3K2BA

Crystal structure of photosynthetic a4 isoform glyceraldehyde-3-phosphate dehydrogenase complexed with nad, from arabidopsis thaliana
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
publication title Structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase (isoform A4) from Arabidopsis thaliana in complex with NAD
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 106
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F, G, H, O, Q
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3k2bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k2bA01
3VKVA 1HE2A 1UXHA 3FNEA 4EW6A 3VVCA 1EDOA 1LJ8A 3C24A 4B79A 4Q3AA 3BXXA 5F1KA 1O6ZA 2AQ8A 2GERA 2PLAA 4I5EA 1NPTO 2IYPA 2HRBA 3G1UA 4OOEA 4EEXA 1DJNA 4GX0A 3PVZA 2GGSA 4B7XA 1ID1A 3BHMA 3O8QA 2PKQP 1HT0A 5JYEA 3HUDA 1BXZA 2CF5A 5AXDA 3PFWO 3ZWPA 3TL2A 3HFGA 3JD4A 1K3TA 1GTMA 3DHYA 3ANMA 2JKVA 5HTOA 1TT5B 4S1VA 1FJHA 2OGUA 4U8GA 2J8ZA 2JFHA 1ZK2A 3RROA 2DT5A 2GN9A 4XQ9A 2P2SA 2YV3A 5KCZA 4E2YA 1PJQA 5CDSA 3ADOA 2WMDA 4R5MA 4A0SA 2Y1OA 3H5AA 4N7RA 3Q9NA 5K6AC 3JQ8B 3KHUA 2YHIB 1UDBA 2NLOA 3RUEA 1E77A 4GGPA 3U5TA 4IJWA 1R6DA 1PZEA 1P31A 4XGIA 1C14A 4BOYA 2WD8A 4HFJA 4DQVA 5KVVA 2Z95A 4NBWA 1QYDA 2GZ2A 1AXGA 4MVJG 2ZB4A 4FFNA 3B1FA 1WZIA 4BNJA 1E3IA 4RPHA 4YAKA 4FD3A 1PX0A 3LDHA 2BH9A 3N74A 4IDDA 4XJTA 5ITVA 4OXKA 3C1TA 2WSBA 2JD1A 2G82A 5L7YA 4GX5A 1Z7EA 2CSUA 1SPXA 4J43A 3AI1A 3QVOA 4FW8A 1Q0LA 3WGZA 1QYVA 2Q99A 1YRLA 4FSHA 4K28A 4BNUA 4YPOA 1Z75A 3KETA 1P0FA 4GMGA 2X7HA 4G2NA 5IN4A 3ICCA 4RLHA 4EUEA 4WLEA 2PKRA 4BQRA 1BXGB 2AQKA 3F3SA 1OFGA 5A04A 2EWMA 5I8ZA 1C0PA 3NJ4A 3ONDA 2HSDA 4JK3A 2R6JA 1PL6A 2D8AA 2Y99A 1MGOA 1P1RA 1IB6A 4ZVVA 5KTKA 1E0DA 5JW6A 1KVUA 3VC7A 5DDIP 4RVDA 3K8ZA 4NHEA 3KYCB 2EF1A 3MOGA 2Y05A 3WSWA 5JYFA 3DONA 3ZN2A 1CJCA 4CMKA 4IQ0A 1BTOA 1LRKA 1HDOA 4ALNA 5ER6A 3TNLA 3PJFA 1EVJA 1GAEO 1DB3A 3I4CA 3U0BA 3AU9A 2HKIA 2DTXA 2I6TA 3D1LA 4OXYA 4PZCA 2PGLA 4M1QA 2X5OA 2B4RO 2RCYA 2C5AA 5AXBA 4B8WA 3F5QA 3F1LA 1BMDA 3H9QA 5TLSA 1YBAA 4QSMA 1JQBA 4MKZA 1ZEJA 2HQ1A 3ITDA 2X0NA 2ZCUA 8ADHA 2EP7A 1TT5A 3C7DB 4BNZA 4JX8A 1DFIA 4KQWA 3GN2A 3RVDA 1YE3A 1K5HA 1NTOA 3KO8A 2W2KA 4IDEA 5COBA 3H4VA 5B4VA 1IZ0A 2FPGA 3ENNA 3DMYA 3KM0A 4HV4A 4YDRA 4IMRA 3JQ8A 5ENDA 2YHIA 3JQBA 2BI8A 4IJVA 4DBVO 3ORFA 2PFGA 1EK6A 4URFA 4Z3DA 4CUZA 1ORRA 4EBFA 3G0OA 4UVEA 3WS7A 5DBIA 2OOSA 1GCUA 1Y81A 4PLGA 1PZGA 3AOEC 4GLOA 4W9NC 1E3LA 2QHXA 4ROSA 3OJ0A 2X0RA 3GEDA 1F12A 3TQHA 3Q9UA 4OIMA 4LISA 2V65A 2FPPA 1ISGA 4B3JA 3DOOA 4FGWA 6LDHA 2WYUA 3QSGA 4PGFA 1GU7A 2XOXA 2ZB8A 4WPGA 3X2EA 2POQX 5ES3A 4XX0A 1HZJA 3LU1A 4J0EA 3KYDB 2Y0CA 3KTDA 3ZHBA 1LC3A 1WP4A 4JGBA 4ID9A 5DT9A 3TZ6A 3FNGA 3ETGA 1A7KA 4J4TA 3LLVA 2PK3A 4R9RA 4BKPA 5I7VA 4JXKA 1HRDA 5A03A 3I1JA 4JROA 2A4KA 2FHSA 4IPTA 4H7PA 1Y8QA 3TFQA 1P9LA 3H2ZA 3HE3A 1A9ZA 4E13A 1N92A 1LNQA 3JQDA 1ZCJA 3JQ6A 3LF1A 5JDIA 4NI5A 2XF8A 4F6CA 2ZCVA 2I67A 1GUYA 2WD7A 3CZMA 4ND5A 2PH5A 2DM6A 4NK5A 4OKNA 4RORA 4J4HA 5IDQA 3WB9A 3A28A 3GMDA 4QX6A 4CMGA 4FQ8A 4Q9NA 2EP5A 3QW2A 4LGVA 4FOOA 3EYWA 2VYVA 4YJDA 2ZYDA 3U9LA 1OAAA 5A4DA 2B69A 2W98A 2UUOA 3HB5X 2FWMX 3FTPA 4YRDA 3BTSA 3QWBA 2BI7A 5G4KA 1W8DA 1NNUA 2Y67A 4MINA 1O5IA 3TWOA 4CMHA 4RGBA 4XGKA 5B37A 4A73A 1S7CA 4WOKA 3F6YA 4ND4A 3W8FA 4RVSA 3FI9A 3CMMA 1ONPA 2V6BA 1XIVA 3V2GA 3FN4A 1JAXA 1WW8A 1XGKA 5TNXA 4O63O 4NZ9A 1DDOA 5CFZA 4IQ8A 1KY5A 4DMMA 4TZTA 2O48X 1KEVA 2E49A 2HK9A 3QY9A 2VYVD 1ISIA 1WDMA 2CVQA 4Z9FA 3BHIA 4YB8A 3PYMA 3AM3A 3GRKA 3JQAB 5JAZA 5TGDA 4NBTA 4O5OA 3RUAA 4JN6B 1GZ3A 4D79A 4TKLA 4D42A 3RU9A 4W99A 3U3XA 3D4NA 3SJ7A 3RUHA 1DC4A 5L51A 2NV6A 3PFFA 3QLJA 4FC7A 4PG6A 2DUUA 5IDWA 1KVSA 1WDKA 1GQYA 1NQ5A 1Y8RA 4DGSA 3LK7A 2OO5A 2A9FA 4HBGA 1GQ2A 4EJ0A 1NX6A 2E37A 3W4JA 2X5JO 1R4NA 2VUSA 3K5PA 1DRUA 4MIEA 1GYPA 4GPD1 1E3EA 3FD8A 4ZRNA 3VH3A 3PIIA 4DIBA 1D3AA 1MLDA 3HQ4O 3JTMA 3F47A 5EQDA 3RCBA 1WWKA 1R16A 1JA9A 3RUFA 3GVHA 1DC6A 2RAFA 3T7CA 1J49A 4YCAA 2VHYA 4NNJA 3HNPA 2O2SA 2B0JA 5AQ1A 2HO5A 2FP4A 4NQZA 1HSZA 3IOYA 4XIYA 1QLHA 3L4BA 4HP8A 1SMKA 1RPNA 3ICPA 4ALKA 1Y5RA 3BMCB 3GOHA 4DPKA 4PG7A 1PJ3A 4WKGA 2P91A 2JFGA 3NX4A 4D3DA 3VPFA 1H6BA 3UF0A 2BMAA 3PRJA 5F1PA 1FF9A 5A5EA 1YWGO 3I9OA 3WGYA 3JYPA 1KIFA 5IFLA 2DTDA 2RHRA 2O4CA 5JO9A 1DRVA 3WWZA 4UVGA 4A03A 3MCVA 1NHWA 1ZO8A 1TXGA 3JQBC 4CL8A 2PD3A 3AOGA 3ASUA 4CM6A 3MJSA 1GYRA 5KKCA 1VJTA 3HZZA 3VAZA 1K6XA 4QTZA 2PNFA 2GUGA 3BYZA 1WAMA 4KDEA 3KEOA 5I9LA 1YVEI 4DC1A 1P74A 3PQFA 3L6DA 3GVIA 3ON5A 5A05A 4K6CA 4OGWA 1DHTA 2PGDA 3K92A 3ANLA 3R6DA 1I3LA 4BNNA 3NT4A 1HE5A 3BZUA 4W82A 1BG6A 3OQBA 4I5GA 2AMFA 3HHPA 4XYMA 2H6EA 3NAQA 4E6PA 1UXKA 2BD0A 3VZSA 3UVEA 3ZV5A 1PJ2A 2CDCA 2HAEA 2JD2A 3PLNA 4AJEA 4EJ6A 2J3IA 4JBGA 3LC7O 1ZXLA 2VNSA 2VRCA 4OSOA 5L45A 4CQMA 1J6UA 1HLPA 4M54A 1E7RA 1M6HA 1ZK1A 3QWAA 4LMPA 3RBZA 3IL2A 1D4FA 1QG6A 1JKJA 2QQ5A 4NJMB 5JAMA 4R4JA 1B7GO 4IDFA 5LCXA 1IHYA 2HJRA 2QG4A 3UFXA 1UZMA 3JYQA 4TVOA 4F45A 3ZV3A 1QKIA 3HDJA 4WCDA 4N5NA 4R51A 1NYTA 3QA9A 3Q1LA 3UUWA 4LSWA 4BV9A 5EQFA 4OSPA 2Z5LA 1LSJA 2ZB3A 1C0KA 4B7UA 1QV6A 3GH3A 1PGQA 1PJCA 5B4TA 4RVUA 1NFFA 1PGPA 4ESOA 4OL9A 4RLSA 3PHIA 1A7AA 3Q0EA 2VRCD 3O26A 1SOVA 5KJEA 4E5KA 1CF2O 3AM5A 4IMPA 1YQDA 2P9GA 4U6QA 4BNMA 3MJVA 3BMCA 3PPIA 3OHSX 4JBHA 4EJMA 4R16A 4IGEA 2OHXA 3G79A 4L4RA 4BV8A 4TROA 2EKQA 1DXYA 4PZDA 1JVSA 4O0LA 2D59A 2IZZA 3RFVA 4BO7A 3KSZO 3S55A 3ZCXA 1G1AA 2FR1A 2LDXA 4MIYA 3RSHA 5G0UA 1Q0QA 3E48A 4NBRA 3DFZA 1XELA 3KRTA 3FSRA 3HDHA 4UEJA 4P8RA 3FNHA 5CG1A 2I65A 2DPGA 4XIJA 2XPCA 4XEHA 3SLKA 5T8KA 2H63A 1PQUA 4PLFA 4DA9A 3IUPA 1GL3A 3FBGA 1UH5A 5CDUA 5ITWA 1XCBA 1Q1NA 1VL6A 2AQHA 3NT2A 1GADO 5IAAA 2FN7A 4E31A 1YKFA 3LYLA 5COQA 3WFJA 3VOSA 2ZQYA 4ILKA 2GCGA 4E12A 1XYGA 3I6IA 3NTOA 3PZBA 3WMXA 5HBRA 2BELA 1WNTA 3I6QA 3PP8A 2VRBA 1KC3A 3AFMA 4GAEA 3RBXA 1C1XB 3DXFA 3GF4A 4XYBA 2VTEA 3H5NA 4FBGA 1Q2XA 3WIEA 1AXEA 1B0AA 3FBTA 3GGPA 3I9LA 4PLVA 2EKPA 2P5UA 1JN0A 1F8FA 4XYLA 4CLOB 1B2LA 4RVFA 2CFCA 4DWVA 3PWZA 3TN7A 4BO9A 2EIHA 1YL5A 1DAOA 1T1SA 2O3QA 2V6FA 4J9UE 3PLRA 1ADBA 2C07A 1NP3A 4PLHA 3EVTA 1KC1A 4W6ZA 1H9AA 5JDCA 1LC0A 4OO3A 1U7HA 4LVCA 2EW8A 1E6EA 1GD1O 2CVOA 2GSDA 2V6MA 2IZ0A 3L4BC 3JV7A 3P7MA 2BFPA 3C1OA 4IGFA 3DOJA 1BDMA 3STHA 1Q7BA 4NG5A 4AJLA 4Z6KA 4YAJA 2I5PO 2JD0A 3PQEA 5TQVA 3D3WA 3NRCA 4P4LA 2GR9A 3U4HA 3OM9A 1M6WA 1ZK3A 3ZDFA 4FN4A 4TVBA 5A1TA 4FCCA 5DCWA 2WM3A 4R3NA 5T64A 4BGVA 2D3TA 1KBZA 4GWKA 1ARZA 1U9JA 4WLVA 3AI2A 3DWFA 3KSDO 4ZJUA 4Q3BA 5JAIA 4MVJM 3EK2A 4TKMA 4A27A 3VVBA 3BMNA 3GAFA 3DAFA 3M2TA 3KB6A 1WMBA 3LF2A 5B1YA 3OA2A 2V6GA 5JS6A 1MFZA 4BIIA 3O9ZA 3DZJA 1U4SA 2H1SA 2ZATA 4MPDA 1I01A 1ZEMA 3DBHB 3GNQA 1QSGA 1BVUA 4E5MA 4BGEA 4BO8A 4P4GA 3WR5A 1BW9B 4FJ0A 1NHGA 1T1RA 3O8QB 4WJZA 3ULKA 2BFAA 2X23A 4IJKA 4L4SA 4RV9A 3KBOA 4N5LA 4K26A 3GHHA 5FEUA 1EUDA 4DLAA 4RL6A 4J3FA 3MOIA 4CLOA 4PLWA 4L75A 3AUUA 4ZGWA 3IQDB 1YGYA 3ZHZA 1GR0A 1LUAA 1LRJA 4BGIA 4QFCA 1SEPA 4YTEA 2YDXA 3S2FA 5DOVA 3TDKA 1HWYA 5FI3A 4RCVA 3RD5A 2B37A 5CHEA 1P1IA 4BO2A 1UXIA 1OMOA 3EZLA 4DUPA 4CMIB 2DUWA 3HADA 1DIGA 2OFPA 4ITUA 1ZNQO 5MGBA 4PZEA 4R1SA 1CWUA 2E4AA 4XD2A 4E5YA 5EIOA 3PWKA 5GZ1A 1RWBA 1TT7A 4W7HA 3I3OA 2QYSA 4YXFA 3CEAA 3GPIA 1EEHA 1LLUA 3GEGA 4FPXA 3AY7A 4BNWA 1ZVMA 2J5KA 3O03A 4BKOA 4L9RA 4RQTA 4CV0A 1LEHA 2EERA 3HWRA 4OQYA 3LSYA 3EW7A 1E7QA 1PR9A 1YJ8A 3UOGA 1X0XA 5H83A 2B36A 2HMTA 4Y98A 5T8KC 3NDJA 3EVNA 5BNIA 4HFNA 4TZKA 4K1LA 1M75A 2VCYA 1Z73A 2EV9A 2ZTLA 1EVYA 2H5LA 4YR9A 4NMHA 1GV0A 3F5SA 1HYHA 4I1IA 3RJ5A 3PYLA 5JO0A 1E1MA 1WMAA 3GRPA 4UREA 3UGKA 4JBIA 3M1AA 4KTVE 4NK4A 1B8VA 1VRWA 3DBHA 1U5AA 1PWXA 2GF2A 4R1TA 4CMAA 3WBBA 4AG3A 2DBZA 3OIGA 1H94A 2GASA 3F1KA 2EKLA 1BW9A 1HSOA 5A3VA 3RI3A 4B4OA 4Y8VA 5C37A 3R3JA 3T7EA 4R5HA 1P1KA 1JKIA 3E6AA 1ZH8A 2OUIA 5L4NA 1CYDA 3I23A 5DCYA 3U4IA 3WICA 4GX1A 1NBOA 1U2DA 4IM7A 2C7VA 4BGUA 4LW8A 1R0LA 5JDCC 2W2KB 1XU9A 4JQCA 2J6IA 2W90A 3PIDA 4A10A 3AFNA 1VC2A 3E8XA 1RKXA 2I66A 1WXDA 3TSCA 3DR3A 3N58A 5CEEA 4J90A 1R0KA 3BTUA 2WDZA 4GKVA 1FDSA 4L73A 2OBYA 2E48A 1BWSA 3ENKA 2W4QA 4CMIA 4B3IA 3PXXA 4ZHSA 1Q0HA 1DEHA 3OICA 5ADHA 2D1YA 1KVTA 2BHLA 1E7MA 1ZJYA 3BHJA 4E5PA 4NFSA 1DIBA 3A06A 4OOFA 2WJPA 4BB5A 4II3A 2QRKA 2H9IA 1HXHA 1E6WA 2AEJA 4I5FA 4JNKA 3PHGA 2JAPA 1EFLA 4J6FA 2OP1A 3T4XA 5A9RA 2ET6A 3WFIA 1NQAO 5L7TA 2B35A 2G76A 1P77A 4MIOA 3WBFA 3ZW9A 3NYWA 4PIVA 4UVIA 3WQRA 2IZ1A 2VWHA 1MP0A 2OXIA 2NQTA 4UEOA 3MJTA 5DCUA 1JLLA 2HMWA 5COAA 1DIRA 1ZBQA 3GT0A 4EUHA 3WWYA 1HDCA 4J7CA 3RC1A 2GN6A 5IN5A 3JYLA 3GFGA 5TIIA 2Q1TA 1Y8QB 4KUHA 3PJDA 4FDAA 1UZLA 3C8MA 3CXRA 3DZBA 4M87A 5HA5A 3A1NA 3W8EA 5ICMA 4PRKA 1B8UA 2WD7B 4R69A 7ADHA 3JCZA 1E1NA 3D7LA 1L1FA 2YYYA 1P3DA 5A9SA 1I30A 3MWDB 3DZKA 1G6KA 1TI7A 4RF5A 3VKUA 4CMJA 4DYDA 3Q2KA 5T5QA 3QQPA 4CPDA 5I8WA 4LCEA 1KOLA 3WTCA 2HJSA 2Q4BA 1OBFO 2X1HA 1SB9A 2IODA 1A5ZA 4OMUA 4YQZA 1HDYA 5G2OA 4NFYA 3RFTA 5G4KB 2C59A 2IEBA 4B7CA 2P5YA 3QVWA 1LXCA 4DPLA 3BIOA 3ZNNA 3QVTA 4CJXA 4BNKA 3VPXA 3ZWBA 2Q1UA 4BNIA 3HDQA 3ANNA 1TEHA 1NPDA 3ETDA 1D7OA 3F4LA 3AU8A 1A4UA 4ZA2A 5THKA 1YL7A 4J7UA 2G0TA 2QRLA 4J4BA 4OM8A 5TX7A 4R1NA 3L77A 1FDUA 4ALIA 3BTVA 4YVFA 1AGNA 1NASA 2SCUA 4AICA 4X54A 3WGOA 3WTBA 2VT2A 1ADCA 1BHSA 1P0CA 1KS9A 4GLLA 4J49A 3M1LA 2RHCA 3KXDA 4IS2A 1X13A 4A26A 4C7KA 4U0JA 4H3VA 5AOVA 1D1SA 5IZCA 4FB5A 1B14A 4Z9XA 3SXPA 1Y8RB 3E18A 1BGVA 3JQCA 2X86A 2NSDA 4TRRA 1EMDA 3WQSB 3DZFA 1CQJA 4XB2A 1IPEA 1EBUA 1U4OA 1R4NB 4R1UA 2PTGA 4WLFA 1GDHA 4DRYA 3SC4A 4BNHA 2ZYGA 2YFQA 5BSGA 4Q39A 2ZK7A 4BNGA 3IP3A 2I99A 4ZQBA 1E1LA 1H93A 1PJSA 1LLDA 3MTJA 4ZD6A 4Y6PA 1FK8A 3CTMA 3ROQA 1LU9A 5T67A 2NU6A 2PKQO 1EUCA 2O50A 4FC6A 5DZSA 4D0RA 3RUDA 3W6ZA 3D4OA 3H7AA 1WPQA 2Y0DA 3VHRA 2AE1A 1LQUA 1OC2A 1EFKA 1N7HA 3INGA 4G81A 4W4TA 1TLTA 3NGLA 3W6UA 4KWIA 4S3MA 3X2FA 2VTDA 1QMGA 2YDYA 4CR6A 4JJIA 1XR3A 3K6JA 3GQVA 3BMQA 5I9NA 3P2OA 3S8MA 3WYEA 3KYBA 4KUEA 3OF2A 4B8ZA 1UDAA 4D44A 4N18A 1G0OA 1XQ1A 1QLJA 2NWQA 3V1YA 4BUCA 3KZVA 1GPDG 1QORA 5C7IO 1M67A 3FRJA 2YQ4A 1VLLA 2W2LA 2E6UX 3NDIA 3L4SO 2J5RA 4KMSA 1DIHA 4FIZA 4WLOA 4IDAA 4TWRA 5FF9A 4K9DA 4LSMA 5BSHA 5AXAA 1YBVA 5BQFA 3I83A 2JFFA 4BO6A 3F4BA 4NFHA 4BNVA 3M2PA 1IUKA 3L9WA 1VKNA 3K2BA 4FJ1A 2J3JA 1X14A 3I9MA 1EVIA 4WASA 5J23A 1PZFA 1DO8A 4CQMB 1N9GB 2DBRA 3BA1A 3DOCA 2X58A 4Y6RA 2GO1A 2HMVA 4E30A 2C82A 3IS3A 3DZGA 5TJHA 1RJWA 1W0CA 1KEUA 4BNXA 3ZU3A 3GY0A 4Z3KA 1CERA 2I3AA 3AK4A 2W2LD 3GHYA 5IG2A 4I9NA 1Q7CA 4MVJF 5A3JA 1ZFNA 4EYEA 3H8VA 3DAGA 3FPCA 1DAPA 1P1HA 2Q45A 1RM5A 4L76A 3ZHYA 5EERA 3ONFA 3I9KA 5EJ2A 3LT4A 4GMFA 3DBRA 3QHAA 1R15A 1W6UA 2GRAA 4ZRMA 5EINA 3HJAA 3KEQA 3RQSA 4CLXA 2VZ8A 1XHLA 4IZHA 5F21A 5JMPA 3ROPA 3WLEA 3IMFA 1GCOA 3BAZA 4CLHA 4B4WA 2XXBA 4FFLA 3TZQA 3RUCA 1ENOA 3WOHA 1ZIDA 1UP4A 3ROKA 5C7LO 3IJPA 3JQGA 2NTNA 4JLWA 3GDOA 3LZ6A 4A2CA 4EITA 9LDTA 3RFXA 4CV1A 1VSVA 4B4UA 2FZEA 1DBVO 2OORA 3KOUA 4ZQEA 4CR8A 5KNLA 2ZTVA 4NBVA 1NFQA 3C85A 3WIDA 4DIFA 4EEZA 3U09A 2YQ5A 1OZAA 3JD2A 1H0KA 2X0JA 4JCOA 3EMKA 3C3XA 4BQPA 1DIAA 1VJ0A 1AHIA 4Y67A 1F06A 3IDSA 3GAZA 5TT1A 1XA0A 1ONOA 2ZTUA 3RU7A 1V6AA 6ADHA 1P1JA 1F0YA 1MV8A 1U2GA 3IKVA 3WJ7A 2GN8A 5L40A 2UAGA 1FDWA 3A14A 4H16A 3GNTA 2VWGA 4RJTA 4CODB 4LMRA 1VSUA 4C7JA 2CZCA 3M6IA 2FZWA 2HRZA 4IS3A 4BO3A 4IDGA 4PVCA 4XDZA 1IHXA 4MO2A 1GEEA 1SB8A 1S6YA 1UP6A 2DVMA 2DC1A 1EVZA 5HS6A 4CM1A 3JQ7A 3E03A 2NVUB 5IZCC 5JCJA 1LDMA 1V3UA 1KYQA 1HE3A 3PDUA 2BGKA 4IJUA 1NR1A 4Z0TA 1PL8A 2UUPA 4D7AA 2B5VA 4MVJD 3QVXA 2GDZA 1N9GA 4CQLA 1I10A 2BFMA 5DBFA 3LC2O 5H82A 2JCXA 5T6BA 5IXSA 4QT0A 4Z9YA 2D4AA 3CPSA 1HKUA 3COSA 3F46A 3WXBA 4PG4A 1YOVB 3RIHA 1MB4A 4ZQGA 3SVTA 5DP1A 1Z82A 2QIOA 4GSKA 4IINA 5TT0A 3ZGYA 2VWPA 1AHHA 3IKTA 1YS4A 5JDIC 5KWEA 2Q3EA 3SC6A 4HUJA 4KP7A 1E5QA 2VHZA 4IUYA 5THQA 4QQRA 3K73O 2AG8A 2BF7A 2CNBA 4PCVA 1D8AA 5DOZA 3RBVA 2PGJA 1YONA 2DAPA 4CV3A 4RF3A 5JCJD 1SNYA 4BNTA 4CLRA 3WYCA 2UVDA 2NM0A 1PJBA 4ZN6A 1UZNA 5DBGA 2Q46A 4ZQHA 4ALMA 2PD6A 3OIDA 4XKJA 3OA0A 3D3WB 1Y7TA 1YB4A 2O3UA 4J16A 2RIRA 3VPGA 2O3TA 1VE9A 1YBMA 2YW9A 3KLMX 2IE0A 2J3KA 4HNHA 5G0SA 3TL3A 1IYZA 4UVDA 1MX3A 2E82A 1M76A 3FWZA 3JYOA 4LN1A 3ZHXA 2A94A 1NVMB 5TC4A 3WLFA 4E2ZA 1LDYA 2J3HA 4ONEA 3SJUA 3BMNB 3OMLA 5JC1A 2JHGA 4I08A 3VDQA 4AJJA 2AW5A 3AJRA 3VZPA 9LDBA 4IDBA 1HL3A 3T4EA 4DYVA 3HSKA 1O95A 1E3JA 2EJVA 3ZWVA 1Z6ZA 2BGMA 2O2YA 4L0QA 1UR5A 3DBLB 4J1TA 5L7WA 3OBBA 1HLDA 5ICSA 5EN4A 3I52A 2GZ1A 1BDBA 3UCEA 1ONNA 4UAGA 4E32A 1NFRA 2NVUA 4FFRA 3D5QA 5GY7A 3CINA 5L4LA 2J5QA 3PYXA 1O0SA 5K0ZA 2O7SA 2DKNA 3K2EA 1DSSG 1I33A 3WSVA 4G5HA 3CSDA 1PR3A 2VZ9A 4CR7A 1TA4A 3PEFA 5DULA 4FFOA 5L95A 4YEDA 4KDFA 5JC8A 3Q3CA 4Z0PA 4E0BA 3EY4A 4NU5A 2C0CA 1V35A 3IUSA 2GNAA 4DIOA 3UKOA 4AJNA 4YJFB 4N5MA 2NNLD 1YOVA 2DPHA 3P5SA 3CKYA 1YQGA 1E7SA 1I3MA 2Y66A 5DNAA 4C4OA 4GBJA 4P4NA 3NT5A 3ZWXA 4PG5A 2OBNA 1IL0A 1LDGA 3UN1A 2VWQA 1E3SA 3ZNOA 4BMVA 1B26A 1N1EA 3L6EA 1E7YA 1PZHA 1DPGA 3I4FA 5ILGA 4E3ZA 5I7SA 3RWBA 3R0IA 4QFDA 3WJAA 2UDPA 1H6DA 3GMSA 3GK3A 3UCFA 3GZNB 3QWFA 1I2BA 1EZ4A 1JU9A 1N8KA 2HU2A 3OETA 4JP2A 2GLXA 4RQUA 3QP9A 2VYND 1CEQA 1DFGA 3HN7A 4AJ2A 1KY4A 1UXGA 3LT1A 1H5QA 4TQGA 3VDRA 3IAHA 5DN9A 1JKFA 2CDAA 3PHHA 4XQGA 4CM8A 3Q11A 2VNAA 3BMOA 4D46A 1RM0A 1B15A 3DQPA 1E5LA 2D5AA 4WGGA 4JIGA 2AG5A 5KVCA 4MDHA 3WQQA 4WNIA 4CMCA 4CLEA 5LDGA 4D45A 3UW3A 4H15A 3S2IA 3ZW8A 4IQGA 3TOZA 3KVOA 3E5MA 1U3VA 2VUUA 2C7GA 1HEUA 3I5MA 2RH8A 4DTIA 3GDFA 1T4BA 2YJZA 2GD1O 2CUKA 3ONEA 3DBLA 1GZ4A 4F3YA 1SAYA 3V1UA 1I2ZA 1LTHR 5HM8A 4II2A 3OH8A 5AXCA 3JQ9A 3ZZNA 4JJGA 4ZU3A 2P9EA 1TVEA 2AE2A 2NACA 4YA6A 1X7HA 4RF4A 5F1OA 2DFVA 3O4RA 3LC1O 4MVJE 1R4MA 2Y0EA 3ITKA 3D0OA 2X22A 3AUAA 1C0LA 4CM4B 3U4CA 4KWHA 3RASA 3DMTA 4LK3A 4MKXA 2WYVA 4IBOA 4KTTE 2HCTA 5GZ6A 4FGSA 1MG5A 4CMEA 4YJFA 4EUFA 2JCVA 1U8FO 5FI5A 2VUTA 3EGOA 1GPJA 3RKUA 7MDHA 5JMWA 1IULA 3ABIA 3Q6IA 5DF1A 2AEMA 2HLPA 1HETA 3H9GA 1JWAB 3QRWA 4B4VA 2NU8A 1CDOA 1M2WA 2DFDA 2NTJA 2JHFA 1ZK4A 4PLYA 4YYZA 4P22A 1PEDA 1T24A 4NH4A 4NR0A 4P38A 2B4TO 5JLAA 3SLGA 5IF3A 1NQOA 3MEQA 4IXWA 1I3KA 3DFUA 3JQFA 1HYGA 1UAGA 1C3VA 3GZNA 1NWCA 4LRSB 1I0ZA 4BKQA 2PH3A 2WEKA 1B8PA 3VH1A 5B4UA 5U4QA 1ISJA 4EI2A 4D43A 2P9CA 3IP1A 4PLCA 3CIFA 4WCFA 1UUFA 1XDWA 1LLCA 3MJ4A 3WGHA 3ROMA 4UUMA 4OH1A 3KLPX 3PTZA 2WWRA 1ZXBA 2FR8A 4YT4A 2BKAA 1O89A 3DBVO 5KVSA 4U6SA 3FHLA 4XA8A 5JNLA 3I9JA 4Y9DA 1EUZA 1OI7A 1K2WA 4CUJA 5K9ZA 2TMGA 3FWNA 1XWFA 3PHLA 1Q7GA 3TF5A 2PWZA 2AA3A 1T4DA 4QO7A 3VPHA 3ST7A 5EPOA 4FR5A 4TRMA 1U3UA 4YT8A 1PTJA 5A9SB 1I2CA 1Y5MA 1ML3A 3JD1A 3ZU2A 4YAGA 2I9PA 3R3SA 1SZJG 2DBQA 4D0SA 4I9HA 5C7OO 3WMWA 5TF4A 1YB5A 4KQXA 5U9CA 1ISFA 3FNFA 3ZWYA 1PJLA 1XG5A 2HMSA 1QXSA 4M86A 3FF4A 4XB1A 5AYVA 4XR4A 4CM4A 3PWSA 1EQUA 2G5CA 2ZKLA 1ZK0A 1I36A 3EUWA 4MJLA 4GKBA 3GVCA 2FRDA 1SC6A 1NAIA 2EGHA 2FSVA 4RPLA 1F17A 3ZV4A 2AHRA 1MA0A 3GA0A 3K31A 1VI2A 3D3EA 4RVHA 3E5RA 4YQYA 3MJEA 2X9NA 3G1TA 1A72A 4GVLA 5IDYA 1DLJA 4MVJP 4UUOA 4ND3A 4R68A 4PRLA 1E1KA 1GV1A 5KOIA 1KERA 2R00A 1V8BA 3TZHA 5CDTA 1YDWA 1PQPA 1YH3A 2CF6A 1T25A 2OZPA 4WUVA 2Y1CA 3SBOA 4DL9A 5HS4A 5JFOA 1C1DB 2C20A 2Q2VA 2XAAA 4J2OA 4AJOA 1LRLA 3A9WA 5KKAA 2RH4A 2ZJ1A 4YJGA 4IIVA 4PLZA 1XKQA 4BKRA 2NVWA 1QP8A 2VQ3A 1HDRA 4J91A 2CMDA 1PWZA 1K6IA 5LDHA 3TFOA 3ZWCA 1LA2A 2X8LA 4EDFA 4FOSA 4KOAA 3DO5A 2X4GA 1NR7A 1NM5A 2CD9A 1YDEA 2V7PA 1HE4A 3VZQA 2A92A 1VKOA 1ZZEA 1KETA 2CY0A 4PLPA 4CLDA 4NJOA 1ENYA 3LLSA 4HY3A 4PVDA 3K30A 4BMNA 3GVPA 2X0IA 1PSDA 3W1VA 5A02A 3NJ8A 3K9QO 5F5LA 1WDLA 2Q2WA 1OC4A 1MUUA 2YFHA 3GG9A 4BO4A 3NTQA 3NEPX 3OFSA 2NU9A 4XYGA 2JAHA 3JQ9C 3PDJA 4RVGA 1BXKA 4ND2A 5F3RA 4E2WA 3HDYA 4RO0A 4NBUA 1PJ4A 1B3BA 3MTGA 1T2AA 4YACA 1MC5A 1XU7A 3H5RA 4TRNA 4YJHA 5C3MA 5JCXA 1H6AA 2QRJA 1DHRA 3GVXA 4XQCA 4CV2A 1F8GA 4NU6A 3DMTC 1YXMA 4CMEC 1UJMA 2GZ3A 3RUIA 5CDYA 3BMQB 2F1KA 2EW2A 3GEMA 4DLBA 1PQWA 1L7DA 1N2SA 4DVJA 2EEZA 1SO8A 1P33A 5BNFA 1A4IA 3QVSA 2P4HX 1LDEA 3VH2A 1UP7A 2ZYAA 3JQFC 3QWHA 4BNLA 5KJ6A 2C2XA 3HG7A 5GZ3A 2AQIA 3TOXA 1R37A 1I3NA 3DTYA 1JW9B 3IJRA 1E3WB 4MP8A 5T57A 3TRIA 1DFHA 5BT9A 2D2IA 4NDNE 4F46A 3U49A 2TMDA 4WCFC 3B20A 3CE6A 1C1DA 4OXNA 4YAIA 1MG0A 3BTOA 4U5QA 1YQXA 3L07A 1KEWA 3LQFA 1U3TA 3WGTA 1T2CA 1MXHA 1R12A 1KVRA 3S2EA 1UXJA 1ULSA 1QYCA 2PR2A 4HKTA 2BRUA 5HRUA 4LRTB 2PY6A 3EDMA 5JAQA 3JQEA 2HDHA 3RC9A 2GYYA 5EMHA 2D0IA 4RDIA 4OHUA 4Q3NA 3FTNA 3QE3A 5B12A 5L9AA 4QUKA 2NUAA 1B3RA 4WK6A 1HF3A 1HTBA 4INAA 2QYTA 1JTVA 1F14A 1PS0A 3AW9A 3GZ4A 2B83A 4WEOA 1UAYA 3E9NA 5GMOA 1EE9A 2CDBA 3DBRB 2Y93A 3GGGA 1U1IA 2VHXA 5L3ZA 3VH4A 4L4XA 2X9VA 4OJNA 3H9UA 2G17A 3OEWA 4RF2A 4MOWA 2HMUA 2C2YA 4FFPA 1I24A 5I7FA 1BXGA 1LI4A 3FR7A 1A27A 1CQIA 3JQGB 3B70A 2YUTA 1Y6JA 2DTEA 4ALLA 4OQZA 1I5RA 1GYQA 1Z74A 1WLYA 1PS9A 3OJOA 3N7UA 2FR0A 3ZV6A 1QYWA 3KYCA 1PU2A 5CPBA 4BL5A 3MWEB 3AWDA 3HFSA 3PK0A 2Q2QA 3GDGA 2HK8A 3LT2A 3QJ5A 2Z1MA 4IXTA 3NUGA 4WNCA 2CVZA 3AY3A 3B6ZA 5JYAA 2GN4A 3OJEA 2R00C 3B1JA 5A06A 1NVTA 4XQEA 3VTFA 3W4KA 5ENVA 4FJ2A 1RM4A 4NIMA 1ZKMA 4M55A 3LVFO 5KIAA 1ZUD1 1ZMTA 3WNQA 2IRWA 1E3WA 1FXSA 3P2YA 1M66A 5FYDA 3WNVA 1CIVA 1HDXA 2Y68A 1EK5A 1IOLA 5I9MA 4YRAA 4XRGA 1YO6A 1ZSNA 3CH6A 1VL8A 3JQ7B 3LT0A 1VM6A 4A7PA 4RZIA 1EQ2A 1ADFA 1GFSA 3PGJA 4ZQFA 1PGJA 4J1QA 2Y1FA 2EGGA 5JYDA 4JJFA 1H6CA 4I9UA 3HN2A 1O94A 4CQLB 3OJFA 3AUSA 3GGOA 5IXYA 2OP0A 4WOJA 1YJQA 5CG2A 4PN3A 1GZ6A 2OMEA 4Q3CA 4AVYA 3H9EO 2DBVO 4BNYA 4DC0A 5ER9A 3OP4A 3PI7A 4J1NA 4GGOA 4J7XA 4XRRA 3MZ0A 3UCXA 1Z7BA 3ADPA 4HWKA 3WX0A 1AE1A 1J4AA 5LC1A 1GY8A 1KEPA 4CM9A 4XCVA 1LBEA 4E4YA 3JD0A 5JY6A 2AXQA 3PQDA 1B16A 1L7EA 1BRMA 4QEDA 1NVGA 3H65A 4XYEA 2NVBA 1LX6A 3KYDA 4DXHA 3GNSA 2AEFA 5KVQA 3OEYA 3OQ6A 1X1TA 1IPFA 4CLRB 2WYWA 1JAYA 4D3SA 2IXBA 2PZMA 2JJYA 2IYOA 1ZSYA 2PZLA 3PHJA 4GL4A 4M8SA 3GC6A 3ZWNA 1E7WA 2O3JA 4UEKA 4AJKA 1QRRA 1T2EA 2IXAA 3Q2IA 1I32A 3ASVA 4UUNA 3ZNQA 2WTBA 3V2HA 4MVJA 3JD3A 1AN9A 4BKUA 1LDNA 3L0DA 1XQ6A 4E5NA 2D5CA 3V8BA 1V9LA 2BLLA 5TJ9A 1X15A 4CM9D 1Y9AA 5M6DA 3RKRA 3E82A 3QIVA 3OIFA 5HWSA 1AUPA 4TMFA 2QW8A 1HDGO 5F5NA 4GH5A 4IIUA 2ZTMA 2QX7A 4YT2A 5IDXA 4KUGA 3DEYX 4YT5A 1GEGA 3VZRA 3E9QA 1EBFA 2OL4A 1D1TA 5IJZA 1XEAA 4DLLA 1BSVA 2Q50A 4I5DA 4DPMA 1X7DA 3OSUA 5FFFA 1ZMOA 4JP3A 3C7CB 4PG8A 2ZB7A 3PJEA 3UHAA 3E1KA 2RBEA 2QZZA 3ZWOA 5G0TA 2DQ4A 4E2XA 1TB4A 3CMCO 1JVBA 1SBYA 2YHUA 4UVHA 1N1GA 1OOEA 3NTRA 3WYBA 3OJLA 4WECA 3S2GA 4LCJA 2ZIZA 4YAEA 5CP8A 5CPFA 1UDCA 3JQAA 2EJWA 2IDZA 2C54A 1ISMA 1JDJA 2WE8A 4YWJA 2ZJ0A 2FMUA 2Y1GA 1U3WA 3W4IA 1HDZA 1K89A 4HFRA 4WE3A 1DC3A 4J9VA 3I9NA 3MJCA 1HZZA 3DL2A 3OECA 3DB2A 4MVJH 2FSSA 2O3SA 4Q3EA 4WLNA 4IDCA 2NQ8A 2GPTA 3D64A 3O38A 3GFBA 1MXFA 4ND1A 1X7GA 2NU7A 2O7QA 4BB6A 1RM3A 3AI3A 3PZRA 1DC5A 4L8VA 1QR6A 3OQ1A 5JSFA 1KVQA 3NDRA 1N5DA 4R41A 2FY8A 1PL7A 1EDZA 1U28A 1V3TA 4A5OA 4BS9A 3C7AA 3E9MA 4I8XA 5T73A 3JQAD 4CM8B 4CM7A 4BNFA 2EXXA 5I7EA 5G0VA 1PGOA 3BMOB 3F9IA 3KUXA 1U7TA 4WEQA 1J0XO 4PLTA 1A71A 3U4DA 2VZ0A 4YRBA 5CDGA 4GWGA 4U7WA 5BR7A 4D41A 2O4UX 1H2BA 4CQMD 2X5KO 4O6VA 5JPIA 2BGLA 4XZ3A 1IZ9A 2Q1SA 3WGQA 3PGXA 4KZPA 4MP6A 4AJ4A 5G0WA 4R54A 5DP2A 1T26A 3ZU4A 4L74A 1H9BA 5MDHA 1W73A 2X6TA 4DREA 1Y9EA 1U8XX 1G0NA 3ZH2A 5C5IA 1PIWA 1IE3A 4MKRA 3P19A 2VOEA 3ZWWA 4FS3A 2DU8A 2XXJA 4IZIA 4DMLA 3INRA 3UXYA 4OYRA 4M49A 2Y1DA 3NKLA 5KJCA 3ZU5A 2ILTA 5BSEA 4Z0HO 3QV1A 2I76A 1PS8A 3INTA 1MFPA 2WE7A 3EC7A 3JYNA 3JSAA 4HXYA 4J0FA 2VYNA 1R4MB 2FPIA 1WZEA 3FCOA 4GI2A 4J2HA 3DC2A 4XDYA 5AVOA 1ENZA 1VPDA 2IEDA 4Q3DA 1ISHA 5JBIA 1E6UA 1O9BA 1ENPA 3C1AA 1PJTA 3TZKA 3DTTA 1W4ZA 1C0IA 2P4QA 1LSSA 3DHNA 1YL6A 3GPDG 1J5PA 3UICA 4OAQA 2ZQZA 1QV7A 3WGIA 4CMBA 3TPCA 1LQTA 3K96A 1X1EA 3CZRA 3AM4A 4HNGA 4RPJA 4EGFA 2R2GA 2Z1NA 1V3VA 3RAJA 3GR6A 3TJRA 4CUKA 3L9XA 4O1MA 3ZWMA 4BO5A 4R9SA 5EESA 2VHVA 3CUKA 4TRJA 1DRWA 3G17A 1CRWG 3G49A 4NJMA 4RZHA 4GQAA 2PD4A 2Q4EA 2JL1A 2PA3A 4GX2A 1SOWA 4O59O 3GUYA 4TSKA 3EZYA 2P68A 5G4LA 4XWYA 3V1TC 1K0UA 1H2HA 1DOHA 4WCFB 4RPGA 1LDBA 1IY8A 1T2FA 2I3GA 3QWIA 4AJIA 4OKIA 2B5WA 4UUPA 1R66A 1X0VA 4G65A 3DAPA 3ZWAA 5JY1A 3DHEA 2YV2A 3VPSA 4BVAA 4D3FA 4RPKA 5K6AA 2NTVA 4MVJI 1HYEA 4ZICA 1ZJZA 2C29D 1NQTA 3L6OO 4K6FA 3TZCA 2LDBA 3H2SA 3WG9A 4MP3A 5H81A 5L53A 2YY7A 1GUZA 1GUFA 4HFMA 3U62A 1FMCA 2UV8A 4WLUA 3W8DA 5CAEA 3RC2A 1XLTA 4F6LA 3H6KA 2VN8A 5TRTA 2UYYA 4BMSA 3S1LA 4PFJA 2PZKA 2O3RA 2X9GA 2JCYA 3D5TA 1ULUA 3GLQA 1DJQA 2Q49A 3RC7A 3H3FA 2YV1A 5TS3A 5CEFA 1CETA 5KJFA 3EHEA 1XSEA 4QO8A 1LLQA 5ILOA 2Q1WA 4EZBA 2HUNA 3H3JA 3KV3O 5U1PA 2NADA 4E21A 3UAGA 1GQQA 1P44A 3G3EA 5BNTA 3ZNPA 4HX5A 5JXWA 1RYDA 3PJGA 1VL0A 3DZIA 5EL0A 4CL3A 3AUTA 4GVXA 3GUCA 3HB4X 5A9TA 5IZ4A 2DLDA 1N7GA 4FFMA 1P1FA 2W8ZA 3V5NA 1ZW1A 1SCUA 2PZJA 5CEJA 8LDHA 3IC5A 4AL4A 5J9GA 1A9YA 1C1XA 1PGNA 2G1UA 4Y6SA 2Y1EA 2EG9A 1DLIA 2VHWA 3DZHA 4DQXA 4YBZA 3SX2A 4BO0A 1O8CA 1E92A 3FR8A 4AJPA 4R3WA 1NWHA 1P45A 5A5FA 2YZ7A 4XJSA 1YB1A 4DBZA 2C5EA 4GSLA 4R01A 2EHDA 4B3HA 4E33A 3V2UA 1SEVA 3A4VA 4AJHA 4YJGB 4XR9A 1ZSVA 2VOJA 4QECA 2F00A 3IIEA 5L4SA 1I8TA 3UH1A 1MC4A 4CM3A 3WDSA 1WVGA 5FWNA 3NV9A 4DQUA 3R1IA 3RJ9A 3D4PA 3AY6A 3ETEA 4RDHA 1RYEA 2BFOA 3KSUA 4AFNA 4LVUA 1FDVA 5TSDA 1NPYA 4W7IA 5BSFA 1ADGA 1K6JA 5KJ1A 2FOIA 3VTZA 5JE8A 1V0JA 2VT3A 1U5CA 3EAGA 2HK7A 3GG2A 1EE2A 3DDNA 4N54A 1BVRA 3WGGA 4IY1A 4HADA 3FPLA 2PV7A 2Q22A 2QZ9A 1LSUA 3AOEA 2A35A 4CM5A 4AJ1A 3H9JA 4W9NA 4ALJA 3ZI0A 4XGNA 2O23A 1QYXA 1NAHA 4M89A 1VJ1A 3SEFA 4BHTA 1Z45A 3NGXA 1LSOA 1Y1PA 4U0KA 1JWBB 2B4QA 4J1SA 4QXMA 4YJHB 3GN1A 1NXQA 4UULA 3B1KA 1FDTA 4NPCA 4BO1A 1T2DA 1R0SA
chains in the Genus database with same CATH superfamily
3VKVA 3MSXA 2BFBA 3QLTA 2A5GA 3EE6A 4PICA 5LYYA 3WGUA 1WV0A 2AYYA 2QJRA 3AV3A 3T7TA 1P8AA 1NW6A 1UBGA 2X0KA 1K5DA 4X3PA 1M10A 3DH0A 4Y9UA 4DIUA 1X1RA 2XODA 4Q3AA 3ZD6A 2L18A 2EFEB 2GERA 421PA 5ED4A 3P52A 4JT9A 4O8JA 1NNI1 2ENWA 3NHFA 1YNSA 2HRBA 1Y6RA 1SK8A 2GWHA 4OOEA 5IAKA 1DJNA 4WIAA 2B6HA 3MUNA 3O8QA 1S96A 3PTAA 5JFGA 2ERXA 1SG6A 3M9LA 2ONKA 3K9NA 4E51A 3HUDA 1R0ZA 1U8EA 1UQUA 3PNLA 2CF5A 4MWSA 1RC0A 4LOKA 3JVVA 4NMLA 1X8LA 3PFWO 2BJWA 2B4YA 3GGCA 1P4AA 4IG9A 3RSQA 3HACA 3WK6A 2WJYA 1CJBA 4UBNA 5FPSA 2NSHA 5SY9A 5KYYB 4UU1A 3DHYA 2FZCA 1KAMA 2JKVA 5KYTA 1YJBA 2FF7A 1W52X 2R5WA 4P84A 1ODKA 1U9CA 5HGXA 1IN6A 3PNSA 3E70C 1ZK2A 3KNZA 4IHQA 5G3ZA 2GT1A 3RROA 3G2IA 4F97A 1TE2A 2DT5A 2GILA 4J75A 1L5FA 4E2YA 1C3JA 4K9MA 5CDSA 1CB0A 3ADDA 4BRSA 3RWOA 1UBOS 4AY3A 5ALWA 1FFXB 1KHHA 2EQBA 3FUUA 1Z7YA 5FOSA 3PX2A 5LMUB 1ZS9A 3Q9NA 4QU8A 4BRUA 3N59A 1E79A 3RS5A 4HAZA 4ZYZA 3ZVNA 3MPUA 4KQIA 3RUEA 1Q0ZA 1L5NA 3L8CA 4MXDA 3ZIAA 3U5TA 1RLTA 4BWYA 1JPNA 1R6DA 4I4TB 5EJGA 5IVHA 2ZJ8A 1P31A 4NMWA 2G9NA 3RS7A 1CUAA 4HFJA 2WD8A 1KRWA 5EXXA 3ZS9A 1KAHA 4MVJG 3TNJA 1XEXB 5CTAA 4Q4HA 4FD3A 3URKA 4ESEA 3PC6A 4K9SA 2CKDA 2FXVA 3UY4A 1Z2AA 3N74A 3UFBA 1X8KA 4QGGA 2WSBA 1FLAA 2P4UA 3S5UA 3LGAA 2G82A 1W5EA 2V7UA 3RVMA 4KB5A 1Z7EA 3RYTC 1WEHA 3O5AA 5AESA 3QEAZ 1P0MA 1G6OA 2KLBA 4D81A 3N2KA 2WP8J 2W83A 1BS9A 4G56A 4FSHA 1YRLA 2ZUFA 4K28A 3BBLA 4YPOA 4Z49A 2WSSD 3KETA 1P0FA 3R7BA 1YRHA 3OZGA 1QB7A 4TQUS 2PKRA 4WLEA 4G5YA 4EUEA 3I1IA 1KGDA 4WJKB 2EWMA 5AJTA 3VR5A 5I8ZA 3QVJA 4B3FX 3NJ4A 3PXEA 4ZGBA 2HSDA 4ZC1A 1MVOA 4TX1A 2QAGC 3U3ZA 1S0UA 3D6NB 3G9ZA 1CX9B 2QYOA 5HQJA 1T1GA 2WTXA 3ESBA 4Y0NA 3VC7A 4ZCLA 3KVNA 2IBMA 5KWJA 4U9HS 3E84A 2Y05A 3EFOB 4JVOA 4KR3A 1CJCA 1WDTA 1MHPA 2O8CA 2ZSKA 1LRKA 1E60A 1QHGA 4ALNA 2WWYA 3TNLA 4F72A 2PXXA 5IC5A 4C6RA 3U0BA 4OV6B 4I46A 5CJ2A 1FIUA 2ZAIA 2DTXA 1ZM2A 2IHKA 3D1LA 4OXYA 4PZCA 2PGLA 2ZJAA 1R7RA 1Q1EA 3ZN2A 2C7BA 2X5OA 4P86A 4BVBA 4EX6A 2B4RO 1E2MA 2HI0A 2MSLA 3EIFA 1FFWA 5TLSA 4RCYA 1YBAA 1JQBA 3C3EA 4W8HA 3R9WA 3ZY4A 2XTZA 2Z83A 1FP7A 5AICA 4OJTA 2ZCUA 1S2IA 4ZI7A 1GTVA 1P17A 1TT5A 4K2HA 1KSGA 4JX8A 1PWEA 1G8YA 3I1YA 5D3QA 5IASA 1NTOA 3A36A 3EXAA 3HI4A 3ILYA 4QYTA 5D00A 3WB0A 4KR9A 4Q4CA 4HWPA 3REFA 1T4MA 2AJCA 4IDEA 3H4VA 5B4VA 1J1ZA 2CDNA 2FPGA 3V4PB 2F3UA 4HAVA 3R23A 2GH1A 2I7XA 2IPNA 1PKEA 1V5FA 2RMKA 4Q4AB 3DMYA 3MTQA 1EHIA 2QDXA 4G41A 4YDRA 2QMZA 3ZE6A 1ZJ5A 1XCPA 4IJVA 2FMHA 4CUZA 1O5OA 4P35A 5IUJC 2GD0A 2GPJA 2Q8PA 3VYTB 4EBFA 4QEKA 1JSCA 4S1TA 1AIPA 1YGPA 2BE9A 4G1CA 4MVYA 2JFXA 4BXOA 1WUIS 1KI3A 4JI4B 1WKBA 2QUBA 2ZT8A 3NZEA 4NZMA 5CX1A 2H7YA 2FWIA 3AOEC 4PPGA 3NV7A 5KNDH 1DJLA 5IABA 1HTTA 5F73A 2H17A 1IC6A 3BCUA 5HF8A 3SM9A 2YBEA 1YZ3A 3ZU6A 1MX1A 2WWGA 1PTJC 3WDKA 4NZZA 1F12A 3TQHA 4OIMA 3WKAA 4G8JA 1YQTA 2ZAYA 3ESXA 3MMPA 4FGWA 4H4CA 2VBCA 1UBFA 2WYUA 2FUG1 4PGFA 2XBLA 2ZB8A 4RXTA 4N6NA 2R7LA 1V9CA 3ND6A 3VR4A 1HZJA 1NUQA 2XQJA 1QJ4A 4JBWA 4KQGA 4BYGA 5DT9A 4HDMA 4D8UA 1SQSA 5G40A 5C46F 1HX7A 2F9FA 1AF7A 1IXSB 4DCGA 2BHNA 2PK3A 4P3NA 5F78A 5I7VA 3FLMA 4JXKA 3DGFC 3IQHX 4FQ7A 4JROA 3NH6A 2UVPA 4XVCA 1EVQA 4KK3A 1Z38A 3H2ZA 4QPPA 5IJAA 4E13A 4BRWA 1IEQA 4CHGA 4WOBA 5CXXA 2FSVC 5JDIA 3K70B 1V95A 4X24A 4X8LA 5FUQA 3B1ZA 3IQFA 1SHUX 2I67A 1GUYA 2WD7A 1MGPA 3MBIA 2CXNA 4LZPA 4OKNA 1NW3A 2ZDQA 3E61A 1N5IA 3WB9A 4QVKA 3A28A 3AYXB 2AXNA 4QX6A 4RK6A 3T3IA 3MWDA 1GTZA 3OWXA 4KQEA 5L6MB 3ITEA 2EP5A 4HAUA 3SIWA 2CDRA 2HREA 3DWGA 2WZBA 4XH9B 1M2HA 4XPIA 3U9LA 5LP6A 4GWLA 4O4LB 1IOZA 1OAAA 3G7NA 3TBKA 5A4DA 2CCKA 2PYZA 2HF7A 1AGYA 2QQ0A 2Q9UA 2UUOA 2VT6A 2W98A 3G2LA 4GMKA 5BRAA 4BP9A 5LXTB 4NCBA 3GQBA 1JFVA 1RQNA 2BI7A 5E7IA 2AG6A 2CT8A 4JC0A 3P2IA 3P0FA 3E4DA 1WW3A 2C4UA 4MYDA 4ZVNA 5HDQA 4MINA 1SCDA 5BORA 3OZCA 1AT1A 5FLYA 4YUWA 1V6SA 4RGBA 5BVHA 4EPXA 4TUYA 4WOKA 2SECE 3F6YA 3W06A 3W8FA 4FYJA 1WXXA 1KQFA 4M0DA 4HYEA 1ONPA 3BL6A 5GOZA 1XP5A 3V6LA 2V6BA 3RTEA 2RGXA 3V2GA 4ZTUB 4Y1RB 4UNPA 4JJKA 4ZOLF 1W4BA 1P2BA 1KMIY 4D25A 1FNCA 3WMRA 2F1IA 2V45A 1T36B 4KXMA 5FBQB 3SZOA 3V42A 2W2MA 3ISJA 3NP9A 2O48X 1KEVA 2E49A 2HK9A 4RZQA 1P2DA 5C5EA 4R2IA 2YS7A 2OKCA 2CLOB 3LX8A 5LBTA 4RLQA 1ISIA 2E85A 3EOBI 5AVYA 1S2GA 5FUWA 1QKJA 3H2KA 1C0EA 3A25A 2WKQA 1N2OA 3HM2A 1SUAA 4JN6B 3T3GA 4D79A 4D42A 3QE0A 3LRTA 4TXNA 4W99A 2GPNA 3D4NA 4KX3A 4M2LA 3MD9A 3SJ7A 4O4IF 3RUHA 4WN9A 3UMMA 4KR6A 1NUSA 2WAXA 8OHMA 3EXHB 1KP3A 2H85A 4MA4A 1D1QA 4PG6A 3M4XA 3ROZA 3BL8A 3VDNB 5A3RA 4XQ0A 1T43A 1KVSA 2ORYA 1NQ5A 2VBIA 4HBGA 1GQ2A 1SBCA 2NU7B 1GGHA 2A0KA 1ZIXA 3OX3A 5A2QA 3A1EA 1QK5A 4TV9A 5D3ZA 4HGZA 2P1DA 4Y1GA 1OWPA 2VUSA 5KSWB 1MJ5A 4BP8A 1LWOA 3KR0A 1SXQA 1OJLA 3ZK9A 2WKWA 5CA0F 1IIBA 4DIBA 2PDAA 3KFLA 3OAAA 4QDXA 2X8AA 4TMXA 4CG1A 3HQ4O 1N0UA 3F47A 4RS4A 5EQDA 3K0SA 1WWKA 2DPMA 2EFDB 3C8UA 3T9CA 5E3JA 3NPAA 3UV3A 2PR7A 2PRYA 4DM7A 2ZVPX 1DX6A 1C7RA 3B9BA 3M6FA 3IUJA 2VHYA 3IB3A 1SR8A 4WA7A 4GC5A 4GZ3A 3OPMA 4FFVA 2O2SA 4L5IA 4OREX 4MR9B 3VFDA 2V4MA 4DILA 4DSUA 5KINB 3A8TA 4NQZA 4RD3A 3U3OA 3AR7A 5JR3A 1G6Q1 1YS9A 3C4QA 1WO8A 2HLDA 2IEGA 3O2NA 5CU7A 2XMQA 1RPNA 3V4ZA 1A2KC 3F2IA 4ZQCB 4P34A 1Z6PA 4PG7A 5DO9A 1PJ3A 2QG6A 2I0FA 3HJTA 2QZSA 3NX4A 4G5RA 1H6BA 3UF0A 2JK1A 5IK2A 1YWGO 3I9OA 3WGYA 2X3UA 3U26A 3R0QA 4KMRA 2J46A 3QOYA 1XTPA 3VZCA 5KWSA 5C51B 3ERCA 2QL9A 1EHYA 3UENA 2UU9B 4UVGA 1KQOA 2YYZA 1PVVA 3OZ7A 1JDSA 1ZO8A 3A3PA 4TLEA 5EA2A 5HEKA 2BHRA 2PD3A 3ASUA 4LK2A 4PAQA 1NXOA 1H65A 2BFFB 3IVXA 1RJEA 3MJSA 3QEJA 2GTPA 4CYMA 1TUIA 3HZZA 1F5NA 3VAZA 4G25A 4QTZA 3EP8B 2PNFA 3BYZA 2WW8A 3P26A 3PE6A 4G4JA 4HVTA 3UC5A 5C8ZA 4YIHA 5I9LA 4LRWA 1MH1A 1P74A 1VQ1A 3GRRA 3PQFA 1GZUA 3ZUGA 4DBLC 1MZPA 4K6CA 4TSRA 3D7MA 2JRLA 1J2UA 1TO6A 4DG9A 1SCNE 4BJ5A 3BICA 5JBNA 4W82A 3HRIA 3IDOA 1NDHA 1ZVJA 2H6EA 4XYMA 5HZHA 1JDZA 2XYGA 3A4TA 3IOCA 1JHXA 3LVRE 3BEOA 5BQ5A 2CDCA 2HAEA 3NEJA 3ZV5A 1BH2A 4JBGA 2VNSA 1ZXLA 3FJ1A 2YJ5A 5L45A 4KQCA 5KTSA 1NW4A 4TKVA 2HW8A 4IXMA 1E7RA 1H2AS 1JR3E 3ELYA 2JGDA 1AHNA 3A9RA 4NZNA 1D4FA 2X14A 4E11A 1QG6A 3TZLA 2QQ5A 2ZUTA 4IIBA 2GETA 1IM8A 1K8QA 2B9VA 1Z5GA 1IHYA 2QG4A 1T13A 1NXTA 2ZG6A 3O6VA 2ZSBA 1EVKA 1WVMA 4OHMA 4L78A 2WOOA 4DNFA 4WCDA 3HDJA 4ZAGA 3PLAE 1DUSA 1TD9A 3BKXA 3C6KA 4G9BA 4N5NA 1HT2E 4JP5A 5C8YB 2O8NA 1CVLA 1Q7RA 2WBLC 3KTAA 1N4AA 4LSWA 4DLXA 2W4MA 4JXJA 1NW8A 3T3PB 2ZB3A 4OQQA 3FNRA 5B3JC 3T1YB 1QV6A 1IN7A 1FJGB 1ZUHA 3R75A 1PGQA 4RW0A 4JXZA 1PJCA 1T3LA 3EZ2A 4EZEA 4RVUA 5B4TA 1NFFA 1PGPA 3K9BA 3QI2A 2EL7A 5ALFA 1P9OA 1YQUA 3OD5A 4RLSA 5EWJB 3UAYA 3PHIA 3L40A 2ISQA 2DUMA 2PCLA 3Q0EA 1K92A 3FMFA 1CFZA 1SOVA 4NZPA 4BVKA 3MTIA 5HOEA 2IZOA 1CF2O 3IMCA 2Y92A 1VP3A 4IMPA 5EIBC 4U6QA 4BNMA 5KNCA 1GGKA 1U5BB 3OHSX 2AFRA 2FB9A 3BMCA 3LDFA 3GOQA 2C83A 3JARB 4B34A 1W44A 3M9XA 5DNUA 2XB8A 2RK6A 4F2GA 5AJUA 4BV8A 2C9CA 5MFPA 5MGNA 5HGJA 1SOMA 1T29A 2D59A 2D62A 2D5BA 3NHSA 4O0LA 5DV9A 5IRCD 4BO7A 3T9EA 3LXUX 3PUKA 1P4GA 2ANBA 1PAUA 3RS0A 2FR1A 2LDXA 2R5NA 3UJDA 1T3GA 3ENWA 4XM2A 3U17A 5K05A 5L3QA 4W7SA 3E48A 4DV6B 4ZT7A 2CV0A 3VNAA 4GP9A 4NBRA 1M9NA 3FSRA 4P8RA 1A95A 2I65A 2HLHA 4XIJA 4Z1MD 1H0SA 3EEQA 3A6PC 2NZ2A 3KAPA 4HRVA 1CCWA 1UH5A 2IU3A 4FM9A 1JHUA 1XCBA 1ZU4A 4D4JA 3GAAA 1QUEA 3WLAA 3L7NA 3WL3A 2FN7A 2I1LA 2NW6A 3FVVA 4P2BA 4PTYA 4S24A 3N5CA 1YKFA 4PR0A 4Y2UA 3ENVA 3ZEIA 4KJZA 1JZTA 5C4IA 5J4LA 2R68A 2X9LA 2GCGA 4L15A 4BE4A 4D8YA 4W5QA 3ZJVA 3NTOA 3FHTA 4IL5A 2VQEB 5KNBD 2I2WA 1EFCA 1JHMA 2H0RA 1WNTA 3I6QA 1JIKA 3PP8A 4QVGA 5DNYB 1U8TA 2YNMC 1H3FA 2AF3C 1WETA 4KQ1A 2GAIA 5I3ZA 4BX0A 3LVBA 1FMTA 2BM0A 3FBTA 2QE7D 4DARA 4I1OA 2EKPA 3EUFA 3CVUA 2CNNA 2VAMA 2ZUSA 4Y1FA 5JWOA 4CLOB 1ZNZA 1B2LA 2LTAA 3IHWA 1T34A 1XX6A 4EENA 2BGRA 1I2AA 2V9PA 4K5QA 1TNDA 5K3CA 4N0DA 3PWZA 2QUHA 1E63A 1Y37A 5F7OA 1TCUA 3DGEC 3VHQA 1XD2A 4CTNA 4LFBB 1KOJA 4I2NA 4QTTB 3QNMA 3N8KA 2ODEA 3ECSA 4QXPA 1RPJA 2O3QA 1UAAA 1O95D 3OOJA 3UMBA 4RJLA 4HDRB 3W5SA 3TLKA 4PLHA 1PE0A 2OR3A 4P5EA 1E9EA 4MYRA 1PYDA 3UMFA 5JDCA 1QE0A 1LC0A 4HEA6 1FS4A 1L7RA 2NO1A 1AMNA 3EPBB 1KIAA 1S2MA 2Q3HA 5B3AA 1O9GA 2GSDA 2IQ5A 2IZ0A 4F38A 2KBEA 4GI5A 3WAKA 1LJLA 2OCYC 3C1OA 1P7CA 3DOJA 4GPAA 4DLSA 5AW2A 2SKDA 4AJLA 4Z6KA 3WRYA 4Z2AA 3V7UA 1E9RA 1OBVA 2ZJYA 2GCNA 1PFVA 3EDOA 2P65A 3MGAA 4HWRA 5TQVA 1T0PA 3D3WA 2O2IA 3MTDA 1KRXA 3KIPA 4F2PA 4WL0A 3AXSA 2QW0X 4HX9A 4TVBA 4KO1S 4V0RA 1JQ3A 2WM3A 1KOFA 1N2CE 4KLAA 3DLAA 4C0QC 1XZHA 4GICA 1KBZA 1NBAA 2IOQA 4PZLA 3RSZA 1U9JA 3QLUC 3AI2A 2Q5HA 4QTXA 2ILVA 1NRIA 1AKTA 4MHOA 3TSAA 1N2BA 4TKMA 3T3NA 5ETJA 3BMNA 4XIFA 3LA6A 4TTSA 3LTEA 3Q1KA 3W5CA 2D7JA 1FJ2A 1SCKA 4OK6A 3ZK7A 3M2TA 4HPWA 1H8HD 1C50A 2X2EA 2PIDA 4L3WA 5K8JB 5JS6A 1IK4A 4LBZA 2EFYA 4AXXA 2OGZA 4A8TA 4AY2A 4XLLA 3ZR4B 1U4SA 5KX5F 1SUWA 2IU6A 4H0CA 1JEEA 1JEYB 3GV0A 1MIOB 4YAOA 1EKXA 2NZXA 3BE5A 3BF7A 5BV2P 4CF7A 1I01A 2VJMB 3ROTA 1F4PA 5C52B 1EB8A 2W6ZA 5KUTA 1YI1A 5HE9A 4E5MA 2CL0X 3O75A 4MWBA 5JRJA 1U2PA 2JGLA 2DHEA 2YN0A 4F1JA 5LD2B 1RD4A 3ROFA 1RMYA 2JEYA 4R9VA 1CUIA 4K9NA 5GIPE 1F5SA 4WJZA 2PSEA 2YC4C 2YW2A 2XCIA 1N5JA 1F2UB 3TRDA 3ZE0B 4DCNA 1AUQA 4MS1A 4N01A 4IJKA 4L4SA 2BTEA 4O2LA 1BDJA 3AH8A 2DP4E 4YP9A 4K26A 4KXLA 3RPEA 3ZJTA 3AZPA 1Z06A 5FEUA 4DLAA 4RL6A 4P5DA 3AVPA 2FGJA 3D3JA 4RHYA 1GPUA 2JLZA 2HMAA 1ZVKA 1L2TA 4QUAA 3RLFA 3WLSA 1K6MA 3IQDB 5L3SA 2ZIEA 1YGYA 3ZHZA 3AR5A 1ISSA 1MAHA 4LI0A 4J3NA 4BMYA 3DDCA 1SEPA 1TVKB 1OREA 3S2FA 1W88A 3KQPA 1PX2A 1UMCB 4FUQA 4HO1X 5FI3A 3FZQA 1AQNA 1MRSA 1R8XA 1ULTA 4Z5XA 4O4JF 1MZVA 1L4BA 5CHEA 1P1IA 1EX1A 2O9JA 3Q8LA 1UXIA 1ZONA 4EATA 2E1PA 1FNSA 3MFYA 1SXJA 4NMXB 1DIGA 4KPFC 1ZNQO 3DNMA 5BMVF 4DIDA 4R1SA 2FG5A 1WXWA 4I9GA 4IO1A 5KAMA 3FPEA 2G0AA 4E5YA 2VQ6A 4YV2A 2SKCA 5GZ1A 1HYQA 1M6EX 1RWBA 4JITA 1T0BA 4TLDA 3GCGA 3R4VA 4W7HA 5DHUA 4YXFA 3LI2A 3L6RA 2GAJA 3S68A 3CEAA 1JGTA 1RTKA 1CQXA 1EXVA 4TMZA 3ICOA 1ZRHA 3AY7A 3DZDA 1BOFA 1P2VA 4BKOA 1QK4A 4L9RA 2XV1A 4RQTA 1LEHA 5ALHA 2A9RA 4KBGA 3T4PA 3TRHA 5GONA 3UOGA 4Y6OA 1X0XA 3B3QA 1K06A 3FFAA 4M1YA 3HDGA 3UGQA 2Q1XA 4V03A 2WFMA 4KJXA 5LLTA 3NDJA 4KQ2A 4MB0A 3VSAA 5EE0A 4K1LA 3WFZA 5F3WB 4A5SA 1L5MA 2NTEA 2B4AA 1KMCA 1ADJA 4L3OA 1IXZA 2VYQA 1GNPA 4C78A 1WMAA 3GRPA 4JBIA 5JFTA 1NF2A 4KTVE 4N3BA 5HILA 3SSMA 5I4BA 1KI2A 1VRWA 3QH4A 3BQ9A 1U5AA 4Q47A 4R1TA 1MKYA 1QRDA 4R2JA 3WBBA 4CMAA 3IBSA 2R79A 3HCNA 5NLLA 3A6FA 1HNZB 2DBZA 4IEIA 4F7WA 2J9ZB 5HF9A 3M34A 2JFOA 4RESA 4MLZA 1M5TA 1HSOA 2XITA 3CTPA 4JYZA 2PUDA 3NVAA 1BS2A 1GG9A 1NXPA 2XE8A 4Q00A 3RI3A 4B4OA 1C8LA 5KYKA 2I54A 5C37A 1PKXA 1TTQB 4FHGA 2CVFA 3JPWA 3R3JA 4ZDWA 1NF9A 3RS3A 4X60A 1IHPA 2AOTB 3WO0A 4QD3A 4URHA 4ACAA 3LKZA 1CYDA 4S1PA 4KCGA 1OXMA 4PWYA 1NBOA 5C7YA 2NTYC 1WUKS 1QF7A 4X6YA 4B82A 2OZLB 3VNRA 1ZGCA 1D6MA 1F2VA 2W2KB 3LXMA 4JQCA 2QMOA 3Q2OA 2W90A 1OLUA 3FUXA 2YIDA 1RKXA 3MQ2A 4I3HA 4BFSA 5DHQA 3CX6A 4WCVA 1R0KA 1TCBA 3BFXA 3JWHA 4LV6A 1GP2A 1UOPA 1FDSA 2WA1A 3RR2A 1GA4A 3EAFA 2E48A 2EJBA 3ENKA 4CMIA 2YL2A 1LBIA 1Z37A 4CKBB 4DNQA 1LZKA 4O33A 5D87A 5ADHA 1RP7A 2X8JB 3GYBA 2FQ1A 2QLFA 1WG8A 5ERGB 1E7MA 4C3UA 2D54A 5KQMA 4JFAA 4NFSA 1KI6B 1DV1A 1HEYA 4N49A 4B6JA 3A06A 3OU7A 2WJPA 4RD0A 3TNDA 5EFZA 4II3A 5CB4A 3SY8A 2J9RA 2AEJA 3O47A 4Q7LA 2HHHB 2HQOA 4BPRA 2JAPA 3QMPA 4JSRA 4NZYA 2IX9A 3C45A 2H51A 2VK8A 3ZLUA 2GS9A 3BGIA 3JAKB 3MINB 3T4XA 4C4TA 2ET6A 3WFIA 4WWHA 4OAPA 4ESVA 3ZDAA 2B35A 1P77A 4MIOA 3WBFA 2UZIR 4ZEXA 4PIVA 3WQRA 3ZW9A 5E7MA 1BNCA 2IZ1A 2OXIA 1FFDA 2WNSA 1MO5A 5ARBA 4LF8B 1O03A 2EFHB 2JHCA 1E1YA 3FFTA 4OLHA 1PW5A 3IIMA 3TNFA 3U44B 1ZBQA 3U7JA 3ZBTA 1F2TB 4MTCA 1QO0D 2WIKA 4HDKA 3QQ5A 2OMKA 4J7CA 2DQZA 3ZZUA 1ID8A 4EYKA 3CS3A 4ZDKA 5HUJA 1NNSA 4FDAA 3OEEA 5HA5A 1U1EA 1F20A 3PDIB 4M87A 3L0ZA 1OE0A 2C2KA 3LC0A 3W8EA 4PRKA 4KR0A 3ZLJA 1L4LA 3TD2A 3JCZA 7ADHA 3D7LA 4G97A 3NORA 1A5BB 3G8DA 4PYOA 3K4HA 1TI7A 2HSJA 5T5QA 4EI7A 1VRCA 2GXUA 5I8WA 4LCEA 4QKQA 3LKVA 2PX3A 2ZYHA 4FMDB 4DOMA 2HPHA 4ZI7F 1II0A 1GGFA 2YV5A 5FTMA 3WTCA 4ASUA 2PUHA 1OBFO 1CLEA 1RCFA 2X1HA 1P1BA 3LS2A 4K9KA 4AROA 2YWJA 5GV8A 1E5TA 1MA3A 3GBSA 4KIUA 4OMUA 3X0DA 2F90A 1VMIA 1CKEA 3RFTA 2LW7A 2JAXA 1K63A 3IHLA 4LYFA 4N0MA 4XVQA 3PQ2A 5E3IA 5B58T 3U3JA 3WK8A 2Q4OA 3ZI4A 2NOAA 3SI7A 3QJYA 4GRIA 3BREA 3NC1C 4MUEA 3IDAA 5HCIA 3QVWA 1P91A 4UMEA 5E2BA 2HBQA 4DPLA 1OX4A 3JVUA 4FLMA 5GGYA 1C9EA 4M6WB 1OA1A 3D1JA 5HPYB 3VPXA 3W8RA 2OA0A 4BNIA 5GADl 3B9QA 4C1NA 1XVLA 3ETDA 3TTXA 1D7OA 2MT9A 2Y77A 4YMLA 4ZA2A 1M34B 2P9HA 5FD8A 4WZAB 2OT3B 2HCFA 1U2QA 4J4BA 4OM8A 3RHZA 5TX7A 3AF0A 2DHDA 3UUGA 2Q28A 4R1NA 4AMBA 1FDUA 4ALIA 4KV9A 1DWUA 4YVFA 2FPNA 7GPBA 2Q27A 3GXOA 1J0EA 5BQXA 3ELWA 2SCUA 4WZZA 4QDOA 4AICA 4BLPA 4MRAA 1WCXA 3WGOA 2SICE 4K8RB 1RXSA 4QDUA 3W5JA 1XHEA 1N2XA 4JOSA 1BGWA 1I0LA 2JH9A 3E7XA 3RYHA 3HBMA 1YTUA 1ACJA 3B2QA 3AILA 121PA 1QOQB 2RHCA 4LJ8A 1E0AA 3KYJB 3HO8A 5D85A 3L8EA 5IZCA 2R9VA 4J6EA 3ZYCA 1X38A 1G3QA 4MKHA 3GNLA 2DWUA 1FVOA 2B94A 3E18A 1GU0A 3KOWA 3QE4A 5F76A 4A6XA 4KYIB 3TB6A 2ZZNA 2YOGA 2R7AA 1U4OA 4Z2YA 2A9OA 3BS4A 1GZHB 1WB4A 2Z57A 2ZYGA 2YFQA 4H35A 4H6VA 4BNGA 4KRFA 4MWGA 2CHQA 4ZQBA 2P2ZA 2IP1A 3EGVA 1E1LA 2O2ZA 1BCSB 4DIEA 4Y6PA 3CTMA 3ROQA 4OQLA 1LU9A 4EB8A 3MWYW 4H1HA 4RKFA 4Z8YA 1L8OA 3AQIA 2F3TA 3M82A 1MV5A 2EJCA 3R5KA 4G23A 4RVOA 3W6ZA 2C3MA 3H7AA 3V8RA 1H2ZA 2Y0DA 3CSUA 4B71A 3KJIA 1TLTA 4TUYF 3UT5B 4KWIA 1ZR4A 2QY9A 4LECA 3T15A 1E2PA 1QMGA 2YDYA 3VMFA 2CXUA 2RK3A 5EMMA 4TLMB 5A4KA 3IAXA 4KE9A 1W2HA 3WRWA 5I9NA 4I66A 1UM8A 4BBAA 3GB9A 3P2OA 4ITVA 5T4BA 3WYEA 2DR2A 1ECJA 2W6JD 3KYBA 3LQYA 4IR7A 4KUEA 3TEMA 2VTKA 3TOSA 2P35A 2QU7A 4PXAA 4BC0A 2FMXA 1ZWKA 5K0TA 1NBEA 1QG4A 1Y9JA 1QLJA 1XQ1A 3Q12A 3FTDA 1NQXA 3PUWA 1QORA 5C7IO 1IHDA 4NE7A 2NPIA 4IDPA 4D0GA 3FRJA 2PLFA 2W2LA 4D82A 4S04A 2GBPA 4EA9A 2E4UA 4R3UC 5C35A 5IUNC 3HCWA 4IDAA 4A0HA 1WCYA 3R3VA 5AO9A 2MR6A 3EGXA 3NTUA 4L3VA 4EW3A 4FR2A 3PNBA 3NASA 5D7NA 4K9DA 1SY7A 4DG5A 1BXRB 3VOAA 4RFSB 1BRTA 2JLXA 2JFFA 4RA6B 1CS0B 3OFNA 2A0UA 4B43A 4NFHA 2OFXA 3M2PA 4NG4A 1IUKA 4UM8B 3WE7A 3DVSX 1TO2E 2IYLD 3DZCA 2TMKA 3FROA 3H3XA 3ZQ6A 4QUHA 2ZIXA 4GXNA 1QFSA 5E6RB 5AH0A 1OF1A 3CN9A 3LNTA 1OBHA 3HZRA 1RYHA 1WOMA 2I62A 3V97A 4AECA 2WICA 1JFRA 2XYRA 3NHRA 5CCBA 2VSOA 3RYIB 4REQB 4CQMB 1IBCA 1QIFA 5FPKA 2HMVA 2HJHA 4E30A 1VDMA 4LXHA 4EJ2A 5ERXA 1R5JA 1FNDA 1S8AA 2VKTA 2I3AA 4BMDA 3N8IA 4PNPA 5KTYA 2QRZA 3UFXB 3G6WA 5EMJA 1TYEB 5AHRA 3ADCA 5A3JA 3OCXA 5CDFA 3HFJA 1F38A 4RVNA 5I51A 2HCJB 2X7JA 3ME5A 1BHJA 3FPCA 2LCQA 5FWYB 4QGHA 3I9KA 4HDAA 4ZOAA 4G0YA 4R1PA 4ZO6A 4P7JA 1R15A 5AJYA 1BJKA 2GRAA 2HDNB 3KDPA 5EINA 3KTOA 4ZRMA 2F4NA 2POCA 4CFYA 2R1ZA 3A4MA 2GAAA 3MWKA 3BILA 4S35A 1C7EA 3R3HA 3WLEA 1T0HB 3BAZA 5B64A 5CBKA 2YICA 2LVBA 1O5TA 2ZSAA 4XSVA 3KQHA 1JFSA 3KCNA 3WOHA 1ZIDA 2BTQA 1UP4A 2JEOA 2WINI 5C7LO 4MRNA 1XTIA 4ZV7A 3U48A 4D9IA 2UUCB 3GDOA 3LZ6A 3Q3HA 5DRYA 3RFXA 1JQLB 3A3NA 1Z16A 4HGRA 2OFOA 1PZNA 4KPUA 4B4UA 5HUHA 3LO8A 1RAHA 2Y9MB 3K72B 4F85A 4FMCB 2YQ5A 1WMSA 1FZQA 5LQSA 1Z6TA 4DXDA 2XWQA 3AUJB 3JD2A 1OWOA 4MULA 2VAXA 4U9UA 2PU7A 4PNZA 5JJ5A 1NKSA 3UV6A 4IHKA 4JCOA 3EMKA 4KGZA 4BQPA 4LDPA 4IVRA 2FFQA 2CYAA 3MJRA 4GM4A 3IAUA 1XKTA 2YV4A 1RWXA 5BW6B 4JIMA 4KI0A 4NONA 5TT1A 1XZIA 3RU7A 1IG3A 1V6AA 2IYWA 1P1JA 4M83A 5KTPA 4IIDA 1R5NA 2AN1A 1Y1SA 1U2GA 2LIPA 5CMLA 2ZKIA 3RTGA 3VR0A 3WJ7A 2XUDA 2XAUA 2UKDA 3MPOA 4YMSA 3EP5B 5JZOA 3FJYA 3A14A 4H16A 4I50F 3RF7A 1RJDA 2XKJE 5GPBA 4C7JA 2CZCA 1IOWA 1VRVA 3LIIA 4W5WA 2IEZA 1ND5A 4IDGA 4PVCA 1BIFA 4XDZA 5E1MA 4F71A 3G2JA 3QXHA 4AN0A 1KDRA 1MF7A 4LC1A 4P7GA 1SA0A 4OM7A 4R7TA 1RJFA 5HS6A 1C5KA 5WRFA 3SEZA 1XD8A 1G21A 3QUTA 1Q6YA 1KYQA 1T5HX 3PDUA 2BGKA 1MEEA 4O4HA 4Z0TA 3R76A 2CFTA 3N76A 2WFAA 4KNVA 2CFOA 4JVNA 4LF7B 3QVXA 2GDZA 1DTSA 1N9GA 4CQLA 1AG9A 3M5WA 3UAZA 2DR3A 1X9GA 1OI4A 2C9MA 5DGHA 1JI0A 1L5ZA 2G40A 2KWIA 2CLDX 2XGGA 1DBRA 3CPSA 1HKUA 2Q9CA 2BMVA 2KE5A 3COSA 4JZKA 4P7KA 3WXBA 3GLKA 4C14A 1BKDR 5H9VA 4GSKA 4GHWA 5TT0A 2BZ0A 4H0NA 2VS1A 4W9RA 2VWPA 4RIHA 5JDIC 2PWBA 2HIMA 2VDQB 4XTCS 2CYCA 3KKOA 1GLGA 2YH2A 4U2DA 3QF4A 1KH1A 2R60A 4DUGD 4KP7A 3VGPA 1D9XA 5YASA 3VSEA 2PG3A 2VHZA 2FN8A 3R3YA 4EAAA 3OFJA 3K73O 5ALOA 1XN1A 3ECAA 1GDTA 5LP6C 5DOZA 1T6XA 1XK7A 5EJ6A 2IV3A 2GARA 3H1AA 1S1CA 2OQ2A 3F78A 3FVQA 1VCHA 4K2AA 4PCLA 4BNTA 1S3GA 2QMUA 4WHMA 3EOZA 2QV7A 4IP0A 4RJKA 4FB4A 1SULA 2J9FA 4E15A 2O5EA 2Q46A 1OAKA 5JSZB 4IHJF 2PD6A 3BEDA 1SHTX 3GJ6A 2BEVA 3HL4A 3P9RA 4L4UA 3EBLA 3LVQE 2ICAA 5BUQA 1VE9A 3G9TA 3VJKA 3ORQA 1YZVA 1LV7A 2J3KA 2HA3A 2RGAA 3IMKA 4JOCA 5DX8A 2QBYA 2H7XA 4M1MA 3QJGA 2JI7A 3O3OB 5ICFA 5K0NA 2J5BA 1M76A 3TL3A 3O92A 3EIOA 4MKGA 2MSCB 4LN1A 3FYCA 3ZHXA 4BLUA 4KX5A 1GRQA 2GPWA 5MN5A 5EIFA 3J81A 3DNPA 2QRGA 5SZHB 2QORA 1V26A 1QX4A 1VKJA 3H8JA 5HKLA 2G07A 1Z13A 5LB2A 2VF2A 4NS4A 1L0BA 5K8LA 3DDWA 3EZ9A 2GD2A 4M38A 3TXYA 2AW5A 4GR5A 9LDBA 1U8AA 1QO9A 3T4EA 3KZNA 4ZWNA 3TTWA 2PYDA 4W5JA 1NG1A 2ESRA 5SZKB 4FX2A 4Q4JB 3VOTA 1Z6ZA 2BGMA 1XMPA 2O2YA 1WVIA 3GA5A 1V41E 4L9AA 1SC3A 4NCIA 1UR5A 1H05A 3EODA 5ICSA 2F43B 4I1VA 2DWQA 1JQEA 4LRYA 2ZUBA 4FDTA 3VKWA 1QFZA 1RWMA 1NFRA 3CZ4A 3MGCA 1YBFA 3OQJA 5TQ2B 4DZTA 4E1BA 2FWNA 3D5QA 3CINA 3PUHA 5ICGA 1O0SA 4QE3A 2DKNA 5FRDA 4UTRA 2AV6A 4X7MA 4AMGA 4BPBA 3CSDA 1IBRA 2R4UA 3AGPA 1RHQA 3RSLA 5KEIA 1TA4A 5DNDA 2C4TA 2DCMA 3PEFA 4F4FA 3G6KA 3E7DA 3CYFA 4KDFA 5HMLA 1RABA 3ZZMA 4GEGA 4Z0PA 4RSRA 1CP3A 2V59A 2ZRAA 1VZ2A 4M0PA 3GLIB 1IXYA 1V35A 1YR8A 3IUSA 2CLEB 2JFWA 2V6IA 1YOBA 1PLKA 5JAUA 5DNCA 3HJUA 1YQGA 2Y66A 2PPLA 4AT1A 4C4OA 2MMGA 4P4NA 4DLRA 3IJEB 2ZUUA 4MWCA 2Z3VA 3VMMA 4JBYA 3RSFA 1Q7EA 2OBNA 4MQ4A 2D1QA 3V6MA 4G0WA 1GNTA 2VWQA 4L27A 1CDEA 1VE1A 3CLHA 3ISVA 4EFLA 4HEJA 5KNBH 3K9LA 4YNBA 1GARA 4EB0A 3L6EA 4JQSA 1E4EA 1PZHA 4MGYR 3T7JA 2P67A 4E3ZA 1QQTA 2HSWA 3RWBA 3MHPA 3WJAA 1I7CB 1L7MA 1QLWA 1K9SA 2FHPA 2IELA 3RAPR 4AXBA 2RB5A 2P2LA 1IMJA 4BE9A 3QWFA 1ZP6A 1I1OA 2G1PA 1OLXB 5IYZF 3UPDA 3SOZA 2ENUA 2B0CA 2HU2A 2OORC 3KV1A 1INLA 1OIXA 4N39A 2VYND 2R1VA 5EZYA 1CEQA 2OYCA 4P31A 4UHJA 3D43A 4EY4A 1R4ZA 1JPUA 2O7RA 4N3GA 1QH8B 4C3ZA 3K1AA 3NOVA 16PKA 3EWIA 1H5QA 1L8QA 2VPPA 3C48A 4RMGA 3VDRA 4XUCA 1JKFA 4TTQA 4XQGA 3ANXA 4CM8A 1SQ0A 1HNXB 4H0FA 3TRFA 2SBTA 1P9WA 5EUMA 3BMOA 4D46A 2OK8A 3DQPA 3IGFA 2FPWA 2WTNA 2H4FA 2ZAGA 2D5AA 4WGGA 3C6XA 4RS3A 2HF8A 2D1RA 4WNIA 4CLEA 2BCEA 3ASZA 3DCNA 5LDGA 4HPJB 3UW3A 3VRHA 3ZJ4A 5JVDB 4TYPA 4NYMR 3KZXA 2W37A 3B2NA 3P5BA 4IQGA 3AR4A 1CY6A 2Y1WA 3PNMA 3TOZA 4KR2A 4EF6A 2QTRA 1U3VA 3UYKA 5IC4A 5DM70 3I5MA 3QFCA 3AF3A 4UCFA 4YJ3F 4G1EB 5K4GA 2R6ZA 5B1SA 5I9SA 3U7EB 1T4BA 4DR2B 1PD0A 2ZYWX 5JUWA 1B1AA 4LNAA 4YP5A 4DLYA 1XJQA 2N47A 4PCUA 5LOVB 2WIDA 2ZVDA 1BCRB 2HXSA 1W46A 1I2ZA 1Z56C 2FUCA 1HKHA 1NBMA 2H1WA 2A0XA 2WV7A 4II2A 1N3YA 2H2IA 1T5LA 2PX6A 2VF7A 3ZZNA 3SC3A 2AE2A 4EHFA 2M1XA 3GAMA 3B13B 4NICA 1NZFA 4C0AC 2DFVA 1XXHB 3O4RA 3Q15C 2X40A 4IF6A 4E5DA 2IY8A 3SR3A 5A7HA 3T5BA 2Y0EA 4IDQA 3ZY2A 4Y2SA 1VCOA 4D96A 4L85A 4XWOA 4CM4B 2PGXA 1ST2A 2QWXA 2NO0A 5LA6A 1W75A 2HCTA 3A2LA 3OQIA 1Q20A 3FOZA 5M5BA 1U8FO 5FI5A 2VUTA 3G8BA 4HWSA 3DFIA 3F73A 4P4SB 1GPJA 2GEKA 2XEDA 4M88A 3TR5A 2QSJA 3FSGD 3H11A 2RCNA 3R40A 5CGZA 2CUZA 4JXXA 4UFOA 4NNOA 1O8BA 3B3GA 5H68A 2W8BA 2AEMA 1Z5WA 1YNOA 4LX0A 4Y7DA 2PH7A 2NU8A 5TS2A 3WIUA <