR5A 3U1OA 3L6GA 4U1ZA 5DEXA 2I4BA 2EFNA 5BOXA 1IUYA 1MZBA 2EV5A 1FY7A 1AH5A 5DUKA 3ECRA 2C6YA 1S9TA 3VVDA 2M87A 3KP4A 3OSQA 4NF4B 3GLBA 1ZRFA 3UIFA 3VDFA 1MDP1 4OQOA 2Z33A 1R6ZA 3K6XA 3KEIA 1SI0A 3KFWX 3C18A 4HA8A 5LLQA 2HQ0A 2REJA 1ZRDA 2JTVA 2MH2A 3RNNA 1SI1A 4FAJA 4R2FA 1XT8A 1I1SA 1OQHA 3T93B 5E20A 5E18F 1J75A 2VP1A 4F29A 1YCJA 3Q26A 4TOZA 3HHHA 2H27A 4KICA 3H3UA 4FORA 3O6GA 3TPAA 4P0IA 2R7FA 4IY5A 1NNTA 1JHHA 3B02A 4OESA 1S6LA 3EDPA 4UHTA 3F22A 4N9IA 2LF7A 1EZPA 5I58B 1B9NA 1H44A 1XSXA 4Q48A 5D8KB 5CMKA 5L3EA 4I0BA 2UVHA 2PMSA 3JAMZ 2EV6A 3LUYA 4G9YA 5F1RA 2OBPA 4OENA 1B58A 2D1HA 1NNPA 3GBAA 1E17A 5CMBA 2ALUA 3RTWB 3ZN1A 4OFJA 1XSDA 2FBIA 5I2NB 4UVBA 2FA5A 3ZMSA 3I0TA 5J6XA 2EFWA 1NMUA 3MW0A 4G6QA 2QUFA 1PUEE 1SQYA 5B7DA 2ZYKA 3IL2A 1KGSA 1RNLA 4LVQA 4MTDA 2ZYMA 4KMUX 4YMAA 1IZ1A 1ODDA 2ZMEB 1U8RA 4A6DA 2Y7RA 3EQLF 4N9HA 4PCQA 4PETA 2CZLA 2O69A 4ZEFA 1ZKBA 1HBXG 2Z3YA 3EHSA 2VT3A 3BDDA 3T8TA 4DCYA 3JZJA 2IA1A 1FQAA 1MQDA 3MQ0A 3GUDA 3C31A 3I58A 3C4MA 4FATA 1LJ9A 4GYGA 1BI2A 2CSOA 3IO6A 3KFMA 4L9VA 2EK5A 4U21A 2VC0A 3HTSB 1PP8F 3HUGA 4Q8RA 1SW2A 4X9TA 1FPQA 1MXXA 2O61A 4HF0A 4PFTA 1FBUA 4YKKA 2GQQA 5HLIA 2K86A 3B6TA 3TTKA 1S7OA 4M6XA 4BH9A 4X48A 2FYIA 3CO6C 4UV8A 2E7XA 2BBYA 4FT8A 5LHGA 1URGA 1USYH 4YZZA 5KDTA 3CJNA 3WTVC 4BDNA 2F78A 2CMOA 1SFXA 1SW5A 3G3JA 1B0HA 1JEVA 3RKYA 3W15C 4N07A 3BFUA 3MFKA 3FXQA 1B3EA 1B0LA 3DF8A 3V7RA 4U0WA 3T9XB 4OEVA 4ECFA 1KU7A 2F7AA 1GV8A 1TWYA 2GFEA 2GXGA 2XV4S 4KYWA 1O63A 3HTUA 6PAXA 2ANJA 3MVYA 2F35A 1WSUA 2LNBA 1D4NA 4G6DA 3K2ZA 1TT1A 3EETA 2UVJA 2HTSA 3FM5A 2GH9A 4O3MA 4F18A 3DEUA 3V7SA 4RPOA 3LFKA 1FX7A 1I1GA 5FFXA 1F9BA 4ND9A 4RJZA 2UYFA 2HOEA 3V7CA 3B6WA 3CRBA 1YO5C 1DPRA 2IJLA 3P9CA 3FVOA 1Z7ME 4K3FA 3E6CC 4U0YA 4AWXB 3FJMA 1CF7B 4FEDA 2WTEA 3MVWA 2R7DA 2UWMA 3BBRA 3KP7A 3T9HB 3KN8A 4OHNA 2F8DA 3S2VA 2LSOA 4FEBA 1U78A 3MWBA 4NE4A 4LMYA 5JEIA 2G7UA 3LA2A 3BFTA 3D4CA 5H8NA 3A09A 3VLVA 4CO8A 1I5ZA 1O3TA 4G68A 4U2RA 5LRRA 3I64A 3SEXA 5FO5A 3WAFA 1FP2A 3T1BA 1PEBA 3FJGA 5AA1A 2V6CA 1B3LA 3QPTA 3N6UA 3Q25A 3J80Z 4EJUA 3LSTA 4ESXA 4JDFA 1ZLJA 1FCKA 2RF1A 4ZYHA 5DCMA 5D4RA 3TELA 1ZN2A 1FYLA 4IO2A 3WTZA 5L3DA 5LGTA 1BIYA 4GF8A 1U2WA 5LBQA 1M5CA 3O66A 1R9QA 2O7UA 3QOPA 4KFQA 4C1TA 4ZEKA 1B4ZA 4EQBA 1B5IA 4GRKA 2QWWA 5L3BA 3DQVC 2GRVA 2AS5F 3VVEA 2EB7A 1URDA 3GXOA 4LQ2A 3M8EA 5E8GA 1XN7A 2F7BA 2OJTA 2Q0OA 2O6GE 2B3FA 2I0CA 1LB8A 4EJTA 3M1EA 3T9UA 3PFIA 4F2QA 2DWHA 2V3QA 1FQCA 3R6UA 2FU4A 4ESBA 4GL8A 2GXBA 2E1NA 3E6MA 1LEAA 4Z7EA 1HW5A 3TO6A 2I0BA 1DPEA 3BPVA 1IQ7A 1GTKA 1B40A 2QENA 1Y3PA 1WQ2A 3TTNA 4ELPA 4KUMA 1QZZA 2V3TA 4ASNA 2ZNTA 1LFIA 3K2DA 4Z2YA 5TP9B 1B3HA 1YQAA 4H8IA 2QM3A 2XD2A 3KLOA 5AA4A 3S4UA 3SQNA 4QFNA 2P0SA 3CFZA 3HYIA 1LNWA 4H0EA 1YIOA 4R8HA 2IA2A 3TAJA 4AQ4A 5FD6A 1HKTA 1ZREA 1JXSA 1FYMA 4L0ZB 2DYXA 1ZAOA 4XKPA 3MZHA 3FUZA 2FQ3A 2HR3A 1S29A 1TFAA 3I5UA 2H98A 4I01A 3TZAA 3WTXC 1NNKA 3EHUA 3E6BA 3D0SA 3PMXA 3QK6A 1Y4CA 3H4ZA 1IXSB 2G7HA 2P5VA 1N7XA 2V1UA 4GIZA 5I84A 2WKYA 5L9SA 1Z7UA 3C7JA 4WEPA 2H6BA 4MEYF 4U4SA 2HQRA 3N4MA 1OLAA 4GLIA 3O9PA 4QLCU 2YPNA 2CQKA 3FF5A 3OV8A 3REOA 1XHYA 4I7HA 4G7HF 3T9VA 4NF8B 4AB6A 3ABUA 2ZMBA 3UP9A 1QVSA 3L09A 1ZGAA 4R79A 2XD3A 2DAOA 1BC7C 4OETA 5H8SA 4R74A 1PC3A 3B7DA 1LSTA 3N6TA 1R36A 4L5IA 1P4AA 1UB9A 3FVNA 2XX9A 1XOCA 2YJPA 1B51A 3CFLA 5H8FB 2VXZA 4YKJA 4XSXF 1MXYA 2XXTA 2A61A 4O5VA 2YR2A 2VBYA 1SFUA 1XVXA 4R6HA 4NMYA 1H76A 3ZSFA 1IN8A 3O2AA 3QP5A 4A0YA 3E9XA 5HLHA 1XVYA 2XAHA 1MQGA 3VEPA 4IO3A 1J7KA 3K4UA 4KCCA 2X26A 2W85A 4LB5A 2JSCA 3KP5A 1YFHA 5CRYA 1STZA 1LVAA 4JSOA 2ZKZA 1I6AA 1SDXA 3O29A 4A6EA 2D2WA 1MD0A 3BROA 3WTYC 4A2UA 2UVIA 3M3LA 4IRHA 4EXKA 1SYHA 3FXRA 4OYVA 5I56B 5JVTA 1OVBA 1WRJA 4PFWA 3IB2A 4G94A 2V1DA 2HYGD 1NH8A 1MDMA 4HCYA 3J81K 1ZLQA 4GXOA 3RI4A 4U4XA 3IB0A 1O7TA 2DE3A 4IXAA 2P6SA 4WXDA 2YU3A 1FBQA 5H6RA 1ZJLA 1HSJA 1L0OC 4ETSA 1JW4A 3QRFF 2DLLA 5L3GA 4XKRA 5BPIA 1DMBA 1K78B 1TQIA 4LONB 2FMLA 5HS7A 5AA2B 1DPPA 3IHUA 4G7OF 1ANFA 2DE2A 3USDA 3R26A 2DP8A 2VBZA 3SFZA 2VD3A 1CB6A 1EZ9A 3KJTA 5DD8A 2O7IA 3OEMA 2GZWA 2JRTA 2PN6A 3I54A 2G29A 4RGRA 4KIFA 4MGRA 1A54A 1FT9A 4H5FA 3ZMUA 3TCGA 4U0VA 1MPDA 1XSVA 3FWEA 4B09A 3G3ZA 2F6GA 1BI3A 5I59A 1IXGA 4ZZAA 3F8CA 4OINF 5CMCA 2Q8JA 4LATA 4OTEA 4F1UA 3V83A 1B6AA 1GHCA 1QQIA 3EYYA 4KIGA 1XGOA 1S3JA 3DP4A 4QFOA 4KIBA 1OKRA 2THIA 1K7AA 1WI9A 4QFPA 3O2PE 3DP6A 4UXNA 3E4RA 2BE5F 2HTJA 5HDKA 2GA2A 1E2XA 2OD5A 2QZ8A 3K02A 3BJAA 2XKPA 5ICGA 3KN3A 3MWMA 2H99A 1NNFA 2Y7WA 3SEYA 2RNJA 1LGBC 2RKMA 4ENJA 1A55A 2BGCA 4R72A 3COAC 4QSDA 4WK8F 3K6UA 2D3IA 5I2KA 3QU3A 1OLCA 5I56A 3QSLA 2DW4A 3PPOA 3MEXA 2ISZA 2MLGA 2XHDA 1MPCA 2LDUA 2RVCA 3IX1A 4E0XA 1V4RA 2QBYA 3WAEA 4GOTA 4F19A 4AIKA 2PX1A 1W4MA 2QRYA 3KZYA 3O6HA 4ZH4F 3GO5A 3ODBA 5LOMA 1IEJA 2NNYA 3VOEA 5FHOA 3H6VA 2VC1A 5DTBA 4PQJA 3IORA 1R00A 4WX9A 5JTYB 2A07F 5LGUA 2F5DA 4OVJA 1FWZA 3WGGA 3Q5FA 2V93A 4RGSA 2QMWA 5LRSA 2XXUA 4R2BA 3JAMK 3H03A 3RDIA 1M5EA 5AIPA 5ITPA 3H6TA 1Y3NA 1P92A 3FATA 5KCJA 1IXRC 2Q8KA 1KU2A 4P55A 3WE2A 4UACA 3ZN0A 1HKQA 5D5UB 1QW0A 2I3WA 5HM4B 1FNNA 1XMKA 3P7NA 3QXMA 4NF6B 3BKIB 1B7ZA 1NHAA 4L9JA 2KIFA 4HAMA 2RQPA 4DQ2A 4NHJA 2A5TB 2XHKA 5A5XB 2W25A 3F6VA 4CXFA 4CYDA 1MM7A 4F2OA 2DQVA 4LLGF 4DZ1A 1D5VA 2OAZA 2PT1A 3DKWA 3MAMA 5HS8A 4OMBA 2I58A 4KYSA 3U92A 4LFUA 1T0FA 1MRPA 5M2VA 2ZNUA 2FBHA 2GA1A 1LQ1A 1QBJA 1TTYA 1LB9A 4KNYA 4WXHA 1Z91A 5CVVA 3ERED 3EPEA 2Z23A 2K7LA 5FHNA 1PB7A 4Q5SF 1O64A 3F23A 3U94A 1ZU0A 5DVJA 5I57B 1LCFA 2Z9OA 4ZYGA 1HW2A 5L3FA 5TU0A 3QUJA 1LEBA 2O1LA 1OQGA 4M1VA 3KGCA 4WKMA 5BWJA 1MGTA 3PQKA 1MXVA 1YW7A 5TJJA 2ACJA 5BS6A 3OO7A 1ZGJA 2RC7A 3K69A 4S04A 1ZG1A 4P9FA 1U5TB 1UIVA 3KZZA 5CJ9A 4EMSA 4EM2A 4XSZF 4H65A 1ZTYA 5CVRA 5EHSA 2XAQA 2PI0A 1N0TA 3NQOA 3FHZA 2VGQA 1ZG3A 2D5WA 1UTHA 3I53A 3IWFA 3VLWA 1A8EA 1KU3A 4PZJA 1FYKA 3QU6A 4M72A 1LDDA 4FECA 1EU8A 2RCBA 2MC3A 3E3VA 3C1DA 1BKAA 4LQ5A 2RGVA 4HZFA 2CW0F 1GXPA 1QGPA 3RTFB 1NFTA 4HW8A 3CG3A 1QUIA 3CUQB 3E13X 2UZKA 2PLYA 2DWIA 3MQ9A 3SXYA 4OEUA 1FW0A 3CTAA 4YAHX 5JHUA 3I59B 1ZH5A 4X1DA 5D5VB 4MQVA 2O8XA 4BQAA 4NEDA 4TLLB 4GXSB 4YB5A 4KPTA 5FFZA 3FXUA 4IRGA 4ENNA 1YS7A 2ZNZA 4EXLA 2NS0A 2I4CA 2KLFA 4PP0A 2P8TA 4Q47A 2BJJX 1ZLKA 3G3GA 2M8EA 4HLYA 2O84X 2DXYA 5D6FA 3J80K 3F11A 1MQJA 2D1VA 2F5CA 3EQ1A 2XXYA 4POWA 4NQWA 4OFLA 2JPCA 2Y0MA 5D6EA 3HSEA 3TOAA 1MY2A 5ED4A 1Q1HA 1RI7A 3DPLC 3R0AA 4LZ5A 2CFXA 5FB2A 5E1ZB 1LAFE 4BDRA 3IB1A 2ZYNA 4RAYA 1Y1MA 1QULA 2V84A 3WU0A 1ZRCA 3ZMTA 5EYFA 3RYPA 4NF4A 4WXCA 5DV5A 3V8JA 1HW1A 1Y1ZA 2QQ9A 2XROA 1GVJA 2Y75A 2Z8DA 3VB2A 3N26A 4N6PA 3LA7A 2RC9A 1J9IA 1AWCA 1XC1A 4BXUA 4RNSA 4DLDA 2BV6A 2EV0A 3T96B 2JPBA 3V8LA 1YTYA 4O6JA 1SD6A 3LAJA 3UA8A 1MKMA 1YYVA 4ZEBA 1PBQA 1SMTA 4BHCA 5I58A 3HSFA 2CG4A 1F5TA 2G93A 1FBSA 5DUIA 1T2KA 5K5RA 1XB4A 1D8KA 2H4IA 2HGCA 4XKNA 1MY4A 5D5XB 1SD4A 1JW1A 2VT2A 2I49A 5HDNA 2AL4A 4BDLA 4R1HA 4LZ7A 3CSBA 5FGMA 4K2EA 2M30A 2ZFWA 5DD4A 1JETA 3L7WA 3RN8A 3MJNA 3IK6B 5I2NA 1ELJA 3CLOA 3SEUA 5K1YA 2XRNA 3TTRA 4RB0A 4IO4A 1WDNA 4R73A 1AMFA 2XXRA 1TW3A 1TW2A 4M74A 1J2XA 1R58A 5H20A 3MPKA 4AIHA 3C34A 4M9ZA 2ZMEA 4DE8A 1H9GA 5DVIA 4ZYDA 3OD7A 1EH7A 4RK2A 3PUWE 2DOJA 1P2FA 1SD3A 2W84A 2QS3A 1XD7A 3QAHA 4UNOA 2XXXA 1OPCA 1N76A 1F4KA 3GFLA 2QSXA 4QFKA 1B4HA 3RT6B 4GXAA 4I1DA 4F3GA 3O3KA 2XX7A 3HCQA 1LDJA 2DFIA 3VFZA 5K5QA 3EN3A 5E1WA 4LJZF 1T38A 1Z6TA 2FRHA 1SW4A 2NYXA 5FD5A 3PV0E 4LD5A 2PG4A 1ONVA 1IITA 1KYZA 3O6BB 1MG1A 1ATGA 1R9LA 5ERIA 2QMXA 5BPDA 3IRQA 4RY1A 3DXJF 4HW0A 2OA4A 4MNUA 3GFJA 1BP5A 3L6HA 1XS5A 3DLNA 3G73A 4OFOA 4BLAA 4BDOA 1WWXA 1AOVA 3ISPA 3R0JA 1Z9CA 3CFXA 4U23A 2HS5A 5ICFA 3W6JB 1ON1A 2Z22A 1ULYA 2F97A 4JWYA 1BI1A 4ESJA 1OVTA 3HRMA 1MH3A 5H6QA 2PT2A 2V25A 1J59A 4ELOA 2E1SA 1Y9UA 3ML6A 1O7LA 1T39A 4PE5B 2M5WA 4UV9A 2V1XA 5LGNA 3M8FA 2XGXA 3OEKA 3CIJA 4GFRA 4MLVA 3MZ9A 2EFQA 1W7PD 1IRGA 2OCUA 1H43A 4G77A 1H9TA 4EF1A 3WODF 4KD5A 4L9NA 1P1NA 4EGZA 4BNCA 3TOBA 4IHSA 3O28A 5ICQA 1EH6A 3IOUA 4S05A 2DVCA 4GD5A 2RDPA 3VVFA 1R1TA 1C0WA 1B7HA 2PVUA 3TQWA 3HSRA 1CF7A 3KLNA 4LGWA 4O3BA 2NWJA 2EA2A 3KOTA 4M71A 1IXCA 1HSTA 1BLFA 1DUXC 5HVQC 4HQEA 3E5UA 3LC8A 1MY1A 4IRIA 2ZNYA 3C36A 1UTBB 3HV1A 3EYIA 1ZARA 1W7PB 2XXPA 2Y7PA 1U5TC 3LSFB 3FMRA 1A99A 4FIMA 3P9KA 4MHGA 4C0RA 5IKBA 4YIFA 2P7VB 4RYAA 1S7AA 4IJAA 3KETA 1GXQA 2PMHA 1UCRA 2M1BA 1ZMGA 4N0BA 4R9GA 2MD5A 5FTHA 2O6AA 5HDGA 3PPNA 3H06B 3Q9VA 4A5NA 4LA9A 2ELHA 5L9MA 3G7WA 1IUDA 3PMWA 4RS8A 3QAXA 3F8MA 3TEPA 2KJCA 1V3FA 1OMIA 3TQNA 3RPQA 3KN7A 4AVPA 3WTWC 5E1XA 2V79A 1CGPA 2OQRA 3CUQC 4KHZE 5ELVA 5BMZA 5CVIA 3V8KA 4U7BA 1UFMA 4HLXA 3U2RA 1Y0UA 2H94A 3OXNA 2NUVA 5AIQA 1ON2A 3WU1B 4G2ZA 3MVZA 3V8XB 3VXBA 3RKXA 3KEOA 2ZCWA 3I3VA 2DE4A 5AONA 2FE3A 3A3UA 3TTMA 2R9JA 4YICA 5ILVA 3LSXA 2NRAC 1T98A 3IO4A 2O0YA 1KQ8A 2P4WA 3HHGA 3S9NC 3B73A 3SEWA 3E97A 3RY3A 3TDJA 3IKVA 1MXWA 1LB2A 3K1MA 2VN2A 4KT5C 1H0MA 1FZPB 1M5DA 2HFBA 1SFEA 4P5OA 5TP9A 1SBPA 3OENA 4E0WA 1R1NA 2KRFA 3H6UA 4HYEA 1XCBA 3P7IA 2VE8A 3CSGA 1Z1DA 2F5FA 1ZYRF 4THIA 3HRTA 1T6SA 2XXHA 1DP7P 1ZG5A 5AA2D 3K0VA 4Z0IA 5H8QB 3U1DA 4PFYA 3ILUB 1US4A 3TTLA 4G7ZF 2OK2A 2FSWA 5TPAB 1OR7A 4YFKF 1Z6RA 2VOZA 2QVOA 4OOIA 4Q0CA 2RV8A 4KFCA 2Q2EA 2RC8A 4GL0A 2ADUA 4AIJA 3RJPA 3VE1B 1O3RA 4ENMA 4JK1X 1R1UA 4EJVA 1U3EM 2DU9A 2VBXA 1FLIA 3RLFE 2DQLA 3ULQB 4ZS9A 5FLXZ 1OYWA 1OYIA 1K79A 4XTCQ 4ZDMA 2XVCA 3GFMA 4M9SA 1JVYA 1RZ4A 1BN5A 3BY6A 3R61A 3R4KA 1G3TA 3RQTA 1B3GA
chains in the Genus database with same CATH superfamily
1WODA 4H4KC 2GWRA 2LOOA 3ELKA 1B1HA 1IN6A 4XKVA 4EJOA 5CQEA 3JCUC 4XLFA 3MCZA 3HOYJ 1PBPA 5K2YA 1PDNC 4NF5B 4BACA 2Z5UA 3GF2A 4KR5A 2X7QA 4BDQA 1BI0A 4Z6YA 1FQFA 4OVQA 1Z05A 4NF8A 3GYYA 4XRFA 1MXZA 3KX2A 1LBCA 3V89B 2OWSA 4AB5A 3PUVE 4HSRA 2OCCH 2I48A 2NOOA 1JEUA 1T95A 1URSA 1VFDA 5CPRB 2PEXA 1B8IB 2X1CA 4KQPA 3S2WA 3O8HA 4OZ9A 4XQFA 3KJ7A 3FVKA 4PAFA 2H6CA 1RYXA 4CCKA 1FOKA 4V2GA 2RQQA 3HO7A 4XOPA 1S8NA 2FNPA 2R8TA 3OS1A 3DTKA 4MQ9F 1G6NA 4NAPA 1WKMA 1F1ZA 3TCHA 4GWOA 1B9MA 2DFHA 2Y48A 4NB5A 4EM0B 4DXCA 5H8FA 5HPQA 1Q35A 2A5SA 5HNFA 1B5JA 1MPBA 2XF7A 4RAGA 3M4OJ 1IIWA 3PQJA 1FSAA 3GLLA 1D1BA 2EZIA 5HODA 2DWJA 2QS2A 2K27A 2DPUA 1LE8A 2ONSA 4PSWA 4PFOA 3S9LC 4EQ9A 4IGRA 1KA1A 4NNJA 1JUPA 3M3LA 4XR6A 1MXUA 1U9OA 3MVXA 1IN4A 4RB3C 2XAFA 4OIOF 3IOWA 5ICEA 3BLYA 1J5YA 4LP2B 1SANA 4LZ8A 2EJRA 2LTPA 3B50A 4FASD 1TC3C 3F8BA 1UQWA 4ESFA 1P4WA 4P56A 3G3HA 4BJ5C 4F7ZA 1B32A 2D21A 4ZEDA 1ZHFA 2P7CB 2ME0A 3WGHA 2H25A 3BQZA 1XCVA 1MNDA 2HKOA 2K9NA 2IVMA 3KP3A 2E2JJ 3HIFA 4EQ7A 2FEZA 3QPHA 5ILUA 2I3VA 1FSEA 4I98B 2CZKA 4II2A 1BK4A 3IL1B 4OIRF 1ZKGA 2IPQX 2KISA 5GADJ 2HPIA 2IW5A 2UXXA 3BWGA 4GGGA 3G6EI 1JW5A 4H67A 4XKQA 3C2BA 3E5QA 1BM9A 3FJ7A 4QXDA 3ZMDA 4UB8C 4JWXA 4A0XA 4H5GA 4E7IA 4O3AA 2XXWA 4F55A 5H8HB 3L00A 1NUWA 5ICCA 3Q28A 3K6WA 5ESYA 1G8XA 3HOXJ 3K9TA 4X1EA 3PUZE 5CBSA 3ZKKA 1FSHA 2Z1DA 3BOQA 5DEXB 2QQAA 3M3KA 4I62A 4BHPA 5LFAA 1LAHE 3TBIA 2NXOA 4BBSJ 1XMAA 1VFEA 2UV1A 4HOBA 4JBZA 2F34A 2Y84A 1K78A 3M3YJ 3ZPLA 3C2GA 1X3UA 1XGMA 1RR8C 4QFLA 4OIPF 4HBLA 3T22A 1XC5A 5AA2A 3LOCA 2W4SA 4AIDA 1B4AA 4KA4A 3G3KA 3SKPA 4ZECA 4KN4X 1IAWA 3JW4A 1B52A 1R23A 4RB1A 4X04A 3V4GA 1S72I 4YB6A 4QHQA 3RPLA 1B1BA 2KDOA 3FX3A 1EH3A 2VPLA 1QUJA 2BXYA 2L02A 3TDZC 1NK2P 4LG0B 3LAPA 4U1OA 2GAUA 4AVZA 4NF5A 3VXCA 4ITVA 3ZQIA 4N13A 3S15J 3IC7A 1YW8A 2XKOA 3H35A 3IAS2 2F6PA 5E3LA 2JWTA 1I6XA 1O3SA 2RCAA 3H6WA 1EZOA 1EYKA 2XIGA 5AA3A 4NBQA 1WCMJ 3LWFA 3S17J 1DP3A 3R6SA 4HTGA 4F39A 2L9RA 2RC4A 5JK4A 1I27A 1FTAA 1RKWA 4YG2F 2UYEA 3KSXA 5ITOA 2L4MA 3EUHC 3H9QA 3BG5A 3S9MC 2UXNA 4M6YA 4XRSG 3ABMH 4JWOA 1QKBA 3E0JB 3LSRA 5FRNA 1P4XA 4BQOA 2EILH 2GM4A 2K4JA 1B1XA 1R22A 1R7JA 4NWDA 4ONYA 1OCPA 4IO5A 1OCRH 4HQMA 4PC9A 4YEJA 3CCLI 2IEEA 3HHFA 4GO1A 3HSTA 1MH4A 1WJBA 3MP8A 4ELRA 3OOPA 1LBYA 4E4HA 4F3SA 1I69A 2V3UA 2COBA 2L4AA 4U22A 2D5VA 2WC2A 2XAJA 2HNHA 4PDKA 2V9VA 1QNTA 3HZJA 3K6GA 5LHHA 1IMEA 2Y7KA 1D3KA 3C9HA 3ZS6A 1QO0D 1LFGA 3FASA 2JZYA 2L7KA 2VOPA 3GW2A 3HOSA 2YSRA 3HDDA 1N84A 1GGGA 3M1CA 2QL3A 1S7YA 2DK5A 2HAVA 3GZGA 4HDUA 3MKWB 3MP6A 2O3FA 4JBAA 3UNGC 1B6HA 4JB7A 3MKYB 2JA7J 2DMUA 4Y3OA 4G4PA 3BJOA 2I8DA 2QQBA 4XNFA 4E7HA 3MP1A 5J1DA 2XGDA 4R6YA 4LK0F 2K9SA 3DTEA 1A7LA 2DXRA 5DYHA 4QWQA 2FD5A 2W57A 3PGFA 2P6TA 2WA0A 3PSFA 1EV7A 3TDUC 5GPAA 4R6KA 5KZTA 4D5CA 1EH8A 3L2CA 3HRUA 1W5TA 4C3IJ 1OIBA 2GHBA 2MSYA 1ZR4A 2VHAA 4RLFA 2EWNA 4KXPA 4YKIA 1LAXA 1Y8QB 3IRRA 2X7PA 4NTLA 3GFIA 1B05A 3RUMA 1MMDA 5FKLA 4CZZA 2DI3A 1PVEA 4I0AA 4D1QA 4PFRA 3RKWA 1POTA 3IOVA 2JT1A 3KCCA 1TXFA 2HXRA 2ZJ2A 1UHWA 1X1CA 3HUGB 2HWVA 2LY9A 5JTYA 5IAIA 5LTCA 3GLXA 3MN2A 1AA7A 3WU2C 4ZDOA 4ZZDA 4C9YA 2MLKA 4E7LA 4U7DA 2OWZA 3CHGA 2DXIA 1TLHB 3EHTA 4NQ8A 3E7LA 4WEDA 4A12A 4V19K 5CVUA 4MHFA 4CDGA 2YLNA 4PK4A 3OYLA 3BR2A 2XPVA 4G8HA 3FV1A 1V5EA 4HS7A 4YKPA 3FVGA 1FTOA 4TLMB 4YFNF 1I6BA 4YU0A 4Y7NJ 5DS9A 3C3WA 3DM0A 4WXJA 4LG0A 3MMYB 1ZBMA 2CW7A 4Y17A 1MW7A 2M0MA 4PFPA 3QPSA 2R7WA 1O4XA 3J7YJ 1NK3P 5KDTB 3ONMA 5J3LA 1D0XA 9ANTA 2OBGA 3T8RA 4NF6A 5F0HA 2X6OA 4OVSA 1JHFA 1W36C 4NWCA 1BC8C 2Z8FA 2LRDA 4RXLA 1MMAA 1FOWA 2PJRB 4J00A 3WE3A 2ZJRF 4HF1A 2A5TA 5E8IA 4EF2A 2Q89A 1P99A 5A5XA 3MBPA 3F6OA 2DMTA 3KZGA 1S7EA 1SD5A 2BY1A 3HKZN 1NL5A 5FTIA 2DJNA 3BG7A 2WBBA 1USTA 2XX8A 4M4GA 4HNTA 2WAEA 1R5GA 1IMCA 5TGTA 2JA6J 3SZGA 5JFRA 3I4MJ 2CV1A 3I5OA 4EATA 4BEHA 4YRVA 3WHCA 2CQXA 2GIVA 4WF2A 2QSGX 5CVJA 2BVLA 4UUSA 3AG3H 3LQRA 1DU0A 2BY3A 2AXLA 1BTJA 3KP6A 3V5AA 3H0DA 3WHBA 2VJ4A 5IP9J 4OIQF 2HFHA 1VE4A 3NWSA 2Q2AA 3CUOA 3TGNA 3OYIA 4A3EJ 2DQRA 3D4GA 3BG9A 2ONKE 3SZPA 3PO2J 1W1WE 4LB6B 3U9GA 4PDHA 1A8FA 4FJPA 3JTGA 2HVRA 3ZQGA 2I6EA 3IJOB 2STWA 2IGOA 1IN5A 5CI5A 1AOYA 2JMWA 3TP0A 1VQ9I 3DBHB 3CCMI 3DP8A 1TT5B 2DS9A 1MMGA 3G1LA 4GQOA 3CCQI 4L18B 4BS9A 5I57A 5H8NB 2HOSA 3Q27A 4XBFA 2NS7A 2E60A 1IDYA 2LC2A 5F6FA 5BNGA 4ABZA 1M5FA 1NG7A 2RNGA 3QQAA 3QYFA 3ZXSA 3PPQA 3F8FA 3FM3A 4L9TA 4DDDA 3ZP5A 5CMMA 2R7RA 2DT5A 1HC8A 1GR2A 2R92J 4CCNA 1WVRA 2F7CA 3I4PA 1P1UA 2KRCA 2AYSA 2H1KA 2KJBA 4OXVA 4RGXA 2CO5A 2WAQN 1B3FA 1CNQA 3O8GA 1PDAA 3GBBA 1NUZA 2Y7IA 4WCGA 1YAEA 2L5VA 1N3WA 3KZIC 1U5TA 4ZTFA 1AKHA 5DCMB 3NEUA 1J0RA 4DXBA 1R1VA 2MA3A 4BDYA 4HX8A 4B3XA 1P1OA 1DTZA 3K1NA 2GQ1A 3ZQQA 4GFBA 1FQEA 5I3SA 3T5XA 1BOAA 4AD9A 4GWXA 1HKSA 1MY0A 4DXUA 3ABTA 2ZXJA 3Q9SA 4XICA 4I2OA 1I6QA 2REGA 4Y13A 1TL8A 3CC2I 2XDVA 1OMPA 3D5RC 2W00A 3GTMJ 3JREA 1MJAA 4ZZLA 1PB9A 2VD2A 2O51A 4P0GA 4NGUA 1TWHJ 2HVQA 2VPRA 4PGHA 1YG2A 5C44J 4M9XA 1YJWI 2JUCA 2LYCA 4MF3A 3N97A 4C3JJ 5DVFA 4OWRB 4GDFA 2BEOA 3S3MA 2FA7A 5CYVA 2VJ5A 5ET7A 5HOOA 3ILTB 4RPNA 3CUQA 1UAAA 1B2HA 1QKAA 1HSEA 1YXIA 1UHMA 3K00A 4L0YB 4X1BA 1USSA 3I59A 1SMYF 2HDWA 2F5EA 1OCZH 3TEDA 4ISUA 1Z7NE 4UA8A 4L5EA 1MJ9A 2WAQA 3KE2A 3T66A 2R5YB 1JE8A 2Q8MA 1PP7U 3NRVA 1RDYA 1W5SA 1IF1A 2K9QA 4JVDA 4EGYA 4IHXA 1S50A 4BXFA 4PJ0C 1IUFA 3JSPA 3DV8A 3ZQLA 3LSPA 3C35A 2B9SA 3SERA 3L9FA 1WVJA 1PJRA 1SW1A 3LA3A 2W1OA 1HQCA 2YX4A 3DEWA 3FMQA 1SC7A 4BAYA 1H3DA 4R75A 1KQ0A 5J1UA 2IA4A 3H7MA 2QYOA 4E70A 5IP6A 3LSWA 3J7AY 2RINA 2VIXA 3MKLA 4WWCA 4MBPA 4OWDA 5DT6A 2EFOA 2KL4A 4OU0A 4L17A 5EEGA 3CJRB 2PJPA 1LDKB 5AA4B 4DNCA 2R7XA 1Q1KA 3OMBA 1ZIUA 4QPOA 4GVOA 1RYOA 5EHMA 2OU2A 3X2QH 3PIPF 3W6KB 4D7MA 3SESA 3CJTB 1RDZA 2E35A 1YJNI 3IJXB 3CCRI 2GIZA 3G3IA 3U93A 1BOBA 1U0JA 2ISYA 4IKFA 1Y4TA 3QYTA 4BHBA 4Q30B 3A01A 2K4BA 4U88A 2H5YA 4JSOA 5F04A 4OERA 4H8JA 2HAUA 3PD9A 4XLHA 3KP2A 4B3AA 4G8XA 3RYRA 5CC2A 4NN3A 2NOJB 1OCCH 5BUUA 2B65A 3OYBA 2CYYA 1II5A 2EIKH 2WV1A 3F72A 4XFEA 5HLTA 3WG9A 1TWCJ 3H36A 5HS9A 3GX4X 1IXHA 4G6TB 3MPLA 1TQMA 5B70A 2GHAA 3EF7A 2XAGA 3F21A 2CWEA 1XDSA 2MH9A 3HPGA 3PPRA 4I9DA 3JRHA 4RA1A 4F3PA 1AL3A 3CVGA 4KI0E 3DKXA 4JXIA 1N3XA 1Z7LA 4BDMA 2YPRA 4UB6C 2B3BA 1VSOA 1FIPA 2M4KA 4A93J 3WTSC 2FXAA 1JVXA 2M8CA 4P3LA 2V4JC 5I7IA 2MD0A 1RUNA 2QSFX 2CZIA 5DCFA 3GZ6A 2ZZXA 3C33A 3RPWA 2GOXB 2X4HA 1YITI 3VV5A 2F4OB 3TUSA 2VL8A 3ECHA 3RIRA 3UK4A 2FOKA 1JJ8C 3RSNA 3N94A 3MSTA 3O6IA 2HOAA 3GTQJ 1JNFA 4P11A 4A3JJ 5EGOA 4B47A 1JGSA 4FE8A 1YPNA 3VLUA 2M45A 3OO8A 1TWGJ 4KMFA 3GWZA 1KQ9A 3N5LA 5DDGA 2UVGA 3PO3J 1TZLA 2FNAA 4HG2A 3T0YA 1JKPC 1RUOA 1FPEA 2MBFA 2X6XA 4P9KA 1DTGA 4A0ZA 4BJTA 4ZYAA 4RLQA 4IZZA 3FV2A 3ROJA 4YIIA 3E3KA 1FEXA 2XWKA 4OMZA 4CCJA 5JI6A 4C3HJ 5D5WB 4EDPA 1HF0A 2RKHA 5C4XJ 3PMVA 2A6HF 1MDQA 2CUJA 2FMYA 4NHBA 4ESWA 2Z16A 1T33A 1Y0NA 1G3YA 5CLSA 3OYHA 3B6QA 3M07A 4H6DA 4EUOA 4LK1F 5JR3A 1OFCX 3HG9A 1ETKA 1X1DA 5TRDA 1CE2A 2KKOA 4XIGQ 3LQQA 3SDFA 4DIGA 4GYIA 2HHMA 1L3LA 4NX1A 2E1CA 1OYYA 1WFXA 2MW8A 4ZEIA 2PYYA 2A69F 4M3DA 2F36A 3R60A 2EZLA 1L5TA 4UY8I 3H3GA 1FRPA 5LHIA 3A3CA 4XLCA 3OYJA 3LSIA 5I5PA 3SDGA 2HZKA 3OO9A 3I71A 4ENKA 2N8GA 1VQ6I 2WB1N 5EJCA 2B0LA 3ASOH 2HCAA 2QS1A 1AIVA 5GAEJ 1T0KA 2Y0SA 2ESNA 2H09A 2VBWA 4XK4A 5FLXK 3KG2A 1DDNA 1H8AC 3OYNA 3MAJA 3C32A 1BL0A 2IGKA 3FZVA 4QF9A 2F5XA 1NV1A 1FC3A 3RZDJ 5IZ3A 2M9HA 1QUKA 1G4DA 1MDMB 3OSRA 4N6KA 1NV5A 2ZXWH 1NV6A 2OZUA 2F4IA 2KIMA 3K1PA 3CMEI 3IAZA 2IA0A 1MY3A 5E17F 4I3EA 2VQLA 1B5HA 3THIA 3OSFA 3CO7C 5L9OA 3ZQ7A 1H45A 3KBZA 2A68F 1S5LC 3K10A 1YTVA 2L3DA 2Z2SB 2LG4A 3J7AO 2IRFG 3P9IA 3O29A 4G8NA 4IVNA 3MZBA 1W0TA 2A6TA 2LAOA 4CHUA 4F52A 1FTLA 5F64A 1A5JA 3BZ6A 1B7UA 4PGGA 1JTXA 1FPKA 3RYDA 3DPTA 2NAZA 2IT0A 2QLZA 2NVUB 3ZMZA 3HOTA 4DZPA 1TNTA 2KRHA 3G2BA 2DA1A 1KA8A 3RPUD 3IKTA 3DELB 4F31B 1W36D 2X51A 4IGTA 1ZQ3P 3SHFA 2WB1A 2JA5J 4DCXA 2F48A 2HXWA 3CI8A 3AXFA 2HVSA 3HGGA 3OY9A 1JTYA 1B46A 3QODA 3SEYA 2LKPA 4KYDA 2PMUA 3SYTA 1POGA 2IP2A 5J1RA 2Y9YA 1NH7A 2DTZA 5IPAA 4G8MA 4YMBA 3DFGA 3FMSA 5D8LB 2ZXTA 4F3QA 2X1DA 2OWTA 4YFXF 4P8BA 1Z77A 1J1NA 2A5WA 5EQAA 2ABHA 3M3FA 1LBVA 1RKTA 5LDZA 4BDZA 2DO7A 4QRZA 2BZTA 3OYKA 2Q88A 2FNCA 1Y20A 2J5PA 5EYGA 5I59B 1RKMA 4JQFA 4KCDA 1QZYA 4F92B 5AE4A 3S2HJ 5FKOA 3QPLA 4IY6A 2WV0A 4S0HB 3MUQA 3EUHA 1R5ID 5CQGA 2IBDA 1FPLA 1FTJA 4ON0A 2D45A 2XXVA 4JSDA 3G4SI 4PFUA 3JSOA 5EEHA 4EM1A 1LLSA 4PJJA 5FLMJ 1N78A 2NNNA 1BIAA 3TCFA 3QIMA 2XB0X 2Z8EA 1YYZA 4DI3D 2GLOA 1VQOI 5L8DA 4LIUA 1WJFA 4G68C 3QP6A 3BJ6A 2O03A 1F9NA 5K5OA 3E6DA 1LFHA 1KWHA 1TBXA 3CDLA 2CGPA 4HF2A 1USYE 2JVHA 2QJEA 3LBSA 4MJOA 1UTBA 3TFLA 4KN7X 2X9DA 3DLAA 1W7PA 4Y15A 2XB5A 1FQDA 1LBWA 2AIXA 4N8GA 2F4MB 2HYFA 3K2AA 1TWFJ 4I09A 4XM3A 3WGIA 2X0LA 2E7WA 1ORKA 1KU9A 2VASA 4CA0A 3WTTC 4P96A 5L3CA 3K6VA 5I2KB 3LV0A 4M73A 4KITB 1D9VA 1PUFA 1M5BA 2PBWA 2UXAA 3HPIA 1TQPA 2A6EF 2F3BA 5GTHC 3H5RA 5J8FA 2EFPA 4XORA 5EG0A 3IOTA 1K61A 3FXOA 3LSLA 4Q5TA 3TO9A 2QBYB 2Q9TA 5IT3A 3BQYA 4C1UA 4MEXF 4IO6A 2R6GE 1IC8A 3UORA 2HEUA 4UVCA 4HE1A 3LR1A 1WPKA 4RB2C 4O3CA 4PE3A 2ZO4A 2NVQJ 1AHDP 3HN0A 3TKDA 2L01A 1YOVB 2R7UA 1SVXB 3SZTA 1FQBA 1A04A 2Z99A 3JRIA 3VWBA 2OZZA 2PFBA 1HXDA 2KLOA 1JKRC 4MX6A 3DTIA 1DPUA 4CSWA 2KPMA 3HXLA 2W24A 1YW9A 1IRZA 1Y3QA 3TODA 1OCOH 3W2VA 2E5ZA 4TQUQ 3QUFA 1SYIA 1RIOH 2Y69H 3G3FA 4QSCA 4ELQA 2PFZA 5EZGA 2HXOA 5J8CA 3KEQA 3OYDA 3F0CA 4I8CA 2Q2CA 2OF7A 5KAIC 5JHFA 1Y1WJ 5ILSA 1EF4A 4MTEA 4JP0A 3K4MA 2CEXA 2DA3A 4M3EA 3ROUA 1A40A 1IRFA 3I6VA 1FP1D 2DYSH 4A3KJ 1KYWA 1UG0A 1D9YA 4NG7A 5F1QA 5KCJB 1I3QJ 2OPTA 4KJZA 4UUVA 3D5LA 4LLNA 1E0EA 1MNEA 2DVZA 4ZYEA 2HZLA 4MFIA 4POXA 5K2XA 1BW6A 2HEOA 2HDCA 1NI9A 1B59A 3AKZA 3ESWB 1XGNA 2F2EA 4B8XA 3TKYA 1IMAA 4RJZA 2BW3B 1O57A 3CESA 1Q9DA 1HSLA 1GVCA 2ID3A 4L5JA 3PPPA 4CICA 4BYYA 2VLAA 1D8JA 2YX7A 2AL5A 1XGSA 3Q29A 3IUOA 4IF4A 4PUSA 1YRNA 5HLGA 4D0PA 4RAZA 2L5QA 1US5A 4OVJA 5A2QK 1P1QA 1ETYA 2DN0A 3WTUC 1IW7F 2STTA 4ZE8A 4XXUA 2VE9A 4P1WA 1P7IA 1PB8A 1R5HA 1MBHA 4XLNF 3CR9A 2L54A 1LAGE 3PUYE 3KYCB 3RPUA 3U8QA 2VQHA 4PGNA 4X6AJ 2HZTA 1N04A 2DDKA 3S9EA 2G9WA 1BJZA 2OQGA 4I02A 3W2WA 2DBBA 3M9AA 3MZ8A 5HBCA 2HKXA 3CDHA 1B72A 1IXIA 2DK8A 4MLOA 4KDPA 2ZNSA 4EVIA 2V9PA 3FIRA 4H1XA 3OR1C 3ZGKA 4LUBA 4IPAA 2WY7Q 3ECOA 2LY2A 1Y39A 4M3GA 2R7VA 3GEZA 1MM6A 2FBKA 5LEKA 1MQHA 2ONRA 3OO6A 5DEQA 1SAXA 4A5MA 1ETOA 2FBPA 3IWZA 4ZZEA 4O94A 1UELB 2HQNA 3K0LA 3FXKA 1N77A 1HOMA 5IT9K 2K3PA 2VODA 3UGWA 1DSNA 3MC2A 5H8QA 3PU5A 3PUFA 1BBYA 2M3AA 4LLLA 5FHMA 4RGUA 2ZB9A 4GWZA 2LVSA 3RKQA 2DPDA 1G3WA 3BR6A 3M8UA 1YS6A 4RM3A 5TPAA 2DTRA 3PTYA 3CMAI 1XDUA 3F3XA 2QPQA 4GX3A 3FXBA 2XASA 1POY1 4QSEA 1DGWY 1FTKA 3SETA 1VTNC 2EA4A 1OLTA 4AM3A 2CQNA 3M7GA 2M7AA 4B43A 1SEUA 3PUXE 5CM6A 3RTRA 2DA4A 4N91A 1S9HA 2TDXA 1WH5A 2L0KA 1P6RA 1MJBA 1TFDA 2KZVA 2ELKA 5BQTA 1QJMA 2XXIA 3GTOJ 3JTHA 4GWUA 5IZZA 4PBHA 5J1YA 4XLPF 3OOAA 3F8NA 1T8IA 2X6WA 1IN7A 4UVAA 3TYHA 2MKZA 4XMYA 2XUBA 3F9KA 2BYVE 3DP7A 2DYRH 4OMYA 4NF0A 4AC0A 3K01A 4MLQA 3TMGA 3HRSA 2IGNA 4MIMA 2OZ6A 3UN6A 2DOAA 2A3SA 1YHQI 4GWYA 5LEJA 2ESHA 5F08A 3J81Z 4IO7A 4II3A 4EQQA 5M3MJ 2P2AA 1LFBA 2CQ7A 2H9BA 2ZYOA 2ZBKA 1O3QA 2LMDA 1O7FA 2VOOA 2O68A 3ZKLA 1V5GA 2LF8A 3LSGA 4FHTA 3GYHX 4I76A 1UTHB 1RC9A 2O1MA 4IQ4A 5IM2A 3KSJA 5TISC 4RDUA 2ETHA 3MZYA 3H92A 5GPCA 4I40A 2FHYA 1K6OA 4NC7A 5EYRA 5D4SA 2P5LC 1A6IA 4A3IJ 4LG3A 2K02A 4A3MJ 1B8IA 4CGZA 3IR1A 1D3YA 2XGEA 2XXQA 1F36A 3GXAA 4HX7A 3BPXA 2IS4A 1JQFA 2Y7RA 5CBRA 2OCEA 2CFOA 1MSFC 2KZGA 4F3BA 2E0SA 2M0CA 3H9GA 3KIOA 1REPC 1FTMA 3BCBA 4R9FA 3KBRA 4MH5A 3SEVA 2FF4A 2DWAA 4FX0A 5ISUA 3DBRB 3HB9A 2JA2A 3E5XA 1BIBA 1DGRM 4HV6A 5F7VA 2R3SA 1U6GA 2COMA 5DTDA 3FD3A 5B1AH 3TQLA 3VFJA 3PD8A 4KYEA 3W9WA 1LCTA 4FX4A 1QHGA 2QS4A 4HDVA 2RN7A 4Q4ZF 4P9UA 4A3BJ 4O7IA 1OCTC 2VT5A 3W9VA 4ZE9A 4EV0A 2A5YB 5KVRA 3JYRA 4F1VA 1DOTA 2CV0A 2X1EA 1NKXA 1QHHD 2W7YA 3GVAA 2P5KA 2DSFA 4HV5A 1R4NB 1HDDC 4IQJA 4CYCB 3H3ZA 5F0CA 5KK1A 3JV9A 3CZ6A 5A2QZ 1MS7A 4MNPA 3FXLA 1XI6A 5I84A 5IGAA 4GWWA 3MZ1A 1QPMA 4HX4A 4EJWA 1TNSA 4YELA 3RGYA 3TO7A 1MQIA 3GZ5A 5DYMA 1P1WA 1R71A 4OAYA 2VONA 1I6HJ 2P1SA 4BY7J 2J5OA 2B63J 5J47A 2WX9A 1JKQC 1BJAA 5GTIC 4H0WA 4HCWA 4XEQA 5ICTA 4PFBA 1SFKA 3FDYA 1SVMA 1UIUA 1YLFA 2XSDC 1N7WA 3BP8A 1LBBA 2DT7B 4NQWB 3ZMVA 3H5AA 3O97A 1VNDA 2PBIA 2WWYA 3W3CA 2R71A 2PQ8A 5ET6A 3VODA 3TMOA 4IR8A 1CQTA 2MGQA 4TV7A 2OLBA 3FGSA 5H8HA 4F22A 1G3SA 5J4VA 4IHTA 1SD7A 4GCVA 1X2MA 4YB7A 3U72A 4LN5A 5IT9Z 2KIUA 3RT8A 3R7XA 3AAFA 1INPA 1B9JA 3ABLH 1K4SA 1VR5A 2M4GA 3IFCA 5EYHA 3U1OA 3L6GA 4HE2A 4U1ZA 5DEXA 2XXKA 4IOAF 2I4BA 1UZCA 2EFNA 5BOXA 1IUYA 1MZBA 2EV5A 1FY7A 2H1LA 1AH5A 4HPQA 5DUKA 3ECRA 2C6YA 1S9TA 3VVDA 2M87A 3KP4A 3OSQA 4NF4B 2ZXIA 1ZRFA 3GLBA 3UIFA 1MDP1 3VDFA 4OQOA 2Z33A 2Y30A 1R6ZA 3K6XA 3KEIA 1SI0A 4QIWN 3KFWX 3C18A 2VJIA 4HA8A 2ICWG 5LLQA 1ZRDA 2DMPA 1ZTRA 2JTVA 3HOWJ 2REJA 1WJEA 2MH2A 3RNNA 4XF5A 2OV7A 1SI1A 4FAJA 4JX4A 4R2FA 1XT8A 1I1SA 2ZC2A 3CQZJ 4RM2A 1OQHA 3T93B 3EUAA 5E20A 5E18F 1J75A 1GV2A 1X3WB 2KP6A 2VP1A 4PF6A 4F29A 1YCJA 3Q26A 1NV0A 4P1LA 2VKEA 4TOZA 3HHHA 4IHYA 2H27A 4KICA 3H3UA 4FORA 3O6GA 1HDPA 3SEZA 3ZR8X 5E3OA 2LY1A 5EEAA 4P0IA 2R7FA 4IY5A 3TPAA 3L1PA 4N4UA 1NNTA 1JHHA 3B02A 2R93J 1S6LA 3EDPA 4UHTA 3F22A 4N9IA 2LF7A 1QPIA 4OESA 1FBFA 4U87A 3U21A 1B9NA 1H44A 5I58B 1XSXA 4Q48A 1EA3A 5D8KB 4NUBA 5CMKA 5L3EA 4I0BA 2UVHA 2PMSA 3VYTB 3JAMZ 2EV6A 3LUYA 4RBOA 4G9YA 3MVPA 5F1RA 4I3YA 3HJEA 1KA0A 2OBPA 4PJLA 2CZHA 4OENA 1B58A 2D1HA 1NNPA 2WEFA 3DPUA 3GBAA 1E17A 5CMBA 4FBPA 1R49A 2E34A 4G68B 1LVKA 2L7FP 2ALUA 3RTWB 3ZN1A 4OFJA 1XSDA 1XPXA 2BHZA 2FBIA 4UVBA 2FA5A 3ZMSA 3I0TA 5J6XA 1I50J 2EFWA 1NMUA 4MCOA 3MW0A 2O8KA 4G6QA 2QUFA 1PUEE 4XL9A 2CV2A 1SQYA 3NARA 2ZYKA 5B7DA 3IL2A 1KGSA 1RNLA 4LVQA 2JQ7A 3M8JA 1FPIA 1Z0XA 2G0EA 4D9JA 4MTDA 4KMUX 2ZYMA 4YMAA 1IZ1A 1ODDA 2ZMEB 1U8RA 4A6DA 1BR4A 4UUTA 4DYRA 3EQLF 4N9HA 1VQ5I 4NC8A 4PCQA 2IS2A 4PETA 2CZLA 2O69A 4OVRA 4ZEFA 1ZKBA 1HBXG 2Z3YA 3EHSA 4LOCA 2VT3A 2KHMA 3BDDA 1KZHA 1IMFA 3T8TA 4AS4A 3HOUJ 4DYCA 2DMQA 4B4CA 4DCYA 2WBDA 4RAFA 3JZJA 4GRIA 2IA1A 2GOMA 1FQAA 1MQDA 3MQ0A 3OIPA 3PIOF 3GUDA 1FTTA 3C31A 1NUYA 3I58A 3C4MA 4FATA 1LJ9A 4GYGA 1BI2A 3U1KA 2CSOA 3IO6A 3KFMA 4L9VA 4M6VA 2EK5A 4U21A 3HL2A 2VC0A 1VQKI 3HTSB 4N8YA 1PP8F 1FMVA 3HUGA 4Q8RA 2XA5A 1SW2A 4OVTA 1I3AA 5KCMA 2AQFA 4X9TA 1FPQA 2AQEA 1MXXA 3ZQHA 3OOUA 2O61A 4HF0A 4PFTA 1FBUA 1K6YA 4YKKA 2GQQA 1SVOA 3GMEA 5HLIA 2K86A 3B6TA 2CEYA 3TTKA 1S7OA 4MNIA 4PCDA 4M6XA 1JJ6C 4O7MA 4BH9A 2YUSA 4DW6A 4X48A 4D7NA 2JSPA 2FYIA 3A4CA 3CO6C 4UV8A 2E7XA 2BBYA 4FT8A 5LHGA 1URGA 3CDIA 1USYH 4YZZA 2Q1ZB 3CJNA 1DBZA 2NOGA 4E7JA 5KDTA 2L7MP 2I10A 3WTVC 4BDNA 3AFHA 2F78A 2CMOA 4DI4B 1SFXA 3D5SC 1SW5A 3G3JA 4DZJA 1B0HA 3RKYA 1JEVA 2IS6A 2EIJH 4N07A 3BTLA 3BFUA 3MFKA 3W15C 1QZEA 1FBCA 3FXQA 1B3EA 2PJRA 5GAHJ 1B0LA 3DF8A 3LSMA 3V7RA 4U0WA 3T9XB 4HSTA 4OEVA 4ECFA 4PBQA 3DBLB 1KU7A 1T0FC 5JLWA 1TWYA 2F7AA 1GV8A 2GFEA 2GXGA 1JT6A 2XV4S 4KYWA 1O63A 3HTUA 6PAXA 2ANJA 3MVYA 2V4CA 3BCAA 2CW8A 2F35A 2QVUA 1WSUA 2LNBA 2L9SA 1V5FA 1ETVA 4G6DA 1D4NA 4ZJZA 2V26A 3K2ZA 3D1NI 3EETA 1TT1A 3VDXA 3L2UA 2UVJA 3WG7H 2MYSA 2HTSA 3FM5A 3BZCA 2GBYA 4O3MA 3AL0B 2GH9A 4F18A 3DEUA 3V7SA 4RPOA 4QTRA 1FBHA 3LFKA 1E3OC 1FX7A 1I1GA 2BY0A 2E1MB 2KFDA 5FFXA 1F9BA 2HOEA 3V7CA 2UYFA 3B6WA 1YO5C 1H88C 3BIHA 3K4JA 1DPRA 2IJLA 3P9CA 3HOZJ 3FVOA 1VI0A 1Z7ME 4K3FA 4CCLA 3E6CC 4U0YA 2NS8A 4AWXB 3FJMA 1CF7B 2Y5LA 4FEDA 2WTEA 3MVWA 2ZXHA 2R7DA 2UWMA 3BBRA 3BR3A 3KP7A 3T9HB 3KN8A 1W5CC 1HA8A 4OHNA 2F8DA 3VSLA 3S2VA 2LSOA 4FEBA 1U78A 3MWBA 4W97A 2ZZVA 3EKIA 4LMYA 4NE4A 4XRSA 5JEIA 1TWAJ 2XWVA 2G7UA 3LA2A 1G0HA 3BFTA 3D4CA 5H8NA 5KHDA 3A09A 2XF6A 3VLVA 4CO8A 3L2VA 1I5ZA 1O3TA 4G68A 4U2RA 1Y1VJ 5LRRA 2BY2A 3I64A 2E36A 5FO5A 3OS0A 1FP2A 2LBFB 3SEXA 1MBKA 3WAFA 4N4OB 3T1BA 1PEBA 3FJGA 5AA1A 2V6CA 3Q0UA 1B3LA 3QPTA 1ERDA 3N6UA 3Q25A 3J80Z 2M8GX 4EJUA 3LSTA 2R5ZB 4ESXA 4JDFA 1ZLJA 2DDBA 5B3SH 3K7AJ 1AU7A 1FCKA 2RF1A 4ZYHA 5DCMA 5D4RA 3TELA 3H9JA 1ZN2A 2ZSIB 4XN0A 1FYLA 4IO2A 4IHVA 4G61A 3WTZA 5L3DA 5LGTA 1BIYA 4GF8A 1U2WA 5LBQA 1M5CA 3O66A 1X4OA 1R9QA 2O7UA 3BR1A 3ONQA 3QOPA 2MC4A 2CMPA 4KFQA 1UHSA 1B4ZA 4ZEKA 4C1TA 4EQBA 1B5IA 2LFBA 4GRKA 4GBWA 4KISA 2QWWA 4MMPA 5L3BA 1ITYA 3DQVC 2GRVA 2AS5F 3VVEA 2EB7A 4MO7A 3B6CA 3GXOA 1URDA 3DEEA 4N6DA 2B7EA 3I9V2 1U9NA 2WAFA 1IDZA 4JVCA 2Y0SN 3IH3A 4LQ2A 3M8EA 1BW5A 3CF2A 5E8GA 1XN7A 2F7BA 2ECCA 2OJTA 2IAIA 2Q0OA 2O6GE 2B3FA 2I0CA 1LB8A 4EJTA 3M1EA 4G12A 3T9UA 3PFIA 4DJAA 2Q74A 4F2QA 2DWHA 3CRBA 2V3QA 5FRMA 1FQCA 3PL8A 3R6UA 2FU4A 4ESBA 4NDLA 4GL8A 2ZZWA 2GXBA 2E1NA 3AG1H 3E6MA 1LEAA 3HPHA 4Z7EA 2R5YA 1HW5A 3TO6A 2I0BA 1IV6A 1DPEA 3BPVA 3MKZA 1IQ7A 1GTKA 2XC7A 1B40A 1NV4A 2QENA 4PJMA 1WQ2A 4C2TA 1SPIA 1Y3PA 1E3PA 3TTNA 2VQGA 4ELPA 4KUMA 1D0ZA 1QZZA 1RESA 3LNQA 3ZQFA 2V3TA 4ASNA 2ZNTA 1LFIA 3CMYA 4M3BA 4Z2YA 5IP7J 3K2DA 4RK9A 2DODA 3OSGA 3ZOBA 2X6YA 1B3HA 5TP9B 1YQAA 4BBRJ 4H8IA 2QM3A 2XD2A 3KLOA 4IO9F 5AA4A 3S4UA 3SQNA 4XLEA 4QFNA 2P0SA 3CFZA 3HYIA 1LNWA 4H0EA 1YIOA 4R8HA 2IA2A 3TAJA 1LPQA 4AQ4A 5FD6A 3SEQA 1HKTA 3IP4B 1ZREA 1JXSA 1FYMA 2P3VA 2QEXI 3IV5A 4LITA 2M7BA 1Z67A 5K7ZA 4L0ZB 2R7TA 1ZAOA 2DYXA 1E3HA 1GDTA 4XKPA 2QVRA 3MZHA 1YI2I 2R7SA 3FUZA 3QYBA 4CUGA 3JRGA 3G71I 2FQ3A 2HR3A 1YIJI 3FKIJ 1S29A 4ND9A 1BA5A 1TFAA 4FTHA 3I5UA 2H98A 2Q2EB 4I01A 2K5CA 3TZAA 3MD2A 3WTXC 1NNKA 3E6BA 3D0SA 3H1CA 2WYPA 3JRAA 3EHUA 3PMXA 4H46A 1K9YA 3S3OA 3QK6A 1BR1A 1Q1VA 1Y4CA 3H4ZA 1IXSB 2G7HA 2P5VA 1A6QA 2V1UA 1N7XA 2QVVA 4GIZA 1Z3XA 1U8BA 2Y2ZA 2KIQA 1MBEA 2WKYA 3D1RA 3A0HC 5L9SA 1Z7UA 3C7JA 5FBPA 2DA7A 2H6BA 1GV5A 4MEYF 4WEPA 1FPGA 3PM1A 4U4SA 2HQRA 2CUFA 1ACIA 2JUGA 3N4MA 1WZ2A 1OLAA 3FISA 4GLIA 3O9PA 2VJJA 2QGUA 3KPHA 4QLCU 5B66C 3DCFA 2CQKA 2YPNA 4BJ6C 3FF5A 3OV8A 3REOA 1XHYA 3HOVJ 4I7HA 1ZELA 4G7HF 3T9VA 1X2NA 2MG4A 4NF8B 3OL3A 3ABUA 2HPGA 4AB6A 2ZMBA 3T0JA 1EKEA 3AG2H 1QVSA 3UP9A 3L09A 1ZGAA 4JVIA 1T56A 4R79A 2XD3A 3LL7A 2DAOA 4C2UA 4ZC3A 1BC7C 4OETA 5H8SA 4R74A 1PC3A 3B7DA 1LSTA 2FUG2 2MABA 3N6TA 1R36A 4L5IA 1P4AA 1UB9A 1QVTA 4PSXA 1A36A 2XX9A 1XOCA 2YJPA 3FVNA 1B51A 3CFLA 5H8FB 2VXZA 4YKJA 4XSXF 1VQ4I 3PNTA 2ZMEC 4GBVA 1MMNA 1MXYA 2XXTA 2A61A 4O5VA 2YR2A 2VBYA 3OS2A 1SFUA 1XVXA 4R6HA 4NMYA 1VFCA 1NUXA 1H76A 3ZSFA 1IN8A 3H5NA 2EZHA 3I56I 3KYDB 3SJMA 3QP5A 4A0YA 3O2AA 4GWSA 1LE8B 3E9XA 5HLHA 1XVYA 2XAHA 1MQGA 3VEPA 4IO3A 1J7KA 3K4UA 4KCCA 3CCJI 1MSEC 2X26A 1VF9A 2QF7A 2W85A 2JJ7A 4E7ZA 2JSCA 3KP5A 4LB5A 1YFHA 5CRYA 1STZA 1LVAA 4BXXJ 3AG4H 2V7FA 2ZKZA 5CKTA 5IOZA 2BVMA 4M3FA 1I6AA 1K9ZA 1SDXA 4A6EA 2D2WA 1MD0A 3BROA 3WTYC 4A2UA 1G59A 1HCRA 4IRHA 2UVIA 3NOHA 4EXKA 2CUEA 1NV7A 1NV2A 1SYHA 1KONA 1I39A 3FXRA 5JVTA 1OVBA 4OYVA 5I56B 1GT0C 1WRJA 2F5VA 1DU6A 3IB2A 4PFWA 4G94A 1V55H 2BHYA 2XWIA 5E3NA 2V1DA 5FKMA 3S8PA 2LKXA 2HYGD 1DCUA 1NH8A 1R4MB 2EINH 1MDMA 3J81K 2B4LA 4HCYA 1ZLQA 3PJRA 2E2HJ 4GXOA 3RI4A 3GTGJ 3IB0A 4U4XA 1O7TA 3VSKA 2DE3A 3Q0VA 3OYFA 4IXAA 4DBRA 2P6SA 1IJWC 3DKYA 4WXDA 1D9QA 2YU3A 1FBQA 5H6RA 3A29A 3K4KA 1ZJLA 1HSJA 1L0OC 2EIMH 2LH9A 4ETSA 1JW4A 5A5LA 4DYQA 3QRFF 3B6AA 2DLLA 4XLAA 5L3GA 5LD2C 1AWBA 4XKRA 1EJ9A 5BPIA 3IAM2 1DMBA 3IH4A 3BTJA 1K78B 2FIXA 4HNUA 1TQIA 4LONB 2FMLA 1F43A 5KNLA 5HS7A 1Z3YA 1DPPA 5AA2B 3IHUA 4G7OF 1ANFA 2DE2A 4XIDA 5J16A 3USDA 1ZGWA 3R26A 5K7FA 2VBZA 4BGDA 2DP8A 3RPLB 3SFZA 2VD3A 1CB6A 1FOYA 2Y5KA 4CZCA 1EZ9A 1QU3A 3KJTA 2KQZA 1ETXA 3FBNB 5DD8A 2O7IA 1QRYA 4FQGA 3OEMA 2GZWA 1OQYA 2JRTA 4RA2A 2PN6A 3EPZA 3I54A 2G29A 4B1RA 4AYBA 4RGRA 3AL0C 4KIFA 4MGRA 1W0UA 1UG2A 1YJ9I 1A54A 1FT9A 3FIWA 4H5FA 3ZMUA 3TCGA 4U0VA 1MPDA 1XSVA 2E1MC 2LR8A 2QKMB 1MMSA 1IV8A 3CJQB 3FWEA 4B09A 2RAEA 2DOEA 2HI3A 3G3ZA 2F6GA 4GX6A 1BI3A 5I59A 3HBLA 1IXGA 4E6KG 4ZZAA 2QQ8A 3F8CA 5FKNA 4OINF 2PCRA 2E5NA 1ZK8A 3CP8A 5CMCA 2Q8JA 4LATA 3U65A 4NC6A 4OTEA 4F1UA 3V83A 1FTZA 4BL0B 1B6AA 1GHCA 1QQIA 3EYYA 3OELA 1YZ0A 4KIGA 1XGOA 1S3JA 3DP4A 2CUZA 4KIBA 4QFOA 1OKRA 2THIA 1K7AA 1WI9A 1DK4A 4PFYA 4QFPA 3O2PE 3CP2A 3DP6A 4UXNA 3E4RA 1FBDA 2BE5F 2HTJA 3SDBA 5HDKA 3K70C 2GA2A 1E2XA 2OD5A 2QZ8A 3K02A 1FBEA 3KOSA 4XN3A 3BJAA 2UUZA 1LFUP 2XKPA 3E78A 5ICGA 2IXSA 3MWMA 2H99A 1NNFA 2LP0A 2Y7WA 3KN3A 2RNJA 1LGBC 2RKMA 1LFPA 4ENJA 2XAUA 2BGCA 3I55I 1A55A 4R72A 3COAC 4QSDA 1OJLA 4WK8F 2M34A 2D3IA 3K6UA 3QU3A 5I2KA 1OLCA 5I56A 3QSLA 2CH0A 2DW4A 1GUUA 3PPOA 3MEXA 2ISZA 2MLGA 2XHDA 5EQ7A 4H45A 2AO9A 2LLKA 2AXTC 2I5UA 1MPCA 2LDUA 2RVCA 3IX1A 4E0XA 1V4RA 5E3MA 2QBYA 2OJED 1TP4A 1VDWA 4GOTA 3WAEA 4F19A 1BR2A 2WADA 5T3JA 4AIKA 4POWA 2PX1A 5M3FJ 3TL4X 5IYBJ 1W4MA 2QRYA 3S1RJ 3KZYA 3O6HA 4ZH4F 2JRMA 3GO5A 2L7ZA 4DIQA 5B1BH 3ODBA 5LOMA 1IEJA 2NNYA 2YS9A 3VOEA 3GTPJ 5FHOA 3H6VA 2K3FA 2VKDA 2VC1A 4PAIA 2FIEA 5DTBA 4PQJA 2XWOA 1R00A 3IORA 4WX9A 3BTCA 5JTYB 4PDDA 2A07F 5LGUA 3S93A 2F5DA 5F1JA 1FWZA 3WGGA 3Q5FA 1XS9A 4RGSA 2QMWA 5LRSA 2V93A 2HDDA 4IX7A 2XXUA 4R2BA 3CCSI 4QBAA 3LUZA 3JAMK 3H03A 1NH3A 2KMUA 3RDIA 1M5EA 5AIPA 5ITPA 3H6TA 1Y3NA 5GP9A 3OIQA 3GZNB 1FPJA 1VQ7I 1P92A 5IZ1A 1RRJA 3FATA 2P81A 1MNMC 2RREA 5KCJA 1IXRC 2Q8KA 1KU2A 4P55A 3WE2A 4UACA 3ZN0A 1HKQA 5D5UB 5F0FA 3NWTA 1QW0A 2I3WA 5HM4B 1FNNA 1XMKA 4XKBA 3A2KA 3P7NA 5GAGJ 2BW3A 4MEVA 3QXMA 4NF6B 2HXIA 3N05A 3BKIB 1IMDA 2VKHA 3GTLJ 1B7ZA 1NHAA 4L9JA 2KIFA 4HAMA 3ZQCA 2VUMJ 2RQPA 4DQ2A 4NHJA 2A5TB 3S3NA 5F24A 2FQ4A 2XHKA 1IGNA 3RZOJ 2OX3A 5A5XB 1FPDA 1OISA 2W25A 3F6VA 4CXFA 4XRMA 4P47A 3BG3A 4CYDA 1EYJA 1MM7A 4F2OA 2ZJPF 2DQVA 4LLGF 3FK7A 2DA5A 2OAZA 1D5VA 2PT1A 3DKWA 1FBPA 4DZ1A 3MAMA 4FE4A 5HS8A 4OMBA 3PUBA 4AU7A 2I58A 2NVTJ 4KYSA 3U92A 4LFUA 4IL6C 1T0FA 4BEHB 3S16J 4JOMA 4BQQA 1MRPA 3GCMA 1Y8RB 4UUSB 1OR7C 2E2IJ 5FKKA 4OAZA 5M2VA 2BXZA 4AS5A 2ZNUA 2FBHA 2CU7A 2GA1A 1LQ1A 1QBJA 1TTYA 1JUMA 1LB9A 1PYVA 5C4JJ 2VPNA 1RDXA 2XRLA 2AHQA 2DFEA 2NXNB 4WXHA 4KNYA 1FJ6A 2K40A 3HM5A 2LK2A 4HEA2 1Z91A 5CVVA 3ERED 3BG6A 2HQ0A 3ASNH 1APLC 3EPEA 2Z23A 5B5EC 3K4BA 1LUJB 2OUMA 2K7LA 3OL4A 5M5WJ 4E7KA 5FHNA 1PB7A 4Q5SF 1O64A 1SAUA 1N75A 3F23A 1DQUA 1D5YA 3U94A 2LD5A 1ZU0A 1X1AA 5DVJA 1LCFA 5I57B 2Z9OA 4A3LJ 2XPUA 2DMNA 3CMMA 4ZYGA 1HW2A 4X8RA 2JK3A 5L3FA 5TU0A 3QUJA 1LEBA 2O1LA 1OQGA 4M1VA 3KGCA 4WKMA 5BWJA 3LMMA 3HEFA 1MGTA 1MBJA 3K4CA 3PQKA 1MXVA 1YW7A 3FHNA 5TJJA 2DA2A 2JN6A 3K4NA 5BS6A 2ACJA 3LSKA 1X1PA 1ZGJA 3OO7A 3BC8A 2RC7A 3K69A 2XPWA 3OYAA 3QWLA 4S04A 1ZG1A 4P9FA 1U5TB 1AKHB 1UIVA 3KZZA 1X4PA 1RETA 5CJ9A 4EM2A 4EMSA 2NVXJ 4XSZF 3BR0A 1ZTYA 5CVRA 4H65A 5EHSA 3BTIA 2XAQA 2PI0A 1N0TA 3NQOA 1VQ8I 3FHZA 3ERMA 2VGQA 4F1YA 1ZG3A 2D5WA 1UTHA 3I53A 4J01A 3IWFA 3VLWA 3GTJJ 3FXJA 1XG1A 1K83J 3S1QJ 1A8EA 1KU3A 2EQRA 4PZJA 1FYKA 3UKGA 2HPMA 3QU6A 1LBZA 4OVPA 1WHUA 4M72A 3IH2A 3CCUI 1LDDA 4A3FJ 4BKXA 4F91B 4FECA 3DU5A 4A3CJ 1EU8A 2RCBA 2MC3A 1A35A 3E3VA 1WGXA 3C1DA 1BKAA 3CC7I 2RGVA 4HZFA 4LQ5A 2CW0F 1GXPA 1QGPA 4RMNA 3RTFB 1NFTA 3ZRGA 4HW8A 1WI3A 4BE1A 3CG3A 1IO2A 4DBQA 1RPWA 1QUIA 3CUQB 3E13X 3TP3A 2UZKA 5HNHA 5JVGF 3SXYA 2W7NA 2PLYA 2DWIA 3MQ9A 4HXVA 4OEUA 3OYCA 1FW0A 3DWLE 3CTAA 4YAHX 5DW8A 5JHUA 3I59B 1ZH5A 2QKLB 4X1DA 5D5VB 4MQVA 2O8XA 5KAFC 4X0GA 4BQAA 4NEDA 1LKXA 4TLLB 1T08B 4HE0A 4GXSB 4YB5