3K1NA

Crystal structure of full-length benm
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 88
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1nA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA03
1Z9CA 3QAHA 5CI5A 1B5JA 1T2KA 4N9IA 4QFPA 2YX4A 3TZAA 2I48A 3HO7A 3WTTC 5AA3A 4PP0A 4NHJA 1IW7F 3LSFB 3EQ1A 3DF8A 2ZNTA 3EF7A 3IHUA 2O8XA 3IORA 1LGBC 3SXYA 3N6TA 1M5DA 4MGRA 5E1WA 1QZZA 1LCFA 1OLCA 2ZNYA 2RKHA 4MFIA 5LOMA 1B58A 3GZ5A 5K5RA 3Q28A 2IP2A 4IXAA 5HLHA 4NF8B 3ZPLA 4ENKA 3C31A 3LA2A 1GV8A 1ZLKA 4PGGA 3F6OA 2O1LA 4G77A 1YTVA 1L0OC 1U3EM 4LG0A 4RGRA 1B6HA 4OZ9A 1GXQA 1ZTYA 3C32A 2PJPA 2NWJA 3UORA 1B1HA 2GWRA 1I6AA 1MQGA 1J2XA 3QRFF 4U4XA 3CVGA 3THIA 2JT1A 2FA5A 3B02A 4F3SA 1B9NA 5ICFA 2FBKA 2ONKE 3DP6A 2GAUA 4JWOA 4F29A 2A5SA 3LSTA 5F7VA 2WTEA 3N6UA 3IB1A 3T93B 5EEGA 4EF2A 2A6EF 2ZNSA 3M3FA 4RA1A 2ZXJA 3ZKLA 2XXWA 3KP3A 3K69A 3TGNA 3U1DA 5KDTA 3H6UA 3D5LA 4XBFA 3JTGA 2HAVA 1WQ2A 4HLYA 1IXCA 4E70A 3TCGA 2QS3A 4HF2A 3R6UA 1QKAA 4RK9A 3FM3A 3TPAA 1N7XA 3K2DA 1VSOA 4HZFA 3E4RA 4I1DA 1E2XA 2XXHA 4HYEA 4MEYF 3QOPA 1E17A 2I49A 3FZVA 3SDFA 1DTGA 2FNPA 3V89B 1Y3NA 1BBYA 1OYWA 4I7HA 3CR9A 1SAXA 4I2OA 3VXBA 1ZU0A 3FD3A 4EDPA 4G8NA 4EV0A 5TU0A 1RNLA 2Z3YA 4RGUA 4TOZA 1YS6A 4OXVA 5HS7A 1ZIUA 4WK8F 4KA4A 4F18A 4JSOA 3QUFA 2F5EA 4UXNA 1A8FA 1R7JA 3HTUA 3FUZA 1ON2A 4HAMA 3HSEA 1Z6RA 2RF1A 1NFTA 4R2BA 3QP5A 1PP7U 4PFUA 2YPNA 3WAFA 2Z23A 5L9MA 4RYAA 5ICGA 4ON0A 2EFWA 2NXOA 3MVYA 4YB6A 4KMUX 3FASA 3UGWA 3FXQA 1FQEA 3SKPA 1Z05A 4ENNA 1YPNA 3TAJA 3TYHA 1A8EA 3VEPA 1MS7A 3MZ9A 2PT1A 5I58A 2P6TA 1WKMA 4XKRA 1R36A 3ZSFA 3LWFA 3WE3A 4OMBA 4Q30B 2A5YB 1A55A 1SD3A 1J1NA 5ICEA 1Z7NE 5JTYB 2VC0A 3IKTA 4KMFA 1MG1A 3FJGA 3O28A 2YSRA 3J7AO 2PMHA 1O57A 3RT8A 4M9SA 5IT9K 3KFMA 2HFHA 4AB6A 3V83A 2ZMBA 1UTHB 3TQLA 1IN7A 4XLPF 2XVCA 3LC8A 4FE8A 2ESNA 3M8FA 5HDNA 3ONMA 3G3FA 4ND9A 3CG1A 3MWBA 2ANJA 3PD9A 3UIFA 3RTWB 1G3SA 3IC7A 4M9XA 1BP5A 3MAMA 1B0HA 4ZECA 4L5IA 3TODA 4EVIA 2XIGA 1ZGAA 3F8CA 2V1UA 4MTEA 5H8QA 3UN6A 1MKMA 4IO4A 1EU8A 3I6VA 1FCKA 1S7OA 4BYYA 3T5XA 4EF1A 2DWIA 4XRFA 2OJTA 4I0AA 5AIPA 4R72A 5CJ9A 1Y3PA 4KYWA 2ZCWA 2H4IA 2ZNZA 1HKTA 4L9NA 1UHWA 1R1VA 2GA2A 2AXLA 5H8HB 5D6EA 2KIFA 3I59A 1KYZA 3ZP5A 1RIOH 1D5VA 4C1TA 3KZGA 4HF1A 2HYFA 1I6XA 3RN8A 4I01A 1PEBA 2VE9A 4HDVA 5K2XA 1XGNA 2P7VB 3LSWA 2ZFWA 1ZRCA 5DUKA 1HBXG 1HXDA 1XSVA 1OQHA 4RS8A 3H6TA 4I9DA 4QFNA 3CO7C 4GXAA 4LQ5A 4HBLA 4EMSA 3I4PA 5IAIA 3HRMA 4YAHX 2QBYA 4KCCA 5ILSA 4KI0E 3SZPA 4RPNA 4OQOA 2D3IA 2XAGA 2HR3A 3VVDA 2OCUA 1M5FA 1SW4A 2QS2A 1J5YA 2P2AA 1B9MA 3PPOA 2BV6A 3DLNA 4EM1A 4ZYDA 5E1XA 4R6KA 4UA8A 4R75A 1LDKB 3MFKA 2RGVA 2V3UA 5ILVA 4OEVA 3JSPA 5CVIA 1A04A 1QVSA 5DYHA 1WVJA 5CBRA 1W4MA 2V9VA 2Q8KA 1QW0A 1SD7A 3P7IA 2H6BA 1UIVA 5K5QA 3S9MC 5H8FB 3KJ7A 3U1OA 1SYHA 4LGWA 3KZYA 4ZEDA 3RI4A 1ZN2A 2OZUA 2PMUA 3HRUA 3EPEA 4IGRA 3IAZA 3QYTA 4Z2YA 1LB9A 3RKWA 4ZDMA 1IEJA 3REOA 3SERA 2CZLA 2FMYA 3T9UA 1SQYA 3CFZA 2XHDA 2Q0OA 4ESFA 2ALUA 4I62A 3KEOA 3HHHA 4U0VA 1N3WA 1ZYRF 4CO8A 1QQIA 4H0EA 4YU0A 4WCGA 4R79A 5BPIA 4NEDA 5EYFA 1FBSA 3HOTA 1IUYA 1WRJA 3WU0A 3SEWA 1FWZA 1IN8A 1R9LA 1AWCA 4ZYGA 5HBCA 3C36A 3I5OA 1G3TA 2M8EA 4MNUA 4AB5A 1FBQA 4R9GA 4IRIA 1I1SA 2NOOA 2J5PA 2QJEA 3F8NA 2Q9TA 5H8QB 1FY7A 2MH9A 2M8CA 2RVCA 4HX8A 1OMPA 2H98A 2DQLA 4HV5A 4BAYA 3H3UA 2Q89A 2GXBA 1P4WA 2ESHA 1POTA 3CFXA 5I57A 5D4RA 2P5KA 4GOTA 1YLFA 3A3UA 5CVVA 4YFNF 5LGNA 3CLOA 3HV1A 4IO5A 3K6UA 4UHTA 2O6AA 4GLIA 3VDFA 3HCQA 2V3QA 4A12A 3F3XA 4IPAA 4RGXA 4QSCA 4ECFA 3R26A 3I59B 3ZN0A 1MY4A 4IY6A 2HYGD 2QMWA 4HX7A 3DM0A 1HKSA 4KN7X 1IXSB 2I58A 5F1RA 1XGSA 3BPVA 3L7WA 3E97A 3G3GA 5KK1A 3M3LA 4XSXF 3RYRA 2VP1A 3IO4A 2F97A 2D45A 3MP1A 2O6GE 3UK4A 1YW8A 2MH2A 3IOWA 1B3FA 4YMBA 3MP6A 2ISZA 2UXAA 4Q5SF 3IJOB 4PFYA 2Y7WA 2BE5F 4XLNF 2QLZA 3PPQA 2OBPA 2OQGA 3E5QA 3T9VA 2GZWA 4R6YA 4YKIA 3P9CA 1URDA 3DELB 4GL0A 3V5AA 1EZOA 3GFLA 4EJVA 4MLVA 2F5DA 5TPAA 4MH5A 2P5VA 4LZ7A 5BS6A 4DZ1A 4OU0A 3PUYE 1YCJA 1MQJA 1LVAA 2WC2A 1H44A 3BWGA 1MM6A 3MVWA 4IGTA 3I71A 1LLSA 2IA0A 3KN8A 2HCAA 4Y13A 3EDPA 4PDKA 1OMIA 4HW8A 3M1EA 1O7TA 4A0XA 4EXLA 2M45A 2NYXA 1N84A 3VXCA 4EGYA 4DE8A 1R5HA 3MUQA 1SYIA 4DDDA 2OD5A 3K00A 2FBIA 2NS0A 3Q5FA 3C7JA 2RC4A 3FIRA 1O3RA 3V8KA 2OWSA 3MCZA 5DYMA 4EJUA 4GIZA 4HX4A 1J59A 5FLXK 1VFEA 3O9PA 4KD5A 1B52A 3K1MA 1B3EA 5CMCA 2B3BA 1KA8A 1M5BA 3FVKA 4UUVA 3S2VA 4PGHA 2W85A 3TDZC 1DPRA 2I3WA 2Q2AA 5ISUA 1Z7ME 3SEXA 4M4GA 3GX4X 5CM6A 1MXUA 1Z7UA 4LP2B 2UVHA 1R6ZA 2GHBA 3S9LC 2PBWA 4H5FA 4NF6A 1NH7A 2Z8EA 4R73A 3F8BA 3HHFA 1L5TA 1PB7A 4KIBA 1P99A 2GIVA 3PMVA 3LQRA 2K7LA 3SEUA 2COMA 5J6XA 1UCRA 3VFJA 4A0ZA 3E3KA 1JEVA 3KE2A 4ZZLA 3HTSB 3S2WA 5I57B 4KT5C 2OK2A 2P0SA 3LA3A 1UB9A 1P1NA 1YW9A 2D1VA 4OYVA 4P11A 4FATA 2XAFA 4XSZF 3S9EA 2XAJA 2OA4A 3DEUA 3KP2A 2DT5A 5I2KB 4G68C 5IT9Z 4O6JA 2WWYA 1NNFA 4N6PA 2XHKA 1FBUA 1DSNA 5DEXB 2M87A 4QFOA 3SZTA 2NAZA 2EFPA 2MA3A 3BP8A 3FMRA 1FTKA 4AIHA 3FATA 2EA2A 5I59A 4D0PA 1UFMA 4TLMB 1R58A 4LZ5A 2CGPA 3HHGA 3A09A 4FECA 4X9TA 3TTRA 5DDGA 2MC3A 2NRAC 2O51A 4L0ZB 2DVZA 5IT3A 2RN7A 1B5HA 2RCAA 1HQCA 3J81K 3IKVA 4GXOA 1XS5A 3V8XB 1D3YA 5AIQA 1ZKBA 5I56A 1U5TA 1QGPA 4ENJA 5TPAB 4Q0CA 1DMBA 1BTJA 4NB5A 1FZPB 3EN3A 1Y4CA 1IIWA 1KQ0A 4AIJA 3TO9A 1LFHA 3U93A 3OV8A 3EYIA 4M73A 4U0WA 1TQPA 4QFKA 5DCMB 1UTBA 3H3ZA 2GH9A 3BROA 1O3TA 3HIFA 5DVIA 1N7WA 2HTSA 3MWMA 4RY1A 1F4KA 4R9FA 1YG2A 4WF2A 2VOOA 2C6YA 2H99A 5BMZA 3E13X 3H6VA 2QSXA 3MJNA 1MGTA 1FQAA 3D4CA 2F8DA 4LUBA 3RPQA 3TELA 5LHGA 1LEAA 3R6SA 2XASA 4ZYHA 4Z0IA 4FX4A 5CMBA 3OOAA 3ZMZA 3BZ6A 2PBIA 5HOOA 1I1GA 3T9HB 1AMFA 3GWZA 3AXFA 1BIBA 1A99A 4ZEKA 3QUJA 1WI9A 5D4SA 2PVUA 1IXRC 1FQBA 2XXTA 4OIPF 3W6JB 5L8DA 1O7LA 5CMMA 5CMKA 4U7BA 3GXAA 4NF6B 4B8XA 4DXBA 3T8RA 1HW5A 4X1DA 3ZKKA 4ZE8A 2YR2A 4U23A 3B6QA 5HS9A 1XMAA 4WXCA 3RPUA 1MXYA 1MY3A 1H76A 4Q8RA 4R74A 3RGYA 2NVUB 2HEUA 6PAXA 3BKIB 5CLSA 3H06B 3I54A 2HZLA 2FYIA 1RI7A 3IOTA 3C4MA 3CI8A 4NE4A 3Q25A 4Y17A 3F23A 5HVQC 1LCTA 1T38A 3K1PA 4L9VA 1YW7A 4KYSA 2L4MA 4GYGA 3O97A 3S9NC 2AS5F 3IX1A 5H6QA 1URSA 4FIMA 3P9IA 2I6EA 3IR1A 4JB7A 1S29A 1ZGJA 1A40A 4KUMA 1F9NA 5D8KB 3ABTA 1J7KA 4ESWA 3DP7A 4AWXB 2OWTA 1S9TA 1XMKA 1ZARA 4IO2A 1DPUA 4WKMA 3NEUA 1O3QA 2DSFA 5I59B 2DBBA 1MPBA 1P1QA 3MZBA 2TDXA 3N94A 1NNKA 3BDDA 2IA2A 1KYWA 5F6FA 1NL5A 1SI1A 3FVNA 1K78A 1PDNC 4GRKA 3E6DA 4IY5A 2DK5A 2FF4A 3BOQA 3L2CA 3R61A 5E20A 4ZZAA 3GVAA 1UQWA 3O66A 2VE8A 1OYIA 1FT9A 2RC7A 1ZRDA 4I98B 5LRRA 4LD5A 4EQ9A 1SFUA 2H25A 4YKPA 3RKYA 5H8NB 4WWCA 3CUOA 5HDGA 2F5FA 3T96B 4WXJA 1ZG1A 1NH8A 2KIUA 4ZH4F 3EHSA 1LFIA 4K2EA 1SMYF 5ITPA 1XB4A 2H5YA 4OIQF 1UTBB 3BPXA 3KEIA 1D9VA 4ZEBA 3FXUA 2PLYA 4Q4ZF 3E5XA 1KQ8A 1YTYA 3V7CA 2IA1A 4QWQA 4EJOA 4YMAA 3KP4A 2DPDA 2ZJ2A 2QVOA 4MLQA 2UVJA 3LAPA 2LF8A 4MTDA 4HOBA 1OVTA 4XTCQ 2X26A 3KFWX 1JVXA 2Y84A 4UNOA 4EM2A 2HDCA 4HV6A 2FQ3A 5FO5A 4NF5A 3OO8A 2HAUA 1IITA 4NTLA 4HW0A 4OVJA 1H9GA 4HA8A 1Y4TA 3G73A 2I4CA 4OESA 1R00A 3M9AA 3CIJA 3IK6B 3ZMTA 4U21A 1JW5A 3KZZA 5TRDA 2QM3A 4X1BA 5EHMA 1AIVA 5JK4A 3SFZA 1DTZA 2DI3A 3CSGA 3CUQA 1VE4A 2V79A 3I5UA 3SEVA 4E0XA 1SBPA 3GLBA 4MHGA 3RNNA 2DXYA 1BJAA 3OEKA 4R1HA 2X7QA 3HN0A 2PFBA 4I02A 2VN2A 5HDKA 5IKBA 3MQ9A 3F6VA 1O7FA 2OZ6A 2Y0MA 1TW3A 2VBWA 4CICA 2XUBA 2Q2EA 4GQOA 1AOYA 2Q2CA 1FC3A 2CQKA 4CYDA 4ELPA 1B7UA 1S50A 4F1VA 1K79A 2DWHA 3V7SA 2ABHA 1NMUA 2B3FA 3CTAA 3TO7A 4JBAA 4CDGA 5JHUA 4JDFA 2VXZA 5DEQA 2CMOA 5FLXZ 2GQQA 4RJZA 4F39A 3A3CA 2P6SA 2F6PA 4ONYA 4HTGA 4ESXA 1BIAA 1W5TA 4LG0B 3F11A 4KFCA 1P1UA 3VLWA 1EZ9A 3KP6A 3Q27A 3E3VA 4P0IA 3VFZA 1ATGA 2REGA 5DV5A 1FYLA 4GFRA 4KDPA 3JAMK 4R6HA 2LKPA 2F5XA 4RB1A 3H03A 4PQJA 5DT6A 2GA1A 2HWVA 3LFKA 1YIOA 1RKMA 2HXWA 4H8IA 3Q29A 1CF7A 5L3CA 3TKDA 1D3KA 3ERED 4EJTA 4CGZA 1FSEA 2ISYA 3SQNA 4QRZA 4H65A 4EXKA 1MPDA 4JK1X 2LSOA 1EH6A 1AOVA 1B59A 1V4RA 4FEDA 5KDTB 3ISPA 1FSHA 1HSTA 3O6IA 5LHIA 3O2PE 2VT2A 1QUKA 3QAXA 3DP8A 2M5WA 4PZJA 1JHFA 4TV7A 2EJRA 1YAEA 1P1WA 3CRBA 2DVCA 3E5UA 4UV9A 2QPQA 1TTYA 4U1ZA 1HSJA 1XGOA 1BKAA 2O03A 2ZXTA 3LA7A 2XKPA 4C1UA 4LK1F 1KU2A 5DVJA 2WKYA 3TQNA 3QU6A 2XXIA 3KGCA 1X3UA 3M7GA 3USDA 2EA4A 5HS8A 1DUXC 4BDLA 1QZYA 1F9BA 4QSEA 1MD0A 2OZZA 2UVIA 4HF0A 5ICTA 5A2QK 3MZ1A 1MY2A 1OLAA 2E1NA 3G3ZA 1PDAA 1MJAA 4QHQA 2VBXA 3FVOA 4BHCA 1H45A 4U4SA 1SMTA 2O1MA 3ELKA 3J81Z 5JFRA 4WXHA 4POXA 3N5LA 1K7AA 4GVOA 1XD7A 1B32A 3G3IA 3MQ0A 3U94A 3IRRA 2K4JA 1FNNA 3JYRA 4ELQA 1MY0A 3EQLF 5I58B 2Z99A 4RK2A 1MM7A 4GGGA 1CB6A 3DV8A 4GYIA 1B9JA 4G4PA 2W24A 4GCVA 5H20A 2MBFA 2Y7RA 2JSCA 1TNSA 1BI2A 1OQGA 2QUFA 3BJOA 3RDIA 2O61A 2XXRA 2Z33A 5D5XB 1TFAA 3I58A 2D5WA 5FTIA 2L4AA 2KJCA 4G8MA 3QPTA 1TQMA 2FMLA 2ZKZA 3VV5A 2H6CA 5KVRA 2A5TA 4ENMA 1Y0UA 3JZJA 3FHZA 4LB6B 2MD5A 1I27A 4EUOA 3PPRA 3TOBA 2Z5UA 1MDMA 2W25A 3D0SA 2Y7KA 1XCBA 2J5OA 5E8GA 1FP1D 2O0YA 1LBCA 3VLUA 5D8LB 2CSOA 1ZRFA 4QLCU 2VD2A 5EHSA 3PPPA 1JGSA 1OYYA 1MJ9A 3CSBA 4IO6A 4F3BA 1W5SA 3FVGA 1QNTA 4BHPA 1CF7B 1EH8A 3ZN1A 3N97A 3WTXC 4H0WA 3PPNA 2H09A 3KLNA 4YB5A 1ZLJA 4DXCA 1YFHA 1USTA 3COAC 4YB7A 2ZYNA 3UP9A 3TEPA 3V8LA 3G7WA 5L9SA 2K4BA 4P55A 4PCQA 4BNCA 4YKKA 1LJ9A 4FAJA 1YS7A 1PBQA 2E1CA 2V3TA 1REPC 3DQVC 3M3KA 3U2RA 3IWFA 4G6QA 3LR1A 5AE4A 5B70A 1SW1A 3WTYC 3WG9A 2FEZA 4FX0A 3RTRA 1J75A 3PFIA 2IT0A 4YFXF 1B7HA 3MZHA 1HSLA 4O3BA 2QBYB 1R9QA 3JV9A 1R5GA 2BBYA 2GXGA 3ABUA 2IEEA 2RV8A 4OMZA 3PMWA 1N3XA 2YX7A 3P9KA 4BQAA 2REJA 1R1TA 3CO6C 4AQ4A 3IO6A 1CE2A 3OO9A 4FEBA 2AYSA 2JPCA 5BUUA 3I53A 2EK5A 1B2HA 3GFIA 3B7DA 3ILUB 2XGXA 1Q35A 2FE3A 3MAJA 5LBQA 1BC8C 2OQRA 3ECHA 4JWYA 4O5VA 4U1OA 1Y20A 3FV2A 1B0LA 3QP6A 1TXFA 5JR3A 2HKOA 5H6RA 2HZKA 1XCVA 3DXJF 3OSRA 4JBZA 1POY1 1MY1A 1VTNC 2XXPA 2R7DA 2XAHA 2XXYA 5KZTA 5ICCA 2CYYA 2M30A 2QRYA 1RYOA 4RB2C 2THIA 3U8QA 3DFGA 3RJPA 5ICQA 3FF5A 2X4HA 2IW5A 3LQQA 1IN5A 4LVQA 1BI3A 1M5EA 4F2QA 2O69A 2PYYA 2RKMA 2DQRA 2WV0A 5LHHA 2Z8FA 3K1NA 1TLHB 1BN5A 1MQIA 2EB7A 4JWXA 3GXOA 3HSTA 1NNPA 3PUVE 1FTLA 2VODA 4BDMA 1XSDA 2HQRA 3PGFA 1FLIA 1MDP1 1IUDA 4M6YA 4ELRA 4G6DA 5L3GA 4AIKA 2ZNUA 1B1BA 2ADUA 2L01A 2UXNA 2CW0F 3D4GA 1JW4A 2HOEA 2F6GA 1LAXA 1XT8A 1A7LA 1B6AA 4F22A 2FXAA 1KU9A 1SD5A 2EV5A 1Y9UA 5KCJA 4ZE9A 4IHSA 2H94A 1SDXA 3DPLC 5JI6A 4RPOA 4O3AA 4XKNA 3F8MA 1GTKA 4I0BA 1IXIA 1FOKA 4ESJA 4U88A 4LLNA 3PV0E 4DLDA 1QUIA 2HZTA 2FU4A 4H5GA 4FORA 1U2WA 1WDNA 1YO5C 3J80Z 4OFLA 1MXVA 4ZEIA 5B7DA 2XAQA 1T0KA 2EFOA 3C34A 4M72A 4QSDA 2AL4A 5ELVA 4NF8A 2IPQX 3W9VA 5FHOA 2M1BA 1QKBA 5DTBA 5FHMA 3FM5A 3O6GA 5K5OA 4G2ZA 4OFJA 4F3GA 5E8IA 3OOPA 3TUSA 3T9XB 2V93A 1K6OA 3HPIA 4M74A 4ETSA 4Y15A 4EQQA 3KSXA 1XSXA 3JAMZ 5LEKA 3ODBA 1IZ1A 2IVMA 1R23A 2A68F 3K01A 5HLIA 3L00A 5BQTA 3RPWA 1VR5A 1IN6A 2X7PA 2HGCA 2DXRA 1USYH 2XD2A 3V7RA 4R8HA 5BOXA 3CG3A 3OO6A 3WODF 5EEHA 4B09A 1Q1KA 3ROUA 3SHFA 4A5NA 1Y3QA 3ULQB 1B51A 3GFJA 2UZKA 4U2RA 5FD6A 3PUZE 5K2YA 1KWHA 4AVPA 1NHAA 3V4GA 2D1HA 4ZS9A 4XKPA 5CVJA 5LGTA 4ZEFA 4S04A 4OINF 1SFEA 5FD5A 5ILUA 1DP7P 2I0BA 3OENA 1ZAOA 2DO7A 4FJPA 3L6GA 1FQDA 1LB8A 1SVXB 5CYVA 3BJAA 4JSDA 1ONVA 3K6VA 1ELJA 4G94A 4ASNA 4N07A 3K0LA 3B6WA 4KHZE 2P5LC 3MVXA 4PFTA 3VB2A 4HLXA 1II5A 4HCYA 1LAFE 5J8CA 3SESA 1FW0A 3LUYA 1TNTA 3HUGA 3C18A 4P9UA 4WEDA 2BYVE 2P8TA 2FSWA 1MH4A 3OXNA 3F72A 3I64A 3NQOA 3M8UA 5D5VB 1TFDA 4A0YA 2DWAA 2G29A 2R6GE 4BDOA 5A2QZ 1I6QA 1ZHFA 5E1ZB 3VVFA 3IL2A 1C0WA 2ONSA 2UYFA 2RQPA 3L9FA 1KQ9A 3PMXA 4ZZEA 3GYHX 1JVYA 2E7XA 3PQKA 2XXQA 3H3GA 4OHNA 3Q26A 3WU1B 5CC2A 2VD3A 1HKQA 1LEBA 1MXXA 4WEPA 3HYIA 4UV8A 4LZ8A 4XIGQ 5JEIA 5KCJB 2XXXA 3L6HA 1FTMA 2DQVA 5LLQA 3T1BA 3OELA 3MPLA 4BHBA 2QWWA 1JQFA 4C0RA 1LAHE 2BGCA 4NQWA 3U92A 2F7BA 4M6XA 4WXDA 1DPEA 4N13A 2F7CA 2DYXA 5JTYA 1BOAA 3WTSC 1ZBMA 2HEOA 2MLKA 2PEXA 4RB3C 3ML6A 5L3EA 2D21A 3JW4A 2XKOA 3GLXA 1EH3A 1UTHA 2RC9A 3TFLA 5J1DA 3S4UA 1USSA 1PBPA 3TKYA 2LAOA 5CBSA 4POWA 3FXRA 1GGGA 3KG2A 2ZYOA 1B4HA 4P0GA 1SD4A 1A54A 3SEYA 3IB0A 1HSEA 3WGHA 1T39A 5FFXA 3VE1B 1G3YA 3HRTA 2BEOA 3H6WA 2I3VA 1JEUA 2PT2A 5BPDA 4KYDA 1P4XA 3KJTA 3PUXE 5I56B 1P1OA 1U5TB 1EV7A 1I69A 3RT6B 1MXZA 2PG4A 2Y75A 3B73A 4YIIA 4KNYA 1QJMA 4DCXA 1S6LA 1TQIA 1T0FA 3KOTA 5H8HA 3TCHA 3E6CC 2VBYA 2LNBA 4KIFA 5FFZA 1IXHA 1XOCA 4MF3A 2O3FA 4ZZDA 4FHTA 2DW4A 2DPUA 1H3DA 3C33A 2XXUA 4UVAA 5DCFA 4BDNA 3MW0A 3FV1A 2HTJA 1Z6TA 3TTMA 2F2EA 1GR2A 1XC1A 2ONRA 1GXPA 3KOSA 1B4ZA 1VFDA 4YG2F 4KIGA 1FTJA 3GF2A 1R22A 4OETA 3RYPA 2ZMEA 3RKXA 1BIYA 4NMYA 5LEJA 3PQJA 1NKXA 3GZGA 3IOVA 2R3SA 3LBSA 3GBAA 3RIRA 3I3VA 2YJPA 1G4DA 1ZMGA 3BFUA 2ETHA 4L5JA 3DPTA 1JNFA 1KU7A 3W6KB 2UYEA 4L17A 4F3PA 2VOPA 3CJNA 2NNYA 3QIMA 1LBBA 3DKWA 4KFQA 4N0BA 1U5TC 1S7AA 5HM4B 4MQVA 2XX7A 4EJWA 2DOJA 5L3FA 4RAYA 2GFEA 5FGMA 3KCCA 1LFGA 2AIXA 5H8FA 1LDJA 4EGZA 2ZYKA 3J80K 3WE2A 1JXSA 5I84A 1KU3A 3ZMSA 1I5ZA 2P1SA 1N76A 4LK0F 4HQEA 2QMXA 1FX7A 4GO1A 4KCDA 4O3CA 2QL3A 2V84A 2JZYA 2EWNA 2L54A 5CVUA 2O68A 3RTFB 4KQPA 4BDQA 2DU9A 1UIUA 2R71A 4I8CA 2JRTA 1URGA 5L3BA 5M2VA 2MLGA 1XN7A 1B3LA 1XHYA 2IJLA 1BC7C 1GHCA 2F36A 4LFUA 4NF4A 3ZMUA 4H1XA 2JPBA 3WTZA 2ZBKA 1B40A 3K4UA 1BM9A 4LLGF 2V6CA 4KN4X 2DE2A 3R0AA 1YYVA 3RY3A 4L0YB 4F2OA 2G7HA 1STZA 2RCBA 4CZZA 1WODA 2F7AA 2G93A 1SFXA 3T0YA 1JE8A 3TTKA 1QULA 1K78B 4A6DA 5JVTA 4U22A 3GUDA 1B5IA 2DAOA 4UVBA 2B0LA 4XKQA 2QQ9A 1Z1DA 2FOKA 3WGIA 4GWOA 5K1YA 2DWJA 2O84X 2RDPA 3WTWC 1J9IA 2OBGA 3O3KA 3KEQA 1O63A 2E0SA 2DE3A 1LAGE 3KSJA 4JQFA 4H6DA 5AA1A 2EV0A 4DIGA 3MZYA 2PX1A 3IOUA 2Q88A 3ECOA 1B3HA 3ILTB 1ON1A 2OU2A 1MQDA 4AD9A 3WAEA 3C1DA 4M9ZA 2LF7A 3KP7A 4IRHA 3EHTA 5TP9A 3FX3A 3F22A 2FNAA 4OENA 5CVRA 5AA2D 1N0TA 1LDDA 2R7FA 3T22A 5LRSA 5LGUA 1SW2A 1RZ4A 2V25A 3BJ6A 1U8RA 1FYKA 1MH3A 4TQUQ 4I09A 3FMQA 4MQ9F 4L18B 2DTRA 2NUVA 3C3WA 5D6FA 2L02A 2FRHA 4HS7A 1D8JA 1AH5A 2DS9A 1OPCA 4KPTA 1HW1A 3KETA 2VT3A 1H0MA 2OLBA 1F5TA 4BLAA 1FQCA 4NF5B 2ZMEB 1YQAA 3P7NA 4LMYA 4OOIA 3T8TA 1O3SA 2KRFA 3IL1B 1XDSA 1QBJA 3E6MA 4ESBA 1IRGA 1BI1A 2PMSA 1S3JA 1G6NA 1P2FA 1L3LA 4RXLA 3HSFA 1H9TA 4G9YA 2O7IA 3O29A 2G7UA 2QYOA 2YU3A 3LAJA 2ZYMA 4GF8A 4UVCA 1DPPA 3OD7A 5A5XA 5AA2A 2XX8A 3CUQB 2STTA 4F19A 2Y48A 1ZJLA 4RB0A 5AONA 1U78A 1TBXA 2X0LA 2K27A 2XXVA 3GZ6A 1IRFA 3BBRA 3K02A 2V1DA 3ZQ7A 3EHUA 1P92A 1O64A 2QENA 2I4BA 4OIOF 1U6GA 3TTNA 3K9TA 4CHUA 2HQ0A 5FB2A 3CFLA 3MVZA 3I0TA 3IWZA 4RNSA 4YICA 3H7MA 4K3FA 4G68A 3H4ZA 4DQ2A 2W84A 2UXXA 3G3JA 4Q5TA 2EFNA 4A2UA 4OEUA 4OTEA 3EYYA 4G7HF 4RAZA 2PI0A 1ANFA 2RC8A 3MC2A 5HLGA 3U9GA 3MPKA 2KIMA 2Z22A 1ZG5A 5ED4A 2VHAA 1KGSA 2BJJX 3O2AA 3OSQA 4E0WA 2A61A 4L9JA 1G3WA 4OMYA 4R2FA 3L09A 4F31B 4H67A 4NF4B 4IO7A 3N26A 5FTHA 3ZS6A 3FWEA 1ODDA 4G7ZF 5E18F 3TO6A 1IN4A 3RLFE 2CFXA 5DD4A 4EQ7A 3HOSA 1V3FA 4HQMA 2F5CA 3FMSA 3KN3A 2B65A 3N4MA 4DXUA 4ISUA 4LONB 4PFWA 2W7YA 4Q47A 3NRVA 1US4A 3CUQC 4IJAA 2LDUA 4KICA 4F1UA 2VONA 3K6XA 3PU5A 1B4AA 3K0VA 2I0CA 1MXWA 3H92A 4OERA 2PN6A 2JTVA 2L3DA 1RUOA 1QUJA 4M71A 1LSTA 1PC3A 2YPRA 3KBRA 3FGSA 1B3GA 2QS1A 1B05A 2HQNA 3IB2A 3VOEA 2Y7IA 5D5UB 3PUWE 2GHAA 1LB2A 1N04A 1AL3A 1P6RA 4M1VA 3CDHA 4LLLA 2UVGA 4P5OA 2P4WA 1IQ7A 5I2KA 5TP9B 4MEXF 3ECRA 2VGQA 1ZH5A 2XRNA 3O6BB 4N9HA 2RNJA 5DEXA 5FHNA 4IO3A 1JETA 3T66A 1FYMA 2DFIA 1JW1A 4YFKF 2XX9A 2NNNA 3HRSA 5AA4A 2EV6A 4P96A 3HSRA 5F1QA 1TW2A 3VLVA 4GD5A 1D4NA 2V1XA 4H8JA 3WGGA 3EETA 2E1SA 5HPQA 1IAWA 1FPQA 1R1UA 1W7PD 3C9HA 4EM0B 3WTVC 4A5MA 1S8NA 4Q48A 3C35A 1FTOA 1MPCA 1P4AA 4UACA 2XV4S 3GFMA 1ZREA 2XD3A 1EH7A 1GVCA 5E17F 2K02A 2FBHA 5A5XB 5AA2B 1F1ZA 3W15C 3UA8A 1OIBA 1Y1ZA 3MBPA 4WX9A 3R60A 1EZPA 3K2ZA 4OFOA 5DCMA 2A07F 2F35A 2QQBA 4HDUA 5H8SA 3BY6A 3B6TA 4S05A 1IXGA 3R7XA 2HS5A 1Z91A 3OMBA 1T6SA 1W7PA 3GBBA 3Q9VA 2G9WA 2P7CB 4YZZA 4IRGA 3GW2A 4P9FA 1BI0A 4MBPA 2H9BA 2KKOA 3TDJA 4PE5B 3G3HA 4G68B 2F78A 2A5TB 3VVEA 5DUIA 3TMGA 1XDUA 2GRVA 4IHTA 1OKRA 4QFLA 1PB9A 1MDQA 2D2WA 5I2NA 1IF1A 4XXUA 1SW5A 4BH9A 1MDMB 1OR7A 2DLLA 3E6BA 1T98A 4ZYEA 1MRPA 3AAFA 3E9XA 1PP8F 2KLFA 4PETA 3OEMA 1ULYA 3K6WA 4G8XA 3ZMVA 2UWMA 2A6HF 2HKXA 4GXSB 2XROA 4A6EA 4IB2A 1DOTA 3TCFA 3TTLA 2DK8A 3QPHA 2PQ8A 2IA4A 4LJZF 5J8FA 2YLNA 3QXMA 1MQHA 2DE4A 3EUHA 1BLFA 2Q8JA 3MEXA 3ZMDA 4IF4A 4HCWA 2KJBA 1NNTA 3RUMA 3V8JA 3LSXA 1J0RA 1QPMA 2DP8A 4KR5A 3TDUC 4Z7EA 3KP5A 4U7DA 2RINA 1UHMA 3F8FA 5CRYA 2Z8DA 3R0JA 2ELHA 2QQAA 1OVBA 1PB8A 1JHHA 3JTHA 1B7ZA 3QSLA 3GO5A 3TQWA 4X48A 4THIA 4LATA 1H43A 1FQFA 4L9TA 3LSLA 3PD8A 5L9OA 3IJXB 5BWJA 4O3MA 3IRQA 3KN7A 1RUNA 1WWXA 3U72A 4DNCA 4F7ZA 3SETA 1D8KA 3VODA 2ACJA 2ZO4A 1D9YA 3QK6A 4EQBA 1RYXA 1MZBA 4DCYA 2CO5A 4GL8A 1B46A 3DP4A 2FNCA 2IRFG 3WTUC 2A69F 2CG4A 2F34A 1LNWA 4LQ2A 1DDNA 4BDRA 5AA4B 5L3DA 1WSUA 5DD8A 5TJJA 1ZLQA 2O7UA 2K86A 1I6BA 1SI0A 1Q1HA 1TT1A 5DVFA 3JSOA 4FT8A 1LQ1A 1Y1MA 3F21A 2STWA 1USYE 2FA7A 4BXUA 4JXIA 5ITOA 1XVYA 3TOAA 4NWCA 2R9JA 2VBZA 2CWEA 2QS4A 1QO0D 4U0YA 1R1NA 4G7OF 3O6HA 5H8NA 1XGMA 4F1YA 5F64A 3BFTA 3G3KA 1PUEE 2AL5A 3Q9SA 2E7WA 1ZG3A 2HFBA 2H27A 3GEZA 4RGSA 4G8HA 4IVNA 1US5A 4QF9A 3MP8A 2OAZA 2W57A 5D5WB 1S7YA 4YKJA 4OWDA 3FJ7A 1FP2A 3KLOA 1M5CA 4OIRF 1W7PB 2VOZA 3FJMA 3OO7A 4LA9A 3QU3A 1GVJA 2VC1A 2Y7PA 1XVXA 3RQTA 1MJBA 1TWYA 1CGPA 3W9WA 4ELOA 2A3SA 5ERIA 4CXFA 4LB5A 1HW2A 2EFQA 4NWDA 1B1XA 3R4KA 5I2NB 3M8EA 1SD6A 2QZ8A 4KYEA 2Z9OA 4YIFA 4TLLB
chains in the Genus database with same CATH superfamily
1Z9CA 2PMZA 3QAHA 1B5JA 5CI5A 1T2KA 4N9IA 4QFPA 5EQ9A 2IGKA 2KLOA 2YX4A 1JTYA 4GWXA 3C2BA 3TZAA 3BTLA 2BXYA 2I48A 1LEVA 3HO7A 2A5WA 4Z6YA 2Y69H 3G1LA 2IAIA 3WTTC 4C3IJ 4PP0A 4NHJA 3FBPA 2O5RA 4X04A 4IHXA 3Q28A 1IW7F 3LSFB 3EQ1A 3DF8A 1ZKGA 3QPLA 3FXLA 2NVYJ 2LKSA 2GOXB 2ZNTA 1FPLA 3IHUA 2O8XA 3EF7A 3IORA 4PBHA 1LGBC 2FVZA 3SXYA 4JX6A 3N6TA 1K83J 4XL9A 1M5DA 1XS9A 5KHDA 4MGRA 5E1WA 1QZZA 1YX5A 3OYJA 1VDWA 1LCFA 1OLCA 2ZNYA 2RKHA 3HJEA 4MFIA 3BQYA 5LOMA 1B58A 3A01A 3GZ5A 5K5RA 2M3AA 2IP2A 4IXAA 4AC0A 4B47A 5HLHA 1YITI 3ZPLA 4NF8B 4ENKA 2R92J 3C31A 3ASOH 3LA2A 1GV8A 1ZLKA 4PGGA 3F6OA 2O1LA 4G77A 1YTVA 1L0OC 1U3EM 2DYRH 3MN2A 4LG0A 4RGRA 1B6HA 1AHDP 4OZ9A 1GXQA 1Y6IA 4HNUA 1ZTYA 3C32A 2PJPA 4CCLA 1OQYA 2NWJA 3OR1C 3UORA 1B1HA 2GWRA 2V9KA 4XN3A 1I6AA 2QVUA 1A6QA 1J2XA 1WFXA 3QRFF 1MQGA 2WYKA 4U4XA 3CVGA 3THIA 1G2HA 2JT1A 2FA5A 2XDVA 2HVQA 3B02A 3I4NJ 4F3SA 3CP8A 1B9NA 2OF7A 2FBKA 5ICFA 2ONKE 2GAUA 3DP6A 2QSFX 4JWOA 1UAAA 5H2FC 1BA5A 1Q1VA 5FROA 2A5SA 3LSTA 1WCMJ 2LMDA 2H1LA 2WTEA 5DM6F 3N6UA 1PJRA 4RMNA 4P3LA 3IB1A 3OOUA 3T93B 4Y4RA 5EEGA 2HHMA 2R5YA 4EF2A 2A6EF 2ZNSA 3M3FA 4RA1A 2ZXJA 3ZKLA 2XXWA 3KP3A 3K69A 3TGNA 2P81A 2LBFB 3U1DA 5KDTA 1X2MA 3H6UA 3D5LA 4XBFA 3JTGA 4UUSB 2COBA 3PUBA 3CCUI 1IMDA 2OPTA 4PFIA 3RZDJ 4JX5A 3B50A 2E2HJ 4DI4B 3DLAA 1APLC 3W3CA 2HAVA 1R4NB 1IXCA 1WQ2A 4E70A 4HLYA 2QS3A 4HF2A 3TCGA 3R6UA 1QKAA 3ZQCA 3FM3A 4RK9A 3TPAA 1N7XA 4BQOA 3K2DA 1VSOA 4HZFA 5EZHA 1VI0A 3KYCB 4A3JJ 1E2XA 1VQKI 4HYEA 4MEYF 2XXHA 3E4RA 4GBVA 3QOPA 3PJRA 5DW8A 1W36D 1MNDA 2R5ZA 2ZJRF 3CMYA 1E17A 2I49A 3FZVA 3SDFA 2DOAA 2FNPA 1DTGA 3M3YJ 3V89B 1Y3NA 1BBYA 1OYWA 4I7HA 3CR9A 4G6TB 1SAXA 2PMZN 4I2OA 3VXBA 3LNQA 1ZU0A 3FD3A 2JUGA 4EDPA 3MKLA 4G8NA 1W0TA 3ZQLA 1DCUA 1NTCA 4EV0A 1FJ9A 3CMEI 5TU0A 1RNLA 2Z3YA 3HUGB 4RGUA 2H8RA 4TOZA 1YS6A 4OXVA 2D5VA 4GX6A 2X6WA 5HS7A 4DBQA 4WK8F 4KA4A 1ZIUA 1D9QA 4F18A 4JSOA 3QUFA 2F5EA 4UXNA 1A8FA 1R7JA 3HTUA 3FUZA 1ON2A 4HAMA 1PUFB 3HSEA 1Z6RA 2RF1A 1NFTA 4ZTJA 5FKLA 1SVLA 1I50J 4R2BA 3QP5A 1PP7U 5J4YA 4PFUA 3PIPF 2YPNA 1K61A 3WAFA 4DZJA 4XN0A 2Z23A 3I4MJ 4RYAA 3BR1A 5ICGA 4ON0A 2ZSIB 2EFWA 3ESWB 4CSWA 1FPEA 2NXOA 4KMUX 3MVYA 4YB6A 3VDXA 3FASA 2H1KA 3UGWA 2HYJA 3FXQA 1FQEA 1Z05A 2EIMH 4ENNA 1YPNA 3SKPA 3TAJA 5KAFC 3BG9A 4M3EA 3TYHA 3PO3J 2CQ7A 4LN5A 1A8EA 1Y56A 5CQEA 3VEPA 2QSGX 4XOTA 4KT6A 4I3YA 3OYDA 2NVXJ 1MS7A 1ZGWA 3MZ9A 2X9DA 2PT1A 5I58A 5J1YA 2P6TA 1WKMA 4XKRA 1E3PA 1R36A 3ZSFA 3LWFA 3WE3A 3W6VA 3HG9A 1LPQA 4OMBA 4Q30B 2A5YB 1A55A 1SD3A 1J1NA 4NQWB 2VL8A 5ICEA 2BZTA 1IMAA 4G61A 1Z7NE 2LOOA 5JTYB 2VC0A 3RQIA 4DJAA 3IKTA 4KMFA 1MG1A 4BS9A 1SFKA 3FJGA 2YSRA 4RA2A 3TW6A 3O28A 2OTLI 3J7AO 2PMHA 3VLWA 4XLEA 1O57A 3RT8A 4M9SA 5IT9K 3KFMA 2HFHA 4AB6A 2FUG2 3V83A 2ZMBA 1UTHB 4C30A 3KC1A 4PGNA 4IX7A 3OYAA 3BLYA 4L5EA 3A01B 1FBDA 3TQLA 3CC4I 1IN7A 4UY8I 5H8QB 3JRGA 1FPFA 4XLPF 2XVCA 3LC8A 4FE8A 2ESNA 3M8FA 5HDNA 1QA6A 3ONMA 3G3FA 4ND9A 4GDFA 3CG1A 3MWBA 2ANJA 3CC2I 4B1RA 2DCEA 3VSLA 1TT5B 3PD9A 2VASA 3RTWB 3UIFA 1G3SA 3IC7A 4M9XA 4A3KJ 1BP5A 1ZELA 1B0HA 3MAMA 4L5IA 3TODA 3PUFA 4EVIA 2WBBA 2XIGA 1ZGAA 3F8CA 2V1UA 4U87A 3BIGA 3E1SA 4MTEA 2ZZWA 5EG0B 2O8KA 5H8QA 3UN6A 1MKMA 2ZXHA 4IO4A 1EU8A 3H9QA 3I6VA 1FCKA 4DIQA 1S7OA 1FTZA 4MAGA 1G8XA 1OCRH 4BYYA 2ZXWH 3MZ8A 3T5XA 4EF1A 2DWIA 4XRFA 2OJTA 4I0AA 5AIPA 4R72A 5CJ9A 5B66C 1Y3PA 4KYWA 1FEXA 2ZCWA 4S0HB 2H4IA 2E34A 2ZNZA 1HKTA 3FKIJ 5ET8A 3CZ6A 2EIJH 4L9NA 1UHWA 1R1VA 2GA2A 3OS1A 3IAS2 4E7SA 1IC8A 3RPLA 2AXLA 5H8HB 3D1NI 5D6EA 2KIFA 3I59A 1NH3A 2WB1A 5C44J 1KYZA 1RC9A 3ZP5A 1RIOH 2HPMA 1D5VA 1IMEA 3KZGA 4HF1A 4I40A 4OVPA 2HYFA 4PGPA 4NAPA 1I6XA 3RN8A 4I01A 1PEBA 2VE9A 4HDVA 5K2XA 1XGNA 2P7VB 1ITYA 3LSWA 2ZFWA 1ZRCA 5DUKA 1HBXG 1HXDA 1XSVA 2E2JJ 1OQHA 4RS8A 3H6TA 1NV0A 4XR6A 4PAIA 1Y1VJ 5F27A 4I9DA 4QFNA 1FOWA 3CO7C 4GXAA 5IOYA 4N17A 4LQ5A 4HBLA 4EMSA 3I4PA 4BEHB 3HRMA 4E7IA 5IAIA 4YAHX 2QBYA 4KCCA 5ILSA 4KI0E 3SZPA 4RPNA 4OQOA 2D3IA 2XAGA 2HR3A 2RAEA 4MFDA 2OCUA 2IXSA 3VVDA 3N05A 1M5FA 2YS9A 1SW4A 2QS2A 1J5YA 2P2AA 3OYEA 1B9MA 3ASNH 2JJ7A 2L7ZA 3BR3A 1MSEC 3PPOA 2BV6A 3BT9A 2UV1A 4GWUA 4II2A 3DLNA 4EM1A 2WY8Q 2FIXA 4XONA 4ZYDA 3SDBA 5E1XA 4R6KA 4UA8A 4R75A 1LDKB 3G1MA 2RGVA 3MFKA 1JJ8C 1I3AA 2V3UA 5ILVA 1CQTA 2AHQA 2XPVA 5CVIA 3JSPA 4OEVA 1DU0A 1A04A 1QVSA 3BG7A 3JRAA 1WVJA 5DYHA 1A6IA 3MMYB 2ZFUA 5CBRA 2V26A 1W4MA 2V9VA 2Q8KA 1QW0A 4JVDA 2L5VA 1SD7A 3P7IA 2H6BA 3PNVA 1UIVA 5K5QA 3S9MC 5H8FB 3KJ7A 1S9HA 1T0FC 5IZ1A 1DP3A 1SYHA 3K4CA 4LGWA 5ET7A 3KZYA 3U1OA 4ZEDA 1YX3A 2R7OA 3Q0WA 3RI4A 1ZN2A 2OZUA 2PMUA 4DYRA 2N8GA 2VB6A 3HRUA 3RYDA 3EPEA 4IGRA 1G0HA 3IAZA 3QYTA 4Z2YA 4CCJA 3BCAA 1LB9A 2MFZA 3RKWA 4ZDMA 1FTAA 1IEJA 2CH0A 3REOA 3VPRA 3SERA 2CZLA 2FMYA 3T9UA 3SEZA 1SQYA 5IY5H 1FBHA 3CFZA 2XHDA 2Q0OA 4ESFA 2ALUA 4D7MA 3BTIA 1ETQA 4I62A 3KEOA 2CZHA 3HHHA 3TW7A 4U0VA 1N3WA 5GP9A 1ZYRF 2L7KA 4CO8A 2O9LA 1QQIA 4H0EA 5LFAA 4YU0A 4WCGA 1FIPA 2ZZVA 3GTQJ 3CCQI 4R79A 5BPIA 4NEDA 5EYFA 1FBSA 3HOTA 3FKJA 1IUYA 1WRJA 4C1TA 4BUPA 1T33A 3WU0A 2WB1N 3SEWA 1BJZA 1FWZA 2ZYKA 1IN8A 1R9LA 1R4MB 3ERMA 3FK7A 1AWCA 4ZYGA 5HBCA 3C36A 2CV2A 3I5OA 1G3TA 2M8EA 2TCTA 4MNUA 4AB5A 1FBQA 2XB5A 4D9JA 4R9GA 4IRIA 1HF0A 3LSMA 1W0UA 1K6YA 1JKRC 1I1SA 4ZYAA 4QPOA 2J5PA 5FLMJ 1KZ8A 3F8NA 1GV5A 2NOOA 1FY7A 4CYCA 2MH9A 4II3A 2Q9TA 1SFOJ 2M8CA 2RVCA 1YZ0A 4HX8A 1S72I 1OMPA 3T9HB 1YIJI 2H98A 2DQLA 2KFDA 4HV5A 4BAYA 3H3UA 2Q89A 2GXBA 1ZR2A 5F0FA 1P4WA 2ESHA 2LP0A 3L1PA 1POTA 3CFXA 5I57A 2W48A 2K5CA 5D4RA 2P5KA 3PTYA 1YLFA 3A3UA 4GOTA 5CVVA 4YFNF 1V5GA 5LGNA 3CLOA 3HV1A 4IO5A 3K6UA 4UHTA 4J00A 1RR7A 2O6AA 4GLIA 2CQNA 4O7IA 3VDFA 3QWLA 4H45A 3HCQA 2ICWG 3F3XA 4IPAA 4RGXA 4A12A 2V3QA 4QSCA 4ECFA 3R26A 3I59B 3ZN0A 1MY4A 4IY6A 2HYGD 2QMWA 2R7TA 4HX7A 2KQZA 4O7MA 4E7ZA 1KZHA 3DM0A 1HKSA 3CCJI 4KN7X 1LBYA 1IXSB 1RDXA 2I58A 2KHMA 5F1RA 3L2RA 5J16A 1XGSA 2QQ8A 3BPVA 3E97A 3L7WA 5KK1A 3G3GA 3M3LA 4XRMA 1MIJA 4GX3A 4XSXF 2DOEA 3ZQHA 3RYRA 2VP1A 2ZXIA 3IO4A 4GBWA 2F97A 2D45A 3MP1A 2O6GE 2E35A 1YW8A 5IZ3A 3UK4A 1UG0A 3B6AA 2MH2A 4HEA2 3IOWA 1NUZA 1B3FA 4YMBA 3KZIC 2EH3A 4D1QA 4IZZA 3MP6A 2CRGA 3LUZA 2ISZA 1HC8A 2GLOA 2Y5LA 2UXAA 4Q5SF 3HZJA 3IJOB 4PFYA 2Y7WA 2BE5F 3KEYA 3OSFA 4XLNF 2QLZA 3PPQA 3GTOJ 2OBPA 2OQGA 1TWFJ 3E5QA 5IOZA 3T9VA 2WADA 2GZWA 4R6YA 4GWZA 4Y7NJ 4YKIA 5EDNA 3P9CA 1V5FA 4FE4A 4XRSA 1URDA 3DELB 4GL0A 4N8GA 3V5AA 2DODA 1EZOA 1FMWA 3GFLA 4EJVA 4MJOA 5EQ8A 4MLVA 2F5DA 4X1EA 5TPAA 4MH5A 2P5VA 4BE0A 4F55A 5BS6A 4OU0A 3H5NA 2JQ7A 1YCJA 4YEJA 1D5YA 3PUYE 4DZ1A 1MQJA 1LVAA 2WC2A 1H44A 3BWGA 1MM6A 3MVWA 4IGTA 4NDLA 3I71A 1LLSA 2IA0A 1IG7A 2HCAA 3KN8A 2E36A 4Y13A 3EDPA 4PDKA 3DBHB 1ETKA 3GMEA 1OMIA 4HW8A 2HVRA 3M1EA 4D5FA 1O7TA 2KRCA 4N4NB 3UNGC 4A0XA 4EXLA 2M45A 1VNDA 2F4IA 2NYXA 2O7OA 2VXDA 1N84A 2HDDA 4EGYA 3FXOA 3HOVJ 3V42A 4AM3A 2QVVA 3VXCA 4DE8A 9ANTA 2L9VA 1R5HA 3MUQA 1LUJB 4FCYA 2MD0A 4HG2A 1SYIA 2X6OA 3CCVI 1NV1A 2OD5A 3K00A 4DDDA 2FBIA 2NS0A 3Q5FA 3W2AA 3LSIA 2L9RA 3C7JA 2RC4A 1OFCX 1OCOH 3FIRA 4M3DA 1O3RA 4IO9F 2F6CA 3V8KA 2OWSA 3MCZA 3C2HA 5DYMA 4EJUA 3KYLA 4GIZA 1HDPA 4HX4A 1J59A 5FLXK 1K9ZA 1VFEA 3O9PA 1B52A 4KD5A 3K1MA 1AKHA 1B3EA 2IS6A 4HNTA 1NV5A 5CMCA 2B3BA 4LOCA 4PF8A 1KA8A 2RNGA 1M5BA 3FVKA 3G2BA 4UUVA 2Y31A 3S2VA 4PGHA 2W85A 3TDZC 1DPRA 2I3WA 2Q2AA 5ISUA 1OCTC 2MKZA 1Z7ME 3SEXA 4M4GA 3GX4X 5CM6A 4IOCF 4OAYA 2LRDA 3I55I 1MXUA 1Z7UA 1VQ5I 2V6EA 1R71A 4LP2B 4MNIA 2GXAA 2UVHA 4PJ0C 1WJCA 3ZGKA 1R6ZA 4F3QA 2GHBA 3S9LC 5HNFA 2PBWA 4H5FA 3DTEA 4NF6A 1NH7A 2Z8EA 4R73A 3F8BA 3HHFA 1L5TA 1PB7A 1JT6A 1QHHD 2W82A 4KIBA 2B4LA 1P99A 2GIVA 3GTPJ 4BU2A 3I56I 3PMVA 4B48A 3QYFA 3TMOA 1WPKA 3S15J 3CMAI 3OWTA 2K40A 5EZGA 1FPKA 3LQRA 2K7LA 5CQGA 3TP3A 1DU6A 4X6AJ 2I5UA 3SEUA 2XF5A 2COMA 5J6XA 1UCRA 3VFJA 4A0ZA 3E3KA 1JEVA 1K9YA 3KE2A 1WJ5A 2JUCA 4ZZLA 3HTSB 3S2WA 5I57B 4KT5C 3CMMA 3TBIA 2OK2A 2P0SA 4F1VA 1F36A 1FPDA 3LA3A 1UB9A 1P1NA 1YW9A 2D1VA 4OYVA 3HDDA 4P11A 1EYIA 5FKOA 4FATA 2XAFA 4XSZF 3S9EA 2XAJA 2OA4A 1MMSA 3LSJA 1BW6A 3DEUA 2WYPA 1H88C 3KP2A 2DT5A 4XLHA 4FISA 5I2KB 4G68C 3A02A 4BE2A 5IT9Z 4O6JA 3AKZA 2WWYA 1NNFA 4Y3OA 4N6PA 3CLQA 4H46A 2XHKA 1FBUA 1DSNA 3HPGA 5DEXB 2M87A 4QFOA 2Y2ZA 2V1NA 1P7IA 3C2GA 3LSGA 2NAZA 3SZTA 4EATA 5GPCA 2EFPA 2XPWA 2MA3A 3BP8A 2QJEA 2LYCA 3FMRA 1FTKA 3CHGA 4AIHA 2VI6A 3FATA 2EA2A 2VPLA 2L9SA 5I59A 4O8MA 4D0PA 1Z77A 3OS0A 1UFMA 4TLMB 1R58A 2X6YA 1T8IA 4LZ5A 2CGPA 2WAQA 3HHGA 3A09A 4XKBA 4FASD 2ZJPF 2QGUA 3M8JA 4FECA 4X9TA 3TTRA 1OISA 4PAKA 5DDGA 2MC3A 2NRAC 2O51A 4L0ZB 2DVZA 5IT3A 2RN7A 2BXZA 2HU9A 1B5HA 4C2MJ 2RCAA 1HQCA 2DDBA 3J81K 3IKVA 4GXOA 1MNMC 1XS5A 3HFUA 3V8XB 4V2FA 1D3YA 5AIQA 1ZKBA 5I56A 3K70D 1U5TA 3I3LA 1X3ZB 4PBQA 1QGPA 4ENJA 5TPAB 4Q0CA 1DMBA 1BTJA 2FBPA 4I99C 4NB5A 1VZ0A 1FZPB 4ITVA 3EN3A 1Y4CA 4MIJA 1IIWA 1KQ0A 4AIJA 3TO9A 1A5JA 3OYNA 1XI6A 3QMFA 1I6HJ 3U93A 1LFHA 3OV8A 4PCDA 3GTGJ 3EYIA 1X19A 4M73A 4U0WA 1TQPA 4QFKA 5DCMB 1ZK8A 3H3ZA 1UTBA 2GH9A 3BROA 1O3TA 4XKVA 2ECBA 3HIFA 5DVIA 4GX4A 1N7WA 2HTSA 3MWMA 4RY1A 1QRYA 5TGTA 2OWZA 4XQFA 1F4KA 3FXMA 4R9FA 4NQ8A 1HOMA 1YG2A 4WF2A 3FISA 2VOOA 2C6YA 2ZJQF 4CCNA 5BMZA 2H99A 3E13X 3H6VA 4PDDA 1ETVA 1MMAA 2QSXA 3MJNA 1MGTA 3RPUD 1FQAA 3D4CA 2XF7A 2F8DA 4LUBA 5LDZA 3RPQA 1FBEA 1AKHB 3TELA 4OWRB 5LHGA 1LEAA 1VQMI 5F24A 3H36A 3R6SA 3HOUJ 4LITA 2XASA 4ZYHA 2E19A 4Z0IA 5K7FA 4FX4A 5CMBA 3OOAA 3ZMZA 5DS9A 3BZ6A 1WJBA 2PBIA 5HOOA 1I1GA 2KZGA 1AMFA 3GWZA 4DOZA 1BIBA 4D5CA 5GAGJ 4ZDOA 1A99A 3AXFA 1WI9A 3QUJA 4ZEKA 5D4SA 3QPSA 2QKMB 2PVUA 1IMCA 1IXRC 1FQBA 2BY0A 5J4VA 1D0YA 1MBJA 2XXTA 5A5LA 4OIPF 3W6JB 5L8DA 1O7LA 5IP9J 1D0ZA 5CMMA 5CMKA 1WI3A 4PSWA 4U7BA 3GXAA 4NF6B 4B8XA 4DXBA 4MMPA 3T8RA 3D5SC 1HW5A 3OY9A 4X1DA 3ZKKA 2NVQJ 3KIOA 4ZE8A 3LV0A 2AO9A 2YR2A 3PFYA 5JLXA 1RDYA 3B6QA 4U23A 5HS9A 3NAUA 1XMAA 4WXCA 3RPUA 1MXYA 1MY3A 2OV7A 1H76A 4Q8RA 4R74A 3JCUC 2CJJA 5CKTA 2CUZA 2NVUB 2HEUA 1U9OA 3FXBA 1IRZA 4X8RA 3RGYA 6PAXA 3CCRI 1TWCJ 3BKIB 4OAZA 5CLSA 3H06B 3BG5A 3I54A 5L9MA 2HZLA 2FYIA 1RI7A 3IOTA 3C4MA 3CI8A 3JREA 2KMUA 5T3JA 2JA7J 4NE4A 2LK2A 2WAQN 4Y17A 3F23A 5HVQC 1LCTA 2M2EA 3Q25A 1T38A 3K1PA 1MBEA 4L9VA 2HZDA 3IV5A 1YW7A 4KYSA 2L4MA 4GYGA 3O97A 3S9NC 2AS5F 4XK4A 3IX1A 5H6QA 4PJNA 1URSA 3PNYA 4FIMA 3P9IA 1ERDA 2I6EA 3IR1A 4JB7A 1S29A 3PSFA 1ZGJA 4NUBA 1A40A 4N4UA 4KUMA 1MBHA 3RQ4A 1F9NA 1NUXA 5D8KB 4C2TA 2H8WA 3ABTA 2JK3A 2IS4A 1J7KA 3MD2A 1LBWA 4UABA 4ESWA 3DP7A 4AWXB 1UMQA 1WJDA 2FX0A 2KIQA 2OWTA 3W2VA 5IGAA 4Y52J 1G0IA 5J3LA 3X2QH 1TZLA 1S9TA 1XMKA 1ZARA 2WY7Q 1OR7C 1E3OC 4IO2A 1DPUA 4WKMA 3PNTA 3NEUA 2TRTA 1O3QA 1YRNA 2DSFA 2UUZA 5I59B 2DBBA 4RM2A 2VUMJ 2BY3A 1MPBA 2TDXA 1P1QA 1HDDC 3MZBA 1X1AA 3SEQA 3BDDA 2IA2A 1NNKA 1KYWA 4AIDA 3N94A 5F6FA 1NL5A 1SI1A 3AG3H 3FVNA 1T95A 1K4SA 1K78A 1PDNC 4GRKA 3E6DA 3OYMA 2DK5A 4IY5A 4BY1J 2FF4A 3BOQA 4F91B 3L2CA 3R61A 5E20A 3MSTA 4ZZAA 3H1CA 3GVAA 1UQWA 3O66A 2VE8A 3EUHC 1OYIA 1FT9A 2RC7A 4LG3A 1R5ID 1ZRDA 2M0MA 1NUYA 1V5EA 2EIKH 4I98B 4LD5A 5LRRA 4PJJA 4EQ9A 1SFUA 2H25A 3HPHA 3RKYA 4YKPA 4WWCA 3CUOA 5HDGA 2F5FA 4BGDA 4A3FJ 3T96B 3BIHA 4WXJA 4XKCA 2FD5A 4MO7A 1ZG1A 2KIUA 3PSIA 3JRCA 1NH8A 1RDZA 4ZH4F 4M3GA 1SEUA 1VQ4I 3EHSA 4MHFA 2HXOA 1D1AA 1LVKA 5C4XJ 1LFIA 2XAUA 1SMYF 4K2EA 5ITPA 2R7SA 1XB4A 3W2WA 2H5YA 1MMNA 2LKXA 4AS5A 4OIQF 1U0JA 3BPXA 1X4OA 1UTBB 1D9VA 4CCKA 2WBDA 3KEIA 4ZEBA 3FXUA 1Q9DA 2PLYA 4Q4ZF 3D5RC 3E5XA 1KQ8A 1YTYA 3V7CA 2IA1A 3LSKA 4QWQA 4EJOA 4YMAA 3KP4A 2DPDA 3O8HA 2LH9A 2GM4A 2ZJ2A 2QVOA 1F43A 4MLQA 4IEJA 2UVJA 3LAPA 2LF8A 4MTDA 4HOBA 1OVTA 4XTCQ 2X26A 2HNHA 3KFWX 1JVXA 2Y84A 3GTLJ 3L2QA 4UNOA 3TP0A 4EM2A 3VWBA 2HDCA 4DI3D 4HV6A 2JVGA 5EQAA 2FQ3A 3CDLA 4M3BA 5FO5A 3OO8A 4NF5A 2HAUA 4XLFA 5EYRA 3PO2J 1IITA 4NTLA 3MYUA 4HW0A 4OVJA 1H9GA 1WJAA 4HA8A 1Y4TA 4XFEA 3G73A 2I4CA 4OESA 1R00A 3A03A 3M9AA 3CIJA 2CW7A 3ZMTA 3IK6B 4GWWA 1RKTA 4U21A 4JX4A 1JW5A 3IAM2 3KZZA 1OJLA 1IUFA 5EGOA 2E1MB 3WHBA 5TRDA 1A31A 2QM3A 4X1BA 5EHMA 3K4LA 3OIOA 1AIVA 5JK4A 5FRMA 1GT0C 1SANA 3SFZA 2DI3A 1DTZA 3CUQA 1VE4A 3FXJA 3CSGA 2V79A 2VJIA 3I5UA 4MFEA 2JWTA 3SEVA 4E0XA 4IKFA 4DGWB 4B3XA 1SBPA 3GLBA 4MHGA 3BR0A 3ZQIA 3BR5A 3RNNA 2DXYA 2KR0A 3RCOA 1BJAA 3OEKA 4R1HA 2X7QA 3HOYJ 1H8AC 1BW5A 2PFBA 4I02A 2VN2A 4YELA 1N78A 3HN0A 5HDKA 1IDYA 5IKBA 3MQ9A 1TT0A 3F6VA 2L9NA 3JRFA 1O7FA 2OZ6A 3HC7A 2Y0MA 4PJMA 1TW3A 2VBWA 4CICA 4IHYA 2W1OA 2Q2EA 2XUBA 4IQJA 1AOYA 4GQOA 2Q2CA 1FC3A 2CQKA 4CYDA 1BR1A 3G71I 1YJNI 1B7UA 3CD6I 1K79A 1S50A 2DWHA 3V7SA 4ELPA 2ABHA 1NMUA 2B3FA 2E2IJ 3CTAA 3TO7A 4JBAA 4CDGA 5JHUA 4JDFA 2VXZA 5DEQA 1LBXA 2GQQA 5FLXZ 1JP4A 2CMOA 2BHZA 4RJZA 3A3CA 2P6SA 2F6PA 4ONYA 4HTGA 4ESXA 1BIAA 1W5TA 2B9SA 4LG0B 3F11A 4KFCA 1P1UA 2XWIA 1D0XA 1RRJA 3KP6A 1EZ9A 1N77A 3Q27A 4DYCA 4O94A 3E3VA 1ORKA 1GLNA 4P0IA 3CDIA 2LY2A 3VFZA 1BR2A 1ATGA 5DV5A 2REGA 1FYLA 4GFRA 4NF0A 4C9YA 3JAMK 4KDPA 4NC8A 5B5EC 4R6HA 2LKPA 1G59A 4RB1A 2F5XA 3H03A 4PQJA 3S2DJ 5DT6A 2GA1A 4J19A 1V55H 3S1RJ 3NWTA 1R9TJ 2KZVA 4D7NA 4IR8A 2HWVA 3LFKA 1YIOA 1RKMA 2HXWA 4H8IA 5M3MJ 3Q29A 1CF7A 5L3CA 1AOVA 2R7WA 3TKDA 2VKHA 4RBOA 1D3KA 3ERED 4N4OB 3CCLI 5H8NB 4EJTA 4CGZA 1RPWA 4B44A 1FSEA 2ISYA 3SQNA 1YJWI 2AXTC 4QRZA 2R5YB 1EYJA 4H65A 4KXPA 4EXKA 1MPDA 4JK1X 2LSOA 1EH6A 5IYCJ 1B59A 1V4RA 4FEDA 1JJ6C 3ISPA 5KDTB 2XWKA 1FSHA 1HSTA 3I9V2 3O6IA 2CEYA 1MW7A 2JA5J 5LHIA 3O2PE 2VT2A 3FK6A 1JKOC 1FPIA 1QUKA 3QAXA 3DP8A 2M5WA 4PZJA 2ME0A 5IYBJ 1JHFA 4UUTA 2R7ZJ 4TV7A 4JVCA 4ABZA 2EJRA 5HNHA 3ZQFA 4BKXA 1YAEA 2QEXI 2R5ZB 1P1WA 2QCOA 3CRBA 2DVCA 1QZEA 4W1UA 3E5UA 1Y8QB 4UV9A 5F0CA 1FPBA 2QPQA 1X1DA 3TL4X 5HODA 1TTYA 4U1ZA 3HOXJ 3MKZA 1HSJA 2Z1DA 1XGOA 1BKAA 3OS2A 1DBZA 2IEKA 2O03A 2ZXTA 3LA7A 2XKPA 4C1UA 4LK1F 4E7LA 1KU2A 1RKWA 5DVJA 2YU9J 2MSYA 2IGNA 3TQNA 3QU6A 2WKYA 4N6DA 2XXIA 3KGCA 1X3UA 3M7GA 4V2GA 4OA4A 4OVTA 3G4SI 3USDA 2EA4A 5HS8A 1DUXC 1IMFA 4BDLA 1QZYA 1INPA 4XF5A 5EJCA 3QQAA 4XKWA 3J7AY 1F9BA 4QSEA 1MD0A 2OZZA 2UVIA 2W7NA 4HF0A 5ICTA 5A2QK 3MZ1A 1MY2A 2KT0A 1OLAA 3KYDB 2PFYA 2DMTA 1QHGA 4IHWA 2E1NA 4F1UA 3A1YA 3G3ZA 1PDAA 1FBGA 2KP6A 1MJAA 4QHQA 5I7IA 1Y8RB 2VBXA 5B1AH 1RETA 4BHCA 3FVOA 1H45A 4U4SA 4DW6A 1SMTA 2O1MA 3ELKA 3J81Z 5JFRA 4WXHA 4POXA 3N5LA 1K7AA 3HBLA 2NS7A 2AQEA 4GVOA 1XD7A 2EINH 1B32A 4BBSJ 2BW3A 3G3IA 1Y39A 3MQ0A 4NHBA 1AA7A 3IRRA 2K4JA 3U94A 1FNNA 5EGOB 2X85A 3S3OA 3JYRA 4P9KA 4ELQA 2K9NA 1MY0A 4BE1A 3G6EI 3EQLF 5I58B 2M4GA 2Z99A 4RK2A 1MM7A 3L2UA 4GGGA 1CB6A 3DV8A 4GYIA 1B9JA 4G4PA 2W24A 4GCVA 1ENHA 5H20A 2MBFA 2Y7RA 4B43A 2JSCA 1TNSA 1BI2A 1OQGA 2QUFA 3BJOA 4XLAA 3RDIA 4AUXA 2O61A 4F29A 2XXRA 2Z33A 2QVRA 4MEVA 3CC7I 2GOMA 5D5XB 1TFAA 3I58A 2D5WA 5FTIA 2L4AA 3P5JA 2KJCA 2Q2EB 4G8MA 3QPTA 4W97A 1TQMA 2DOFA 2FMLA 2ZKZA 3VV5A 2H6CA 3RSNA 5KVRA 2LFBA 2DJNA 3PM1A 2A5TA 4ENMA 3RKQA 1Y0UA 1TWAJ 2JMWA 3FHZA 1I39A 3JZJA 4LB6B 2MD5A 2ZZXA 1I27A 4I6ZA 3ABLH 3BC8A 1SAUA 3DLLF 4EUOA 3NWSA 3PPRA 2K85A 3TOBA 2Z5UA 1MDMA 2W25A 3FHNA 3K4MA 3D0SA 2Y7KA 1JUPA 1XCBA 2J5OA 2M9HA 5E8GA 3H3VK 3GTMJ 1FP1D 1U8BA 1VQ8I 2BJIA 2XGEA 3CP2A 2O0YA 1W36C 1LBCA 3VLUA 3EPZA 2CSOA 3A4CA 5D8LB 2CUJA 4QLCU 3JRHA 3JR9A 1ZRFA 2VD2A 5EHSA 3MVPA 1JGSA 2ELKA 1OYYA 1POGA 1MJ9A 3CSBA 3PPPA 4IO6A 4F3BA 1W5SA 3FVGA 1QNTA 4BHPA 1CF7B 1EH8A 4H6DA 1NG7A 3ZN1A 3KC0A 3N97A 3WTXC 1S5LC 2RREA 3ZQGA 2H09A 3PPNA 4H0WA 3LOCA 2HXRA 3KLNA 4YB5A 1ETYA 1ZLJA 1BL0A 4DXCA 3OYIA 1USTA 2HPIA 3COAC 1YFHA 1Y1WJ 4I76A 2CZIA 4YB7A 2ZYNA 5EEAA 3NOHA 3RPLB 3UP9A 3TEPA 3V8LA 3G7WA 5L9SA 2K4BA 1TWGJ 4P55A 3S32A 4PCQA 2KL4A 4BNCA 1MBFA 4YKKA 2F5VA 1LJ9A 3OL4A 4FAJA 2PJRA 1YS7A 1Z7LA 2HOSA 1PBQA 2E1CA 3UKGA 4XEQA 2V3TA 1REPC 3DQVC 3M3KA 1VQ7I 1PYVA 3IWFA 3U2RA 4G6QA 3LR1A 5AE4A 2WV1A 4QIWN 4XIDA 3HXLA 5B70A 3ZOBA 1SW1A 3WTYC 3WG9A 2FEZA 1U9NA 2Q1ZB 4FX0A 3RTRA 1LFUP 4NX1A 2JVHA 1JKPC 3LFUA 1MBGA 3PFIA 2Y9ZA 4YFXF 1J75A 2IT0A 1B7HA 3MZHA 1HSLA 4O3BA 2QBYB 1R9QA 3JV9A 1T56A 1R5GA 2BBYA 2GXGA 3ABUA 3S2HJ 2IEEA 2RV8A 2L2OA 4OMZA 3PMWA 4NN3A 1N3XA 3GCMA 2YX7A 3P9KA 3BQZA 5FKNA 4BQAA 1R1TA 3CO6C 3K4NA 2REJA 4AQ4A 3AG1H 3IO6A 3DWLE 1CE2A 1HA8A 3OO9A 4FEBA 3H35A 2JPCA 2AYSA 5BUUA 3I53A 2EK5A 4MLOA 3HKZA 1B2HA 2JA6J 1A35A 3GFIA 3B7DA 3ILUB 2XGXA 1VFCA 1Q35A 2FE3A 1T08B 4QPQA 3MAJA 5LBQA 2DA3A 1BC8C 2OQRA 3ECHA 3DKXA 4JWYA 4O5VA 5E3MA 1TWHJ 4U1OA 2VQLA 1Y20A 3FV2A 1B0LA 3QP6A 1WVRA 2VQHA 2W00A 5JR3A 1LFPA 1SC7A 2HKOA 1NK2P 1TXFA 4PFBA 5H6RA 2HZKA 1SVOA 2HQAA 1XCVA 2CS3A 1FJ6A 3DXJF 4IL6C 1YYZA 3OSRA 4JBZA 1POY1 2BW3B 1MY1A 1Z0XA 1VTNC 5F7VA 2XXPA 2R7DA 2XAHA 3S3MA 2XXYA 5KZTA 3CJQB 5ICCA 2CYYA 4LIUA 2VKEA 2M30A 1VQNI 2ZC2A 2B4MA 1RYOA 2QRYA 4RB2C 2THIA 3U8QA 3DFGA 3RJPA 5ICQA 3M4OJ 3FF5A 4XLCA 2W4SA 3K10A 2MYSA 2K3FA 2CMPA 2X4HA 2F4OB 2DA6A 1H89C 2IW5A 4B4CA 3S1QJ 4UB8C 3LQQA 1IN5A 4CH7A 4P56A 4LVQA 4A69C 1BI3A 1M5EA 2PX9A 4F2QA 2VJ5A 2O69A 3E7LA 2PYYA 1YI2I 2RKMA 5ET6A 2DQRA 2WV0A 5LHHA 2Z8FA 3K1NA 2XXKA 1TLHB 1BN5A 2K9LA 2LC2A 1MQIA 2EB7A 1FSAA 4JWXA 3GXOA 2JJKA 3HSTA 1R49A 2VKDA 3J7ZI 1NNPA 3PUVE 2QKLB 1FTLA 2VODA 2JA8J 3A29A 4BDMA 2E71A 1RR8C 1XSDA 4N8YA 2HQRA 2M7BA 3PGFA 5EYHA 5FBPA 1FLIA 2XGCA 1MDP1 1IUDA 1I3QJ 4M6YA 1VF9A 3ZCOA 3IFAA 4ELRA 4G6DA 5L3GA 4MCOA 4AIKA 1OLTA 2ZNUA 1B1BA 2ADUA 2L01A 2LTPA 2LY1A 3H0GJ 1XPXA 2UXNA 2CW0F 3D4GA 3TEDA 4F92B 1JW4A 5JVGF 5I3SA 2HOEA 3ZRGA 3SFIA 2CU7A 1LAXA 1WGXA 4CYCB 1XT8A 2F6GA 3CQZJ 1A7LA 1B6AA 2I10A 4F22A 2DA7A 3SZGA 1UZCA 2FXAA 1KU9A 1SD5A 2EV5A 1Y9UA 5KCJA 4ZE9A 2E1OA 3MKWB 1IV8A 4IHSA 2H94A 1SDXA 3DPLC 5JI6A 4RPOA 4O3AA 2DMPA 4XKNA 3F8MA 1GTKA 1D1CA 4I0BA 1IXIA 1FOKA 1X3WB 4ESJA 1EF4A 2ID6A 2MABA 4U88A 4LLNA 3PV0E 1QUIA 2OX3A 4DLDA 2HZTA 2FU4A 4BJ5C 4H5GA 5E3LA 4FORA 5EYGA 1U2WA 1WDNA 1YO5C 2AQFA 3J80Z 1QPIA 1VQ6I 2R93J 4GWYA 1P9QC 3HKZN 4OFLA 1MXVA 4ZEIA 5B7DA 2XAQA 1T0KA 2FOWA 2WX9A 5DTDA 2EFOA 2DDKA 1B72A 3C34A 2BY1A 3BTCA 4M72A 4QSDA 2AL4A 4PJLA 3CCMI 5ELVA 4NF8A 3PIOF 2CZKA 1ZTRA 2IPQX 4BXFA 4RLQA 3W9VA 3HEFA 2LREA 2M1BA 1Z3YA 1QKBA 5FHOA 5DTBA 5FHMA 5IZ3B 3FM5A 3O6GA 3Q3SA 2XSDC 5K5OA 4G2ZA 4OFJA 3S16J 4YRVA 1NV2A 4PUSA 4F3GA 2CQXA 5E8IA 3OYBA 3OOPA 3TUSA 3T9XB 2V93A 1K6OA 2CFOA 3HPIA 3KX2A 4M74A 4ETSA 4Y15A 4EQQA 3KSXA 1XSXA 3JAMZ 5LEKA 3ODBA 1IZ1A 2IVMA 1R23A 3ABKH 2A68F 1X4PA 1MMGA 3L00A 5HLIA 5BQTA 2OJED 5IYDJ 1IN6A 1DGWY 1VR5A 2X7PA 2HGCA 2DXRA 1USYH 2XD2A 3NARA 2WEFA 4PE3A 2VPNA 3V7RA 1SPIA 4R8HA 5BOXA 3CESA 3CG3A 2VPOA 3DU5A 3WODF 5EEHA 2R0QC 3OO6A 4B09A 4RLFA 2P3NA 3MKYB 3OSGA 2CEXA 1Q1KA 1D1BA 2OTJI 1XG1A 3ROUA 3SHFA 5GTHC 4A5NA 4OVRA 4DZPA 3DCFA 3GYYA 3CCYA 1Y3QA 3ULQB 1B51A 1WH5A 3GFJA 4UUSA 2UZKA 4U2RA 5FD6A 3PUZE 5K2YA 5KNLA 1KWHA 3BTJA 4AVPA 1NHAA 3V4GA 2D1HA 4ZTFA 4ZS9A 4XKPA 4FQGA 2XA5A 5CVJA 3QYEA 5LGTA 4ZEFA 4FTHA 4S04A 4OINF 2KDOA 1SFEA 5FD5A 5ILUA 1DP7P 2I0BA 3OENA 1ZAOA 3BZCA 2DO7A 4FJPA 2CUEA 3L6GA 3M1CA 5JLWA 1FQDA 1LB8A 1KONA 4CZCA 1SVXB 5CYVA 4P47A 1WZ2A 3BJAA 5FKMA 4JSDA 1ONVA 3K6VA 1IO2A 2WA0A 1WH7A 2DTZA 1ELJA 4G94A 4ASNA 4C3JJ 2V4CA 3K0LA 3UR3C 3B6WA 4KHZE 4N07A 5ET5A 2P5LC 3MVXA 4GFBA 4BXXJ 3VB2A 3WG7H 4PFTA 4HLXA 1II5A 4HCYA 5IPAA 4FETA 1LAFE 5J8CA 3SESA 1FW0A 3LUYA 1TNTA 3HUGA 3ROJA 3C18A 4P9UA 1FBPA 4J01A 2IGMA 1AU7A 4WEDA 5HLTA 2BYVE 2P8TA 2VPRA 4V19K 1X1PA 2R7UA 1X58A 2FSWA 1MH4A 1UG2A 3GTJJ 3OXNA 3F72A 2DA5A 3I64A 3NQOA 2F3DA 2M7AA 3M8UA 4RAFA 4ZDLA 5D5VB 1TFDA 4A0YA 4YIRX 3E79A 2DWAA 2G29A 2VT5A 2R6GE 3OMYA 2DJIA 4BDOA 5A2QZ 1I6QA 1ZHFA 5E1ZB 3VVFA 2ECCA 4N6KA 3IL2A 1C0WA 3S17J 5BNGA 2ONSA 2UYFA 4P8BA 2RQPA 3L9FA 4PF6A 3JRIA 2CQQA 1KQ9A 5GPAA 3PMXA 2M0CA 3GYHX 1JVYA 2E7XA 3PQKA 2Q74A 2XXQA 4ZZEA 2XPUA 4A3GJ 2IS1A 3H3GA 1ACIA 1HLVA 4OHNA 2DYSH 3Q26A 4PK4A 4MX6A 3WU1B 5CC2A 2VD3A 1HKQA 4CCOA 2K9QA 1XTAA 1LEBA 1MXXA 3HYIA 4UV8A 4LZ8A 4WEPA 4XIGQ 5JEIA 5KCJB 3K4KA 3CCEI 2XXXA 2HXIA 3L6HA 1FTMA 1W5CC 2DQVA 5LLQA 3T1BA 3OELA 3MPLA 4BHBA 2QWWA 1JQFA 4C0RA 2MW8A 2BGCA 1LAHE 4NQWA 3U92A 2JA2A 2ZB9A 4M6XA 4WXDA 1DPEA 2F7BA 4N13A 5M5YJ 2LVSA 4HE1A 2F7CA 2DYXA 5JTYA 1BOAA 2XWVA 5M5XJ 3WTSC 4KJZA 1ZBMA 2E60A 2HEOA 2M34A 2MLKA 2PEXA 2XF6A 4RB3C 3ML6A 5L3EA 2FIEA 2D21A 2GQ1A 2DN0A 3JW4A 2XKOA 3GLXA 2QFLA 2OCCH 1EH3A 1XX5A 1UTHA 2RC9A 5IP7J 1B72B 3TFLA 5J1DA 3S4UA 1USSA 1PBPA 3TKYA 1IRXA 2LAOA 3L2WA 4MNCA 5CBSA 4POWA 2Y30A 3FXRA 3S93A 4BDYA 1GGGA 3KG2A 2ZYOA 1B4HA 4XOPA 4P0GA 1SD4A 1A54A 3IH3A 3SEYA 3IB0A 1HSEA 3WGHA 3IP4B 1T39A 5FFXA 3VE1B 1G3YA 3HRTA 2DMUA 2BEOA 2RQQA 4A93J 3H6WA 2I3VA 2F48A 4IOAF 5EG0A 2XRLA 2DA1A 1JEUA 2PT2A 2DT7B 3HOWJ 4N91A 5FKKA 5BPDA 4KYDA 1P4XA 3VYUB 3DTKA 1NUWA 1YJ9I 2K9MA 2CV0A 3KJTA 3PUXE 4PTKA 4ZECA 5I56B 1P1OA 1U5TB 5GTIC 1NK3P 1EV7A 1I69A 3RT6B 1MXZA 2PG4A 2Y75A 3BR6A 3B73A 4YIIA 4KNYA 1QJMA 4DCXA 3H5AA 1S6LA 1TQIA 1T0FA 3KOTA 5H8HA 1EJ9A 3RPWA 3FIWA 3OYKA 1FOXA 3TCHA 3E6CC 3AFHA 4NC6A 5F04A 1IDZA 3OYLA 2VBYA 2LNBA 4KIFA 5FFZA 1IXHA 1XOCA 4BBRJ 4MF3A 2O3FA 2BOLA 4ZZDA 3U1KA 2XC7A 4FHTA 2DW4A 2DPUA 1Z3XA 1H3DA 3ZQQA 3C33A 1X1CA 2KISA 1E0EA 2XXUA 4UVAA 5DCFA 4BDNA 4BACA 3MW0A 3FV1A 2HTJA 2KQRA 1Z6TA 3TTMA 2F2EA 1GR2A 1YOVB 1XC1A 1NG6A 3OIQA 2ONRA 1GXPA 3KOSA 4BEHA 1B4ZA 1VFDA 4YG2F 4KIGA 3JRBA 1FTJA 3GF2A 2CV1A 1R22A 2NOJB 3DBRB 3F9KA 3CCSI 3RYPA 1ZQ3P 4OETA 2ZMEA 2VKVA 3RKXA 1BIYA 4NMYA 2E5NA 5LEJA 2LY9A 3PQJA 1NKXA 2EPFA 1Z67A 4XMYA 4RDUA 3GZGA 3S3NA 2R3SA 3ZXSA 3IOVA 3HGGA 3LBSA 4HNVA 2X1DA 4IHVA 3GBAA 3RIRA 3I3VA 2YJPA 1G4DA 1ZMGA 3BFUA 2ETHA 2ME6A 4L5JA 3DPTA 2VJJA 1JNFA 1BR4A 3W6KB 1KU7A 1FTTA 2UYEA 4L17A 4F3PA 3DEWA 2VOPA 3CJNA 2NNYA 3QIMA 1LBBA 3BR2A 3DKWA 4KFQA 3GLLA 3AL0B 4N0BA 1FOYA 1U5TC 1S7AA 1W1WE 4HXVA 5HM4B 2BVMA 4MQVA 2Y0SA 2XX7A 1V54H 4EJWA 2DOJA 2WAEA 3QODA 4RAYA 5L3FA 5FGMA 3KCCA 2GFEA 1LFGA 2GIZA 2AIXA 4CA0A 2OCEA 5ESYA 5DM7F 1LDJA 5H8FA 4EGZA 1OCPA 3J80K 5LD2C 3WE2A 3HOZJ 2JN6A 1KU3A 3ZMSA 1JXSA 1JI8A 2Y5KA 3T0JA 5I84A 1I5ZA 2P1SA 1O4XA 1N76A 2R7VA 4LK0F 1Y0NA 4HQEA 1NI9A 2QMXA 1FX7A 4GO1A 4KCDA 4O3CA 2QL3A 1IJWC 2V84A 4F93B 2E5ZA 2EWNA 2JZYA 4GWSA 4ZDPA 1J09A 2L54A 1FPGA 3LSHA 5CVUA 4A3DJ 2O68A 3RTFB 4KQPA 1FBCA 4BDQA 4NBQA 2DU9A 1UIUA 2R71A 3VSKA 2GBYA 4F52A 4I8CA 2JRTA 1URGA 4BDZA 3K70C 1LBVA 5L3BA 4N81A 5M2VA 2MLGA 1XN7A 1B3LA 1XHYA 5B3SH 2IJLA 2CW8A 1BC7C 1GHCA 2F36A 4LFUA 4NF4A 1N25A 3ZMUA 4H1XA 2JPBA 2IS2A 3WTZA 2ZBKA 1B40A 3K4UA 3IH2A 1BM9A 4LLGF 3S1NJ 3FXKA 5IM2A 2X6XA 1FIAA 2IGOA 2V6CA 4KN4X 1NV3A 2DE2A 2NS8A 4BL0B 4A3EJ 3R0AA 1YYVA 4G12A 4JP0A 1YRNB 5GAEJ 4L0YB 4A3LJ 2G7HA 3RY3A 4F2OA 1STZA 3H0DA 2RCBA 4CZZA 2MC4A 1WODA 2F7AA 2G93A 1SFXA 2HDWA 4A3CJ 2E1MC 3HGYA 3T0YA 1JUMA 1JE8A 1K78B 1QULA 3TTKA 4A6DA 5JVTA 1N75A 1K4TA 4U22A 2F3BA 1M1EB 5J1UA 1WHUA 3OYCA 3GUDA 4B3AA 1B5IA 2DAOA 4UVBA 4DBRA 2B0LA 3Q0UA 5K7ZA 3AL0C 4XKQA 1XC5A 3DPUA 5B1BH 2QQ9A 1Z1DA 2FOKA 3WGIA 4GWOA 2R4GA 5K1YA 3OYHA 2DWJA 2O84X 2RDPA 3WTWC 1J9IA 2OBGA 3O3KA 3KEQA 5E79C 2QA4I 1B8IA 1LAGE 1O63A 4JQFA 2WAFA 2DE3A 2DFFA 2E0SA 2EV0A 3K2AA 3MZYA 4BQNA 4KISA 2PX1A 3IOUA 1YHQI 4DIGA 3ONQA 2Q88A 3ECOA 4H4KC 1B3HA 3ILTB 1ETWA 1ON1A 2OU2A 1MQDA 3LL7A 4RAGA 4AD9A 1Z21A 3WAEA 3C1DA 2LR8A 3DTIA 2V7FA 3BCBA 4M9ZA 2ID3A 1LKXA 2LF7A 3KP7A 4IRHA 2HVSA 3EHTA 2CUFA 4PC9A 3FX3A 3F22A 2K9SA 5TP9A 2FNAA 4OENA 1GVDA 3EUKL 5CVRA 2NVTJ 2R7RA 5AA2D 1N0TA 1LDD