3K1NA

Crystal structure of full-length benm
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
303
Chain Sequence
b'MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 88
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1nA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA03
2Z3YA 2HS5A 5I58A 2NS0A 4PGGA 1R7JA 2CG4A 1YAEA 1R1VA 2ZBKA 2BYVE 5CJ9A 4GL8A 1DPPA 3TTNA 2P7VB 3GXAA 4NF8B 1O3QA 3I54A 3Q9SA 4OTEA 3H92A 3LSLA 3DP7A 4TLLB 1RNLA 5LRSA 1ZLKA 3M3KA 1MQHA 1VE4A 3E5UA 4GXOA 4I0AA 2R6GE 4ZYEA 3KCCA 1KU3A 4U4SA 3OXNA 2NWJA 2OJTA 1HSJA 2O1LA 1QQIA 4EF1A 4HCYA 1HW5A 4QF9A 1MXWA 2M30A 1NL5A 5LGTA 3TPAA 3KFWX 1POTA 3T8RA 2BV6A 1NH8A 5FB2A 4N9IA 1URDA 4FORA 2A07F 3FVKA 3U94A 3BROA 4IRHA 3CFZA 3IO4A 4GVOA 2EFNA 4HF2A 2E1SA 5I2NA 1MGTA 1AIVA 3I58A 3BBRA 4ONYA 1BIYA 3FD3A 2X7QA 1T6SA 3WGHA 4DNCA 4HQEA 3FJMA 3QAHA 3PPOA 4A0YA 3F3XA 1CB6A 3T8TA 3VB2A 3IKTA 3C9HA 1G3YA 1TNTA 2P4WA 1IUDA 1MZBA 3SEUA 3CUOA 3T66A 2DYXA 1LVAA 1RIOH 2JRTA 1MY4A 2V93A 1QKAA 4EQQA 2HTSA 1YW9A 2G9WA 4DXUA 4MTDA 3T1BA 1MDP1 5TPAA 1ZIUA 5L8DA 1ULYA 3ERED 2FYIA 2UVHA 3KP5A 2EA2A 2CO5A 3TMGA 3B02A 4YICA 3KZYA 4OIRF 3TKYA 2DWHA 2XV4S 1NHAA 5LEJA 4LQ2A 3M8EA 5KZTA 4IO2A 2DE2A 3WTVC 2ZXTA 3QUFA 5L3BA 4YZZA 2QS4A 2P0SA 1TTYA 1U3EM 1LEAA 4EJWA 4E70A 3GW2A 1B3GA 2ONKE 3VLVA 2NUVA 5FHOA 2XAJA 1MPBA 4KPTA 5DVJA 3R7XA 3IL2A 4GXAA 2B3BA 3ZP5A 1I6BA 3V7SA 3E3VA 3GZGA 1EV7A 1R22A 3OO9A 3IAZA 2DK5A 1KYWA 4HV5A 2IT0A 4KT5C 4NE4A 3E97A 3A3CA 4ELRA 3VEPA 4PETA 1JE8A 2Q2CA 1GGGA 1IN5A 1JVXA 5FGMA 5I56B 1YTVA 4H65A 4EM2A 2YJPA 4IF4A 4Y17A 4ISUA 1G6NA 2ISZA 3KFMA 3HHFA 3ECOA 3FVGA 4O3CA 3IORA 2ISYA 3J80K 5IKBA 4FT8A 4JWOA 1YW8A 3IWFA 2VGQA 3EHSA 4GCVA 5TRDA 1H44A 2XX8A 4G68C 1TQPA 4PFUA 5DVFA 2E1CA 2GA1A 5JEIA 1P4AA 4AWXB 1FBUA 4M73A 3TEPA 1UFMA 2STWA 3A09A 4ESXA 4YIFA 3C7JA 4R6HA 3S2VA 2XD3A 3AXFA 1W5SA 4PZJA 4B09A 4M72A 4U7DA 4NTLA 4IO4A 3I71A 3OV8A 4XKQA 5E17F 2Z33A 3OD7A 2OWSA 3G3FA 3QP5A 4U0WA 3G3IA 3MZ1A 2XUBA 1FOKA 3USDA 4PFTA 2O68A 4YKIA 4E0XA 1F9BA 3PUVE 4LATA 3K01A 1Z6TA 1A8FA 3IRQA 2O0YA 3Q25A 1MD0A 3N6TA 3RNNA 4LONB 2QBYA 4BAYA 3ZSFA 4BHBA 1LB2A 4RPNA 2F6GA 5I58B 4F7ZA 1B3HA 5B7DA 3E13X 1SYIA 5CVRA 5HLIA 1UTHB 2XXTA 4LG0B 2WWYA 4RA1A 2CFXA 1ZRCA 4I62A 5ICEA 4CGZA 1SMTA 1U5TC 4G9YA 4OU0A 3TTMA 2HEUA 2E1NA 3KGCA 2GXBA 1UIVA 1IN6A 3V5AA 2GZWA 1Y4TA 5KCJA 5ERIA 4Z7EA 3U2RA 3FMQA 3PPNA 3PPQA 3B6WA 1BI0A 3TQLA 5DD4A 2RC4A 2FU4A 2PLYA 5TP9B 4CXFA 4IO6A 4M6XA 1DDNA 2YPRA 5HPQA 3EDPA 5L9MA 2CYYA 4LFUA 2HZTA 2V3QA 3TTLA 2NYXA 1FQEA 3L09A 3H4ZA 4I8CA 3EYIA 3PQJA 5D5XB 4MF3A 2H4IA 1Y9UA 3MBPA 4ZH4F 4L5JA 5D8LB 4U1OA 4NF5B 4POWA 2QS2A 1Z91A 2PN6A 3U1DA 3E3KA 3KP4A 3ZMVA 4XKRA 4THIA 4ESFA 3TGNA 3PGFA 2F7BA 4NWDA 2R71A 1CF7B 3TDUC 4ZYGA 1OYIA 2B0LA 5DUKA 1GV8A 1BC8C 5FD5A 2VC1A 2A3SA 4HZFA 4MEXF 1IF1A 1TNSA 1U8RA 3R26A 2W7YA 4YFNF 1LBCA 1B46A 2RQPA 1UTBA 3ZKKA 1MG1A 1BIBA 3WTSC 3C32A 2J5PA 3SEXA 4H5FA 3LAPA 1ZGAA 3RLFE 4YIIA 1DP7P 1QZZA 3IOWA 4OHNA 2KIFA 4F29A 1YS6A 4KMUX 5H8SA 4ZZEA 1FZPB 3SHFA 3HOSA 2OZ6A 2HCAA 2HDCA 1HW2A 3VOEA 3I3VA 4A6EA 1B1XA 4HW8A 4ESWA 5B70A 1B1BA 3OEMA 3VFJA 4D0PA 2QQ9A 2AS5F 1W7PD 3CVGA 3WAFA 4I0BA 1F4KA 3EN3A 4OOIA 3E5XA 3TZAA 5AA2A 5I57B 5F7VA 3KLNA 4ZEKA 4EJTA 5E1ZB 4L5IA 1JW4A 5BMZA 3RGYA 1D9YA 1K7AA 4M9SA 2ZYKA 1ZU0A 5D5UB 2XKOA 1SD3A 4KCDA 4LA9A 3TKDA 3RDIA 1RUOA 1TWYA 4H8JA 3CO6C 1HQCA 1QGPA 4EJUA 4PE5B 3N4MA 2GA2A 1HKQA 3BJOA 3HSRA 3C18A 2RDPA 4EGYA 3IOVA 5CC2A 4DQ2A 1ZYRF 4ND9A 2COMA 4RB3C 1XC1A 3QIMA 3DKWA 2DAOA 2YR2A 5DEQA 3MVXA 1MXUA 1N0TA 4AIHA 1LCTA 1LFIA 5ICQA 3FGSA 2A6HF 3M1EA 3MWBA 1IXGA 4ESJA 3HV1A 1MPCA 3IK6B 2PMUA 4G4PA 4I9DA 1MY2A 2FNPA 4P0IA 5KK1A 1MM7A 3R4KA 3TYHA 1LDJA 2DS9A 4BQAA 1HSLA 3H3GA 4Z0IA 1URGA 4O3MA 1USSA 2DPUA 3KEIA 4ZZAA 3OELA 2FOKA 4OMZA 5AA4B 3HCQA 4RXLA 2Z23A 2W85A 1XSXA 3JTGA 4JXIA 3CUQB 3RT8A 3F11A 3MQ9A 5ILVA 2KJBA 2QQAA 4EM1A 1XGSA 1IN8A 2Q0OA 4BDLA 2K4JA 1TFAA 5H8NA 2V84A 4GXSB 2FSWA 4L9TA 4UXNA 1LAFE 1MXYA 5JTYA 4NHJA 4ZE8A 4WF2A 3D4GA 5JHUA 2NXOA 3F8FA 5LLQA 4OWDA 2V25A 3ZMZA 1GHCA 5KVRA 3CG1A 2ZYMA 1WKMA 3MFKA 5LRRA 2VOOA 3HO7A 5ITPA 3QUJA 4G68A 4BDQA 3HN0A 5A5XA 1TLHB 2F5XA 3IL1B 4GWOA 4EF2A 1BI1A 2AYSA 2QMXA 4FHTA 3V8LA 1JHHA 4ELOA 5ILUA 4KUMA 2X26A 1B0LA 4OIQF 5L3DA 5E8IA 2PJPA 1LCFA 2ANJA 2EFQA 1S7OA 2LAOA 4LLLA 4L9NA 2NAZA 5LEKA 3IRRA 2RC7A 1TW3A 2F35A 2XXVA 1MRPA 4G8MA 3ECHA 3V8KA 1USYE 4NF8A 1P1NA 2Y7KA 3MCZA 3HYIA 3H3ZA 1YPNA 4XSXF 1I1SA 5FTIA 3WGGA 4ASNA 3H6TA 3QU6A 1OPCA 4I09A 3MP1A 2EJRA 2C6YA 4BXUA 3CLOA 1Y1ZA 2D5WA 5L3FA 2ZFWA 2BEOA 3N6UA 5CBRA 4IRGA 2UYFA 2AL4A 3ELKA 3WODF 1NNKA 4RB1A 2VOPA 5DCMB 2XAQA 1OR7A 3CFXA 2J5OA 2PBIA 2QYOA 1FNNA 1E17A 4C1UA 1D9VA 3DPLC 5H8HB 4BDMA 1K79A 4P0GA 4GF8A 1WRJA 4FJPA 2P7CB 3OMBA 2K7LA 1P1UA 3S4UA 3IKVA 3A3UA 5CMKA 5BPDA 1P6RA 2O7IA 2I0BA 5HDGA 2QSXA 3RT6B 3N97A 1SI0A 1O3TA 1KQ0A 4GYGA 1VSOA 1REPC 2I4CA 1DPUA 4QLCU 1B51A 2VC0A 4EQ7A 3E6BA 3ONMA 4N9HA 2WKYA 3T22A 3B6QA 1UIUA 2K02A 3R60A 4BLAA 1T39A 3L00A 4QFKA 4X48A 2QVOA 4YB5A 4B8XA 3BP8A 3KJTA 1WI9A 1XGMA 3S9NC 4RYAA 3TCGA 5LHHA 3CIJA 1B3FA 3DXJF 2H27A 4ON0A 5K5QA 4RJZA 3RIRA 1VFDA 4GIZA 2XXRA 2XASA 1UCRA 3BY6A 1RZ4A 4G77A 1Y3PA 2XAHA 4F2QA 3D5LA 4LK0F 2F5EA 1OIBA 1RYOA 2W25A 1M5FA 2IA0A 3CUQC 1KA8A 3W15C 3SXYA 3TCFA 1MQJA 4XKPA 3MPKA 4R79A 2DQLA 3R0JA 3EUHA 5F64A 5I56A 4U88A 3Q26A 1IZ1A 2PFBA 3O6BB 1FQDA 2O6AA 2HYFA 3FXQA 1R1TA 1MDMB 1MY0A 1L5TA 3GUDA 5F1QA 2GAUA 2DU9A 4IHTA 1VR5A 3OEKA 4H6DA 3M8UA 2H09A 2UVIA 2ELHA 4MLVA 1ZAOA 3ISPA 1QVSA 2XXUA 3TUSA 4Q5TA 1SW1A 3LA3A 1QBJA 1A40A 2XXXA 3P9IA 4M9XA 1NFTA 2R7FA 4AIKA 1A54A 4DXCA 2RKHA 1UB9A 3THIA 3MVZA 5ED4A 1H45A 1II5A 1BOAA 1TFDA 2MLGA 3HHHA 5AA1A 2KIMA 4KR5A 2XX9A 2E7XA 4OIPF 2Z8EA 2IJLA 5LBQA 4H0WA 1IN7A 4CYDA 1EH7A 3G3JA 1FY7A 1V3FA 3K2DA 2OAZA 4M4GA 5TU0A 3AAFA 2RF1A 3QYTA 1SW5A 4I01A 3O66A 4NWCA 1TXFA 3L6HA 2HGCA 5HOOA 3F8CA 1U6GA 4YFKF 3ODBA 2JTVA 2D2WA 2XX7A 3R61A 2TDXA 1UTHA 4LG0A 1DUXC 2RGVA 1L0OC 1B32A 1FW0A 2OD5A 2ZNYA 3HTUA 2Z9OA 4G8NA 2JPCA 2FBIA 1FPQA 1S7AA 3L9FA 3LA2A 2XXHA 4QSEA 2VODA 2Q8JA 2OBPA 4KYSA 4M74A 3H06B 1N3WA 5CBSA 3ILTB 1SW4A 3MZ9A 1M5DA 4R75A 3IOUA 4GFRA 2AXLA 3QP6A 1BLFA 2MC3A 5TP9A 4U2RA 2GXGA 3V7CA 1U5TB 1LAXA 2REGA 5IT3A 1B2HA 1Z1DA 5HS8A 4MFIA 2HQNA 3KP6A 1KGSA 3TCHA 3FVNA 4I02A 3W9WA 4WXHA 3MEXA 2Y7IA 5ICFA 3ZKLA 2VBZA 3EF7A 4NF5A 2P6TA 1JQFA 2UXNA 2EV6A 2OZUA 4LQ5A 4FAJA 4HAMA 3CRBA 1LB9A 2DSFA 3SEVA 1XMKA 3FF5A 1CF7A 2G7UA 1Y1MA 1R9QA 2RCAA 2GFEA 3B73A 3T9HB 5L9SA 3Q28A 1Z7ME 4OMBA 3P9CA 5HBCA 2FXAA 4F39A 3L7WA 3PUYE 2DO7A 1FSEA 3WGIA 4YB7A 2P5KA 1LQ1A 1T38A 1YCJA 1P2FA 5BS6A 4Y15A 3EQ1A 5AE4A 3R0AA 4KYDA 1J59A 2IEEA 1F9NA 2HZLA 1T0KA 1D3YA 1D5VA 3MPLA 4ZDMA 3I0TA 2OK2A 4O3BA 5H20A 3B7DA 1ZRFA 1LB8A 4AQ4A 1IQ7A 3O2PE 3ZMSA 4P96A 4IJAA 1YG2A 2O6GE 4G7HF 4NQWA 1UQWA 2NNYA 2ETHA 3TOAA 1MXXA 3UGWA 3DFGA 3K69A 3K6VA 4RGXA 1IRGA 1A99A 2A5TB 2E7WA 3CDHA 4XIGQ 2VHAA 5J6XA 3WTYC 1Y0UA 3OO6A 1PUEE 5I57A 2DWIA 2I4BA 3JV9A 2Q8KA 1A55A 2P1SA 2ZYOA 3GZ6A 3K00A 2V1UA 2KLFA 3PUXE 4L0ZB 5ICTA 4R6YA 3HSTA 2F8DA 1F1ZA 1SQYA 1MH4A 3P7IA 5ILSA 3ZMDA 4ZS9A 4HV6A 4A0ZA 2JSCA 2Y7RA 1Z05A 4UA8A 1USTA 2RVCA 3IHUA 4G7ZF 2O7UA 4QSCA 2RCBA 1MXVA 2O1MA 4LP2B 4KFQA 5L3CA 4U22A 3DLNA 3RKXA 3FV1A 4U4XA 4KI0E 1B7UA 4NF6B 1XB4A 2D45A 5K5RA 3Q9VA 4HOBA 4HLYA 3VDFA 3FWEA 4AVPA 4CO8A 1P99A 3PU5A 4PDKA 3QSLA 2ZCWA 2QENA 3M3FA 4S04A 4WX9A 1DPRA 2IA4A 3E6DA 3TO6A 1UHMA 4YFXF 3BZ6A 5LGUA 2KKOA 4DE8A 2VD2A 3Q29A 3FM3A 2ESNA 3IJOB 3C36A 2M45A 5AA4A 4YAHX 3PQKA 3K1NA 4RGRA 4MTEA 4EGZA 4U0VA 2F6PA 4A2UA 3PMXA 5JVTA 1SDXA 3UN6A 4YMAA 5DUIA 3CUQA 4FE8A 1XOCA 2OA4A 1XT8A 1TBXA 1OYWA 1CGPA 1J7KA 1Q1HA 1B7ZA 2OZZA 5DCFA 4F22A 1R1UA 3G3ZA 1QULA 4EJVA 1BJAA 5I59B 1U78A 1VFEA 4KYEA 1RYXA 1MKMA 1MJAA 1N04A 4QSDA 1IITA 4Q5SF 1N76A 2ZNTA 1NH7A 4QFNA 2EFOA 4IRIA 1PEBA 4RAYA 2FEZA 3M7GA 3KP7A 3DP4A 4N07A 4RNSA 4L9JA 1SFXA 4EVIA 3TTKA 3PFIA 3T9VA 3GXOA 3E6CC 3DPTA 1IXSB 5LHGA 2FBHA 1K6OA 4MH5A 1P4XA 3H6VA 4MLQA 2ZMEB 4M1VA 2ZMBA 2Y84A 3GEZA 2I49A 4KNYA 3V83A 2KRFA 1P4WA 1KQ8A 2P8TA 2Q89A 2DQVA 4U7BA 4OEUA 1ZHFA 3D0SA 4WXCA 2PVUA 3ILUB 2XGXA 2E0SA 1W7PB 2HZKA 4UVCA 4X1BA 3WTWC 4OVJA 3MZBA 4M71A 3ULQB 4XXUA 2NRAC 3VODA 2F78A 1SBPA 3VLUA 3F22A 3LSXA 3OO7A 4Q4ZF 3UK4A 1FLIA 4DCXA 1S3JA 4IO5A 3LWFA 1ZN2A 1EH6A 4RY1A 3SEYA 2OWTA 4EM0B 1XHYA 1EZPA 4I2OA 2KIUA 3GO5A 3LA7A 3MUQA 1HSTA 4Q30B 3T9UA 2CMOA 4HQMA 2DE4A 1HXDA 4DCYA 2L4AA 3EYYA 3RPUA 1PB8A 5DCMA 2NNNA 2BE5F 3G7WA 2UVJA 3HUGA 4BHCA 2BBYA 5AIQA 3IJXB 4GQOA 1MXZA 4WCGA 5H8HA 2ZO4A 2RINA 2HFBA 2HR3A 3SFZA 1GXPA 3FXRA 2RV8A 2QUFA 2W24A 2DXRA 1BC7C 3CSBA 2GHAA 4KCCA 3S9LC 4TLMB 3U93A 2PQ8A 2I48A 4U0YA 4AIJA 2I3VA 4KIBA 3RTWB 2DK8A 3HRUA 4KIFA 5I2KB 1B0HA 4F3SA 4OENA 4EXLA 1ZG5A 3CTAA 2QPQA 3REOA 1D8JA 1SD5A 4RK2A 2NOOA 2Q2EA 3F72A 1QUJA 3TELA 1YS7A 4GL0A 2CQKA 4ENKA 1B4HA 4RB2C 1OLCA 3MWMA 4O6JA 4ZEFA 2Y7WA 1R36A 2PG4A 1WODA 3VXBA 1DPEA 2FQ3A 6PAXA 3B6TA 4CHUA 5JFRA 3KG2A 5E18F 5D5VB 3O29A 3TTRA 4L9VA 1NNFA 2XRNA 1G3SA 2DE3A 1R5GA 1ZJLA 3K6XA 2HTJA 4X9TA 3J81Z 2F34A 1TQIA 2FMLA 2XKPA 2G93A 1GVCA 5E8GA 4KDPA 4LJZF 4LD5A 3FASA 5D4SA 1W4MA 4A6DA 4ZEIA 2LF8A 3PUWE 1DOTA 5ITOA 4JK1X 3MZHA 3QPTA 5DVIA 1FBQA 2IVMA 2R7DA 3GVAA 1MDMA 2CZLA 2LNBA 4K2EA 4F1VA 3GFMA 1X3UA 2MA3A 4QFLA 2YX4A 4KN7X 2EV5A 4NEDA 1LBBA 3RYPA 3FUZA 1J9IA 3L6GA 2QM3A 5M2VA 3SETA 1CE2A 2QMWA 1H9TA 3EHTA 3FIRA 3BFTA 3N94A 5FLXZ 3H03A 2QQBA 2XXQA 3L2CA 5FTHA 2F5DA 1EU8A 4IO3A 2L01A 2DBBA 2QL3A 2QLZA 1SI1A 5HDNA 1ZMGA 5I84A 1B9MA 4KHZE 4ZZLA 1AOYA 3HRTA 1HKTA 4HS7A 4GOTA 1PB9A 2H94A 2VOZA 3MP6A 3CJNA 2THIA 5HVQC 3IB1A 4ZEBA 3WTZA 2VN2A 2EWNA 2IP2A 1MY3A 4LLGF 5DYHA 1POY1 1IAWA 2MH2A 2HYGD 1DTZA 1NNPA 2XXWA 1IRFA 1BI2A 5H8QB 1HKSA 4R74A 3IB2A 1L3LA 1O3SA 5DD8A 2P5VA 3RY3A 4KD5A 1GXQA 1QUKA 3I5UA 2M8EA 4IB2A 4GRKA 1LSTA 3KBRA 2HKOA 5CRYA 2D3IA 1KU9A 1OMPA 3SERA 1EH3A 2UXXA 3V7RA 3V4GA 5BUUA 3FMSA 1IXRC 4P9FA 1SVXB 2HQ0A 2Y7PA 1H3DA 2I6EA 2QRYA 3OSQA 1R58A 1B6HA 3ROUA 1MM6A 3GBAA 4HX7A 1R23A 2AL5A 3W9VA 1U5TA 4NF4B 4ETSA 4QWQA 1MY1A 5FHNA 1YYVA 2L3DA 2ZJ2A 4FATA 5JK4A 3SESA 2JZYA 5LGNA 2VE8A 2UVGA 4EMSA 3BPVA 1ZG1A 1B9JA 1N3XA 2OQRA 4RGUA 1FQFA 3FATA 1P1OA 4H5GA 5CI5A 1AWCA 4S05A 2AIXA 4G8XA 1QZYA 4P5OA 2UWMA 3IC7A 4DDDA 3M3LA 1OYYA 3BKIB 3C33A 3DP8A 3F8BA 2HKXA 3I64A 2A69F 3V8XB 2V9VA 4LZ7A 5HS7A 5DEXA 2MLKA 1WQ2A 4LVQA 3LFKA 5DV5A 4MQ9F 4LB6B 4PP0A 4PFYA 3I59B 2FRHA 2Z99A 4I1DA 3U9GA 1YLFA 2ZNUA 1KWHA 3T5XA 3IR1A 4EJOA 1I5ZA 4QHQA 2MBFA 3FM5A 1B5IA 1NMUA 4FEDA 4R6KA 3QPHA 5D5WB 4N6PA 2V1XA 2UXAA 3C1DA 2O03A 4TV7A 3PD8A 3ZS6A 4U21A 2HWVA 3JAMZ 1R1NA 3J81K 3WTTC 3K0VA 4YKPA 2A5TA 4I7HA 3U92A 1SD7A 1IXHA 1US5A 3U1OA 2XHKA 1S29A 2HEOA 3E6MA 2EFWA 1YQAA 4JWYA 3COAC 5IT9Z 1JEVA 2HFHA 4JB7A 3PPRA 3BFUA 3QU3A 1ZG3A 3KSJA 5F1RA 2PYYA 3R6UA 1YTYA 3I53A 1FWZA 1TQMA 1MQIA 4OESA 3SEWA 4BDRA 4LZ5A 4XRFA 2W84A 1LEBA 1STZA 1GTKA 3PD9A 2XROA 1XMAA 2DPDA 2ACJA 3O97A 4LUBA 2PX1A 3ZMUA 3O28A 1Z7NE 4H8IA 4HX4A 3JSOA 1N7XA 4JQFA 1K78B 4G6QA 1I1GA 5FLXK 4ELQA 1Z9CA 3Q27A 4DXBA 2Y75A 4NF6A 4YG2F 4Y13A 1G3WA 4F3GA 2ADUA 1MH3A 5K1YA 1DSNA 2RC9A 3TODA 2M5WA 4ZZDA 2M1BA 1ZARA 1M5EA 2B65A 2LKPA 3H6UA 1PP7U 1PDNC 2H25A 2YSRA 3LR1A 3FXUA 4HDVA 5H8FB 4R72A 1SFEA 3KETA 3NQOA 1XSVA 2XIGA 3ZQ7A 4R1HA 2PT1A 1Y3NA 5DT6A 2WTEA 2HAUA 4OFJA 4CICA 4PGHA 1B4AA 4QRZA 1XGOA 1I6XA 3PPPA 3VV5A 1I69A 3MVWA 1T98A 5ICCA 2QWWA 5HM4B 3GWZA 2H6BA 5AONA 4GGGA 4ELPA 1FYMA 4HYEA 3QRFF 3KN8A 2DFIA 3KN7A 3LQQA 1PC3A 2K86A 4ENJA 1XVYA 1J1NA 4RK9A 4EQBA 3F23A 3F8MA 4CZZA 1JW5A 4TOZA 5I59A 2XAFA 2XVCA 4XSZF 2VD3A 4GLIA 1FP2A 3KJ7A 4KICA 5HLGA 1O64A 1NNTA 2LSOA 3PUZE 1IEJA 3M9AA 1LDDA 2RNJA 1ODDA 2XXIA 1BBYA 4KYWA 5LOMA 1I6AA 2VP1A 4IO7A 1Z6RA 5EEHA 4UNOA 2Z5UA 1JEUA 2ZMEA 3DQVC 3TO7A 4R2FA 4ZECA 1C0WA 1SD6A 3D4CA 3HRSA 2VE9A 5BWJA 2QZ8A 4HDUA 1A7LA 4HX8A 4FX0A 2F36A 4Z2YA 3NEUA 2IA1A 1O7TA 1M5CA 1ZGJA 3RQTA 4U23A 3K02A 4XBFA 1WSUA 1W7PA 2GQQA 3TAJA 2A61A 2CW0F 4DIGA 1FC3A 1QKBA 2XXPA 3TOBA 4AD9A 4POXA 4IY6A 1MQGA 1FTKA 3ABTA 4HTGA 3P7NA 3I5OA 3DEUA 5DEXB 3VXCA 4RGSA 4OXVA 2M8CA 2OU2A 4F1YA 2PMSA 1YO5C 5E20A 1FYKA 5TJJA 1XS5A 1XGNA 3HHGA 2GHBA 1B59A 2IW5A 4H67A 1FTMA 2ZYNA 3U8QA 3HIFA 3ZN0A 1OQGA 1B58A 5CMBA 1XD7A 1MJBA 4WXDA 5HLHA 2DXYA 2JPBA 4MHGA 4EQ9A 1FTLA 4UVAA 2VBYA 3KE2A 4AB5A 3JAMK 4YU0A 3H7MA 2A68F 1US4A 1RI7A 1AH5A 2MH9A 5CVIA 4G7OF 5I2KA 3KZZA 1GVJA 1WWXA 1J2XA 4M9ZA 4TQUQ 2RN7A 1HSEA 3LSFB 3N5LA 3JW4A 2Y0MA 4RB0A 5IT9K 2O69A 4KA4A 3TDJA 4KN4X 2G29A 1SD4A 3O9PA 4Q47A 4G6DA 2YPNA 3E5QA 4WWCA 4ZEDA 3S9MC 1AMFA 5KDTB 2ALUA 5L3GA 2DWJA 1NKXA 4EV0A 4R9GA 3RJPA 2P2AA 4OYVA 1B6AA 2DVZA 4IHSA 5ICGA 2EV0A 1SFUA 2KJCA 4N13A 3O6IA 4FIMA 4PQJA 4BDOA 3WTXC 1OVBA 1B7HA 1QPMA 3RPWA 1B3LA 5A2QZ 4G94A 2A5YB 4XLPF 1FQCA 2IPQX 1LAHE 1XVXA 4WK8F 3TO9A 2L54A 3PV0E 3RKWA 3KEQA 4YKJA 2PBWA 2V79A 1XN7A 1V4RA 2I3WA 2ONSA 5BOXA 2B3FA 4GD5A 4QFPA 1Y20A 5L3EA 3K0LA 2F2EA 2HXWA 3DP6A 4OINF 4N0BA 5D6EA 1B5HA 1R00A 1Y4CA 2D1VA 1PDAA 3BWGA 3I4PA 4Q8RA 4ESBA 5DDGA 2Q9TA 1KU2A 3K1PA 2VONA 4LMYA 3T0YA 4P55A 4R2BA 2RC8A 2PEXA 1MS7A 4BHPA 3MQ0A 2O51A 1FT9A 4GO1A 4MNUA 3IB0A 4BDNA 1E2XA 2Y48A 2DWAA 3C4MA 3OOAA 3OSRA 3SZPA 4OEVA 3TDZC 1BN5A 2OBGA 3CR9A 5EEGA 3VFZA 4WXJA 1YW7A 2OQGA 3C34A 1ATGA 1R5HA 3HSEA 4O5VA 3FJ7A 5JI6A 2Q2AA 3CFLA 1LNWA 1H76A 2K27A 2UYEA 4K3FA 5CYVA 1O7LA 4UV9A 3Q5FA 4KMFA 4E0WA 2DOJA 1RKMA 5CMMA 1Q35A 2DI3A 1A04A 1KYZA 4G8HA 2QS3A 3KZGA 4OFOA 2ZNSA 2HQRA 4F18A 3T93B 1Q1KA 2DVCA 2V1DA 5H8QA 5HS9A 1R6ZA 4JWXA 1O57A 1DMBA 3P9KA 4A0XA 3MAMA 3C3WA 1XCBA 5AIPA 3U72A 4LZ8A 1S50A 1ZLQA 1JXSA 3QOPA 4KFCA 4O3AA 3GYHX 1J75A 2IA2A 3UIFA 2WV0A 4JDFA 5I2NB 1P1QA 4IPAA 1DTGA 3WTUC 3IOTA 4EUOA 2Z8FA 1LAGE 4H0EA 3O3KA 2F7AA 1KQ9A 3SKPA 1ZLJA 3WE3A 1ZH5A 1T0FA 2VBWA 3S2WA 2WC2A 3EQLF 2DTRA 3HSFA 1D3KA 2QS1A 3N26A 1B40A 2YU3A 3F8NA 2H6CA 5CVVA 2RKMA 1WDNA 2R9JA 3MJNA 3G3KA 2GRVA 3MW0A 4NF4A 5ISUA 4EDPA 4L18B 1XSDA 4FX4A 4A5NA 2PMHA 5TPAB 2F5FA 1FQAA 3JTHA 1D4NA 3K6UA 3KP2A 4OQOA 3G73A 3MAJA 1A8EA 2OCUA 4MEYF 3ZPLA 3OOPA 1UHWA 1XCVA 1BM9A 3WU0A 4YB6A 1EZ9A 4OMYA 3CSGA 3GLBA 3BOQA 2D1HA 2FF4A 4AB6A 3EPEA 5CVJA 4WEDA 3UP9A 1G3TA 1P92A 2O8XA 4IGRA 4UV8A 5J8FA 2EA4A 3MC2A 4LB5A 4F3PA 2DP8A 2R3SA 4OIOF 4RS8A 1JVYA 2V6CA 3QXMA 3W6KB 3DV8A 4X1DA 1VTNC 4MGRA 3G3GA 2V3TA 2EB7A 1U2WA 4F19A 5BQTA 1LGBC 3I59A 5FFXA 4FEBA 3UORA 4YMBA 2VXZA 3K6WA 1P1WA 5CLSA 3RUMA 1MDQA 1YFHA 3RN8A 3OO8A 3O2AA 3K9TA 3C31A 2GIVA 1S7YA 1QJMA 3GFIA 1Y3QA 3JSPA 4OFLA 4HA8A 4YKKA 3V89B 2ZKZA 1N84A 3H6WA 3LSWA 1ON2A 1BP5A 1B5JA 1LFGA 4WEPA 2ABHA 4IXAA 1N7WA 1M5BA 2BGCA 2PI0A 3K1MA 4Q0CA 1QNTA 1F5TA 3KOSA 5FO5A 2A6EF 5A2QK 1KU7A 2DW4A 1ZREA 1OVTA 3JYRA 4UVBA 2Q88A 3DM0A 1IN4A 1BIAA 1B3EA 4RPOA 1OKRA 3BJ6A 3WG9A 3LAJA 1S8NA 3WU1B 3IO6A 3NRVA 3KN3A 4BNCA 1JNFA 1B9NA 3PMVA 1IW7F 1QUIA 4R73A 3FHZA 3VVFA 4OETA 4NMYA 3DELB 3J7AO 1OQHA 3EHUA 3V8JA 3CO7C 2L02A 1BKAA 4L0YB 4PFWA 2H99A 1ZTYA 3RTFB 1R9LA 1K78A 3BPXA 3F6VA 2GWRA 4A12A 1URSA 4WKMA 4ZE9A 3S9EA 3GFLA 2QBYB 1PP8F 1EZOA 1LDKB 4RAZA 3G3HA 1BI3A 1IIWA 1FTOA 3O6HA 2ESHA 5JR3A 3LC8A 4P11A 1YIOA 2K4BA 2FE3A 2JT1A 3FX3A 2Z8DA 3GFJA 2XXYA 5K2YA 1HW1A 1MJ9A 3TQWA 4OERA 2O61A 5H8FA 2X4HA 3E4RA 2VT3A 4XKNA 4DZ1A 4UUVA 1USYH 3F6OA 3HTSB 4KQPA 4HCWA 5EHMA 5DYMA 4Q48A 3VVEA 4G2ZA 5KCJB 3GX4X 3R6SA 5K5OA 4IGTA 4F1UA 4R8HA 1BTJA 3KSXA 3OENA 5EHSA 2ZNZA 4FECA 3WAEA 2FA5A 3ML6A 1SW2A 2REJA 2FNAA 4C0RA 1FQBA 4LGWA 3ZMTA 3BDDA 5BPIA 2F7CA 3DF8A 5FD6A 5E1WA 2O84X 5J8CA 3RI4A 4GYIA 2CGPA 5D8KB 5K2XA 1ZRDA 2F97A 3T96B 2X7PA 2A5SA 1JETA 3WE2A 4EXKA 3HRMA 1GR2A 5J1DA 4H1XA 3GLXA 3FJGA 4I98B 2LDUA 5D4RA 1LFHA 1B1HA 1H43A 3RYRA 2FA7A 1LJ9A 2Z22A 4XLNF 1FTJA 4ZYDA 3GF2A 4M6YA 2IRFG 4OZ9A 3T9XB 4HF1A 4IVNA 2F5CA 3FV2A 2XHDA 3SZTA 1H0MA 1JHFA 3CI8A 2H98A 3EETA 1FSHA 4NB5A 2X0LA 1S9TA 4U1ZA 4XTCQ 2MD5A 1QO0D 1HBXG 1O63A 5D6FA 3TQNA 4HLXA 1OLAA 2H9BA 3FMRA 1QW0A 1UTBB 2DLLA 1ANFA 4ZYHA 4F2OA 4PCQA 3KEOA 5E1XA 3IWZA 4F3BA 2P6SA 5IAIA 1S6LA 1LLSA 3KP3A 1H9GA 2GH9A 4CDGA 1TT1A 1ON1A 3W6JB 1ZKBA 4IY5A 3UA8A 4ENMA 2XAGA 5CVUA 5LHIA 5H6QA 3IX1A 1FP1D 1WVJA 4C1TA 5AA2B 3FVOA 4MBPA 2FMYA 4ENNA 3VVDA 3HOTA 4MQVA 3HPIA 3M8FA 3KOTA 3PMWA 4ECFA 2QJEA 4R9FA 2VBXA 5DTBA 2BJJX 5FFZA 2PT2A 2HAVA 1SAXA 1FCKA 1MQDA 1JW1A 5HDKA 2I58A 1FX7A 1B4ZA 2D21A 3GZ5A 1OMIA 2V3UA 1TW2A 4QFOA 3ZN1A 4BYYA 5AA3A 2YLNA 1RUNA 2I0CA 4KIGA 1ZBMA 1ELJA 4UACA 2NVUB 4HF0A 3SDFA 2ONRA 4LK1F 1W5TA 3SQNA 4A5MA 2H5YA 1D8KA 2L4MA 5CMCA 3LSTA 1SMYF 3VLWA 3ECRA 3ABUA 2CSOA 4JSDA 5KDTA 4F31B 3RTRA 4UHTA 3GBBA 3BJAA 2G7HA 1XDUA 4JSOA 2OLBA 5AA2D 1XDSA 3C35A 2M87A 4DLDA 3JZJA 3I6VA 1I27A 1EH8A 2DQRA 1B05A 2EK5A 3RKYA 4HBLA 5FHMA 1PB7A 5CM6A 1AL3A 2DT5A 1SYHA 2XD2A 1O7FA 3KLOA 1PBPA 2HOEA 4BH9A 2VT2A 3J80Z 5L9OA 3RPQA 1PBQA 2LF7A 5ELVA 3K4UA 1IXCA 4JBAA 1MPDA 4HW0A 1AOVA 4P9UA 2STTA 3FZVA 3LQRA 2CWEA 3O6GA 5H8NB 3VE1B 1JGSA 1B52A 1O3RA 5JTYB 5H6RA 3MZYA 1G4DA 4L17A 3LUYA 3LBSA 5F6FA 2YX7A 1IUYA 1I6QA 2FNCA 3CG3A 1FBSA 3E9XA 1J5YA 3TFLA 3MVYA 4G68B 5EYFA 3MP8A 5A5XB 2O3FA 3F21A 1J0RA 3QK6A 3H3UA 2ZXJA 3K2ZA 3QAXA 1FYLA 2UZKA 4JBZA 4LLNA 1IXIA 2W57A 1Z7UA 1T2KA 2P5LC 1ONVA 2FBKA 2EFPA
chains in the Genus database with same CATH superfamily
2Z3YA 4KT6A 2PFZA 2HS5A 4PDHA 4MMPA 5I58A 2Y5LA 2AQEA 2NS0A 4PGGA 1R7JA 2OTLI 4HSRA 2CG4A 2EQRA 1YAEA 4M3EA 3OIQA 3ZRGA 1R1VA 2BXYA 2ZBKA 2WAQA 5GTIC 5JHFA 2ZB9A 2BYVE 5CJ9A 2NVXJ 5IZZA 1FOYA 5FKLA 4GL8A 1WJAA 4C3JJ 1DPPA 3QPSA 3TTNA 3WHBA 3PO3J 2P7VB 3GXAA 4NF8B 1O3QA 3I54A 2IS6A 1BR4A 3Q9SA 4OTEA 3H92A 1O4XA 3LSLA 2NS7A 3DP7A 4AU7A 1RNLA 5LRSA 1ZLKA 3M3KA 4TLLB 3CCRI 1MQHA 3B50A 1VE4A 3E5UA 4GXOA 4I0AA 2JMWA 2R6GE 5HNHA 4ZYEA 4L5EA 3KCCA 1KU3A 4P9KA 4U4SA 3OXNA 4ZJZA 2NWJA 5EZHA 2OJTA 1HSJA 4NNJA 1QQIA 2MC4A 2O1LA 4HCYA 4EF1A 1HW5A 4GFBA 4QF9A 1MXWA 2M30A 1NL5A 2PJRB 5EYGA 5LGTA 3TPAA 4XOTA 3OYIA 3KFWX 1POTA 3T8RA 2BV6A 3OYDA 3BR5A 3PNYA 5M5YJ 1NH8A 5FB2A 4N9IA 3HM5A 2NVYJ 3CJTB 1FRPA 1URDA 2FBPA 4FORA 3DEEA 2A07F 4PC9A 4FCYA 3FVKA 3U94A 3LV0A 3BROA 3MZ8A 4IRHA 1JJ8C 3CFZA 3IO4A 2EFNA 4GVOA 4HF2A 4BE0A 2E1SA 5I2NA 1D1CA 1MGTA 2X6WA 1BL0A 4GBVA 1AIVA 4OAZA 4PJLA 3I58A 3BBRA 4ONYA 3OYHA 1BIYA 3FD3A 2X7QA 1SANA 1T6SA 3WGHA 2FUG2 2X9DA 4DNCA 3QAHA 4HQEA 2R7ZJ 3FJMA 4A0YA 3F3XA 1CB6A 3PPOA 3ABKH 3I4MJ 3T8TA 3VB2A 3IKTA 3C9HA 1G3YA 4D7MA 1TNTA 2P4WA 4O8MA 1IUDA 1MZBA 3SEUA 3CUOA 4RLQA 3T66A 2DYXA 4GX4A 1LVAA 1RIOH 2JRTA 1MY4A 4HG2A 2V93A 1QKAA 1IMAA 4EQQA 3GTGJ 2HTSA 1X3ZB 1G0HA 1DP3A 1LKXA 1YW9A 1FPKA 1LFBA 1I50J 2G9WA 3KIOA 4MTDA 4DXUA 3T1BA 2WY7Q 1MDP1 5TPAA 1ZIUA 4RBOA 2PFYA 2LC2A 3PTYA 5L8DA 3SEQA 1U0JA 1ULYA 1B8IA 3ERED 1DU0A 1QPIA 3KP5A 2EA2A 2CO5A 4Z6YA 2FYIA 3B02A 2UVHA 2F3BA 3KZYA 4YICA 3TMGA 2CW8A 4OIRF 2VLAA 3RCOA 4PJJA 3TKYA 2DWHA 2XV4S 2HVQA 1NHAA 4OA4A 1G59A 5JLXA 1Y1VJ 1AKHA 5LEJA 4LQ2A 1LBYA 3F9KA 3M8EA 1S5LC 5KZTA 4IO2A 2DE2A 2I10A 3WTVC 2ZXTA 3QUFA 2K40A 5L3BA 4YZZA 2W48A 2QS4A 5F04A 2P0SA 1TTYA 1U3EM 1LEAA 4EJWA 4E70A 3GW2A 1B3GA 2ONKE 3VLVA 1IV6A 4FE7A 1QVUA 3OYCA 2NUVA 5FHOA 2XAJA 1MPBA 4KPTA 5DVJA 3FBNB 3R7XA 1F43A 3IL2A 2CJJA 4GXAA 2B3BA 3ZP5A 1X1CA 1I6BA 3OYMA 3V7SA 1MNEA 3A03A 3E3VA 3GZGA 1MBGA 1EV7A 1R22A 4IO9F 1Y39A 1KYWA 2DK5A 4XM3A 3IAZA 4HV5A 3OO9A 2IT0A 4KT5C 3MKZA 3HOYJ 4NE4A 3E97A 5J47A 3A3CA 4O94A 4ELRA 3VEPA 2BXZA 2E1MC 4PETA 2WBMA 1QVTA 1JE8A 2QF7A 1GGGA 1IN5A 2Q2CA 3EKIA 1E3HA 2ECCA 2L0KA 1JVXA 5FGMA 5I56B 4BE2A 5FLVA 4RA2A 1HLVA 1VZ0A 1YTVA 4H65A 4EM2A 2HZDA 2YJPA 4IF4A 4Y17A 4ISUA 3TMOA 1G6NA 2ISZA 3KFMA 3HHFA 1MIJA 3ECOA 3FVGA 4YEJA 2P81A 4O3CA 4BBRJ 1KA1A 5I7IA 3IORA 2ISYA 3J80K 1LEVA 5IKBA 3FBIB 4FT8A 4JWOA 4BJTA 1YW8A 3IWFA 2VGQA 2F3DA 3EHSA 4GCVA 5TRDA 1S7EA 4XONA 1H44A 2XX8A 1TQPA 4G68C 4PFUA 2HVSA 5DVFA 2E1CA 2GA1A 1PUFB 5JEIA 1P4AA 4AWXB 1FBUA 4M73A 1XMXA 3TEPA 1UFMA 2STWA 3A09A 4ESXA 4YIFA 3C7JA 3NAUA 4DIQA 2HPIA 1IXIA 2FOWA 4R6HA 3S2VA 2XD3A 3AXFA 1W5SA 4PZJA 4B09A 2ZJQF 1NH3A 4M72A 4U7DA 1WJFA 4IO4A 3I71A 3OV8A 3QPLA 4NTLA 4XKQA 2NVQJ 2Z33A 5E17F 3OD7A 2OWSA 2WB1N 3G3FA 3DCFA 3QP5A 4U0WA 3G3IA 3MZ1A 1VQLI 1TWCJ 3LL7A 2XUBA 4OWRB 2KL4A 4RAGA 1FOKA 3W6VA 1G8XA 3USDA 2MG4A 2CQ7A 2HNHA 2E5NA 4PSXA 4DJAA 2O68A 4PFTA 4YKIA 4E0XA 1F9BA 3PUVE 4LATA 3K01A 1Z6TA 1A8FA 2JVHA 2QEXI 1VQ5I 2FJ1A 1MMSA 3IRQA 2O0YA 3LSHA 3Q25A 3RGYA 1MD0A 3AL0C 3N6TA 3H9GA 4LONB 3RNNA 2QBYA 3GMEA 4BAYA 3VPRA 4ZTJA 3ZSFA 4BHBA 3QYFA 1LB2A 2F6GA 4RPNA 2CZHA 5I58B 2DMQA 4F7ZA 3DEWA 1EYKA 1B3HA 5B7DA 3E13X 1SYIA 4II3A 5CVRA 5HLIA 1UTHB 2XXTA 2KZGA 1Z3YA 4LG0B 2WWYA 5EEAA 4RA1A 1U9NA 3CJRB 4V19K 2CFXA 4XICA 4N17A 1ZRCA 4A3LJ 1DK4A 4I62A 5ICEA 4CGZA 4GBWA 1SMTA 1U5TC 4G9YA 4OU0A 3CCQI 1K9ZA 3HOVJ 2HEUA 3TTMA 2QKLB 2E1NA 3BQYA 1N77A 3KGCA 1W1WE 2BY1A 3HPHA 2CUEA 5GAHJ 2GXBA 3TBIA 1UIVA 1IN6A 5T3JA 3V5AA 2GZWA 1Y4TA 5KCJA 2VQGA 5ERIA 1ACIA 4JOMA 1K4TA 3U2RA 4Z7EA 3FMQA 3FK7A 3PPNA 3AG1H 3PPQA 2R4GA 2BY3A 3B6WA 5B3SH 1VQ8I 1BI0A 1ETYA 3DTKA 3TQLA 4QTRA 5DD4A 4PCDA 4M3BA 2WYKA 2RC4A 2FU4A 2PLYA 5TP9B 5F24A 3PO2J 4CXFA 4A3DJ 1V5FA 4M6XA 4IO6A 1DDNA 2YPRA 5HPQA 3EDPA 5L9MA 2CYYA 4LFUA 2HZTA 2V3QA 3TTLA 2NYXA 1D0YA 1FQEA 3L09A 3H4ZA 3KYDB 4I8CA 3EYIA 1QZEA 5EDNA 1EKEA 1X1DA 1V5EA 1RETA 2M4KA 3PQJA 4CA0A 5D5XB 2WAFA 2ME6A 4MF3A 4XRSA 2H4IA 5IP9J 3MKLA 3UNGC 1Y9UA 3MBPA 4ZH4F 4L5JA 5D8LB 4U1OA 1MBJA 4NF5B 4POWA 1LBXA 1Z91A 2PN6A 2QS2A 4GWWA 3U1DA 3CCMI 1VF9A 2EINH 3HG9A 3TP3A 2L9VA 3E3KA 3KP4A 3ZMVA 4XKRA 4THIA 4ESFA 3LFUA 1X4PA 3TGNA 3PGFA 1YX3A 2F7BA 3DU5A 2R71A 1CF7B 3TDUC 4NWDA 1G0IA 4ZYGA 1OYIA 4GX3A 2B0LA 5DUKA 1GV8A 1BC8C 5FD5A 2VC1A 2A3SA 4HZFA 4MEXF 2LH9A 3CD6I 3S14J 1IF1A 1TNSA 1U8RA 1NUYA 3R26A 1N75A 1VQPI 1N78A 2W7YA 4YFNF 1LBCA 1B46A 2RQPA 1Y6IA 5M3MJ 1MG1A 2DFEA 1UTBA 2XXKA 1BIBA 3ZKKA 1OCOH 3WTSC 3C32A 2J5PA 3SEXA 4H5FA 3LAPA 2OF7A 1ZGAA 4DGWB 4YIIA 1DP7P 5ET8A 3RLFE 1QZZA 3IOWA 5IPAA 2KIFA 3EUHC 4OHNA 2DA3A 1YS6A 4F29A 4KMUX 3RYDA 5H8SA 4ZZEA 2ME0A 1FZPB 3K4NA 3SHFA 3LSPA 3HOSA 1FTZA 3FBPA 2OZ6A 4NQWB 2HCAA 2HDCA 1HW2A 3VOEA 1EA3A 4A6EA 1B1XA 3I3VA 4X6AJ 3HXLA 4HW8A 4ESWA 5B70A 1B1BA 3OEMA 2DYSH 3VFJA 4D0PA 2QQ9A 2AS5F 1W7PD 3CVGA 3WAFA 4I0BA 2PMZN 1F4KA 3EN3A 4OOIA 3E5XA 4NHBA 3TZAA 5AA2A 2X1DA 4MFDA 5I57B 5F7VA 1A6IA 1WJCA 3KLNA 4ZEKA 4EJTA 3HJEA 5E1ZB 2R7OA 4L5IA 4ANJA 5BMZA 3PM1A 5FKNA 1D9YA 2CS3A 1K7AA 4M9SA 1JW4A 4M3FA 1ZU0A 2ZYKA 5D5UB 2XKOA 1SD3A 3PSIA 4KCDA 4LA9A 1LFUP 5LDZA 3TKDA 4ZDOA 3RDIA 1DBZA 2VJ4A 1RUOA 2VQCA 2L7ZA 2VQLA 4I99C 4X1EA 2DA2A 1TWYA 3LSIA 4H8JA 3CO6C 1HQCA 1QGPA 4EJUA 4PE5B 5EGOA 2GA2A 3N4MA 3SDGA 1P9QC 1HKQA 2LBFB 3BJOA 4PBQA 3HSRA 3C18A 2RDPA 2VJJA 4EGYA 3IOVA 5CC2A 4DQ2A 1ZYRF 4ND9A 2BHZA 1WJDA 2COMA 1PYVA 1TWAJ 4RB3C 1XC1A 1X1BA 3QIMA 3DKWA 2DAOA 4XLEA 2YR2A 5DEQA 3MVXA 1XS9A 1MXUA 1N0TA 4AIHA 4IHVA 1LCTA 1LFIA 5ICQA 3FGSA 2A6HF 3M1EA 3MWBA 1IXGA 4ESJA 3HV1A 1MPCA 3IK6B 2OC6A 2PMUA 4G4PA 4I9DA 1MY2A 2FNPA 5F0FA 4P0IA 4GWUA 5KK1A 1MM7A 3R4KA 3TYHA 1LDJA 2DS9A 4BQAA 1Y0NA 1HSLA 3H3GA 4Z0IA 1URGA 2JJ7A 3KX2A 2QVVA 4O3MA 1USSA 2DPUA 2BVLA 3KEIA 4ZZAA 1RC9A 3OELA 2FOKA 4OMZA 1H88C 2FIEA 5AA4B 4I6ZA 4G6TB 3HCQA 1ETKA 4RXLA 2YU9J 1A31A 2Z23A 2W85A 1XSXA 3JTGA 4MCOA 4JXIA 5EZGA 1NV1A 3CUQB 5M5XJ 1VQOI 1IG7A 3RT8A 3F11A 3MQ9A 3KYLA 5ILVA 1UJ8A 2KJBA 2QQAA 4EM1A 1XGSA 3CDIA 1IN8A 2Q0OA 4BGDA 3OYBA 3JRDA 4BDLA 2K4JA 1TFAA 5H8NA 3DU6A 1MMDA 5EF6A 2V84A 4GXSB 3KPHA 3C2HA 2FSWA 4L9TA 4UXNA 1LAFE 1MXYA 4GDFA 4G61A 5JTYA 2FD5A 4NHJA 4ZE8A 4QPQA 3JREA 4WF2A 3D4GA 1AA7A 2CRGA 4PF6A 5JHUA 1ZKGA 2NXOA 2EIMH 1VQKI 3F8FA 5LLQA 4OWDA 2V25A 4JX6A 3BG3A 3ZMZA 1JKPC 1GHCA 5KVRA 3CG1A 2ZYMA 1WKMA 5LRRA 2A6TA 3MFKA 2VOOA 3HO7A 5ITPA 1APLC 3QUJA 4G68A 2P3NA 4BDQA 3HN0A 5A5XA 1TLHB 2F5XA 4A3BJ 1OCPA 3IL1B 4GWOA 4EF2A 1ZR4A 1BI1A 3CMYA 2AYSA 2QMXA 4FHTA 3V8LA 4YIRX 1ITYA 1JHHA 4ELOA 1P7JA 4KUMA 1WHUA 5ILUA 1B0LA 4OIQF 5L3DA 2VQHA 3ABLH 5E8IA 4C3HJ 4HNUA 2PJPA 1LCFA 3GCMA 2XPUA 3Q3SA 2ANJA 3L2RA 2EFQA 5CQGA 1S7OA 1BW5A 4LLLA 2X6YA 4L9NA 2NAZA 1FOXA 2LAOA 2JA8J 5LEKA 3S2HJ 3IRRA 4IHWA 2RC7A 1TW3A 3W2WA 2F35A 2XXVA 3H1CA 3PUBA 5C4JJ 1MRPA 4G8MA 3ECHA 3V8KA 4OAYA 1OCTC 1USYE 4NF8A 1Z67A 2R93J 1P1NA 2Y7KA 2KDOA 2V4JC 3B8BA 3MCZA 4CSWA 4BY7J 5LFAA 3S8PA 1NV7A 4N91A 3HYIA 3H3ZA 2HDWA 2EIKH 1YPNA 1SVMA 3FXOA 4XSXF 1I1SA 5FTIA 3WGGA 5FROA 4ASNA 3H6TA 1DU6A 3QU6A 1OPCA 3OL3A 2PJRA 4PAFA 4I09A 4MH5A 2OJED 4XRMA 3MP1A 2EJRA 5F0HA 2C6YA 3VSLA 4BXUA 3CLOA 3OYAA 1Y1ZA 2D5WA 5L3FA 2ZFWA 2BEOA 3G6EI 2MYSA 3N6UA 5CBRA 4IRGA 4CCJA 2UYFA 2AL4A 5ET6A 3ELKA 3WODF 1NNKA 1D1AA 4RB1A 1SC7A 1CNQA 2VOPA 5DCMB 2XAQA 2GOMA 1OR7A 3CFXA 2J5OA 2PBIA 1SFKA 1E3PA 2DMTA 2QYOA 1FNNA 2CQXA 3HUGB 1E17A 1D9VA 3DPLC 4C1UA 5H8HB 4BDMA 1K79A 4P0GA 4GF8A 1WRJA 4FJPA 3W15C 2ZFUA 3QYEA 2VASA 2IAIA 2P7CB 2K7LA 1P1UA 3OMBA 3IKVA 4IR8A 3S4UA 3A3UA 1JTYA 5CMKA 5BPDA 2XF5A 1P6RA 4XKBA 2O7IA 2I0BA 5HDGA 2QSXA 3RT6B 3N97A 1SI0A 1O3TA 1KQ0A 4GYGA 4ZTFA 1VSOA 4OVPA 1REPC 4MIJA 4ABZA 1FBHA 2I4CA 2QVUA 1DPUA 4QLCU 1F36A 3BG7A 1B51A 2VC0A 4EQ7A 3E6BA 3ONMA 4N9HA 4CUGA 3NWTA 2M7AA 3BT9A 2WKYA 3B6QA 3FK6A 1UIUA 2K02A 4YELA 3R60A 2Y2ZA 4BLAA 3BTIA 5K7ZA 1MNMC 2XF6A 5FRNA 1N25A 2Q2EB 2F4OB 3HC7A 1YIJI 1YOVB 1T39A 3L00A 4QFKA 4X48A 5J16A 2QVOA 3FXMA 1LUJB 4F3QA 4YB5A 4B8XA 3HOZJ 3BP8A 4B47A 4CCMA 1WI9A 1XGMA 3KJTA 1NV5A 4N4NB 4RYAA 3S9NC 3TCGA 5LHHA 3L2UA 3CIJA 1B3FA 3ZQHA 3DXJF 2H27A 2R5ZB 4P3LA 5LTCA 4ON0A 5K5QA 4RJZA 3RIRA 2QSFX 1VFDA 3CC7I 4GIZA 3DWLE 1FPGA 4PFPA 2ID6A 2XXRA 2XASA 4HPQA 4XMYA 3VDXA 1MBHA 3W3CA 4BACA 1UCRA 3BY6A 5J4YA 1RZ4A 4D9JA 1I6HJ 2K9NA 1RESA 4G77A 1WCMJ 1Y3PA 2XAHA 4F2QA 3D5LA 4LK0F 2F5EA 1OIBA 1RYOA 3K4JA 3A29A 4E7ZA 1NK3P 2W25A 2DA5A 4RM3A 4AYBA 1M5FA 2IA0A 2X51A 3CUQC 4XK4A 1KA8A 4AUXA 2O9LA 2QKMB 4XORA 1QRYA 2OUMA 3SXYA 1JUPA 1MQJA 4XKPA 3TCFA 3MPKA 4R79A 2Q8MA 2DQLA 3R0JA 2XWKA 3EUHA 5F64A 5I56A 4U88A 3Q26A 1IZ1A 2PFBA 3O6BB 1FQDA 2O6AA 2HYFA 3FXQA 1R1TA 4PDDA 4DYRA 1MDMB 1MY0A 1TWFJ 4XFEA 3BC8A 1L5TA 3GUDA 5F1QA 2GAUA 2DU9A 3DLAA 4IHTA 1VR5A 2DJIA 4UABA 3O8HA 3OEKA 2HOAA 4H6DA 3M8UA 2H09A 4B44A 1FBCA 2ELHA 2UVIA 3IH2A 4LOCA 4MLVA 3L2WA 1ZAOA 3ISPA 1PUFA 1QVSA 2XXUA 3J7YJ 4JVDA 3TUSA 4Q5TA 1SW1A 3LA3A 1QBJA 4HEA2 1IMFA 5EYRA 1QHHD 4E7JA 1A40A 2XXXA 2JA2A 3P9IA 1WPKA 4E4HA 4M9XA 1NFTA 1NTCA 2R7FA 5EQAA 3A4CA 4AIKA 3TW6A 2HPMA 1A54A 2CW7A 4PBHA 1NG7A 2VKHA 5IYCJ 4DXCA 2RKHA 1UB9A 1VI0A 3THIA 3MVZA 5ED4A 1H45A 1II5A 1BOAA 2LYCA 1TFDA 2MLGA 1A36A 3HHHA 3M07A 5AA1A 2KIMA 4KR5A 2XX9A 2K9QA 2E7XA 3OSFA 4OIPF 4MIMA 2Z8EA 2IJLA 5LBQA 4H0WA 1IN7A 4CYDA 1EH7A 2O7OA 2AHQA 2HPGA 5FBPA 3G3JA 4C3IJ 3OYEA 3RZOJ 5LD2C 1FY7A 3BZCA 4PFOA 1GUUA 1V3FA 3K2DA 1YE9A 3BR1A 2OAZA 4M4GA 5TU0A 3AAFA 4DBRA 2RF1A 3QYTA 1MBFA 1SW5A 4MNCA 4I01A 1WFXA 3O66A 4NWCA 1TXFA 3L6HA 2HGCA 5HOOA 3F8CA 1U6GA 4YFKF 3ODBA 2JTVA 2D2WA 3RKQA 4PFBA 1EF4A 5C44J 3R61A 2XX7A 2TDXA 3M8JA 1WI3A 3BR0A 1UTHA 3KC0A 3GLLA 3KEYA 4LG0A 1DUXC 4BY1J 2RGVA 1L0OC 4B43A 2CUZA 3GTKJ 1B32A 2OD5A 3ASNH 1FW0A 4BBSJ 1N76A 2ZNYA 5EG0B 3HTUA 2Z9OA 4G8NA 2JPCA 2FBIA 1FPQA 3AL0B 1S7AA 3L9FA 3LA2A 5IYBJ 2XXHA 4QSEA 2VODA 1NI9A 2Q8JA 2OBPA 4KYSA 2F48A 4M74A 1T8IA 3H06B 1N3WA 5CBSA 5IM2A 3ILTB 3M4OJ 1X1AA 3CF5F 1SW4A 1IMDA 3MZ9A 3F0CA 1M5DA 4R75A 4MO7A 2Y0SA 3IOUA 3DKXA 3A0BC 5M5WJ 3I56I 4GFRA 2AXLA 3QP6A 1BLFA 2MC3A 5TP9A 3A01B 4U2RA 2GXGA 3V7CA 3HPGA 1U5TB 1LAXA 2REGA 5IT3A 1B2HA 5TISC 1Z1DA 5HS8A 4MFIA 3OSGA 2HQNA 3KP6A 3FKIJ 3SYTA 1KGSA 3TCHA 2LP0A 3FVNA 1K9YA 4I02A 3W9WA 4WXHA 5FKOA 3MEXA 2ZC2A 2Y7IA 5ICFA 3G1MA 3CESA 3ZKLA 3IV5A 2VBZA 3EF7A 2M0MA 1X3WB 4NF5A 1OJLA 2P6TA 5DM6F 2UXNA 1JQFA 2EV6A 2NOGA 2OZUA 4PJMA 4LQ5A 4FAJA 3FIWA 4HAMA 3CRBA 1LB9A 2DSFA 1R6RA 2XF7A 2W7NA 1IRXA 3DKYA 4DYQA 3SEVA 1XMKA 3FF5A 2CQQA 3PIPF 2MSYA 1CF7A 2G7UA 1Y1MA 1R9QA 2RCAA 2GFEA 3B73A 3T9HB 4MX6A 5L9SA 3Q28A 1Z7ME 4OMBA 3P9CA 5HBCA 2XSJC 2FXAA 2WBDA 4F39A 4NC6A 3L7WA 3W2VA 5F1JA 5J40A 3PUYE 2DO7A 1FSEA 2R0QC 4LIVA 3WGIA 2P5KA 5J1RA 1W0TA 1T38A 1LQ1A 2NVTJ 1VQNI 1YCJA 3H0DA 4OVTA 2L5VA 1P2FA 5BS6A 4FE4A 4Y15A 3EQ1A 5AE4A 3R0AA 4KYDA 3S1RJ 1J59A 2IEEA 1F9NA 2HZLA 4PJNA 1D3YA 1D5VA 1T0KA 2CMPA 3MPLA 1X4OA 4ZDMA 3B6AA 4GX6A 3KZIC 2FVZA 1NG6A 1T95A 3D1RA 3I0TA 2EH3A 2K3PA 2OK2A 4O3BA 5H20A 3B7DA 1ZRFA 3DBRB 1LB8A 4HE2A 1IQ7A 3O2PE 4AQ4A 3H5NA 1FPFA 3ZMSA 1X2NA 4A3GJ 4P96A 4IJAA 1YG2A 4IZZA 2XWOA 1WVRA 2O6GE 4G7HF 3ZR8X 4P8BA 4NQWA 4DYCA 1UQWA 2NNYA 2ETHA 3TOAA 1FIPA 1MXXA 3UGWA 3DFGA 3K69A 4XLHA 4ZYAA 4RGXA 3K6VA 1IRGA 1A99A 2A5TB 2E7WA 3CDHA 5FRMA 4XIGQ 2ZXWH 4B3AA 2EBIA 3GBGA 4B48A 2W00A 3CCYA 2VHAA 5J6XA 3WTYC 1JKRC 1Y0UA 3OO6A 1PUEE 4IEJA 5I57A 2DWIA 5HNFA 2I4BA 2F4IA 2LMDA 3JV9A 3ASOH 3U65A 2Q8KA 1W36D 1A55A 2P1SA 4XKVA 2ZYOA 1FMVA 3GZ6A 1JKQC 2BW3B 3HOUJ 1QU3A 2V1UA 3K00A 2KLFA 3PUXE 4OVSA 4OVRA 4L0ZB 5ICTA 2DMPA 3VYSB 3I55I 4R6YA 3JRBA 3HSTA 5F08A 2F8DA 1ZQ3P 1F1ZA 3HKZN 1ZELA 2IEKA 2K9SA 1SQYA 1MH4A 3P7IA 2L9RA 5ILSA 4D5CA 3ZMDA 4ZS9A 3IP4B 4HV6A 4A0ZA 2JSCA 2Y7RA 1Z05A 3CP8A 1NV0A 4UA8A 1USTA 2LBFA 2RVCA 2WAQN 3IHUA 4BEHB 4G7ZF 1LBWA 2O7UA 4QSCA 2YUSA 1MXVA 2RCBA 3JR9A 4P56A 2O1MA 3FISA 4LP2B 4KFQA 5L3CA 4U22A 3DLNA 3RKXA 3FV1A 4RMNA 4U4XA 4KI0E 1B7UA 3S2DJ 4NF6B 1XB4A 2CFOA 2D45A 5K5RA 1KA0A 3OMYA 1JT6A 3Q9VA 4HOBA 2DOEA 4HLYA 2JN6A 4IOCF 3VDFA 3FWEA 4AVPA 3JRHA 3GYYA 4CO8A 1P99A 4XKWA 3PU5A 4PDKA 3QSLA 2ZCWA 2QENA 3M3FA 2W4SA 3QODA 3I4NJ 4S04A 3K70D 4WX9A 1DPRA 2QSGX 2IA4A 1YHQI 3E6DA 3P5JA 1T33A 3TO6A 1UHMA 2VPLA 4YFXF 1B72B 3BZ6A 5LGUA 2KKOA 4DE8A 2VD2A 3K10A 4C2TA 3FM3A 4E7LA 1SPIA 3Q29A 2ESNA 5CQEA 3IJOB 3C36A 2M45A 2W82A 5AA4A 4YAHX 3PQKA 3K1NA 4RGRA 4MTEA 3CCSI 2XPWA 4EGZA 5DW8A 4CCKA 4A3FJ 3HEFA 4U0VA 3H9JA 4D7NA 3IAM2 1VQ6I 2F6PA 4A2UA 3Q0UA 3PMXA 5JVTA 1SDXA 1FSAA 4X04A 5DUIA 3UN6A 5IZ3B 4YMAA 4A3IJ 3CUQA 2LKSA 4A3EJ 4FE8A 3X2QH 2A5WA 2JJKA 2DT7B 2LY2A 1XOCA 2OA4A 2DJNA 2Y9YA 1XT8A 1TBXA 1OYWA 2HI3A 3G1LA 1CGPA 1RR7A 1J7KA 2GXAA 1UG2A 1Q1HA 1D9QA 1B7ZA 1TZLA 4QIWN 5DCFA 2OZZA 4O7IA 1R1UA 3G3ZA 4AC0A 1QULA 4F22A 4CH7A 4EJVA 3OYFA 1BJAA 3LOCA 5DM7F 2QA4I 5I59B 3IH4A 1U78A 1VFEA 4KYEA 1RYXA 1MKMA 4R9GA 4EEFG 1MJAA 1N04A 4QSDA 1IITA 4Q5SF 1ZTRA 1Y8RB 4BXFA 2VJ5A 1U8BA 2KP6A 1NH7A 1MBEA 2EFOA 2ZNTA 4I3YA 4QFNA 4IRIA 1PEBA 4E7KA 4P1WA 4RAYA 2FEZA 3M7GA 3KP7A 3DP4A 1FTAA 2H1KA 4N07A 4RNSA 4L9JA 1SFXA 2TRTA 4MFEA 4EVIA 2R7UA 4OVQA 3PFIA 3BR2A 3T9VA 3GXOA 3TTKA 3IAS2 3E6CC 3QYBA 4CCNA 3DPTA 1IXSB 3OS1A 5LHGA 1DGRM 2FBHA 3CQZJ 1K6OA 1P4XA 2X6OA 2G0EA 1A35A 2XWIA 3BIGA 2KZVA 3H6VA 2ZMEB 1MMAA 4MLQA 2CUFA 2E2JJ 2ZMBA 4HXVA 4M1VA 2Y84A 3GEZA 1W36C 2I49A 5ET5A 4KNYA 3V83A 3OIPA 2WADA 3H35A 2KRFA 2MW8A 4FQGA 1JUSA 1SAUA 1P4WA 2JUCA 1KQ8A 2P8TA 2Q89A 2DQVA 2AQFA 3K6GA 4U7BA 4NGUA 4OEUA 1ZHFA 4PK4A 3D0SA 4WXCA 4LN5A 2ICWG 3D5RC 2PVUA 3ILUB 2XGXA 3NARA 4F93B 1YRNB 1W7PB 2E0SA 4UVCA 2HZKA 4X1BA 3WTWC 4MAGA 4OVJA 3MZBA 4XN0A 4M71A 3ULQB 5E3LA 4XXUA 5GADJ 3S3OA 3VODA 2NRAC 2F78A 4D5FA 4H4KC 1SBPA 3VLUA 3F22A 3LSXA 3OO7A 4Q4ZF 3UK4A 1FLIA 4DCXA 1S3JA 4IO5A 3LWFA 1ZN2A 4O7MA 2R8TA 1EH6A 4RY1A 3SEYA 2X26A 2OWTA 5I5PA 4EM0B 1XHYA 1EZPA 2JK3A 4I2OA 2KIUA 2PX9A 3GO5A 3LA7A 3MUQA 1HSTA 4Q30B 4C9YA 1ENHA 4CYCB 2CMOA 3T9UA 5GAEJ 5KAIC 4HQMA 1JGGA 2DE4A 1HXDA 4DCYA 2L4AA 3EYYA 3RPUA 3K70C 1ETVA 5DCMA 1PB8A 2NNNA 2BE5F 4RM2A 3G7WA 2UVJA 3HUGA 2LR8A 2BBYA 4BHCA 1YITI 5AIQA 3IJXB 4MNIA 4GQOA 1MXZA 4WCGA 5H8HA 2ZO4A 2RINA 2FIXA 2HFBA 2HR3A 3SFZA 1GXPA 3FXRA 5KCMA 2RV8A 2QUFA 2W24A 5C3EJ 4YRVA 1BC7C 2DXRA 2GHAA 3CSBA 4KCCA 2WBBA 3S9LC 4TLMB 3U93A 2PQ8A 2VI6A 1JUMA 3BR3A 3H5AA 2I48A 4U0YA 4AIJA 2I3VA 4KIBA 4IKFA 2DK8A 3HRUA 4KIFA 5I2KB 3OY9A 3RTWB 1LFPA 1B0HA 4F3SA 4OENA 3FXLA 2KIQA 2VB6A 2VKDA 3ZOBA 4EXLA 1BK4A 1IMCA 2GIZA 1ZG5A 3RZDJ 3CTAA 2QPQA 3REOA 4HNVA 1D8JA 1UZCA 1SD5A 1V5GA 4RK2A 2NOOA 2Q2EA 3F72A 3PJRA 1QUJA 3ZQIA 2R7VA 4MLOA 2DDAA 3TELA 1YS7A 4GL0A 2E2IJ 2CQKA 4ENKA 1B4HA 4RB2C 1OLCA 1SFOJ 2WAEA 3AG3H 3MWMA 4O6JA 4ZEFA 1WGXA 2Y7WA 1R36A 4F55A 2PG4A 3VYUB 3GTOJ 1WODA 3VXBA 2K9LA 2M34A 1DPEA 2FQ3A 6PAXA 2R5ZA 3B6TA 3E78A 2L7FP 4CHUA 5JFRA 3KG2A 5E18F 5D5VB 3O29A 3TTRA 4L9VA 3QWLA 1FBGA 1NNFA 2XRNA 1G3SA 2DE3A 1R5GA 1ZJLA 3EPZA 5FJ8J 3K6XA 2HTJA 4X9TA 4N81A 1TT5B 3J81Z 2F34A 1TQIA 2FMLA 1YXIA 2YS9A 1LE8B 2XKPA 2G93A 4NF0A 4PE3A 2E36A 1GVCA 1Y8QB 3KBZA 5E8GA 4KDPA 4LJZF 4LD5A 3FASA 1QGXA 5GPAA 3H5RA 5D4SA 1W4MA 4BDYA 4A6DA 4ZEIA 1OCRH 5E3MA 3AG2H 2LF8A 3PUWE 1DOTA 5ITOA 4JK1X 3MZHA 3QPTA 5DVIA 3PNVA 1FBQA 2IVMA 3O8GA 2R7DA 3W2AA 1ORKA 1Z7LA 2AXTC 3GVAA 3OS0A 2DXIA 1Z21A 1MDMA 2CZLA 2LNBA 4G12A 4K2EA 2ID3A 1NV3A 4F1VA 3GFMA 1IDYA 1MSFC 1V55H 1X3UA 1LVKA 2MA3A 4QFLA 2YX4A 4KN7X 2B7EA 2EV5A 2TCTA 4NEDA 4QXDA 1LBBA 3RYPA 4LITA 3PL8A 5CPRB 5JLWA 1G2HA 1J9IA 1JP4A 3FUZA 3L6GA 3K4CA 2QM3A 4JX4A 5M2VA 1CE2A 3SETA 3CMAI 3A1YA 2QMWA 1H9TA 3EHTA 5IOYA 3FIRA 3BFTA 3N94A 5FLXZ 3GZNB 3H03A 1A6QA 4OANA 2QQBA 4II2A 2XGCA 2XXQA 2F6CA 3L2CA 5FTHA 2F5DA 2XB0X 1IUFA 2IXSA 1EU8A 4IO3A 2L01A 2DBBA 2QL3A 1GVDA 2ZMEC 2QLZA 1SI1A 1I3AA 3LSKA 1R49A 5HDNA 1ZMGA 5I84A 1B9MA 1CQTA 4KHZE 4ZZLA 5J4VA 2VXDA 3HRTA 1AOYA 1HKTA 4GOTA 1HDDC 4HS7A 1IV8A 2XB5A 1PB9A 3MKWB 3JRCA 4RDUA 2H94A 2VOZA 3BG5A 1R5ID 3MP6A 3FKJA 3CJNA 5B1BH 2THIA 5HVQC 3IB1A 4Y33A 3GTJJ 4ZEBA 3WTZA 3J7AY 1X2MA 2VN2A 5I3SA 2EWNA 1U9OA 2IP2A 1MY3A 2HYJA 4LLGF 5DYHA 1POY1 1IAWA 1IC8A 1AU7A 1OISA 2BVMA 2MH2A 2HYGD 1DTZA 3CJQB 1NNPA 4P47A 3PIOF 4UB6C 2XXWA 3OIOA 2ELKA 1IRFA 1BI2A 3GTMJ 5H8QB 1K83J 1HKSA 4R74A 3IB2A 1L3LA 2OCEA 1O3SA 5DD8A 2P5VA 1DCUA 2NS8A 3IFAA 3RY3A 4KD5A 2KT0A 4PTKA 4PGNA 5EG0A 1GXQA 1QUKA 4DZPA 3I5UA 2M8EA 4IB2A 4GRKA 4NX1A 2DFHA 1FBDA 2XA5A 1LSTA 4S0HB 2MFZA 3KBRA 2HKOA 5CRYA 2D3IA 1KU9A 2WV1A 1OMPA 3SERA 1EH3A 3SZGA 4QSHA 2JQ7A 2UXXA 3V7RA 4FASD 3V4GA 5BUUA 2XGDA 1RRJA 3FHNA 2BZTA 3FMSA 1IXRC 4P9FA 1SVXB 2HQ0A 2Y7PA 1GT0C 1H3DA 2I6EA 2QRYA 3OSQA 2XGEA 1R58A 4JYKA 4PUSA 1B6HA 3ROUA 3WHCA 1Q1VA 1MM6A 3GBAA 3L2VA 4IL6C 4HX7A 3B6CA 3ZXSA 1OCCH 1R23A 2AL5A 3A01A 3W9VA 1U5TA 4NF4B 4KJZA 5KNLA 2RNGA 1XI6A 4ETSA 4QWQA 1J09A 3C2BA 3RQIA 1MY1A 5FHNA 1YYVA 2L3DA 2ZJ2A 1D1BA 4FATA 5JK4A 3SESA 3BQZA 3D1NI 2JZYA 2M3AA 5LGNA 2VE8A 4C30A 2UVGA 4EMSA 3CCEI 4GWYA 4PJ0C 3BPVA 5DS9A 1ZG1A 1JI8A 1B9JA 1N3XA 2OQRA 1FBPA 3CF2A 1V54H 4RGUA 1FQFA 3FATA 1QA6A 1P1OA 2QCOA 4H5GA 3PFYA 5CI5A 3CZ6A 3CMEI 1AWCA 4S05A 2AIXA 4G8XA 1QZYA 4P5OA 2CV2A 2UWMA 3IC7A 4DDDA 4W1UA 3M3LA 1OYYA 3BKIB 3C33A 3DP8A 3F8BA 2HKXA 4W97A 5KAFC 1P7IA 2GM4A 3I64A 2A69F 2M8GX 2V9VA 4RLFA 4LZ7A 3V8XB 5HS7A 5DEXA 2MLKA 1WQ2A 3MSTA 4LVQA 3LFKA 5DV5A 4MQ9F 4LB6B 4PP0A 4PFYA 3I59B 2FRHA 2M2EA 2Z99A 4I1DA 2DYRH 1YLFA 3U9GA 2ZNUA 1KWHA 4E7HA 2OWZA 3T5XA 3IR1A 4EJOA 2F5VA 1I5ZA 3DBLB 1Q9DA 4QHQA 2MBFA 3FM5A 1B5IA 1NMUA 4FEDA 4R6KA 3QPHA 4E7IA 3HB9A 5D5WB 4N6PA 4Y7NJ 2MGQA 2V1XA 2ZSHB 4HE0A 4F92B 2UXAA 3C1DA 3FXBA 2O03A 4TV7A 3TW7A 3PD8A 3ZS6A 1JKOC 2HWVA 4U21A 3VSKA 3DBHB 1ZGWA 3JAMZ 2B4MA 1R1NA 3MKYB 2CUJA 3J81K 2Q74A 3WTTC 3K0VA 4YKPA 2A5TA 4XF5A 3I9V2 4I7HA 4M6VA 3U92A 1SD7A 1IXHA 1US5A 1YI2I 3U1OA 2VUMJ 2XHKA 1S29A 2HEOA 3HGGA 3SFIA 1FPJA 3E6MA 2EFWA 1YQAA 4JWYA 4M3DA 3COAC 1S72I 5IT9Z 1JEVA 2IGNA 2HFHA 2DA4A 4XN3A 3AG4H 2BOLA 3PPRA 3BFUA 4JB7A 2BW3A 3HGYA 5IGAA 3QU3A 2R5YB 1ZG3A 3EUKL 1GV5A 4A93J 5F1RA 2PYYA 3KSJA 3R6UA 3BTCA 4J00A 3J7ZI 1YTYA 3I53A 1FWZA 1TQMA 3CC4I 1MQIA 4OESA 3SEWA 4PFRA 4BDRA 4LZ5A 4XRFA 2W84A 1LEBA 1STZA 2E35A 1GTKA 2ELJA 1UHSA 3PD9A 4XL9A 2XROA 1XMAA 4IQ4A 4BEHA 2DPDA 1NUZA 2ACJA 3O97A 4A3CJ 4LUBA 2PX1A 3ZMUA 3OYLA 3O28A 1Z7NE 4H8IA 4HX4A 3JSOA 2W1OA 1N7XA 2X85A 4JQFA 3S93A 1K78B 1FMWA 1RKWA 4UUSB 4G6QA 1I1GA 5FLXK 4Y52J 4ELQA 1Z9CA 3Q27A 4DXBA 2Y75A 2JSPA 4NF6A 4BE1A 2Y31A 4YG2F 4XLFA 3LSGA 1TC3C 3MN2A 4Y13A 1G3WA 4F3GA 1MH3A 2ADUA 5CKTA 5K1YA 1DSNA 2RC9A 3TODA 3UR3C 1W5CC 2M5WA 3ROJA 4PSWA 4ZZDA 1NUWA 3G1OA 2M1BA 1VDWA 1OCZH 4BXXJ 1ZARA 1M5EA 5IP6A 2B65A 2LKPA 3H6UA 1OLTA 4N4UA 4N8GA 2R7SA 2IS2A 1UMQA 2H8WA 2DMNA 2MABA 1PP7U 1B72A 1PDNC 2CV0A 2H25A 2YSRA 3LR1A 3FXUA 4HDVA 3S15J 2RAEA 4FTHA 2HQ5A 4R72A 1SFEA 5H8FB 3KETA 3NQOA 1XSVA 2XIGA 3ZQ7A 5ESYA 4R1HA 3L1PA 5K7FA 2GQ1A 2PT1A 1Y3NA 5DT6A 2WTEA 1MW7A 3CLQA 4M3GA 3S17J 2HAUA 2KQRA 4OFJA 3I3LA 2M4GA 4CICA 2LLKA 4PGHA 3BR6A 3VYTB 3H9QA 1B4AA 3ABMH 4QRZA 5IZ3A 1XGOA 1I6XA 3PPPA 3VV5A 2OCCH 1I69A 3MVWA 1T98A 2IBDA 2QWWA 5ICCA 5HM4B 1X58A 3GWZA 2H6BA 2WA0A 1T0FC 4GGGA 5AONA 4ELPA 3K4KA 1FYMA 2KQZA 2KPMA 1TWGJ 5C4XJ 3K4BA 4HYEA 3QRFF 3KN8A 2DFIA 3EUAA 1YJ9I 3KN7A 4XLAA 3LQQA 1AWBA 2LTPA 4BKXA 1PC3A 2K86A 4ENJA 1XVYA 3DTIA 1J1NA 3V42A 4RK9A 4EQBA 3F23A 3F8MA 4CZZA 1JW5A 3FXKA 4TOZA 5I59A 2XAFA 2XVCA 4XSZF 2VD3A 4GLIA 1FP2A 4PF8A 3KJ7A 4KICA 5HLGA 3OR2C 1IMEA 1NNTA 2LSOA 1O64A 3PUZE 1MMNA 4XOPA 4F52A 2Z16A 2B9SA 1IEJA 3M9AA 1LDDA 2RNJA 3BG6A 1K4SA 1ODDA 5HODA 2XXIA 1BBYA 4KYWA 5TGTA 4DZJA 3BZKA 1I6AA 2VP1A 4IO7A 5LOMA 1X19A 1Z6RA 5EEHA 2H1LA 4UNOA 2BHYA 3S16J 2CEYA 2Z5UA 1JEUA 4NC8A 2ZMEA 3DQVC 3TO7A 3QQAA 2JA7J 4R2FA 4ZECA 2OPTA 1C0WA 1SD6A 3D4CA 3HZJA 1H89C 3AFHA 3C2GA 3HRSA 4XLCA 5FLMJ 2VE9A 2WB1A 5BWJA 3T0JA 2QZ8A 4HDUA 2DOFA 1A7LA 2VPOA 4HX8A 3GTLJ 1E0EA 2GBYA 2KISA 4FX0A 1BOBA 2KLOA 2F36A 4Z2YA 3RPLB 3NEUA 2E1OA 1VFCA 1M1EB 3A2KA 2IA1A 1O7TA 3CCVI 2O8KA 1M5CA 5B1AH 1ZGJA 2BY0A 1FPDA 4U23A 4D1QA 3RQTA 4FETA 1WJEA 4AYBN 3K02A 4XBFA 1YRNA 3GTPJ 1WSUA 1W7PA 2GQQA 3TAJA 2AO9A 2A61A 2CW0F 2VIXA 4HSTA 4DIGA 1FC3A 2Q1ZB 1QKBA 2XXPA 3TOBA 4AD9A 3DTEA 1FBFA 3OYJA 4POXA 4N8YA 4IY6A 1MQGA 1FTKA 1D0XA 3HOXJ 3ABTA 4HTGA 3P7NA 3I5OA 3DEUA 5DEXB 3VXCA 4RGSA 4OXVA 2V26A 2M8CA 2OU2A 2V9KA 2DDKA 4F1YA 2KMUA 2PMSA 1YO5C 5E20A 4HE1A 1FYKA 5TJJA 2GOXB 4AM3A 1XS5A 2CZIA 1ETOA 1XGNA 3HHGA 3ZQFA 1FPIA 2GHBA 1B59A 4CYCA 1D5YA 3OYKA 1XTAA 2IW5A 2ZXHA 3S3MA 4H67A 3TL4X 1FTMA 2ZYNA 1DQUA 3U8QA 3HIFA 3ZN0A 1OQGA 5IZ1A 4U87A 2HOSA 2L2OA 1B58A 4N4OB 1K61A 1HF0A 1KONA 2JWTA 1VQ7I 4DI4B 5CMBA 3RSNA 1XD7A 2XDVA 1MJBA 2FQ4A 2LD5A 2LY9A 4A3JJ 4WXDA 5HLHA 2DXYA 2JPBA 2I5UA 4MHGA 3MD2A 4EQ9A 1FTLA 4UVAA 1VNDA 2VBYA 3KE2A 1XPXA 2K85A 4AB5A 2VKVA 3JAMK 3H7MA 2A68F 1US4A 4YU0A 1RI7A 1AH5A 2MH9A 5CVIA 5IY5H 2Y9ZA 4G7OF 5I2KA 2VPNA 2R7XA 3KZZA 3CP2A 1GVJA 1WWXA 1J2XA 4M9ZA 4TQUQ 2RN7A 1HSEA 3LSFB 3N5LA 3BCAA 3LSJA 3JW4A 5JVGF 1UELB 2Y0MA 4RB0A 5J1UA 5IT9K 3MVPA 4KA4A 2O69A 3NOHA 3TDJA 4KN4X 1I39A 4AS5A 2G29A 1SD4A 3O9PA 2L7KA 4Q47A 4NG7A 2DDBA 2EZIA 3E5QA 4G6DA 5GPCA 4WWCA 2YPNA 4ZEDA 3S9MC 1AMFA 5KDTB 2ALUA 2HXOA 5L3GA 4N15A 3TP0A 1T56A 4JP0A 2DWJA 3G71I 4EV0A 1NKXA 4PGPA 2M9HA 3BG9A 4RAFA 3RJPA 1E3OC 9ANTA 2P2AA 4OYVA 4X8RA 4X1DA 1B6AA 3DPUA 4MJOA 2HOTA 5GAGJ 2DVZA 5K7HA 4IHSA 2RREA 1BJZA 2Y69H 3Q0WA 3ZQGA 5ICGA 2EV0A 2E5ZA 1SFUA 2COBA 2VT5A 1RDXA 2KJCA 4PAIA 4N13A 3O6IA 4FIMA 4PQJA 4BDOA 2XWVA 3WTXC 1FJ6A 2M7BA 4IX7A 1OVBA 4BUPA 4AIDA 1B7HA 1QPMA 3RPWA 1B3LA 1LE8A 1NUXA 1YX5A 5A2QZ 4G94A 2A5YB 4XLPF 1BA5A 5F0CA 1FQCA 2IPQX 4CZCA 2V9PA 1LAHE 1XVXA 4WK8F 2JRMA 3TO9A 2M0CA 2L54A 3PV0E 3RKWA 3KEQA 4YKJA 2PBWA 2V79A 1IGNA 1XN7A 1V4RA 2Y0SN 1FPLA 2I3WA 2ONSA 4LG3A 4ZC3A 4A69C 3A0HC 3CCJI 3CCLI 5BOXA 2IS4A 2B3FA 4GD5A 4QFPA 3ZGKA 3FXJA 1Y20A 5L3EA 1FBEA 3K0LA 2F2EA 2HXWA 4BU2A 3DP6A 4OINF 2IGKA 4N0BA 3T22A 5D6EA 1B5HA 1R00A 1FJLA 2JUGA 2IS1A 1YJNI 1RPWA 1Y4CA 2D1VA 1QHGA 2K9MA 3VWBA 1PDAA 3BWGA 2V4CA 3I4PA 4Q8RA 4ESBA 5DDGA 2Q9TA 1BR2A 1KU2A 2PMZA 3K1PA 4LMYA 4ZDLA 3JRAA 2VONA 1X1PA 3T0YA 4XNFA 1LPQA 4P55A 4R2BA 4KXPA 5ET7A 2RC8A 2PEXA 1MS7A 4BHPA 3U1KA 3CCUI 3MQ0A 2O51A 1FT9A 4GO1A 4MNUA 5J3LA 1ETQA 3M3YJ 3IB0A 4BDNA 1NV4A 1E2XA 2B4LA 3V89B 1FEXA 1RDYA 2DCEA 2Y48A 4XEQA 2DWAA 2XC7A 3C4MA 3OOAA 3OSRA 3SZPA 3LMMA 5J1YA 2EZLA 2B63J 4OEVA 3TDZC 1BR1A 1R4NB 2VL8A 1BN5A 3KYCB 2X1EA 3PSFA 4NBQA 2OBGA 5EEGA 3VFZA 3CR9A 1YW7A 4WXJA 1TT0A 3HDDA 2OQGA 2HDDA 3C34A 1ATGA 1R5HA 3HSEA 4O5VA 2LOOA 3BIHA 3ZQLA 3FJ7A 5JI6A 2Q2AA 3CFLA 1LNWA 4CCOA 1H76A 1UG0A 2K27A 2UYEA 2EIJH 5EJCA 4K3FA 5CYVA 2DA6A 2DMUA 2DN0A 1O7LA 2DT6A 4UV9A 3PUFA 3Q5FA 4KMFA 1OR7C 1R9TJ 2DOJA 1Z77A 4E0WA 1RKMA 2ECBA 5CMMA 1Q35A 2DI3A 1A04A 1KYZA 4G8HA 1Z3XA 2L7MP 1YZ0A 2RQQA 2QS3A 1EJ9A 1WZ2A 2ZNSA 2HQRA 3KZGA 3T93B 4F18A 4FBPA 5EQ7A 1FIAA 1Q1KA 2DVCA 4JX5A 2V1DA 5H8QA 4IQJA 5HS9A 1R6ZA 4JWXA 1O57A 2LVSA 2LY1A 3HBLA 3P9KA 2LREA 5FKKA 1DMBA 1OFCX 4A0XA 3MAMA 3C3WA 1XCBA 3U21A 5AIPA 1W0UA 2L9SA 3U72A 4LZ8A 1JT0A 2CQNA 1S50A 5IOZA 4CCLA 1ZLQA 5EQ8A 2X48A 4BS9A 2JA5J 5FKMA 1JXSA 3QOPA 4KFCA 4O3AA 3GYHX