3K1NA

Crystal structure of full-length benm
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
303
structure length
303
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
total genus 88
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1nA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1nA03
3G7WA 3RJPA 2B3BA 5ILVA 2V25A 5A2QZ 4OEUA 4KFQA 1ATGA 1UTHB 4HX7A 1EH3A 1PBQA 4G8HA 4JWYA 3CUQB 3T22A 3QXMA 1MXXA 3KGCA 5DEQA 1GR2A 3GXAA 4L0YB 4RGUA 2F5DA 2A3SA 5ILUA 2PMSA 3VDFA 2CW0F 2G7UA 2OBPA 3HIFA 4MTDA 3O6BB 3G3JA 4F1VA 3HHGA 4WEPA 1RUNA 4ELOA 5CVIA 4QFPA 4ESFA 1B4ZA 3U93A 2VODA 2EA4A 1QZYA 4AB6A 1WDNA 4LMYA 3EN3A 1Y4CA 1US5A 1PB9A 5IAIA 1RNLA 3ODBA 2OQGA 1IW7F 3CFLA 4P55A 2F5CA 1SD6A 5AONA 2QMXA 1YW8A 3QP5A 4RB2C 1ANFA 3B7DA 4NF5A 1FPQA 3RI4A 4GL8A 4KICA 5DV5A 3HTUA 4QWQA 3C7JA 5JHUA 1EU8A 5IT9K 3IOUA 4GQOA 4ELPA 3B6TA 4ZEBA 1HQCA 3NRVA 1EH7A 2MH2A 4LA9A 1B3FA 2P6SA 5D5VB 2BJJX 2ZMEA 4E70A 4KIBA 4OFOA 4FEDA 2VOPA 1MY2A 2EFNA 4IY5A 4S04A 1B51A 1UIVA 5JFRA 3CDHA 5L3DA 1B1BA 1FOKA 3G3KA 2O1LA 3M3LA 4HV5A 5CBRA 2EV0A 3I64A 3REOA 4JDFA 4NTLA 4KMUX 2HQ0A 2O69A 4YU0A 4GYIA 3ZQ7A 3U1DA 1LFIA 2H99A 1IN7A 2CFXA 1M5EA 4XLPF 5KDTA 1R7JA 2M30A 1CF7B 2I0CA 2R71A 4M72A 4GL0A 1TWYA 3IX1A 2QUFA 5BS6A 3EUHA 1B0HA 3H03A 2O0YA 5LRRA 1B6AA 2RNJA 2DSFA 1STZA 1FQDA 1YAEA 3CIJA 4O3BA 4OHNA 1FP2A 2FSWA 4IRHA 3WTTC 3B6WA 2B65A 2LF7A 4I8CA 5ILSA 4ENJA 4ZZAA 2ZKZA 1R6ZA 1JEUA 2O7UA 1DTZA 1L5TA 3LQQA 3WE2A 4EUOA 3RKXA 3VE1B 1CF7A 4LLLA 2FNAA 4OVJA 4F2QA 1MZBA 2FXAA 1DMBA 3FXQA 3USDA 3J81K 5LHHA 2H25A 3MQ0A 1TFAA 1U2WA 4R8HA 3KSJA 3QU6A 1LBCA 2CYYA 2JRTA 3OD7A 2NOOA 3F8FA 3OSQA 1GTKA 5F6FA 3Q28A 1N76A 4U21A 4ZEDA 4NWDA 2LNBA 1XHYA 1J0RA 1KA8A 1QGPA 3DPTA 4G7ZF 2NWJA 2HR3A 5H8QB 3ZKKA 1N7XA 1BTJA 2X0LA 5TU0A 2HXWA 2E0SA 4NE4A 3PU5A 3R61A 4BNCA 2HKXA 4YG2F 1GXQA 3T8RA 4JXIA 1FCKA 1TT1A 4F1YA 1LNWA 1QKAA 4C0RA 3JYRA 5CMBA 5I56B 2F78A 4JK1X 4PGHA 4FX4A 3VVEA 2P8TA 3OV8A 4AD9A 2FRHA 3S2WA 3VV5A 4DCXA 4EXKA 3K4UA 5LHIA 3KP4A 3MWMA 2ZBKA 1XSVA 3AAFA 2P7VB 2O8XA 3MWBA 4N07A 1O7LA 4IHSA 1NNKA 3K02A 4LG0A 1Z7ME 3I5OA 2E1SA 4M1VA 2ZNYA 1JW4A 3FATA 1PB8A 3TCFA 1W7PA 3SQNA 3OELA 1Q1HA 2STWA 3KZYA 4B09A 1Z9CA 3I71A 3FVOA 1I5ZA 1OYYA 1MDMB 3RN8A 2QVOA 4ZS9A 3R0AA 5HOOA 3SEYA 3ECRA 2G29A 1ZLJA 1LAFE 1ZREA 1AOYA 2BV6A 4CGZA 3EQ1A 3O6IA 2DFIA 4GGGA 3KSXA 4F18A 3PFIA 1FLIA 3ECHA 2A5TB 2D5WA 2ETHA 4K3FA 4ZEKA 3LQRA 3Q29A 2F5EA 3B6QA 2K4BA 4GRKA 5I2NA 1ZH5A 1EH8A 2COMA 4KYDA 2DO7A 2REGA 2DPUA 1Y0UA 2ZO4A 1N04A 2YPNA 4U7DA 3GLBA 2H6CA 1VSOA 5D6FA 3M9AA 4MEYF 4YZZA 4EJVA 1QZZA 3ZS6A 2F5FA 1IUDA 2DS9A 2QYOA 2Z8FA 4IRIA 2PN6A 1ZRCA 4WK8F 1BC8C 3O3KA 1G3WA 1MS7A 3FASA 3HCQA 2IA2A 1IN8A 4KPTA 4QSDA 1FSEA 1DPEA 4TV7A 4OMYA 2F35A 4G68C 3UORA 3WG9A 3SZPA 3MAJA 5CJ9A 3MJNA 3VXCA 3KP3A 1FQEA 2F2EA 1SW1A 4RK9A 2V84A 1MXWA 1B46A 5EHMA 3GYHX 3TTLA 4JBZA 3PPPA 4KMFA 1JVYA 1GHCA 4P5OA 4EM2A 3D4CA 5H8FB 2L01A 3DP4A 1NKXA 1GVCA 4YAHX 1EH6A 3TZAA 1R1TA 4GD5A 2XXPA 3KLNA 2ONSA 3CFZA 2R9JA 2DQRA 1UCRA 2GA2A 1IITA 4POWA 4U4SA 1LAXA 5LHGA 1LB8A 4OQOA 4HW8A 4O3MA 4EF2A 3PUZE 1G6NA 1IEJA 1AMFA 1LFGA 3IR1A 3E13X 2XX7A 4P0IA 4BHBA 3RGYA 4DXUA 1G3SA 4POXA 3U92A 3LWFA 3ABTA 3HSEA 1FQAA 1MM6A 2L54A 2QBYA 2XD3A 2Q89A 3KE2A 1PB7A 5J8CA 4IO4A 4IO6A 5I57B 2UVJA 3U2RA 1P4AA 3RTRA 3DLNA 4UVCA 2XV4S 3TGNA 4KFCA 1B7UA 4QSCA 1D3KA 4LGWA 5IT3A 2DU9A 4H5GA 3MUQA 4ZYGA 1OQHA 3I6VA 2HGCA 2YR2A 4HW0A 3VOEA 3E5UA 1ZLKA 4NMYA 1TNTA 1TW2A 4A5NA 1HSLA 2RC9A 4KI0E 3BOQA 2BEOA 2HEOA 2V79A 1U78A 3RKWA 5IT9Z 4G9YA 1URGA 2IPQX 5K1YA 3MVYA 4WWCA 4RPNA 4U1OA 4GF8A 4NF8B 5A5XA 4RS8A 1HXDA 3L9FA 4A6EA 3TMGA 2KIUA 2DYXA 1DPPA 5JEIA 2GFEA 1I6BA 1OMPA 4ZYDA 3MZ1A 1NH7A 4QF9A 2DWAA 3JAMK 2ZNTA 3WU1B 5FHMA 1B5JA 4MBPA 1B32A 4WXCA 1NNTA 1TLHB 1T0KA 3KETA 2NS0A 3FVGA 1XD7A 1A7LA 2YJPA 3J7AO 1YYVA 4KN4X 2DE2A 5CVVA 4OINF 4UV8A 1KYZA 5BWJA 3LSXA 4AIJA 3LAPA 2H4IA 4GFRA 1URSA 4A5MA 3MZYA 3ZMVA 4PP0A 1H44A 1M5CA 1FQFA 4MLVA 4KD5A 1YPNA 5I59B 1SD5A 4EVIA 2XAGA 3HOTA 1BP5A 1FTMA 5TP9B 4YIIA 3LSLA 3FV2A 2V6CA 5FLXK 4JSDA 5I58A 1URDA 2GAUA 3V83A 4HF2A 3N4MA 3FM5A 3OENA 1HW1A 5FHOA 2RCBA 1FNNA 3H4ZA 4UV9A 3FMSA 3H06B 1HW2A 2CO5A 1MPBA 4U88A 1Y1ZA 3ZKLA 3E9XA 1ZGJA 3HO7A 1Y20A 3PPNA 2ZNSA 1G3TA 4XRFA 5LEKA 4NF5B 4ELRA 3N26A 2H6BA 2Y84A 2M5WA 3QP6A 3FVNA 2I3WA 3VLVA 5D5WB 2LKPA 2DVCA 4R9FA 2H94A 1ZU0A 2DT5A 2KJCA 2XXTA 3PV0E 1M5DA 3VFJA 5L9OA 1B1XA 4ISUA 4PETA 3LFKA 4I9DA 3KG2A 2LAOA 2VT3A 1YIOA 4ENMA 2QL3A 4GCVA 4NF6A 3LAJA 1RIOH 2GQQA 2DWHA 1MQHA 3RT8A 1BI0A 3N97A 2Y7KA 4THIA 4QFLA 3R6UA 2XAQA 2HAUA 3HOSA 1ZKBA 5LGNA 4NWCA 2O03A 5D6EA 2RC4A 2K02A 1ZHFA 1HSJA 2D45A 2XHKA 2QM3A 1XN7A 4F3GA 2HQRA 4OMZA 2I0BA 4RAZA 3M8FA 4UA8A 5CI5A 1USTA 4KHZE 2H27A 3K1PA 4OERA 3CUQA 4KT5C 3HYIA 4IO7A 1U5TB 1A54A 4U7BA 1YTYA 2NVUB 1L3LA 4PZJA 2XX9A 2DBBA 3LC8A 2A68F 5AA4B 1B6HA 4EGZA 3TAJA 3IOTA 4BDLA 3GFLA 2XVCA 3DP7A 3U8QA 5ITPA 4FATA 4BXUA 1J2XA 3WGIA 1ULYA 4U0WA 4N9HA 3JAMZ 2UZKA 2A5TA 4RPOA 1WRJA 2RVCA 4M6YA 1P1UA 3S2VA 5M2VA 3O2AA 2GXBA 1LEBA 3WTSC 3LSTA 4HYEA 2YX7A 1C0WA 2VD2A 5AA3A 1DDNA 3E6MA 2IT0A 2FU4A 1FX7A 3OOAA 4R2BA 4ZEIA 4RB3C 4G4PA 3PQKA 1QQIA 3S9NC 3IL2A 3UGWA 3IORA 4HA8A 4PFUA 1TQMA 1B5IA 1B2HA 1XC1A 4M74A 3W15C 1MQIA 5E20A 2V1DA 2Q0OA 1VFDA 3ILTB 3W9VA 1Y3PA 3GFIA 3NQOA 4ELQA 3PMXA 2F5XA 2OJTA 2PT1A 4DIGA 3RLFE 4IJAA 4BDOA 1MY3A 1MJAA 3DQVC 2VOOA 3E97A 3TQWA 2O6AA 5HPQA 5K5QA 3M1EA 3T1BA 4LG0B 4UUVA 2M8EA 1UQWA 3BBRA 3TQNA 1MXUA 2F6GA 2ONRA 4O3AA 4EM1A 3IC7A 5CLSA 2R6GE 3SESA 1WI9A 3BJAA 4E0WA 4HCYA 4EJWA 4HX8A 3PQJA 5ICEA 1AH5A 4U0VA 3PUVE 3QAXA 3KZZA 4LZ8A 2WTEA 2RF1A 3WTXC 1UTHA 3FD3A 1SW2A 4N6PA 4PFYA 5K5OA 3SEUA 2V3TA 3VLUA 4WCGA 3S9EA 3BP8A 3SEVA 2X4HA 1HSTA 1XGOA 1BI2A 3C18A 1ODDA 1SW4A 3ONMA 4TQUQ 4KR5A 1JXSA 5JR3A 5B7DA 4EF1A 3MCZA 2M87A 4Y17A 3W9WA 3OO6A 2HZLA 4O6JA 2HTJA 4FHTA 2AL5A 5AIQA 1FTOA 1ZAOA 2Q88A 3T9HB 3C1DA 1KYWA 1MM7A 3K0VA 2HTSA 4OETA 4QHQA 4MEXF 2Z3YA 1GVJA 4HOBA 2Q8KA 1P99A 1LCFA 4OEVA 3H6TA 1JW5A 5KCJA 5FD5A 3G73A 4UHTA 3O2PE 4RJZA 4HTGA 3CUOA 4FT8A 1ZG1A 2E1CA 1KU2A 4CHUA 5DEXB 3S9MC 1R22A 3RKYA 1BN5A 3HPIA 1Z6TA 4A12A 1B05A 1LDDA 2J5OA 4AQ4A 4Q47A 1S6LA 1ZRFA 3FMRA 3MPKA 2O1MA 5H8FA 1I6XA 5D5XB 4LQ5A 4ZYEA 1B5HA 1G4DA 2HZTA 3WE3A 1N0TA 1MY4A 3PD9A 2E7XA 2XAHA 4JWXA 4RGSA 2GH9A 5I56A 3FZVA 4DDDA 3RUMA 2D2WA 4PCQA 4OIPF 2CZLA 4H8JA 1MJBA 3E6DA 1SI1A 2EWNA 3CSBA 3V5AA 3P7NA 3LA2A 2PT2A 2HYFA 4KYWA 1K78B 1ZBMA 2DK8A 1ON1A 3OMBA 4OYVA 1F5TA 4ND9A 1R5GA 5FO5A 3R0JA 1Y1MA 3F21A 3R7XA 1B40A 4FIMA 3K6WA 4BQAA 3U72A 2Y75A 2YU3A 4HLYA 5IKBA 1LBBA 5CVRA 1NL5A 3F11A 2Y7RA 4N0BA 2G7HA 1ON2A 3EYYA 3EYIA 1NNPA 4H0WA 3DV8A 4IB2A 1IXHA 4DNCA 3KFWX 1U8RA 1FWZA 2OWTA 1JW1A 3K6XA 4QFKA 2A61A 2P1SA 2H5YA 4TOZA 5EHSA 4ZE9A 2X26A 3T0YA 3K6UA 2DQVA 5TRDA 3ZN0A 3V8JA 1S9TA 3ZMDA 1P1NA 4AB5A 2PBWA 1B0LA 3MZBA 3HRUA 2XXVA 4X1DA 2P7CB 2DPDA 3TEPA 2UXXA 1XGMA 4R6YA 3OEMA 2W57A 5HBCA 3GVAA 3HTSB 2NNNA 3RYPA 2FBIA 1WQ2A 1YFHA 3SXYA 1KU7A 4G94A 3GW2A 3RTWB 4ETSA 1USYH 1B1HA 3EHSA 3ZP5A 1JETA 1XMKA 2AXLA 2ADUA 4ON0A 1YO5C 5LEJA 1JNFA 2RKMA 1XVXA 1MXZA 2GHBA 2I49A 1MDQA 4QFNA 5H8QA 3UN6A 4R75A 3E5QA 2DP8A 1Z05A 1O3SA 3UK4A 3TOBA 4FX0A 2I6EA 2O68A 4WXJA 1FSHA 2VBYA 2J5PA 1QUKA 2MLKA 1JE8A 1XT8A 1MQDA 2L4MA 4AVPA 5D4SA 2VE9A 4KQPA 1SMTA 1DP7P 3IOWA 3MP6A 4I01A 3H6UA 1J59A 1IZ1A 3DELB 3R60A 3IOVA 4DZ1A 2QS1A 1ZIUA 3K0LA 2EV5A 3SZTA 4UXNA 4G8NA 1A04A 2XASA 4EQQA 3CO7C 1KQ8A 2D21A 3RIRA 5J8FA 2OWSA 3L7WA 3QK6A 3WTWC 4KDPA 4WF2A 4OWDA 3IO4A 4PFWA 2QS3A 4M9XA 2MLGA 2OZ6A 4GLIA 4PE5B 5H8NB 1ELJA 5I84A 4YB5A 1RI7A 4A0YA 2QS2A 1H9TA 3JZJA 3WTUC 2RGVA 2LDUA 2DWIA 2AL4A 2QZ8A 5TPAB 3VB2A 4EMSA 3H6VA 5F64A 4Z2YA 1A99A 1XGSA 4RB1A 2H9BA 2RKHA 4ZZDA 2A6EF 3L6HA 2KJBA 3ZMZA 2GRVA 6PAXA 1EZOA 2C6YA 3MFKA 2PBIA 2H09A 3OO9A 2ZNZA 1DTGA 2G93A 3JTHA 3V7SA 3HV1A 2FQ3A 2D1HA 2ABHA 1OKRA 2FOKA 3IRQA 1HKSA 3QPTA 4Z0IA 2RCAA 5H6QA 2ZMEB 3W6KB 3IJOB 1LDJA 4B8XA 3LSWA 4F1UA 1BIAA 2Z33A 3TDZC 1SYIA 1DOTA 1SDXA 1VR5A 5FB2A 4R9GA 2ONKE 2D3IA 3GZ5A 2DQLA 1J1NA 2F7AA 4DXCA 3M3KA 3I0TA 4RXLA 3KEQA 3LA7A 2FA5A 4I09A 1K6OA 5I2KA 4OIQF 3CRBA 4RGXA 3EHUA 1I27A 1YS6A 4NEDA 2EA2A 3VFZA 2QSXA 4LB5A 1OYWA 3T5XA 3IRRA 2GXGA 3Q5FA 4GXOA 3QAHA 1O3RA 1FYKA 4G6DA 4KN7X 3PUYE 4RA1A 3JV9A 3WTVC 1O64A 1IN5A 1T38A 1OR7A 5J6XA 1NNFA 3IWFA 3EQLF 2K4JA 4M73A 2PVUA 1XDSA 2OZZA 1O3TA 3MVWA 1MH4A 4F19A 2MC3A 2CG4A 1UIUA 5D8LB 5LGTA 1D9VA 3GWZA 4LQ2A 2HZKA 2Q2AA 2JSCA 1XMAA 1QNTA 3L6GA 4P11A 4FORA 2ZYMA 1MKMA 2IVMA 3LA3A 3F8BA 5TJJA 1TTYA 5HS7A 1FYMA 4MHGA 3CUQC 1P4WA 1IXSB 2QWWA 2IRFG 1SBPA 2XXUA 3GBAA 3K9TA 1V3FA 4C1UA 1OQGA 5EYFA 4XKRA 1P1QA 1CGPA 4YFNF 2A5YB 5CYVA 2KIMA 3K00A 2Y7WA 1LAHE 3KP5A 3VODA 1R9QA 3SERA 4OENA 4FAJA 1N84A 3CFXA 2MBFA 2XXRA 1HKQA 4HF1A 1XSDA 3ZN1A 1FTJA 3KOSA 3FJMA 2QQ9A 1XDUA 3Q9VA 3G3HA 3OEKA 4KCDA 1TW3A 1R1UA 3ISPA 2P5LC 4WKMA 2HKOA 2PFBA 4BDQA 1B59A 1JHHA 3WTZA 4QFOA 3M8UA 1II5A 3G3GA 5L3GA 4H1XA 4ESWA 3GEZA 4P0GA 5BPDA 3K1NA 4QLCU 4H65A 5H8SA 5AA4A 4LP2B 1XCVA 2XROA 1B9NA 1XOCA 5F1QA 4BLAA 1Y3NA 4GIZA 1BI1A 2JPCA 3TOAA 2OCUA 2BGCA 4GOTA 5ISUA 2ZYKA 3RQTA 4YIFA 4ESJA 3Q25A 4Q5SF 1B3GA 4ZYHA 2RV8A 3V7RA 2L02A 3FX3A 5AE4A 1LEAA 4HQMA 4Q4ZF 4EGYA 3TDUC 4XKPA 3RYRA 4R79A 1KU3A 4I0AA 3F22A 1CB6A 3IJXB 3VXBA 3KJ7A 5E8GA 3C4MA 2EB7A 1JQFA 1YCJA 3TUSA 1IN4A 4DXBA 4FJPA 1FBSA 3LBSA 4L17A 5ICFA 3GO5A 2Z5UA 5LRSA 2AYSA 2UVIA 3MPLA 3KLOA 4WX9A 2AIXA 1REPC 1TXFA 1O3QA 3BFTA 2W24A 3KBRA 3PPOA 3B02A 4ZEFA 2GA1A 4LLGF 4XLNF 3ECOA 4NHJA 1ONVA 5HDNA 3ILUB 5CRYA 3Q27A 1SW5A 2UVGA 2K27A 4L9JA 2P5KA 4G6QA 2HQNA 3GZGA 3BROA 2WC2A 2PLYA 1LCTA 2WWYA 2F97A 4LATA 4WEDA 2KKOA 1F4KA 5HS9A 3V8XB 1GGGA 1PP8F 1BC7C 2Z8DA 4X1BA 1EZPA 4HAMA 2L4AA 3WGGA 1Z6RA 2DK5A 3J80Z 3E6CC 2XAJA 3SKPA 5D5UB 4M6XA 1UTBB 3F8MA 4X9TA 4I7HA 2FE3A 1MH3A 2HFBA 3K6VA 5DVIA 1MD0A 1I6QA 2OK2A 2FMLA 5CVUA 3VVFA 4R73A 3RT6B 3CI8A 3FGSA 2W7YA 1RKMA 3S4UA 4BDMA 1OMIA 1PUEE 1QJMA 1BJAA 1B3LA 5E8IA 3BWGA 4OMBA 3MP1A 5FTIA 5ITOA 1FBUA 3CLOA 2DE4A 1RYOA 3T96B 2HS5A 3ABUA 2OBGA 4GWOA 4F2OA 3OO8A 3RTFB 5L8DA 4F29A 3THIA 5ICTA 4YKKA 1BI3A 1UTBA 2Q8JA 2V3UA 2IEEA 2JT1A 1Y9UA 2QPQA 1J9IA 2ELHA 1KQ9A 4N13A 3HRMA 2B0LA 4EJUA 2A5SA 2WKYA 1WVJA 1PDNC 4ZECA 2UXNA 3F3XA 4GXAA 3F6OA 5FD6A 2HFHA 3P9CA 3EF7A 4XIGQ 4IPAA 1SFEA 2VGQA 2PJPA 3BPXA 2IP2A 3GUDA 2F7CA 1IN6A 1USYE 1SQYA 2DTRA 3O6HA 2FMYA 4IGRA 2MH9A 3L09A 1HW5A 3J81Z 3JTGA 5HLIA 3F8NA 2ZYNA 4ONYA 5DYMA 2Z22A 3FIRA 3M7GA 2IA0A 1T39A 5HDGA 5ED4A 1KQ0A 3HRSA 5ERIA 5LOMA 4EQ9A 2PX1A 4AWXB 4G68A 1TBXA 4ASNA 2GZWA 2O3FA 2Z99A 1DPRA 4CICA 1XVYA 1SFUA 1BKAA 1SAXA 3H92A 4ZE8A 2DVZA 2FNPA 4AIKA 2GHAA 1GV8A 4F3BA 4H0EA 5E1ZB 4O5VA 3V8LA 2ZNUA 4LK1F 3N6TA 1B3HA 3IAZA 2A69F 1IF1A 4EQBA 1AOVA 4F22A 1MJ9A 4QSEA 1UB9A 4ESBA 2Z23A 3H3UA 3IB2A 3QRFF 3JW4A 3FUZA 4JB7A 3C32A 1ZG5A 2I3VA 2ISZA 4G7OF 2VN2A 3E5XA 5ICGA 5L3BA 3FJGA 3VLWA 5D4RA 4E0XA 4RAYA 3RPQA 3G3FA 3QUFA 2V3QA 5H8HA 5AA2D 5KCJB 2XXWA 5CM6A 2W84A 5FLXZ 1R1VA 4A0ZA 4HLXA 3F8CA 3ZMSA 4NQWA 4ENKA 1R1NA 3CVGA 3DF8A 2JZYA 1T2KA 4OTEA 4MGRA 3I53A 2DXYA 1SD7A 3KEOA 4I0BA 4UNOA 1X3UA 1MGTA 4Q0CA 1NMUA 3SEXA 1HKTA 4LONB 2ZMBA 2L3DA 5I57A 1W5TA 3WODF 1R36A 1T6SA 2R3SA 4JBAA 3VVDA 1ZN2A 4BDNA 3I54A 1Q1KA 4JWOA 1YS7A 1QVSA 2K86A 2O7IA 4XKQA 2NUVA 4OFJA 1UHWA 1AWCA 1B7ZA 4L9TA 1Q35A 3JSOA 3PD8A 3PPRA 3NEUA 2VC1A 1O57A 3TFLA 1YG2A 3D4GA 2EFQA 1S50A 1SVXB 3ZMTA 2GWRA 5L9MA 3BPVA 1KWHA 2PG4A 3F72A 3I59A 2ISYA 1POY1 4PGGA 2EFOA 3R4KA 4PDKA 2XXQA 4A6DA 2MA3A 2VC0A 4LJZF 1PDAA 1IAWA 4I02A 2Z8EA 2RC7A 2VD3A 1EZ9A 1ZYRF 1MDP1 5E18F 5L3EA 3KN3A 2EV6A 3H3ZA 4WXHA 3V8KA 2E1NA 2QLZA 1KGSA 3H7MA 2OZUA 1W7PB 2E7WA 2QENA 2REJA 3FJ7A 4KIGA 4BAYA 3HSRA 2CWEA 4ZH4F 3T9XB 1PBPA 1QW0A 2V1XA 5KZTA 2DAOA 5HLGA 3EPEA 5CC2A 5LBQA 4G77A 2P4WA 2I4BA 3AXFA 3TKDA 1F9NA 5F7VA 3HSTA 3RY3A 1R58A 3QU3A 5JI6A 2DW4A 3HSFA 5LGUA 1O7FA 4U1ZA 5K5RA 5ICCA 2AS5F 2ALUA 4TLLB 4OOIA 2NNYA 4UACA 3O9PA 4DLDA 4IF4A 3O29A 4ENNA 2RC8A 4IO5A 3BDDA 3P7IA 3KEIA 1D9YA 2NXOA 1K7AA 3CTAA 2D1VA 1SYHA 3I4PA 3FVKA 3IHUA 2UVHA 3QOPA 4XSZF 1B4AA 1IXGA 3IKVA 2H98A 4YFXF 1P6RA 2VONA 3ML6A 4RNSA 3V7CA 2DI3A 1W7PD 4R72A 3KJTA 3OSRA 3MZHA 4OZ9A 1E2XA 1SMYF 4Q8RA 4IRGA 1QPMA 1S7AA 3LR1A 4Q30B 3UA8A 4DE8A 4H8IA 3MVXA 2PI0A 3RDIA 4CO8A 3T9VA 1UFMA 3IB0A 3PMWA 2ZYOA 3Q26A 3KP2A 4YMBA 3BJOA 1US4A 5CMCA 1DPUA 5EEHA 3C36A 1AL3A 4MLQA 3D5LA 2ZXTA 4A0XA 2IW5A 1O7TA 1M5FA 3TODA 3I58A 1LQ1A 3V4GA 1XSXA 4N9IA 3SDFA 4C1TA 3BZ6A 3O28A 5L3FA 1FTLA 1HSEA 3DM0A 4HDVA 5HVQC 4LLNA 1USSA 4R74A 3QYTA 3FXUA 5DUIA 2BYVE 2A07F 4EXLA 4NF6B 5DTBA 5JVTA 2DLLA 1LFHA 5HDKA 2NAZA 3DP6A 3LUYA 1LSTA 3KN7A 2XUBA 1A8FA 3DKWA 2Q9TA 2M8CA 4LZ5A 3EDPA 4FECA 1I1SA 4MQVA 2UXAA 4IY6A 1P92A 4YB6A 5DDGA 5BMZA 1IRFA 4GVOA 3L2CA 5DCMA 1B9JA 2Y7IA 3M3FA 5K2XA 4P9FA 1XGNA 3S9LC 1V4RA 2VBXA 1NHAA 1S7OA 1XB4A 2GIVA 3TTMA 2TDXA 1P4XA 1U5TA 2PQ8A 1IIWA 4MF3A 3VEPA 1D3YA 4RK2A 4KYSA 4GO1A 2IA4A 1JHFA 3QUJA 1K79A 4HCWA 1FP1D 3TO9A 4XSXF 1TQPA 1BIYA 3IKTA 2FEZA 3I59B 5F1RA 2NYXA 1NFTA 3PUWE 3RPUA 2PEXA 3C33A 4OIOF 2G9WA 1T98A 4F3PA 5I59A 5DD4A 3DP8A 5HM4B 1IXIA 1J5YA 4L0ZB 2XX8A 4YICA 3EETA 5L9SA 1G3YA 2B3FA 3C35A 3RNNA 1Z91A 2I48A 2XRNA 1J75A 4KCCA 4KA4A 1H45A 1LB9A 1JVXA 2QS4A 1LAGE 2OD5A 2ZXJA 4EQ7A 4MH5A 4OFLA 5DCFA 2ESHA 2IA1A 3IWZA 4UVAA 2XXIA 3TTRA 4S05A 4HF0A 1M5BA 3DXJF 4U0YA 3R26A 3TO6A 3C34A 2IJLA 4OXVA 3ROUA 2XKPA 5H20A 3F23A 1U6GA 1LGBC 4YKJA 4EV0A 1H76A 5A2QK 3T8TA 1BIBA 3K1MA 4HQEA 2HCAA 1ZGAA 3CO6C 1Z7UA 4L9NA 1MXVA 1VE4A 3RPWA 4F39A 4GYGA 2DE3A 3CG1A 3IK6B 5K2YA 1POTA 4L5IA 2UYFA 4HBLA 4GXSB 1N7WA 5L3CA 2XD2A 5FTHA 1FQBA 2Y48A 1CE2A 1MQGA 4XTCQ 2JPBA 1U3EM 3EHTA 5DCMB 3IO6A 1MY1A 4FE8A 1IRGA 4F31B 4ECFA 4M9SA 2XXXA 3FWEA 3LSFB 2THIA 1YW7A 3HHHA 1Y4TA 1YTVA 3IL1B 5J1DA 1HBXG 4U4XA 4LB6B 2FBKA 1D5VA 2XKOA 3KCCA 2VT2A 3L00A 5AIPA 3C31A 5BPIA 3G3IA 3T93B 4UVBA 1L0OC 1A40A 1QUIA 3WTYC 3OXNA 2VP1A 3MZ9A 5I2KB 1H0MA 1OYIA 3M8EA 1IXCA 2Y7PA 5H8NA 3SETA 2X7PA 5HS8A 3UIFA 1PP7U 5BQTA 3W6JB 3ZPLA 2Q2CA 4RYAA 4KIFA 1MPDA 2ESNA 4IGTA 2XHDA 4RY1A 1OVBA 4Q5TA 4G68B 2FF4A 3N6UA 5I58B 4HX4A 5I2NB 1ZARA 3Q9SA 4OIRF 1FY7A 1LB2A 1ZLQA 4QRZA 2NRAC 4CDGA 2A6HF 2HEUA 1VTNC 2RDPA 4D0PA 3CG3A 5AA2B 4PFTA 4CYDA 4O3CA 2UWMA 1QULA 1WKMA 4TLMB 4ZDMA 2HOEA 1H9GA 2K7LA 2KLFA 5FFZA 3I5UA 2R7FA 4YMAA 3N5LA 3MQ9A 5H6RA 3WAFA 3CSGA 2ZJ2A 2CSOA 5JK4A 1A8EA 1JEVA 2XGXA 3E4RA 4K2EA 1D8JA 2P2AA 4AIHA 2DWJA 4YFKF 2WV0A 1OVTA 3ZSFA 5FHNA 3FXRA 1RZ4A 1QKBA 4NF4A 1D4NA 4F3SA 4OESA 3BKIB 2EK5A 3TYHA 1SD3A 3E3VA 2O61A 2PMHA 1PC3A 3ZMUA 4R6KA 1NH8A 2Y0MA 3O66A 1XCBA 4X48A 1N3WA 5FGMA 4JSOA 4WXDA 2QQBA 4BDRA 4M71A 4IHTA 3A09A 1B52A 2M1BA 4MTEA 1I6AA 4I2OA 2Q2EA 5DYHA 2BE5F 4ZZLA 1FZPB 3COAC 4M4GA 3MAMA 2YPRA 1FBQA 4YKPA 3T9UA 1T0FA 4L9VA 3V89B 2P6TA 5FFXA 5BOXA 2EJRA 4U22A 2HDCA 3U94A 3E3KA 4HDUA 2BBYA 2RN7A 4IO3A 2XXYA 3BY6A 2OQRA 3K2DA 1W5SA 2W85A 1OPCA 2P5VA 1I69A 3H6WA 4R6HA 3TCGA 3WGHA 1LVAA 4G2ZA 3KOTA 3K2ZA 4F7ZA 5AA1A 1BOAA 4LUBA 2ZCWA 3TTNA 4G7HF 2V1UA 5DT6A 4M9ZA 4BH9A 3CR9A 4LK0F 3K01A 4YB7A 2OU2A 3MP8A 2EFWA 4NB5A 2F7BA 3SHFA 1J7KA 2VBZA 1R23A 2X7QA 1UHMA 4CXFA 4PQJA 1LDKB 2I58A 3P9KA 3R6SA 5CVJA 4HV6A 3BFUA 1DSNA 1MDMA 2F6PA 1BLFA 4ZZEA 1QO0D 3PPQA 4Z7EA 4MFIA 5JTYB 3FM3A 1B9MA 1YW9A 5JTYA 1R5HA 2UYEA 1ZJLA 4Y13A 4IXAA 1H3DA 5TPAA 1R00A 3U1OA 4IO2A 5DD8A 4NF4B 1ZTYA 1MG1A 1WODA 2V93A 1BBYA 3DPLC 1BM9A 3QSLA 1QUJA 2QJEA 3A3CA 5DEXA 4RGRA 3GLXA 2RQPA 1PEBA 1MQJA 1KU9A 5KVRA 3TDJA 1S29A 2XXHA 3OOPA 4P96A 4KUMA 2QMWA 4FEBA 2XIGA 4EJTA 5CBSA 2YX4A 3HUGA 1B58A 1SD4A 4I98B 1O63A 1F9BA 4NF8A 3BJ6A 5HLHA 3KFMA 4CZZA 1MXYA 2VHAA 2VXZA 3SEWA 1MY0A 4EDPA 2Z9OA 4L5JA 3KP6A 5DUKA 4R2FA 5DVJA 3TO7A 3GXOA 5E1WA 1K78A 5B70A 1LLSA 3C3WA 1B7HA 2KIFA 2O84X 5AA2A 3JSPA 2STTA 5E17F 3KP7A 4YKIA 1IQ7A 2ANJA 2I4CA 3FV1A 2OLBA 2FBHA 3QIMA 3WAEA 3TCHA 1Z1DA 2LSOA 5DVFA 2QRYA 4Y15A 3TELA 2RINA 1VFEA 2DOJA 1FW0A 4XXUA 4DCYA 2CMOA 2LF8A 3MC2A 5BUUA 4U2RA 5H8HB 2FA7A 1Z7NE 1JGSA 1S7YA 3UP9A 3G3ZA 3E6BA 1QBJA 1GXPA 3FHZA 3MEXA 1OLCA 4L18B 2HAVA 2CQKA 1MRPA 5ELVA 3PGFA 4ESXA 1S3JA 4LD5A 3O6GA 1AIVA 1H43A 3J80K 4DQ2A 2F34A 3I3VA 4XKNA 4U23A 3GFJA 2KRFA 3KN8A 1FYLA 2EFPA 4JQFA 3KZGA 3T66A 1TNSA 4KNYA 3P9IA 1R9LA 3OO7A 1P1WA 3A3UA 2OA4A 2F36A 1P2FA 2HWVA 3ERED 3GF2A 1E17A 4BYYA 3CJNA 1YLFA 2XAFA 5CMKA 3ELKA 1TQIA 1YQAA 3QPHA 1OLAA 5EEGA 4RB0A 1SI0A 3FMQA 3TQLA 3ULQB 4HZFA 2VE8A 1ZRDA 2OAZA 3C9HA 1FT9A 4BHPA 4H67A 2VOZA 5D8KB 4MQ9F 1IXRC 3GFMA 2CGPA 4LZ7A 2MD5A 4XBFA 4I62A 3H3GA 5KK1A 1RUOA 2QQAA 4MNUA 2QBYB 1OIBA 4H5FA 1B4HA 2HYGD 3TPAA 3PUXE 1ZG3A 2ACJA 5LLQA 1XS5A 4H6DA 5TP9A 2YSRA 3TTKA 3B73A 3N94A 4KYEA 4I1DA 3GX4X 1FC3A 4IVNA 3U9GA 2F8DA 5E1XA 3D0SA 1F1ZA 1FQCA 1FTKA 1W4MA 4BHCA 1WWXA 2PMUA 2O51A 4OU0A 1TFDA 3WU0A 2O6GE 3HN0A 1I1GA 3O97A 4G8XA 2JTVA 3TKYA 2VBWA 2DXRA 5A5XB 3DEUA 3GZ6A 3IB1A 3FF5A 4G8MA 2M45A 2FNCA 1EV7A 1N3XA 1ZMGA 1B3EA 4LVQA 3MW0A 2ZFWA 4A2UA 2P0SA 3K69A 1LJ9A 1IUYA 1MPCA 5ICQA 1S8NA 2V9VA 1Y3QA 3MVZA 4HS7A 3PMVA 4EM0B 3HHFA 2R7DA 1SFXA 1WSUA 2FYIA 2W25A 4R1HA 1A55A 4Q48A 1RYXA 3SFZA 1P1OA 3DFGA 2YLNA 5KDTB 3GBBA 4P9UA 3F6VA 1DUXC 4EJOA 1U5TC 2PYYA 1D8KA 5CMMA 3MBPA 4LFUA 3HRTA
chains in the Genus database with same CATH superfamily
3G7WA 3RJPA 3ZQFA 2B3BA 3NOHA 5ILVA 2V25A 5A2QZ 2PFYA 4A3MJ 2I10A 4KJZA 1ATGA 1UTHB 4KFQA 4HX7A 4B4CA 3OYGA 1EH3A 1PBQA 4G8HA 4JWYA 5EYHA 3CUQB 4UUSA 3T22A 4I76A 3QPLA 3QXMA 1FOXA 4II3A 1MXXA 4X6AJ 3SZGA 3KGCA 5DEQA 1SVLA 5FKOA 1GR2A 1A6IA 3GXAA 4L0YB 4RGUA 2F5DA 1FBPA 2A3SA 5ILUA 2PMSA 3VDFA 2CW0F 4Y33A 2G7UA 2OBPA 3HIFA 4MTDA 3AKZA 3O6BB 3G3JA 1VZ0A 1Z67A 5GPAA 4F1VA 1DGRM 3HHGA 4WEPA 1ITYA 2M4KA 1YOVB 1RUNA 4ELOA 5CVIA 4QFPA 4D5FA 4NAPA 4CYCB 2L9NA 4XMYA 3HKZA 4IX7A 4ESFA 1B4ZA 3U93A 2VODA 2EA4A 4W97A 1QZYA 2R5YA 4AB6A 2Y0SN 4UB8C 1WDNA 3LSJA 4LMYA 3CJQB 2GQ1A 3I55I 2WYKA 3EN3A 1Y4CA 3DKYA 4PBHA 1RC9A 1US5A 3HEFA 1FJ6A 3LSIA 4ZC3A 3JREA 1PB9A 4PBQA 5IAIA 1RNLA 3H3VK 3ODBA 2OQGA 1IW7F 3CFLA 4P55A 2F5CA 5LDZA 1SD6A 5AONA 2QMXA 1YW8A 1Z3YA 3OOUA 3QP5A 3KYCB 2LY2A 4IHWA 1A35A 4RB2C 1ANFA 3B7DA 4NF5A 4XLHA 1FPQA 3L2RA 3RI4A 2XPVA 1ZR2A 4GL8A 4KICA 5DV5A 3CDLA 3HTUA 4QWQA 4X1EA 3C7JA 5JHUA 1EU8A 5F27A 5IT9K 3IOUA 4GQOA 3BG7A 4ELPA 3B6TA 4ZEBA 1HQCA 3NRVA 3BCBA 1IMCA 1EH7A 2MH2A 3S3MA 4LA9A 1B72A 2P6SA 1OCRH 5D5VB 1YRNA 1B3FA 2BJJX 3NAUA 4DYCA 3OO9A 3VXBA 2ZMEA 4E70A 4KIBA 4OFOA 4FEDA 2VOPA 1OCOH 2HPMA 1MY2A 4D7NA 5M5WJ 2EFNA 2JSPA 4IY5A 4S04A 1B51A 1UIVA 5JFRA 2VPLA 3CDHA 3QYFA 4XKVA 4IHYA 4AYBN 5L3DA 1B1BA 1FOKA 3G3KA 2O1LA 4M6VA 3M3LA 4HV5A 2X48A 5CBRA 3IH4A 3QQAA 2EV0A 3I64A 4N6DA 3REOA 3FBIB 4JDFA 2VQLA 4KMUX 4NTLA 4XRMA 2HQ0A 3JRFA 1FTTA 2O69A 4YU0A 4GYIA 3ZQ7A 3U1DA 1LFIA 2H99A 1IN7A 2CFXA 3GTMJ 1TZLA 1LFPA 1M5EA 2V6EA 4XLPF 5KDTA 1R7JA 1QHGA 2M30A 1RETA 1CF7B 2I0CA 2R71A 4M72A 4GL0A 1TWYA 3IX1A 2QUFA 3PO3J 5BS6A 1A36A 3EUHA 1B0HA 3LFUA 3H03A 4MFDA 2O0YA 5LRRA 3K70C 3E1SA 1B6AA 3FXJA 3W2WA 2RNJA 2DSFA 1STZA 1FQDA 1JTXA 1YAEA 3CIJA 4O3BA 4OHNA 1FP2A 4Y52J 1BOBA 1GV2A 2FSWA 4IRHA 3WTTC 3B6WA 5IYBJ 2B65A 3CDIA 2LF7A 4I8CA 5KCMA 3W3CA 3W2AA 1FBHA 5ILSA 4DW6A 2V9KA 2DOAA 2ZXHA 4ENJA 4ZZAA 4MNCA 2ZKZA 3AL0C 5ET8A 1R6ZA 2V4JC 1ZTRA 3LOCA 1JEUA 1VDWA 2O7UA 1DTZA 1L5TA 3LQQA 3WE2A 4EUOA 5EG0A 3RKXA 4YRVA 4CYCA 3VE1B 1CF7A 3ERMA 4LLLA 2FNAA 2QGUA 4OVJA 3GZNB 2KDZA 4F2QA 1IRXA 1MZBA 2FXAA 1DMBA 2CUFA 1T08B 1WPKA 3FXQA 4PCDA 3USDA 3J81K 5LHHA 2H25A 3MQ0A 1ACIA 1U2WA 4R8HA 1TFAA 3KSJA 3QU6A 1LBCA 3H0DA 1SANA 2CYYA 2JRTA 3OD7A 2NOOA 3F8FA 3FK6A 3HL2A 5F6FA 1GTKA 3OSQA 3Q28A 4P9KA 1N76A 4U21A 2F3DA 4NWDA 3JRIA 4ZEDA 3CZ6A 5DM7F 2IAIA 2VL8A 4PAKA 2LNBA 3VWBA 1WZ2A 1XHYA 1J0RA 1ZGWA 1K83J 3AG4H 1KA8A 1QGPA 3DPTA 4G7ZF 2NWJA 3A01B 2HR3A 5H8QB 3ZKKA 1N7XA 1BTJA 5I5PA 2MW8A 2X0LA 2KDOA 1JI8A 5TU0A 2HXWA 2E0SA 4NE4A 3PU5A 3R61A 4BNCA 2HKXA 4YG2F 1GXQA 3DKXA 3T8RA 2DA4A 2L9VA 1FCKA 4JXIA 3U65A 1TT1A 4F1YA 1LNWA 1QKAA 2H8WA 4C0RA 3JYRA 5CMBA 5I56B 2F78A 3FXBA 4JK1X 2CMPA 4PGHA 4FX4A 3VVEA 2P8TA 4UABA 3OV8A 4AD9A 2FRHA 2LVSA 3S2WA 3VV5A 4DCXA 2W1OA 4EXKA 3K4UA 5LHIA 3KP4A 3MWMA 2ZBKA 1XSVA 3AAFA 2P7VB 3PSFA 4XIDA 5A5LA 3FDYA 2O8XA 3MWBA 1FRPA 4N07A 1O7LA 1AKHB 4II2A 4IHSA 1NNKA 3K02A 4LG0A 1Z7ME 3I5OA 1T0FC 4CA0A 2ZNYA 1JKPC 1JW4A 2E1SA 4M1VA 4IR8A 3FATA 1PB8A 3TCFA 3AG1H 3DEEA 3RZDJ 2DOFA 1W7PA 1PUFB 3SQNA 3OELA 4OEUA 1XPXA 1Q1HA 2STWA 3BG9A 3KZYA 4B09A 1Z9CA 3I71A 2KHMA 3FVOA 3LV0A 4HEA2 1I5ZA 1OYYA 3TMGA 5EYGA 1MDMB 3RN8A 2QVOA 4ZS9A 3R0AA 5HOOA 3DU6A 3SEYA 1YZ0A 3ECRA 2G29A 1ZLJA 5ESYA 1RDZA 3I4NJ 1LAFE 1ZREA 1R5ID 1AOYA 2BV6A 1LUJB 2EQRA 4CGZA 3EQ1A 2DFIA 2L7KA 4GGGA 4C3JJ 3KSXA 3O6IA 5IZ3A 3PFIA 4F18A 1FLIA 3ECHA 2A5TB 2KQZA 2KT0A 2D5WA 2YU9J 2ETHA 2HZDA 4XF5A 4K3FA 4ZEKA 3LQRA 3Q29A 2F5EA 3B6QA 2K4BA 4M3DA 1NTCA 4GRKA 4BKXA 2F3BA 1X2MA 5I2NA 1ZH5A 5ET5A 1EH8A 2COMA 4KYDA 4NGUA 2DO7A 2REGA 2DPUA 1Y0UA 2ZO4A 3OSFA 1N04A 2YPNA 4CCMA 3U1KA 3Q0VA 2BVMA 4N8GA 1ETWA 3PNVA 3AG3H 4U7DA 3GLBA 2H6CA 2HDWA 4Y7NJ 3AFHA 4XL9A 5M5XJ 1I50J 1VSOA 5D6FA 3FV1A 3M9AA 4MEYF 2LR8A 2EZIA 4YZZA 2BW3B 1QZZA 4EJVA 2F5FA 4A3IJ 2CV1A 1IUDA 3ZS6A 4D7MA 2DS9A 2QYOA 3C2HA 3ZQLA 3LNQA 1YIJI 2Z8FA 2PN6A 4E7HA 4WK8F 1ZRCA 4IRIA 1BC8C 3O3KA 1G3WA 1XC5A 1MS7A 3FASA 2IA2A 2DDKA 1IN8A 3HCQA 4KPTA 4QSDA 2MKZA 1FSEA 2W7NA 4TV7A 4OMYA 1DPEA 2F35A 4G68C 3WG9A 3UORA 3SZPA 3MAJA 1T95A 3B6CA 3KZIC 5CJ9A 3TW6A 2TRTA 3MJNA 3CQZJ 3VXCA 2EPFA 3KP3A 1FQEA 2F2EA 1SW1A 4RK9A 5KHDA 2V84A 4MAGA 2H8RA 1MXWA 2Y5LA 1IDZA 3S3OA 1B46A 1APLC 2Y31A 4JOMA 3GYHX 1KA0A 4JBZA 3PPPA 5EHMA 4MHFA 3TTLA 2OTJI 1LVKA 1RKWA 4KMFA 1JVYA 2WADA 1GHCA 4P5OA 3GTJJ 4EM2A 3D4CA 5H8FB 2L01A 1YX5A 2XB5A 2HOSA 3DP4A 1NKXA 1GVCA 4YAHX 1EH6A 4XOPA 3TZAA 1R1TA 2HQ5A 4AC0A 4GD5A 3S14J 2XXPA 1K6YA 2DODA 3KLNA 1MBJA 1MMGA 1IMAA 2ONSA 2DMQA 4E7IA 2R9JA 3CFZA 2DQRA 1UCRA 3BTJA 2GA2A 1IITA 4POWA 4U4SA 1LAXA 5LHGA 1LB8A 4OQOA 3KX2A 4HW8A 4O3MA 4E7KA 4EF2A 3PUZE 1G6NA 1IEJA 1AMFA 1LFGA 3IR1A 3E13X 2XX7A 4P0IA 4DI3D 4BHBA 3RGYA 1XS9A 3SDBA 4DXUA 1G3SA 1IGNA 2RNGA 4POXA 3U92A 4C2UA 2IBDA 3DLAA 5DW8A 3HOYJ 3LWFA 3ABTA 3HSEA 1FQAA 1MM6A 2L54A 1JUSA 2H1KA 1X1DA 2QBYA 4XM3A 2XD3A 1NV2A 2Q89A 2KRCA 3KE2A 1MBFA 1PB7A 5J8CA 4IO4A 5FKKA 4IO6A 5I57B 1HLVA 2W48A 2UVJA 3U2RA 1P4AA 2DMTA 3TMOA 3RTRA 3DLNA 2LK2A 1I39A 4NQWB 4UVCA 2XV4S 3CCYA 3TGNA 4KFCA 2M2EA 1B7UA 4QSCA 5ET7A 1D3KA 5HLTA 1FPDA 4LGWA 5IT3A 2DU9A 1V5GA 4H5GA 3MUQA 4PFRA 4ZYGA 3HC7A 2CUEA 2HGCA 2YR2A 4HW0A 3WG7H 3VOEA 2KMUA 3E5UA 1ZLKA 1LBYA 4NMYA 1TNTA 3AL0B 1TW2A 4A5NA 1OCCH 1HSLA 2RC9A 3BOQA 4KI0E 2BEOA 2V79A 1U78A 2HEOA 3RKWA 5IT9Z 4G9YA 1URGA 2GOXB 2IPQX 5K1YA 1Z77A 4WWCA 2HI3A 3MVYA 1F36A 4RPNA 4GF8A 4NF8B 1IMBA 2R5ZA 5A5XA 4RS8A 1HXDA 2LMDA 3GCMA 1VQ4I 2I8DA 3L9FA 4A6EA 3OIQA 2KIUA 3DWLE 4ZJZA 2LC2A 4E7JA 1DPPA 2DYXA 5JEIA 2GFEA 1I6BA 1OMPA 4ZYDA 3MZ1A 1NH7A 3ONQA 4QF9A 2DWAA 3JAMK 2KPMA 2ZNTA 3SEZA 1FEXA 3WU1B 5I7IA 1OQHA 5FHMA 1B5JA 4MBPA 1B32A 4WXCA 1NNTA 2B63J 2V4CA 1TLHB 1T0KA 3KETA 1CQTA 4FE4A 2M3AA 3TP0A 2NVXJ 2NS0A 3FVGA 3LSPA 1XD7A 1A7LA 2YJPA 3J7AO 4NG7A 1YYVA 4KN4X 2CQ7A 3CC4I 3JRGA 2DE2A 5CVVA 4OINF 1MNEA 1KYZA 4UV8A 5BWJA 3LSXA 4AIJA 4IQJA 2VJJA 3A02A 5IM2A 3LAPA 2H4IA 2L5VA 1URSA 4GFRA 5TGTA 4XQFA 3VYSB 4A5MA 4LIUA 2MGQA 3MZYA 2E36A 4G12A 2DYSH 3ZMVA 4PP0A 1H44A 1M5CA 1FQFA 4MLVA 4KD5A 1YPNA 5I59B 5IYDJ 1SD5A 4EVIA 4N91A 2XAGA 3HOTA 4ZTJA 3J7ZI 1BP5A 1FTMA 5TP9B 4YIIA 3LSLA 3FV2A 2V6CA 5FLXK 4MNIA 4JSDA 5JHFA 5I58A 1URDA 2GAUA 3V83A 4HF2A 3N4MA 3FM5A 3OENA 1HW1A 3H6VA 5FHOA 2RCBA 1FNNA 4F91B 3H4ZA 2WV1A 4UV9A 3FMSA 3H06B 1HW2A 3BIGA 2CO5A 1MPBA 2DOEA 4U88A 1Y1ZA 3ZKLA 3E9XA 1ZGJA 2ZSIB 4J00A 2E2JJ 3A0BC 1Y20A 1BA5A 3HO7A 2ZNSA 1G3TA 3BTIA 2HHMA 3PUFA 3PPNA 1TWFJ 4XRFA 5LEKA 3PJRA 4NF5B 3ZR8X 2HQAA 4BBSJ 4ELRA 2R7WA 2GIZA 3N26A 2H6BA 2A05A 2Y84A 2M5WA 3QOEA 3QP6A 3FVNA 3TL4X 2I3WA 3MKZA 3UR3C 3KYDB 4I6ZA 3VLVA 5D5WB 2LKPA 2DVCA 4R9FA 4H46A 2H94A 1ZU0A 4ZDOA 4XKWA 2DT5A 5J1RA 2LP0A 2KJCA 1X4PA 2XXTA 4HRIA 3DEWA 2M0MA 3PV0E 5C4JJ 1M5DA 2WYPA 3VFJA 5L9OA 3C2GA 1B1XA 4ISUA 4PETA 3LFKA 1WJBA 4I9DA 3KG2A 2LAOA 2HOAA 2VT3A 1YIOA 3K4NA 4ENMA 2QL3A 4GCVA 4NF6A 5HNHA 4BBRJ 3LAJA 1RIOH 2GQQA 4GDFA 1MQHA 2DWHA 3OYAA 3K4KA 3RT8A 1BI0A 3N97A 2OX3A 2Y7KA 3DTKA 4THIA 4QFLA 4XFEA 1NUXA 4GWXA 4HPQA 2XAQA 3GBGA 2HAUA 3R6UA 3HOSA 3HOWJ 1ZKBA 5KAFC 5LGNA 4NWCA 1K4SA 2O03A 5D6EA 2RC4A 2EIJH 4BXFA 3QYBA 1DU0A 3W6VA 2KR0A 4NHBA 4BE2A 2K02A 2PJRA 3CCMI 2XHKA 1HSJA 1ZHFA 2D45A 3S15J 2QM3A 1XN7A 3FIWA 4PUSA 4F3GA 3CMMA 1JKQC 4JP0A 2HQRA 4OMZA 1TC3C 2I0BA 4RAZA 3M8FA 4UA8A 5CI5A 2R7SA 2FIEA 1USTA 3ZQCA 1TWCJ 1MBGA 1ETKA 1QVTA 4KHZE 2H27A 4X04A 2IS2A 3K4CA 3OYBA 3K1PA 4OERA 3ASOH 3CUQA 4KT5C 4B1RA 1G0IA 4BEHA 1NUWA 3HYIA 1FBFA 4IO7A 1U5TB 1A54A 1HDDC 1V55H 2NVUB 4F92B 4U7BA 1YTYA 1L3LA 4N8YA 4PZJA 3QYEA 2DBBA 2XX9A 3LC8A 2A68F 1ZR4A 5AA4B 2Z2SB 1B6HA 4EGZA 3OYCA 3TAJA 2EZLA 3IOTA 4BDLA 3GFLA 3S32A 3CLQA 2XVCA 3DP7A 2OTLI 1RR7A 3U8QA 5ITPA 3BQZA 4IOAF 4FATA 2M34A 4BXUA 3ESWB 3L2UA 1J2XA 2WY7Q 3WGIA 2VASA 1ULYA 4U0WA 2NXNB 4N9HA 2PMZA 4IOCF 3H1CA 2L7FP 5GAEJ 2EINH 3JAMZ 2CUZA 2OCEA 1IO2A 3HDDA 2UZKA 2A5TA 4RPOA 1WRJA 2RVCA 4M6YA 2M0CA 1P1UA 2HXOA 3O2AA 2GXBA 5B1AH 4E7SA 3LSTA 4HYEA 2YX7A 3WTSC 1C0WA 1LEBA 2VD2A 3GTGJ 3A0HC 2QCOA 1DDNA 4G6TB 3E6MA 2IT0A 2FU4A 1FX7A 1OR7C 1V54H 4PSXA 2I5UA 3OOAA 4R2BA 4RB3C 4ZEIA 3V42A 3PQKA 4G4PA 4J01A 4QPQA 1QQIA 3S9NC 3LSGA 3IL2A 3UGWA 2XDVA 3IORA 4O7IA 3C2BA 5F0FA 4HA8A 2FUG2 2MG4A 1TQMA 3Q0UA 4PFUA 1B5IA 1B2HA 3CHGA 1XC1A 1E3OC 4M74A 3W15C 1MQIA 3PL8A 5E20A 4MEVA 2V1DA 2Q0OA 1VFDA 3M3YJ 3HUGB 2QVVA 2EH3A 2B7EA 3UNGC 2PJRB 1F43A 3ILTB 1J09A 4RLQA 1Y3PA 3W9VA 2R5YB 3GFIA 3NQOA 4ELQA 3PMXA 1ORKA 2DTZA 2F5XA 2JRMA 2OJTA 2PT1A 4NC7A 2JA7J 5LFAA 2XPUA 1WCMJ 4IJAA 1BK4A 3OMYA 3RLFE 4BDOA 4DIGA 2GLOA 1MY3A 1MJAA 3DQVC 4N4NB 2VOOA 4BS9A 3HB9A 4DBQA 3E97A 2PCRA 2FJ1A 5M2VA 1JT6A 2O6AA 3TQWA 2OJED 5HPQA 2JK3A 5K5QA 3M1EA 3T1BA 4LG0B 3VYTB 1QA6A 1HA8A 3OYJA 2JA5J 4UUVA 4AM3A 2M8EA 1UQWA 4N15A 3BBRA 3TQNA 1MXUA 3OS1A 2F6GA 2ONRA 2DJIA 4O3AA 4FISA 4EM1A 3EUAA 2LRDA 2XGEA 5F0CA 5M3FJ 3GTPJ 3IC7A 5CLSA 2R6GE 3SESA 1WI9A 3BJAA 4E0WA 4JYKA 4HCYA 4EJWA 4HX8A 1RR8C 3PQJA 3DU5A 4CCOA 5ICEA 1AH5A 4U0VA 3MD2A 5JLXA 3PUVE 3QAXA 1HF0A 3W2VA 3KZZA 1Y0NA 4LZ8A 2WTEA 2RF1A 4PF6A 2BXYA 3WTXC 1ZK8A 3OWTA 3HBLA 4BQOA 1UTHA 3FD3A 4BJTA 1SW2A 4N6PA 1XG1A 3L1PA 4PFYA 5K5OA 3SEUA 2V3TA 3VLUA 4A69C 1FMVA 4JX6A 3BP8A 3G1OA 3PSIA 2X4HA 4WCGA 1G0HA 3SEVA 1HSTA 3RPUD 5EQ8A 2XGDA 5F04A 2KZVA 1XGOA 1BI2A 3C18A 1ODDA 1SW4A 3ONMA 4TQUQ 3JRDA 4ZTFA 4KR5A 1S9HA 1JXSA 5JR3A 1NV6A 5B7DA 2KL4A 3MCZA 2M87A 4Y17A 3TBIA 4BE1A 4EF1A 2HNHA 3W9WA 2JN6A 2K40A 3A29A 3OO6A 1MIJA 3BR6A 2HTJA 4FHTA 4O6JA 2AL5A 3Q3SA 5AIQA 1DU6A 2HZLA 4U87A 3SYTA 1FTOA 1ZAOA 1ZELA 2Q88A 3DTIA 3T9HB 3C1DA 4PE3A 1KYWA 1MM7A 3K0VA 2MSYA 2HTSA 4OETA 4QHQA 4MEXF 2Z3YA 1GVJA 4HOBA 2Q8KA 1P99A 1LCFA 4OEVA 5F24A 3L2QA 3H6TA 1JW5A 5KCJA 5FD5A 2HU9A 3G73A 2BOLA 4UHTA 3O2PE 2QVUA 1IMDA 4HTGA 3CUOA 4FT8A 4DYRA 1ZG1A 1JJ6C 2E1CA 4RJZA 1KU2A 5TISC 4CHUA 5DEXB 3S9MC 5E3MA 2FBPA 1R22A 3RKYA 1BN5A 3HPIA 1EA3A 3EUHC 1SC7A 1Z6TA 4A12A 1B05A 1LDDA 2J5OA 4AQ4A 1NUYA 4Q47A 1S6LA 4DZJA 1ZRFA 3CC2I 5GAGJ 3FMRA 3MPKA 5CPRB 4N81A 2O1MA 2CRGA 2R4GA 4P56A 5H8FA 1I6XA 1MNDA 2VJ4A 5D5XB 4LQ5A 4ZYEA 1B5HA 3HZJA 1G4DA 4PJLA 2HZTA 3WE3A 1N0TA 1MY4A 3PD9A 2E7XA 1DP3A 2XAHA 4KT6A 2ME0A 4JWXA 2R5ZB 4RGSA 2HDDA 2RAEA 2GH9A 5I56A 1GV8A 3FZVA 4DDDA 3RUMA 2W82A 4BY7J 5B5EC 2D2WA 4PCQA 3H5RA 4OIPF 1P9QC 2CZLA 4H8JA 1MJBA 3E6DA 1O4XA 2EWNA 1SI1A 3CSBA 3V5AA 3P7NA 3LA2A 2PT2A 4M3EA 4GX6A 2HYFA 4KYWA 4AIDA 1K78B 1ZBMA 2WX9A 4RLFA 4DI4B 2DK8A 1ON1A 3IFAA 3OMBA 4OYVA 2N8GA 1F5TA 4ND9A 1R5GA 5FO5A 3R0JA 2K9LA 1Y1MA 3F21A 3R7XA 1B40A 2XA5A 2OWZA 4FIMA 3K6WA 5EZGA 4BQAA 3U72A 2Y75A 2YU3A 4HLYA 2E35A 4PJNA 2R0QC 3B6AA 2O5RA 5IKBA 2CH0A 1LBBA 5CVRA 3PUBA 4D9JA 3EPZA 4A3FJ 1NL5A 3H35A 3PIOF 3F11A 2Y7RA 4N0BA 2G7HA 1ON2A 3EYYA 3EYIA 1NNPA 4H0WA 3DV8A 5IP7J 4IB2A 2R93J 1BR4A 1IXHA 4DNCA 3KFWX 1U8RA 1FWZA 2OWTA 1JW1A 4V2FA 4FTHA 2XWOA 3K6XA 4QFKA 2A61A 3DPUA 2P1SA 2P0WA 2H5YA 4TOZA 4P3LA 2L0KA 5EHSA 3FK7A 4ZE9A 3RPLB 2X26A 3T0YA 1OCPA 3K6UA 2DQVA 3RPLA 5TRDA 3ZN0A 3V8JA 1S9TA 3ZMDA 3OYEA 2BZTA 1P1NA 1GT0C 4AB5A 1TP4A 1MMDA 2PBWA 1WGXA 1B0LA 1FPGA 3MZBA 2BVLA 3HRUA 2XXVA 3S8PA 4X1DA 2P7CB 4PJJA 3P5JA 3GYYA 3CMEI 2DPDA 1JP4A 3TEPA 2UXXA 1XGMA 4I99C 2Y9ZA 3OEMA 4R6YA 2W57A 5FLMJ 5HBCA 3BZCA 3GVAA 2XSDC 4PAIA 3HTSB 3EKIA 2NNNA 3RYPA 2FBIA 1WQ2A 4CCLA 2IGOA 1YFHA 1HCRA 3QPSA 3SXYA 1KU7A 1EYKA 4G94A 3GW2A 1YE9A 3RTWB 4ETSA 1USYH 1B1HA 3EHSA 3MN2A 3ZP5A 1JETA 3BR1A 1XMKA 2AXLA 2ADUA 1WHUA 4ON0A 1YO5C 4JVCA 1WI3A 5LEJA 2MC4A 2JA6J 1JNFA 2RKMA 2JWTA 2Q8MA 1XVXA 5K7HA 1MXZA 2GHBA 1MDQA 2I49A 4QFNA 5H8QA 3UN6A 4R75A 3E5QA 2DP8A 1Z05A 1O3SA 3UK4A 3TOBA 4FX0A 2I6EA 2O68A 3D1RA 4WXJA 3BG3A 4GBWA 1FSHA 2VBYA 1LKXA 2J5PA 1QUKA 4OANA 2MLKA 1JE8A 1XT8A 1MQDA 2A5WA 3L2VA 5HODA 2L4MA 4AVPA 5D4SA 2VE9A 1IV8A 4KQPA 2Y30A 1SMTA 1DP7P 3IOWA 3MP6A 4I01A 1PVEA 4YELA 3ZQIA 1J59A 2CZIA 3H6UA 1IZ1A 3DELB 3R60A 4MJOA 2M7AA 3IOVA 4DZ1A 2E1OA 2QS1A 4BL0B 1ZIUA 3K0LA 2E5ZA 2R7QA 2EV5A 3SZTA 1FPBA 2AQFA 4UXNA 2MABA 4C9YA 2HOTA 1A04A 2XASA 4EQQA 3CO7C 1KQ8A 4G8NA 2D21A 4X1BA 2M8GX 3RIRA 5J8FA 2KZGA 5T3JA 2OWSA 2LKSA 3L7WA 2X6WA 2E1MC 3QK6A 4XLEA 3WTWC 4KDPA 4JVDA 4WF2A 4OWDA 1MBHA 3IO4A 4PFWA 2QS3A 4M9XA 1YXIA 2MLGA 1YI2I 3JRCA 5FBPA 2OZ6A 3Q0WA 2CJJA 4GLIA 1ELJA 4PE5B 5H8NB 5I84A 4YIRX 4YB5A 1RI7A 4A0YA 2QS2A 1POGA 2X1DA 2V9PA 3G1LA 4DYQA 2RGVA 5C44J 1QVUA 3WTUC 2LDUA 3CF5F 1H9TA 2FHYA 3JZJA 2DWIA 2AL4A 2QZ8A 5TPAB 5B1BH 1T33A 3VB2A 5F64A 4EMSA 4Z2YA 1SEUA 1A99A 1IMEA 4XONA 1XGSA 3S3NA 4RB1A 2H9BA 2RKHA 4ZZDA 4AS4A 1VNDA 2XF5A 1B8IB 2A6EF 2ZC2A 3L6HA 1K61A 2KJBA 2L9RA 3H5NA 3ZMZA 2GRVA 6PAXA 1EZOA 2F4MB 2C6YA 3MFKA 2PBIA 1X1BA 2DMNA 2H09A 3H9QA 2ZNZA 3QWLA 4C3HJ 3A01A 3CCSI 2QSHX 1DTGA 3JTHA 2G93A 3T0JA 3V7SA 1FJ9A 3HV1A 3ZCOA 2FQ3A 2JQ7A 1D9QA 1NG7A 2D1HA 2ABHA 2DCEA 1OKRA 5GADJ 1QU3A 2XAUA 2AXTC 2FOKA 3IRQA 1HKSA 1K9YA 3QPTA 3I56I 4Z0IA 2RCAA 5H6QA 2R7RA 2ZMEB 3W6KB 3ZXSA 3IJOB 1LDJA 4B8XA 3LSWA 4F1UA 1BIAA 2Z33A 3TDZC 1EF4A 1SYIA 1DOTA 1SDXA 1VR5A 5FB2A 4R9GA 2V26A 2K3FA 2ONKE 3HGYA 3GZ5A 2D3IA 2DQLA 1J1NA 2F7AA 4MX6A 4DXCA 3M3KA 3I0TA 4RXLA 3KEQA 3LA7A 1H89C 2FA5A 3CCRI 2X6YA 4PAFA 4I09A 3B50A 1K6OA 4RDUA 1AWBA 4RAFA 1VQ9I 5I2KA 4OIQF 3CRBA 4RGXA 3EHUA 1I27A 1YS6A 2ZSHB 4NEDA 2EA2A 2KLOA 2LYCA 3VFZA 2QSXA 4LB5A 1OYWA 3T5XA 3IRRA 1NI9A 1QHHD 2GXGA 3FKJA 3Q5FA 4GXOA 3QAHA 1O3RA 1FYKA 4MCOA 4G6DA 2DT6A 3M07A 4KN7X 3RQ4A 3PUYE 2M4GA 4RA1A 3OIPA 3JV9A 3LMMA 3WTVC 2CZHA 2WBBA 2DMPA 1O64A 1IN5A 1OR7A 5J6XA 1T38A 1P7IA 1NNFA 4S0HB 3IWFA 3EQLF 2K4JA 4M73A 2PVUA 1WVRA 4DBRA 3IAM2 1NV1A 4LOCA 1XDSA 4UY8I 2OZZA 1O3TA 1W36D 3HM5A 1MH4A 3MVWA 4F19A 2MC3A 2CG4A 1UIUA 1VI0A 2NS8A 3CP8A 5D8LB 2O8KA 5IP6A 3JR9A 5LGTA 1D9VA 3GWZA 4LQ2A 2HZKA 2Q2AA 2JSCA 4PJ0C 3RSNA 1FPKA 1XMAA 1QNTA 3L6GA 4P11A 4FORA 2ZYMA 1MKMA 2IVMA 5FKMA 3LA3A 3FXKA 3F8BA 4QSHA 5TJJA 4P1LA 4NBQA 2IS6A 5J4VA 1TTYA 5HS7A 2VPOA 2P3VA 3DBHB 4X0GA 1FYMA 1B72B 1YRNB 4MHGA 1A5JA 3CUQC 1P4WA 3FXOA 1UMQA 1IXSB 2QWWA 4IQ4A 2IRFG 1SBPA 2CW7A 3K9TA 1V3FA 3OYLA 4FCYA 2XXUA 3GBAA 1OQGA 3PTYA 5EYFA 4C1UA 3IAS2 1P1QA 1CGPA 4XKRA 4YFNF 2A5YB 5CYVA 5H2FC 2WB1N 2KIMA 3K00A 2IXSA 3J7AY 2Y7WA 1LAHE 4BEHB 3KP5A 3VODA 2ECBA 1R9QA 1VQ8I 5E3OA 1KA1A 4GWSA 3BIHA 1R4MB 3KYLA 3SERA 1G8XA 4OENA 4FAJA 1N84A 3CFXA 2MBFA 2HPIA 2XXRA 1HKQA 2NOJB 4HF1A 1XSDA 2KFDA 2X51A 3ZN1A 1FTJA 3FJMA 3KOSA 2UV1A 1Y8QB 2ZFUA 2QQ9A 2LBFB 2ZXIA 3B8BA 2Z16A 1OQYA 1XDUA 3Q9VA 3G3HA 1ZKGA 3ZRGA 1OCTC 3OEKA 4KCDA 5F08A 1TW3A 1VQKI 1R1UA 1X1PA 2JA2A 3ISPA 2P5LC 4WKMA 1N75A 2HKOA 2PFBA 3SEQA 4BDQA 1B59A 1JHHA 3WTZA 1RRJA 4XOTA 4QFOA 1JKOC 3M8UA 3GTQJ 5CKTA 1II5A 5HNFA 3BR0A 4D1QA 3G3GA 5L3GA 4H1XA 4ESWA 4NC6A 3GEZA 4A3DJ 5BPDA 4P0GA 2QSGX 3K1NA 4QLCU 4H65A 1WJAA 5H8SA 2F48A 3G2BA 5AA4A 4LP2B 1XCVA 2XROA 1B9NA 1XOCA 5F1QA 4BLAA 1Y3NA 3S9EA 4GIZA 1BI1A 2JPCA 3TOAA 1Y1VJ 2OCUA 2BGCA 2FVZA 2DN0A 2OPTA 2AQEA 3O8HA 2ZYKA 4GOTA 4YIFA 4HE1A 3RQTA 3S2VA 1D0XA 5DTDA 4ESJA 3Q25A 2WAEA 1D0ZA 2XB0X 1ZQ3P 4Q5SF 1B3GA 4ZYHA 2RV8A 3K6GA 2H1LA 3V7RA 3CESA 2L02A 3FX3A 5AE4A 1LEAA 1NK2P 4B43A 4HQMA 4Q4ZF 2XWVA 1LBVA 1Z7LA 1OCZH 4EGYA 3TDUC 3BC8A 1FOWA 4XKPA 1CNQA 2E5NA 2AHQA 4OAYA 3RYRA 4XN3A 4R79A 1KU3A 1MBEA 4I0AA 4ANJA 3F22A 1CB6A 3IJXB 1IUFA 2QQ8A 5E8GA 2JMWA 3LSRA 3C4MA 3KJ7A 2EB7A 3RKQA 1JQFA 1YCJA 3TUSA 1IN4A 2Y5KA 2ELJA 4V2GA 4E6KG 4DXBA 4FJPA 1FBSA 4P47A 5DM6F 1FTAA 3LBSA 4L17A 4QXDA 5ICFA 3GO5A 2Z5UA 5LRSA 1EJ9A 2AYSA 1TL8A 2UVIA 3MPLA 4PGNA 3KLOA 4WX9A 2QFLA 4RMNA 2AIXA 1E3HA 1REPC 1TXFA 2CU7A 1O3QA 3BFTA 2W24A 1IG7A 1DQUA 1MMNA 3KBRA 1G2HA 2WAQN 3PPOA 2ELKA 1BR2A 3B02A 4ZEFA 5EJCA 2DA3A 4BGDA 2WAFA 2GA1A 4LLGF 4XLNF 3ECOA 2QSFX 4NHJA 1ONVA 5HDNA 1RKTA 3I6VA 3ILUB 5CRYA 2R7XA 3Q27A 1SW5A 1G59A 2UVGA 2DMUA 2K27A 4L9JA 2P5KA 4G6QA 1S7EA 2HQNA 1AU7A 3PO2J 5FRNA 3GZGA 3BROA 2WC2A 1E0EA 2PLYA 1LCTA 4FE7A 4OA4A 2WWYA 4MO7A 2F97A 2XXKA 1NV0A 3GTOJ 4LATA 1FPJA 4WEDA 4H4KC 2K3PA 4I40A 1EKEA 2KKOA 3SDGA 5EGOB 1F4KA 2PMZN 4UB6C 5HS9A 1MSFC 2B4LA 1GGGA 1OLTA 2K5CA 3LSKA 3M8JA 3PNYA 4XICA 1PP8F 4GRIA 1BC7C 3GMEA 1NV5A 4GBVA 4OVTA 1E3PA 2PX9A 1EZPA 4HAMA 2L4AA 3WGGA 1EYJA 3EUKL 1Z6RA 2DK5A 2LLKA 2W4SA 3RCOA 4W1UA 3J80Z 2QA4I 3E6CC 2XAJA 3I4MJ 3SKPA 5D5UB 4M6XA 5EG0B 1UTBB 3F8MA 1OFCX 4MMPA 4X9TA 1MH3A 2FE3A 4I7HA 2HFBA 4DJAA 4GX4A 3K6VA 5DVIA 1MD0A 1I6QA 1D1CA 1P7JA 2OK2A 5ET6A 2FMLA 4OAZA 5CVUA 2XWKA 4CCJA 4R73A 3FBPA 3RT6B 3VVFA 3CI8A 3FGSA 2ID6A 3DTEA 2W7YA 1RKMA 1RDYA 3S4UA 1OMIA 1PUEE 4BDMA 3MKLA 1QJMA 3LL7A 1BJAA 2V7FA 2BY2A 1B3LA 5E8IA 3BWGA 4OMBA 3MP1A 5FTIA 5ITOA 1FBUA 2VXDA 3CLOA 2ZMEC 3M4OJ 2ZJQF 2DE4A 4RBOA 1RYOA 3T96B 2HS5A 3ABUA 2OBGA 4GWOA 4F2OA 4A3KJ 1D1AA 5DS9A 3OO8A 3RTFB 5L8DA 4F29A 1V5FA 2JVGA 3H36A 2UUZA 3THIA 5ICTA 5FROA 4YKKA 1BI3A 1UTBA 2Q8JA 2V3UA 1WJFA 2CQXA 3BG6A 1GDTA 3OYFA 1MNMC 2JT1A 2E2IJ 2R7UA 1RPWA 2IEEA 2BW3A 3ZQHA 1Y9UA 2DDBA 2LY9A 1J9IA 2QPQA 1RDXA 2ELHA 1KQ9A 4N13A 3HRMA 2B0LA 4EJUA 2A5SA 2WKYA 1WVJA 3IP4B 1PDNC 4ZECA 2UXNA 3F3XA 4GXAA 3F6OA 5FD6A 2HFHA 3P9CA 2E60A 3EF7A 5EYRA 4XIGQ 3H0GJ 4IPAA 2VKVA 1SFEA 2VGQA 2PJPA 3BPXA 2BY3A 3N05A 2IP2A 3GUDA 2IS4A 2F7CA 3KC1A 1IN6A 3VSLA 4GWUA 3GTLJ 1VQ7I 3CCJI 1USYE 1SQYA 2DTRA 3O6HA 2FMYA 4IGRA 2MH9A 1Y6IA 4FQGA 3L09A 1HW5A 2ZZVA 2EZHA 3J81Z 3JTGA 2L5QA 5HLIA 3F8NA 2ZYNA 4ONYA 5DYMA 3ZQGA 3IFCA 1UHSA 2Z22A 3FIRA 3M7GA 4M3BA 4HNVA 2RREA 2IA0A 1T39A 4N4UA 5HDGA 5ED4A 1KQ0A 3HRSA 5ERIA 1AHDP 2ZJRF 1LEVA 3E7LA 5LOMA 3KIOA 1KONA 4EQ9A 3GLLA 2PX1A 4AWXB 4G68A 1WJEA 1Q1VA 1TBXA 4ASNA 2GZWA 2O3FA 2Z99A 4P1WA 1DPRA 4CICA 4F52A 1SFUA 1BKAA 1XVYA 1SAXA 5J1UA 3H92A 4BQNA 1LFUP 5IY5H 4ZE8A 4E4HA 2DVZA 2QF7A 2JJ7A 2FNPA 4AIKA 1VQMI 3ASNH 1FPIA 2R7TA 1HOMA 2GHAA 1XX5A 4H0EA 4F3BA 5E1ZB 2R7OA 4O5VA 3V8LA 2ZNUA 4LK1F 1INPA 3N6TA 1K4TA 1B3HA 3PFYA 2A69F 1IF1A 2CZKA 3IAZA 4EQBA 4F22A 1AOVA 1MJ9A 5J4YA 1VFCA 1UB9A 4ESBA 2Z23A 3H3UA 4QSEA 2LOOA 3IB2A 1SAUA 3QRFF 3JW4A 2X1CA 3FUZA 4JB7A 1U8BA 3C32A 1ZG5A 2I3VA 4EEFG 2ISZA 4G7OF 5K7ZA 2VN2A 2VPRA 1X4OA 3E5XA 5ICGA 5L3BA 3FJGA 2JUGA 3G4SI 4E7LA 3ROJA 3VLWA 5D4RA 3HJEA 1U0JA 3UKGA 5IYCJ 4RAYA 3RPQA 3G3FA 1JUPA 2V3QA 3QUFA 5H8HA 3K4LA 2XXWA 2VJ5A 5AA2D 5CM6A 3ABLH 3CCQI 2W84A 5KCJB 5FLXZ 1R1VA 4A0ZA 4HLXA 4EATA 3F8CA 3ZMSA 4NQWA 3IH3A 4CCNA 4ENKA 1NV3A 1R1NA 3HOUJ 3CVGA 3BR5A 1YHQI 4BJ5C 3DF8A 2JZYA 2XSJC 1T2KA 4OTEA 1JGGA 4MGRA 3I53A 2BHYA 2CQNA 3CJTB 2DXYA 1SD7A 2ECCA 1X3WB 3KEOA 4I0BA 3L2WA 4IZZA 4UNOA 3I9V2 3S16J 1X3UA 1MGTA 5J40A 1WFXA 1BJZA 1X1CA 4Q0CA 4XORA 1NMUA 4N17A 1S5LC 3SEXA 1HKTA 2HXIA 4AYBA 4LONB 4FBPA 2ZMBA 4PTKA 2L3DA 1FOYA 2E71A 1Z3XA 3FKIJ 4OWRB 5I57A 1W5TA 3IUOA 1R36A 1T6SA 2R3SA 4JBAA 3WODF 4GWYA 3VVDA 1ZN2A 4BDNA 1WJ5A 3I54A 3E79A 1MW7A 3CCUI 1Q1KA 4CCKA 1NK3P 4JWOA 3ZGKA 1FIPA 1YS7A 5F0HA 1QVSA 3M1CA 2K86A 1JUMA 2O7IA 4XKQA 4MIMA 2NUVA 1UHWA 1AWCA 1B7ZA 4L9TA 4OFJA 1JKRC 4XNFA 1Q35A 3JSOA 3PD8A 4I3EA 3PPRA 3VDXA 3NEUA 2VC1A 1MBKA 1O57A 1IJWC 1YG2A 3LUZA 3TFLA 3D4GA 2EFQA 2KISA 2MD0A 3ZQQA 1S50A 1SVXB 3ZMTA 2GWRA 2Q2EB 5L9MA 3BPVA 5JVGF 1KWHA 2PG4A 2KIQA 3F72A 3I59A 2ISYA 3OSGA 1K9ZA 1POY1 4PGGA 2CV0A 2EFOA 3JRBA 3R4KA 4PDKA 4OVRA 2XXQA 4A6DA 2MA3A 2VC0A 4LJZF 2EZKA 4YEJA 4B47A 4BUPA 1PDAA 3BLYA 1IAWA 4I02A 2Z8EA 1MMSA 2GBYA 3CMYA 2RC7A 2VD3A 1EZ9A 1ZYRF 1MDP1 3MMYB 5E18F 2EILH 5L3EA 4NC8A 4I3YA 1LE8A 3KN3A 2EV6A 3H3ZA 4WXHA 2LREA 1I6HJ 2V1NA 3V8KA 2E1NA 2QLZA 1KGSA 3H7MA 3KC0A 2OZUA 1W7PB 2E7WA 1PUFA 3BTLA 2QENA 3K10A 2REJA 3FJ7A 4KIGA 4BAYA 3HSRA 2CWEA 4ZH4F 4NF0A 2DT7B 3T9XB 2Y9YA 1PBPA 1EYIA 1QW0A 2V1XA 5KZTA 4BJ6C 2DAOA 2IGMA 5HLGA 3EPEA 5CC2A 2L7ZA 5LBQA 4G77A 2P4WA 1VQ5I 3CF2A 2I4BA 3D5SC 4XLAA 3MYUA 4PF8A 3AXFA 3TKDA 3K7AJ 4B44A 1F9NA 1IDYA 3F0CA 5F7VA 3HSTA 4BE0A 3RY3A 5EEAA 3FXLA 2VB6A 1R58A 1RESA 3QU3A 5JI6A 1R4NB 2VJIA 2DW4A 2DA5A 3HSFA 5EF6A 5LGUA 1O7FA 4H45A 4ZDLA 5BNGA 4U1ZA 4RM2A 5K5RA 3S1RJ 5ICCA 4A3JJ 3TW7A 2AS5F 1NUZA 2ALUA 1VQ6I 1PJRA 4TLLB 4OOIA 5CQGA 2OUMA 1TT5B 2NNYA 3O9PA 4IF4A 3O29A 4UACA 4DLDA 4ENNA 4PC9A 2RC8A 4IO5A 4IKFA 4CH7A 2D5VA 4BXXJ 4JVIA 3BDDA 3P7IA 3KEIA 2VKEA 1D9YA 2NXOA 5B66C 2E1MB 5J16A 1K7AA 5J1YA 3CTAA 2LBFA 3SFIA 2D1VA 1SYHA 1GVDA 5M5YJ 3I4PA 1FTZA 4NQ8A 1TWHJ 3FVKA 3HXLA 3IHUA 2UVHA 3QOPA 4XSZF 1SFOJ 4HG2A 4QIWN 1B4AA 3OYIA 1IXGA 3IKVA 1B8IA 2H98A 4M3FA 4YFXF 1P6RA 1A31A 2VONA 3ML6A 2R7ZJ 4RNSA 3V7CA 2DI3A 1W7PD 1JJ8C 1VQOI 4R72A 3OYHA 3D1NI 4UUSB 3KJTA 3OSRA 3MZHA 4OZ9A 1E2XA 1SMYF 1LBZA 4Q8RA 4A3LJ 4IRGA 1QPMA 1S7AA 3WHCA 3LR1A 4Q30B 3UA8A 1HC8A 4DE8A 1H8AC 3E0JB 3MVXA 4H8IA 4A93J 4BACA 3VYUB 3RDIA 4CO8A 2PI0A 1UFMA 3T9VA 3IB0A 5C4XJ 3PMWA 1M1EB 2ZYOA 4PK4A 4XR6A 3Q26A 4GWZA 3KP2A 4YMBA 3BJOA 4ABZA 1US4A 5CMCA 1FIAA 2ZB9A 5EEHA 1DPUA 1AL3A 3C36A 4LN5A 3D5LA 1LBXA 4A0XA 2ZXTA 4MLQA 2IW5A 1BL0A 3F9KA 2LG4A 3OYMA 1M5FA 1O7TA 3TODA 1MSEC 4PJMA 3S2HJ 1LPQA 4NDLA 2A6TA 5IZ3B 2QKLB 3I58A 1LQ1A 3A03A 3V4GA 1XSXA 2NVYJ 4N9IA 3SDFA 2IEKA 4C1TA 3BZ6A 2HVSA 3O28A 5L3FA 1FTLA 1HSEA 3DM0A 3U21A 4HDVA 2RQQA 5HVQC 2HPGA 4LLNA 1USSA 4R74A 3QYTA 3FXUA 5DUIA 5FJ8J 2BYVE 2A07F 4EXLA 2K9QA 4NF6B 5DTBA 2IGKA 2Z8DA 3K4JA 5JVTA 2DLLA 4NUBA 1LFHA 5HDKA 2NAZA 1LFBA 1D5YA 3DP6A 3LUYA 1LSTA 4J19A 3X2QH 3KN7A 2XUBA 5IP9J 4RA2A 1A8FA 3DKWA 2Q9TA 2M8CA 4LZ5A 3EDPA 4FECA 3G1MA 1I1SA 4MQVA 4IHXA 2R7VA 2UXAA 2ZZWA 1P92A 4IY6A 4YB6A 4C30A 5DDGA 1IRFA 5BMZA 4GVOA 3A2KA 1SVOA 3JCUC 5EDNA 3L2CA 2M9HA 5DCMA 1B9JA 4HNTA 2Y7IA 1ERDA 3HFUA 1N25A 2LFBA 2X1EA 3S93A 3M3FA 4BU2A 5K2XA 4P9FA 1XGNA 3S9LC 4E7ZA 1V4RA 3MKWB 2VBXA 5IGAA 3CMAI 1NHAA 4PFPA 2QVRA 1S7OA 1XB4A 2GIVA 4FETA 2BJIA 4IL6C 2TDXA 4B3XA 1P4XA 3CP2A 3TTMA 1U5TA 2PQ8A 1IIWA 4PDHA 4MF3A 5J3LA 3VEPA 1D3YA 4A3EJ 4RK2A 2CEYA 4GO1A 4KYSA 2IA4A 1JHFA 2WA0A 3S17J 3QUJA 1K79A 4HCWA 1FP1D 3TO9A 4XSXF 1TQPA 5FKLA 4IO9F 1H88C 3IKTA 1BIYA 2FEZA 3I59B 5F1RA 2CEXA 2NYXA 1NFTA 3PUWE 3RPUA 4XEQA 2PEXA 3C33A 1T98A 2BHZA 2G9WA 1S72I 4OIOF 5DD4A 2IS1A 4F3PA 3DP8A 5HM4B 5I59A 1IXIA 1J5YA 5F1JA 4L0ZB 3J7YJ 4HNUA 2XX8A 4O94A 4YICA 3EETA 4MLOA 2CV2A 5L9SA 2VKHA 1G3YA 2B3FA 1BW5A 3C35A 3RNNA 1Z91A 5KAIC 2I48A 4NNJA 4DGWB 2XRNA 1GUUA 1J75A 2BY0A 4ZYAA 4KCCA 4KA4A 1H45A 1LB9A 1JVXA 2QS4A 2KRHA 1LAGE 2OD5A 3OL4A 1T56A 2ZXJA 2VQGA 4EQ7A 4MH5A 4OFLA 5DCFA 2ESHA 2IA1A 3IWZA 1UZCA 4UVAA 2XXIA 4S05A 4O7MA 3TTRA 4HF0A 1M5BA 1VQNI 3OIOA 3DXJF 4U0YA 3R26A 1FPEA 3TO6A 3C34A 2IJLA 4OXVA 3ROUA 2XKPA 2L7MP 5H20A 4C3IJ 1D0YA 3F23A 3OR1C 4XK4A 1VF9A 1U6GA 4XKCA 3S1QJ 1LGBC 4YKJA 4EV0A 1H76A 5AA3A 4GWWA 5A2QK 3T8TA 1BIBA 2Y69H 3CJRB 3K1MA 4HQEA 1ZGAA 2HCAA 3CO6C 1R6RA 1Z7UA 2AO9A 4L9NA 1MXVA 1VE4A 3RPWA 3BZKA 4F39A 3HKZN 4GYGA 2DE3A 4QBAA 3CG1A 3IK6B 2HVRA 2Z1DA 2VPNA 5K2YA 2BY1A 4L5IA 1POTA 3KBZA 1Y1WJ 2UYFA 2XF7A 1FBEA 4HBLA 4GXSB 1N7WA 5L3CA 2XD2A 5FTHA 1FQBA 5GAHJ 2Y48A 1CE2A 4C2TA 1MQGA 4XTCQ 2JPBA 1U3EM 3EHTA 5DCMB 3MSTA 3IO6A 2VT5A 1MY1A 4FE8A 1IRGA 4F31B 3OYNA 1WJCA 4M9SA 4ECFA 3DLLF 2DDAA 2E2HJ 2TCTA 2XXXA 3FWEA 1FPLA 2THIA 1YW7A 3NARA 3LSFB 3K2AA 3HHHA 5AA2B 2OCCH 1I3AA 2DA2A 5FRMA 1Y4TA 1YTVA 3IL1B 5J1DA 3DBLB 1HBXG 4PDDA 4U4XA 3DBRB 2Y0SA 4LB6B 2FBKA 3LSMA 1D5VA 2XKOA 3AG2H 2VT2A 3H5AA 3KCCA 3L00A 5AIPA 4ZDPA 1IV6A 3HPHA </