3K2BA

Crystal structure of photosynthetic a4 isoform glyceraldehyde-3-phosphate dehydrogenase complexed with nad, from arabidopsis thaliana
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase (isoform A4) from Arabidopsis thaliana in complex with NAD
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
total genus 106
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F, G, H, O, Q
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3k2bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k2bA01
1VKNA 2UYYA 4N5MA 1B16A 5BNTA 1GYQA 1M66A 2Q1TA 2YYYA 2G1UA 1R16A 2NVUB 3RUEA 1JLLA 4JGBA 4CMGA 4XYMA 1HZZA 1Y9EA 1TXGA 4FW8A 3FN4A 3WSWA 1E6WA 3EVNA 1EDOA 2FSSA 4IUYA 4FOOA 4N18A 1BXGA 1HEUA 1ADCA 1P0CA 4NJMA 2VYVD 2EJWA 4R16A 4TVOA 1LC0A 4F45A 2VHVA 2RHCA 4P38A 3TF5A 1XQ1A 1LEHA 2HKIA 2W2LA 3IS3A 1P0FA 1QV6A 4GWKA 4PG6A 1VRWA 1DIBA 1TT5B 1U8XX 3ZWXA 2YFHA 4W6ZA 4ALIA 2GSDA 2SCUA 1BRMA 1SMKA 1UXGA 1ZK2A 4L8VA 1IB6A 5TSDA 1PR9A 1UDCA 4AJ4A 3EVTA 4R1UA 1EE2A 3RI3A 2CFCA 1BHSA 1DJNA 4XGKA 3E1KA 3DDNA 3R0IA 1N1EA 2VZ0A 5CG2A 4PRLA 4QO7A 4UREA 1RM5A 1JN0A 3C1OA 2B5WA 4IY1A 4QQRA 5T8KA 1M6WA 4PLYA 4BO6A 2PLAA 4YT2A 4WUVA 3FNFA 5KVQA 3VAZA 4HADA 1JW9B 1GV1A 4WCFB 4YYZA 2X0NA 3DZHA 1Z6ZA 3H2ZA 5L7YA 1U3WA 3MTGA 1GCUA 1UAGA 4GMGA 4P4GA 4GPD1 2DUUA 1LSUA 2Q45A 5COQA 2A94A 2JHGA 3T4EA 1GPDG 4EI2A 1NYTA 2GN4A 3RBZA 1VM6A 2YDYA 4OXNA 2VZ9A 1YB5A 3O8QA 5EPOA 1KEUA 4O5OA 4RQUA 4RF5A 1HT0A 3JQAD 4R3NA 1PGOA 1UP6A 1VL8A 2PZMA 3A06A 1X13A 4PZCA 4OSPA 4L75A 2J3JA 3QRWA 2EGHA 2X22A 1DB3A 1E3SA 2WWRA 1HLDA 2BFMA 1WMBA 1NVGA 3L6DA 1UR5A 3ZGYA 3UCFA 1ARZA 2OP1A 4RDHA 1LU9A 4WLVA 2Y1DA 3IKVA 4S3MA 2XXBA 2OOSA 2F1KA 3QLJA 4XGNA 4XRGA 2WE8A 4D41A 4WASA 4HFNA 1XU9A 3OJ0A 3PZBA 1HETA 3GR6A 4FFMA 4BIIA 2C20A 1KEVA 4J7XA 4AVYA 4LGVA 5A05A 1E7QA 3I9NA 3CZMA 9LDBA 3FBGA 1T2FA 3BMQB 2VHZA 2E4AA 3FWNA 4RGBA 4BNKA 1U9JA 1XCBA 3GVCA 1B8VA 1MXHA 2W90A 5CG1A 2R00C 4WECA 4E3ZA 3LT0A 5CFZA 2A9FA 1T2DA 4L4SA 2PH3A 4OQZA 4JBIA 2I5PO 5ADHA 5CPBA 4DL9A 4B7CA 3V8BA 3WFIA 1ISGA 4J2HA 3R3JA 3DHYA 1HWYA 3GDGA 3MJCA 1XR3A 4KDFA 4GVLA 4XQEA 4AJEA 3TOXA 2CY0A 5G2OA 4RLSA 4BNMA 5BSGA 1P1JA 3JSAA 2X9VA 3ULKA 4A26A 1U28A 1SAYA 3DAGA 3B20A 1E3WA 4ZRNA 1QRRA 3EHEA 1PS8A 3QVTA 1EUDA 2GRAA 2FPPA 3JQ9C 4OOFA 3BMNB 2X9NA 4GKVA 4OSOA 2DM6A 2VRCD 4PZEA 4FB5A 2B83A 3AM3A 3LU1A 4IIUA 3S2GA 1AE1A 4Q9NA 1JKIA 3V1YA 1DOHA 1I24A 4J4BA 4BNJA 2PH5A 4R9RA 1KETA 1Q0QA 1K5HA 2Q2WA 2ZB8A 4FR5A 3OMLA 1YO6A 1H2HA 4TVBA 4QSMA 1HZJA 2FRDA 2HK9A 4YA6A 3CMCO 4B3JA 2AE1A 2PK3A 5JDCC 1ZBQA 4BO5A 3GDOA 4AJOA 3O9ZA 1ENZA 2H5LA 3C85A 4PLTA 3IAHA 2CVZA 1NQOA 3NEPX 4DQUA 4CR8A 3DMTC 4PLGA 1SCUA 2JAPA 4CM3A 1A9ZA 2PKQP 1PQWA 2VYVA 1CQJA 2GD1O 3BHIA 4AJ1A 5KJCA 3OJFA 4NR0A 3E48A 1V0JA 3DAPA 4DXHA 3NTOA 3G79A 4EEZA 1J6UA 2NWQA 2FR8A 1I3LA 5CHEA 3E82A 1ADBA 1JU9A 4K1LA 2X5JO 2O7SA 4H7PA 4NFHA 1KVQA 1HDCA 1KIFA 1LJ8A 3E9MA 1Y8RA 5JNLA 1XLTA 5KJEA 4P4LA 3UKOA 2X8LA 3D4OA 4ZQHA 5JYEA 1QP8A 3P5SA 1PQUA 3PDJA 2LDXA 4J7CA 1NBOA 4R9SA 3DHNA 1KC3A 1MX3A 4YAIA 2EKPA 2B0JA 5DBIA 4QO8A 3RAJA 5A5FA 2Q22A 4G81A 3RUDA 4LCJA 1C3VA 4BB5A 3NTRA 3WDSA 3HFSA 3FBTA 1LQUA 3GRKA 4Y8VA 1RYEA 1PJCA 3H7AA 1P3DA 2JFHA 1HDRA 4NH4A 3RCBA 3TL2A 3W4JA 3NAQA 3Q1LA 4XYGA 1AXGA 3U4CA 3W6UA 3GY0A 1W8DA 2XAAA 1DRWA 3SXPA 3DZGA 1M67A 4KOAA 4WLFA 3AJRA 3FTNA 4JQCA 3WJAA 1PL8A 2GN6A 1NTOA 1JKFA 4XGIA 3AUUA 2GN8A 1ISFA 2Y67A 3MCVA 5CPFA 4ALLA 1B14A 4U5QA 4YR9A 1JWBB 4ONEA 1BDBA 4XWYA 1OMOA 2BH9A 1R66A 1RJWA 5F5LA 4L9RA 3D3WA 2J3KA 2EW8A 3IUPA 1DC5A 4JJFA 4B79A 4DLBA 2AMFA 4AICA 3HJAA 1MA0A 4TROA 1Y9AA 1HDOA 5I7SA 1PWXA 3JYQA 1B2LA 1NQ5A 4FIZA 3ZWCA 4PG7A 2YQ4A 3TZQA 1A71A 4OAQA 2J8ZA 4BO4A 4DGSA 3UXYA 3F5SA 4I5DA 1ZEMA 4BKPA 4BNXA 5B4UA 2HJSA 5C3MA 3IDSA 2JFGA 3DBLA 3NGXA 1E7SA 1NM5A 3HB4X 3ZH2A 3W4IA 3TZKA 4C4OA 3PWSA 1B8UA 4DYDA 3DOJA 3C7DB 5TS3A 1UJMA 2O50A 4E21A 1OI7A 2Q99A 4BNZA 3D5TA 4Q3BA 5ICSA 1FMCA 2IZ1A 5KNLA 4AJ2A 5T73A 3KRTA 1U2GA 4ZA2A 3WICA 2HK7A 3NKLA 5EIOA 2X5KO 2EF1A 4OGWA 4KP7A 4UEOA 1A4IA 3DBRB 1YDWA 3DC2A 3KTDA 3PXXA 1BWSA 7MDHA 1BGVA 5ES3A 4Z9XA 4E5NA 5K9ZA 3G0OA 5IJZA 3GGPA 2JL1A 5DT9A 3I9KA 1I36A 3MWDB 5DBFA 2Q46A 1V3TA 4NBRA 4U0KA 3EDMA 3PJDA 1W73A 4OXKA 1IOLA 1HL3A 4CMHA 4XJTA 1WDLA 1LLQA 5IZCA 2J5KA 4WKGA 5CEJA 1I32A 1A7KA 4YDRA 1DO8A 5DBGA 1ENYA 3HN7A 3JQ8A 2V6GA 1EBFA 3NRCA 4FFNA 1AUPA 2VTEA 1E3EA 3E5RA 3W8FA 3K73O 1YH3A 5B37A 1HYHA 4CR6A 5AXBA 4G5HA 3WYEA 3CINA 1A4UA 3AM4A 4IZIA 1ZH8A 2FOIA 1HF3A 4NMHA 3PHHA 1O0SA 1PR3A 4ROSA 1YBMA 1ADGA 1U3UA 4BB6A 2IDZA 3CUKA 3AY6A 5K0ZA 1GEEA 4XCVA 2ZKLA 3I5MA 1O5IA 4YCAA 3O4RA 1AN9A 1HSZA 4IINA 4NDNE 2Y68A 2AHRA 1I8TA 1V8BA 4BNVA 3A4VA 4P8RA 3ZW8A 2VTDA 3F4BA 1E0DA 5COAA 2WTBA 5M6DA 4LN1A 3TPCA 1XYGA 4WNCA 1GCOA 4GVXA 3SVTA 3IMFA 4GBJA 4MOWA 4Q3AA 5LDGA 2Z5LA 5GZ1A 4IQ0A 2C54A 4CMJA 3MEQA 1QG6A 4YEDA 3G49A 1I5RA 3IC5A 3JQ7A 2NQTA 1ML3A 1YBAA 4CLOB 5EL0A 3EC7A 3TFOA 2O3JA 1Q7BA 1ZXBA 3M2TA 1NR1A 1OC2A 3VPFA 2UUPA 3F3SA 5L45A 3DFUA 4I8XA 4J2OA 4J90A 4JBGA 1SPXA 2PTGA 3C24A 2WEKA 3HDYA 1BG6A 3L4SO 1SEPA 1O95A 1N7HA 1ZMOA 1NPYA 1GZ4A 2DQ4A 3HSKA 2YHIB 1T26A 3GZ4A 4OL9A 1S7CA 1B8PA 2R6JA 4PLWA 4NNJA 3VKVA 1PJLA 1FDWA 4WLEA 4U0JA 3ROKA 3LSYA 2O3QA 3KBOA 3JQ8B 3PQDA 3GUCA 3QWBA 1NAHA 4J0FA 3HHPA 3BTOA 5DZSA 5CDSA 3CIFA 2QX7A 4HFJA 2ZYGA 1OZAA 2NLOA 3AOEC 4OKIA 5T5QA 4CUJA 2CF5A 4JIGA 3PZRA 4JXKA 4R41A 3BYZA 1LTHR 4DIBA 2ZTUA 2I76A 3F4LA 1W0CA 1I0ZA 1PS0A 5JAQA 1H2BA 4OO3A 4LRTB 4N7RA 5IDYA 1V35A 5A9RA 1KC1A 3WXBA 3PVZA 1LDNA 2GYYA 3V5NA 2EV9A 3EW7A 5JY1A 4W4TA 2EKQA 3CXRA 5IDXA 4F3YA 4PRKA 2DT5A 2CSUA 2H63A 4RPHA 3H9UA 5IXYA 3I52A 4ZHSA 3CE6A 4PGFA 1D3AA 4M54A 1MV8A 2Y99A 2GZ2A 4CQLA 1R15A 2C82A 3JQBC 3JQGA 9LDTA 1R4NB 3WWZA 1P33A 3VH4A 3L07A 3OECA 1U3TA 3BMNA 4R1NA 4JK3A 2I3AA 2JCVA 4II3A 4Y6PA 4Q3EA 4DMLA 1ZK4A 4W9NC 4XYBA 3QVOA 4L4RA 3GGOA 2QYTA 5BT9A 4A0SA 1MLDA 4D44A 2V6MA 4BO0A 2PZLA 2Y1CA 3DFZA 4JBHA 5KVCA 2R00A 3BIOA 3MOIA 3JYOA 4JJGA 1TB4A 2A92A 1P77A 1XWFA 2CDBA 3G17A 3MZ0A 1YXMA 4XJSA 4RORA 1EEHA 3ZWNA 1N2SA 3ZNOA 2PGLA 1Z7EA 1BDMA 1T25A 4J7UA 4R54A 3EMKA 4NG5A 1BSVA 3BHMA 4F6LA 3U3XA 3ONFA 2IXBA 2OZPA 2PZKA 3GHHA 3PK0A 3OA2A 3KUXA 2RCYA 3UCXA 2HQ1A 4K6CA 2XOXA 4O1MA 1GU7A 1O94A 2DBZA 1MG0A 5G0TA 4LW8A 3VPHA 3GC6A 1GTMA 3HZZA 1QV7A 3GVHA 3VZSA 2Q2QA 2QYSA 4AG3A 5KIAA 1YDEA 3DMYA 4KQXA 1IPFA 3C8MA 4IDEA 4YQYA 2AEJA 3Q9NA 3RSHA 3IIEA 4E13A 2Y1GA 2P9GA 3E9NA 4HX5A 4DBZA 1PGNA 2ZTVA 1NQAO 4MJLA 1Q2XA 1D1SA 3E18A 1LDMA 2UV8A 4WLUA 4BO8A 4BO9A 5G0SA 3CTMA 3NDRA 4URFA 1VSUA 2JAHA 2ZJ0A 3AOEA 3ZV5A 2C2XA 4IIVA 3G3EA 5J9GA 4KZPA 4BNUA 4RZHA 3T4XA 4HWKA 2FR1A 3HWRA 2E6UX 2VUSA 4KMSA 1F8FA 5H83A 1HE5A 3Q2IA 3S1LA 2X7HA 2FSVA 3ANLA 4Y6RA 4DC0A 1P1FA 4NBUA 1EVYA 1I30A 1UXJA 1PWZA 1EE9A 4II2A 3U49A 2GO1A 2GERA 3BZUA 3GVXA 3HQ4O 1EQ2A 4CM5A 2Q49A 4PVCA 1A7AA 4ZQGA 2ILTA 3KXDA 5TNXA 4BGUA 4CLHA 2GNAA 5JMWA 2HMTA 2HDHA 2AQKA 1X7HA 2WJPA 3GOHA 3RU7A 4R01A 2YV2A 3NJ4A 4LVUA 4MVJP 3I9MA 1N9GB 5JCJD 3FCOA 1Z7BA 2RIRA 3CH6A 4ND2A 5GY7A 1ISIA 4PLHA 4BNLA 4D42A 3I23A 1C1DA 4YJHA 1PU2A 3ZNNA 4AJHA 5F1KA 4BGVA 3VPXA 1LBEA 2PV7A 1UZMA 2X9GA 2D3TA 1PJSA 4E2WA 5L40A 1TI7A 1DFHA 2D59A 3I3OA 1QR6A 1YVEI 2B5VA 2XF8A 2H9IA 2W2KA 1CYDA 3ZU5A 2V6FA 1VJTA 2BFPA 4IJWA 4HFRA 3TRIA 2YHIA 1PL6A 1MB4A 3GNSA 3FRJA 3BTSA 3KHUA 4CV3A 4YBZA 2A35A 2RAFA 1N9GA 3LQFA 3UN1A 3VTZA 2Y1EA 1LNQA 5B1YA 3OETA 5DULA 4BKRA 1ZSYA 5CDYA 3HNPA 1MXFA 4I5FA 1CIVA 1EVIA 3GDFA 4MVJI 3ZWBA 3RIHA 1EUCA 5U4QA 3PTZA 1LSJA 3CKYA 3WOHA 3JYPA 3I4FA 4J1SA 4E12A 2BLLA 4CLOA 3DBVO 1Q7CA 4OIMA 2O3UA 2JD1A 4FCCA 4EITA 2BI7A 3BTUA 1IZ0A 2Q50A 3KSZO 4RVSA 3ANNA 4ZQBA 3U09A 3R6DA 3WGOA 3ZDFA 2GDZA 1N5DA 4P4NA 4ZQFA 3RD5A 2P5YA 3EZLA 4WK6A 3OP4A 1E7RA 2WM3A 1XKQA 2AA3A 1ZZEA 2NU6A 3K31A 5FI3A 3TDKA 1DFGA 1HYEA 4IM7A 1JDJA 2AEMA 2RH4A 3A28A 2PFGA 3OIDA 4IDAA 2P5UA 3INTA 3WNVA 3UAGA 3BMOB 3S55A 3LYLA 4BMSA 4O6VA 5G4KB 1ZSVA 4BQRA 2C29D 3S2FA 3GEMA 1U5CA 3QJ5A 4J9VA 4NK5A 4XA8A 5DN9A 4Y9DA 1ONOA 5DF1A 1KVUA 4F46A 5JC1A 1WXDA 2GN9A 3G1UA 3V2UA 2P2SA 3W1VA 3SBOA 3ASUA 5JCXA 4I5GA 3WQQA 5IZ4A 2X86A 4CMIB 4OH1A 2Z95A 3RC1A 2H6EA 1I3KA 2FHSA 4E5YA 3LT4A 1QYXA 1V6AA 1WDMA 2CVQA 4XYEA 1LUAA 3D64A 3MOGA 1FDSA 4BMNA 4OMUA 5IZCC 4EUFA 5KJ6A 1DC6A 3SC6A 4R5MA 4QX6A 1GZ6A 3LT2A 2FZEA 3L9XA 5EERA 4E31A 1GFSA 2NNLD 4TMFA 1U2DA 3RKRA 4GSKA 3BAZA 3D7LA 1I2BA 1K6JA 1XIVA 2X4GA 3F1KA 4BKOA 1IY8A 3TSCA 3GF4A 1GQQA 3L6OO 2GR9A 1PQPA 5ENVA 3WMXA 4NI5A 3VPSA 1NHWA 3ROMA 1K0UA 1DAPA 4UVEA 4B8ZA 4CQLB 2POQX 4J6FA 2AQHA 4CR7A 3U4DA 4CV2A 2YHUA 3H3JA 4RPKA 2HSDA 5A04A 1ID1A 4Z0TA 3ZWAA 1ZNQO 1SB9A 1CETA 1Z75A 1BW9B 3FWZA 1QLJA 3R1IA 4JCOA 3RU9A 1V3VA 3ZU4A 6LDHA 1RM3A 3LC1O 1P45A 1CQIA 1EDZA 2FMUA 3LDHA 4JJIA 3AI2A 3WSVA 2O23A 1QKIA 1YQDA 4HP8A 4Y6SA 3PYMA 4EUHA 4BNGA 4IQGA 4CLEA 3I4CA 3A1NA 3LT1A 4JROA 1JA9A 4Q39A 1YBVA 4D43A 4CM9A 2YV3A 3F5QA 1F14A 4IJKA 2I66A 4EBFA 3KLPX 4FBGA 3F46A 3AY7A 3GNQA 3HN2A 4BNFA 4IMPA 5FFFA 1SBYA 2EWMA 4CLRB 1U8FO 3GPIA 3DTTA 1JQBA 4CM4A 3U4IA 4HFMA 2J3HA 5A4DA 5BQFA 1MUUA 2EP7A 3PHJA 2OBNA 2C5EA 1I33A 4RF2A 1GYPA 1Z45A 4INAA 1ZSNA 4KQWA 3KETA 2FN7A 1U7HA 4OJNA 2X6TA 1DEHA 4B4UA 1VJ0A 1HE2A 4RJTA 5H81A 4MINA 3ADOA 1DAOA 3RQSA 1WNTA 1ZIDA 4YTEA 5JO0A 1A27A 1YKFA 5L51A 1Y81A 4HY3A 4NBWA 1UP4A 3A14A 3SEFA 3P7MA 4L74A 3BHJA 2C07A 3PLRA 3GN2A 4MVJF 4RVDA 3RUFA 5U9CA 1GEGA 1C0LA 3AY3A 4GQAA 2ZQZA 3H2SA 2AEFA 4U6SA 3QWHA 3L6EA 3OQBA 4XKJA 1L7DA 1EVJA 2J3IA 4CMKA 2X58A 3KSDO 4A10A 4JLWA 3DTYA 5KVVA 4D0RA 1DHRA 2AQ8A 3D1LA 4E33A 1KOLA 5JC8A 1VC2A 4BNHA 3KO8A 1AHIA 3I6IA 1E3JA 3PHIA 1RM4A 4G65A 5JMPA 3ORFA 3DEYX 5CDGA 2ZQYA 5THKA 2BHLA 2Z1NA 2ZIZA 3WTBA 4RZIA 1PIWA 4ALJA 2AQIA 3GRPA 4E2YA 3GPDG 4IDCA 4FFPA 2JCXA 4YXFA 5IG2A 2Q1SA 2ZATA 3JQFA 2D5AA 1YL6A 3FI9A 3BMOA 4MVJH 1N7GA 2I67A 3GG9A 4E4YA 1CDOA 5I7VA 3GK3A 5ICMA 4A03A 4MVJG 4YT5A 4A7PA 1Q0HA 3AUAA 1K3TA 1LI4A 1Y7TA 3ABIA 4YQZA 5LC1A 4CV0A 2CVOA 1LSOA 2X0RA 2HK8A 4OHUA 3IP3A 1RPNA 4GGPA 5KKAA 3QWIA 3TJRA 1X7DA 2Y05A 2FP4A 3KSUA 1HLPA 2NU9A 3TZ6A 4ND3A 5ER6A 2O3SA 2I65A 3VPGA 4JN6B 3Q0EA 3CMMA 5AOVA 2BRUA 3DMTA 1QYDA 1ISHA 1NHGA 1PZFA 5F1PA 4TKLA 3X2EA 3VTFA 5A5EA 5FF9A 5ENDA 3DBRA 1DSSG 3SC4A 3ON5A 4DMMA 1OFGA 2DFDA 4RVUA 2GCGA 2IODA 2NTJA 1PSDA 2VZ8A 4WOJA 3WYBA 2YV1A 1Y6JA 4NFYA 4L73A 4DIOA 2ZYDA 5T64A 3GNTA 1NNUA 2BI8A 3KOUA 2ZCVA 2Q3EA 3T7EA 3STHA 2R2GA 3ST7A 2GASA 3F6YA 2VWQA 5LCXA 3FR7A 3ANMA 3TZCA 3V2GA 3SLKA 3FF4A 1DIGA 2JCYA 3QP9A 4IGFA 5CDUA 3OHSX 1UZLA 3MWEB 3PJGA 1HYGA 2VT2A 3AFMA 4FFOA 4QTZA 4WGGA 1WZIA 4JNKA 1ENOA 1YOVA 3ZWOA 3DQPA 1PJTA 4NBTA 3P2YA 2VWPA 1P9LA 3K30A 3LVFO 5I7FA 4D3DA 3BMQA 3PQFA 4BO2A 2Y66A 4TZKA 1N92A 1OOEA 4A5OA 3BTVA 1GY8A 3FSRA 2DTXA 5JLAA 1HRDA 3H9JA 4YJFA 2NM0A 4PCVA 1VL6A 3JQ7B 5DP1A 4EUEA 4RF3A 1FK8A 3L4BC 5FWNA 5AYVA 3JQAB 3CPSA 3VDRA 1F12A 4ITUA 5KJ1A 1ISMA 1UXIA 1YB4A 1SB8A 3WIEA 1DIAA 2D8AA 2VRBA 2C2YA 3ETDA 4DA9A 3FNEA 3WYCA 4YB8A 2WYUA 1ZK0A 2HMUA 3K6JA 4TRJA 3RFVA 4ZQEA 2VUTA 4K26A 4IDFA 2HMSA 1ULSA 4QUKA 4HXYA 2WYWA 4DQXA 5CEFA 1XGKA 4BNYA 3L9WA 3I6QA 2RBEA 5DCUA 2CNBA 2ZYAA 2GUGA 4B4WA 3H5AA 2EERA 4LSWA 5JAMA 3PI7A 1XQ6A 4QT0A 4GX5A 2TMGA 1R0KA 4FD3A 1H6AA 4BO7A 1U4OA 4IJUA 4KTTE 4U6QA 2HLPA 1JVBA 1PL7A 1Y5MA 5DCWA 5IXSA 3C7CB 3KYDB 1MC5A 1Z73A 4YAJA 3JYNA 1PZHA 2YUTA 3DR3A 1KY4A 3VHRA 4EJ0A 5LDHA 4IDGA 1W4ZA 4N54A 2GZ1A 1YJ8A 2IZ0A 3B1FA 4KUGA 3K8ZA 3KZVA 4NQZA 5THQA 3B1JA 3PYXA 5IDWA 1WAMA 4XDZA 1Q1NA 3I1JA 1K89A 2DLDA 1T1RA 1U3VA 2DTEA 2OGUA 4AJPA 3F47A 1DJQA 3NT2A 2PKRA 7ADHA 1M6HA 4UUPA 4FGSA 1UH5A 3ICPA 3N7UA 1KS9A 3OIFA 1QXSA 3WIDA 3AK4A 3NDIA 1LC3A 1KEPA 1HDZA 3V1TC 1T2CA 1YQXA 4LCEA 1GADO 5EJ2A 3WGIA 5EINA 4H3VA 5J23A 1DIRA 5L9AA 2QRJA 2FY8A 2CZCA 4HV4A 2O2SA 5BSHA 5JAIA 4BVAA 5T6BA 3FHLA 4XR4A 3W8EA 1NFFA 1ZK1A 1HSOA 5FEUA 3ZWMA 1CWUA 2NADA 1H9BA 2NTNA 4Q3NA 1GUYA 3GG2A 3IJRA 4XQGA 3RJ9A 1UUFA 1WPQA 3NV9A 1KERA 2GGSA 4YRAA 4Z9YA 1YL7A 4M8SA 1DRUA 3ZV6A 3WGYA 1UDAA 4PLFA 2HJRA 4Y67A 3ADPA 2E82A 3MJVA 3M6IA 3WBBA 2ZK7A 4ZGWA 1R4NA 4AJNA 4WCFC 4CUKA 2A4KA 2IYOA 5JW6A 1TLTA 2ZB7A 3PGJA 3RBXA 1IE3A 4CV1A 5JXWA 3HDQA 1LRJA 4MP8A 2EP5A 3FNGA 4BNWA 4L0QA 3K9QO 5B4TA 3T7CA 5KKCA 3L4BA 4UVIA 4IQ8A 5ILGA 1GPJA 5JY6A 1LDGA 1NQTA 4MP3A 3QY9A 3WBFA 1IULA 1K2WA 2FWMX 4FSHA 4CMBA 1RKXA 5DDIP 4TRMA 5C7IO 3AUTA 2D5CA 4KUHA 1WWKA 2P91A 3Q11A 2QHXA 1HTBA 1X0XA 1QMGA 3ONDA 3Q9UA 3U4HA 4B3IA 4Z0PA 2NUAA 3K2EA 1QLHA 3PWZA 3WQRA 4MP6A 3WGTA 4IXTA 4P22A 1HE3A 5G0WA 2VYND 5F3RA 4YT8A 1LLUA 1HDGO 1LQTA 4Q3CA 2OORA 1PJBA 4CMIA 5KJFA 1EZ4A 5AQ1A 1WLYA 1UZNA 4CJXA 3NUGA 4FQ8A 1ZO8A 3S2EA 3VOSA 4W7IA 5HTOA 1WW8A 4BNNA 2B4RO 2VUUA 4I9HA 2D4AA 1TVEA 4WNIA 1C14A 1Y8RB 2JD2A 3DAFA 3GFGA 1HKUA 1SZJG 1SEVA 4J16A 4CLXA 1YJQA 2VN8A 3KEQA 5CP8A 4XIJA 2QZZA 2O4UX 2H1SA 3NJ8A 4BGEA 3JD2A 4IMRA 4R4JA 4NK4A 5BR7A 3LLVA 4RLHA 4E6PA 3DZBA 4XQ9A 2Z1MA 1H6DA 1B26A 3G1TA 1EK5A 2Q4BA 3KYDA 4ESOA 5HBRA 1MG5A 4L4XA 2PNFA 1PTJA 3RUAA 2BGKA 2G0TA 4UVGA 1I3MA 1QYVA 2O3TA 2TMDA 3PP8A 4FPXA 5HRUA 5A9SA 5COBA 4RV9A 2DPHA 2EJVA 5CDTA 5JYFA 3H5NA 3WGQA 1GDHA 1K6IA 3D5QA 2Y0CA 8ADHA 2YQ5A 5JPIA 3VKUA 4EYEA 2E49A 2WYVA 1NX6A 1E7MA 1SNYA 2BFAA 5G0VA 2XPCA 5K6AA 4K6FA 5TGDA 3B6ZA 3DZKA 2CDCA 2F00A 3QVXA 3ITKA 3GAFA 1E3WB 4WCFA 1WDKA 3K2BA 1DXYA 3RASA 1ONPA 3UW3A 1YE3A 3QVSA 3FNHA 1VLLA 4Z3DA 5L4SA 2FZWA 2YDXA 1H6CA 4NHEA 2BF7A 2VRCA 1VI2A 3U0BA 4EJMA 3RC9A 3HDHA 4DVJA 2W2LD 4B7XA 4S1VA 2VT3A 3WLFA 1CJCA 1LDEA 3WR5A 1C1XA 2VOEA 1G0NA 1YOVB 4TKMA 3ZHBA 4J91A 4YRDA 2NVUA 3C7AA 4Q3DA 1L7EA 2P4HX 2FPIA 2OUIA 2WE7A 4ZVVA 4EGFA 5FYDA 2Y93A 2PWZA 3E6AA 3DHEA 2PA3A 1NPDA 1J49A 1EBUA 4FOSA 3JQCA 3JQFC 4CLDA 1WMAA 4YPOA 4H16A 1D1TA 3GQVA 1MP0A 1KVSA 3O26A 4X54A 3QA9A 3MJEA 3QVWA 2Y1OA 2EXXA 2J5QA 3ZWVA 4R3WA 3ZV4A 1ZCJA 3IJPA 2GF2A 4AJLA 1ZW1A 2JFFA 4H15A 5AXCA 4PLVA 4QECA 2OMEA 1O8CA 3GGGA 1AXEA 1ZFNA 2AW5A 1N8KA 3QHAA 4ALMA 2GPTA 2JD0A 5A9SB 4EJ6A 4R51A 1ZKMA 2DFVA 4PLZA 2QIOA 2OFPA 1ZJZA 4E2ZA 3JV7A 3VC7A 4BO3A 1GL3A 4B4VA 2VWHA 1EQUA 3JTMA 5F21A 5I7EA 4MPDA 2VHXA 3INRA 1DIHA 3MJTA 3EZYA 4LISA 5G4KA 2BKAA 1YWGO 1E6UA 3LF1A 3ETEA 1D4FA 2G5CA 3EGOA 3TOZA 2YW9A 2PR2A 3D3WB 4YACA 3ASVA 2C7GA 1X15A 4QFCA 3ZWYA 5TF4A 3OSUA 4GX0A 4E5PA 4QXMA 5B12A 2I6TA 4OYRA 1DLIA 4RPLA 4RDIA 4M55A 3SJUA 1PZEA 4PVDA 3S8MA 1B0AA 2C7VA 1NWCA 5HS4A 3ROPA 3R3SA 2ZTLA 2OXIA 5ITWA 3O03A 4RVHA 5I8WA 2P4QA 2DU8A 4ZRMA 3FPCA 3DZFA 2UAGA 5IN5A 1R0LA 3WNQA 2HMVA 6ADHA 1XDWA 4IBOA 4XDYA 1E6EA 2O48X 1VSVA 2ZJ1A 4RL6A 1JKJA 1NFRA 3GMSA 5JYAA 5I9LA 4EW6A 1SOVA 4J1NA 2DBQA 1UAYA 1E3IA 3WWYA 3D3EA 4IDDA 3VH1A 3H3FA 3PHGA 2VNAA 1G6KA 2D1YA 1Y5RA 5ER9A 1NVTA 3KYCB 1C0PA 4GL4A 2Y0EA 5A06A 1DLJA 4M49A 5C7LO 2IZZA 1Z74A 2BMAA 2PD3A 4YT4A 3OBBA 1A72A 4IXWA 3Q6IA 2YY7A 1C1DB 1I10A 4NJMB 3RUCA 3LZ6A 1P74A 3NX4A 1LLDA 5TX7A 1X14A 4LVCA 4MIOA 4GI2A 1XEAA 1ISJA 3ZZNA 4WOKA 5G4LA 3WJ7A 2ZTMA 2VHWA 1LLCA 1R6DA 3EAGA 1IYZA 4TQGA 2HO5A 3LLSA 3DXFA 3ZHZA 5AVOA 1NASA 4OOEA 2Q1UA 4O0LA 4AJKA 2QW8A 2YZ7A 1CRWG 1GR0A 5ILOA 2OHXA 4ZICA 3H8VA 4IGEA 4PG4A 5EN4A 2G76A 4DUPA 3FD8A 4FFRA 4E32A 1BXGB 4WLNA 4BHTA 3LK7A 5IDQA 4MIEA 3H6KA 1C0KA 2IEBA 1ZK3A 3GZNB 4DWVA 3CZRA 4YWJA 3AFNA 4NU6A 1ZEJA 4ND5A 3PLNA 1LDYA 4J3FA 5I8ZA 1O9BA 1BW9A 1YQGA 3F1LA 3PGXA 1NVMB 5HA5A 2O2YA 4O63O 1F0YA 1JTVA 3OICA 4J1TA 4FJ2A 3AOGA 2X5OA 1X0VA 2GLXA 3BMCB 4U8GA 4C7KA 1UXHA 2WDZA 1PJQA 4MVJD 1C1XB 4W82A 1E5QA 2X23A 3LF2A 3OEWA 3WS7A 5C5IA 5BSFA 3LC7O 2GZ3A 1M76A 4XB2A 1SO8A 3OQ1A 3GFBA 4J4HA 4UUNA 2Y0DA 1XA0A 1H6BA 3W4KA 4D7AA 4MKZA 5A3JA 3FPLA 3I9OA 3FR8A 3ZV3A 1Y8QB 2PZJA 4KWHA 1ZUD1 1X7GA 1KY5A 3IKTA 3OH8A 3DONA 1CERA 1DHTA 3DBHB 3KYCA 3ICCA 2UDPA 1RYDA 2IRWA 2NV6A 5JYDA 1F17A 3LC2O 5U1PA 4O59O 1EUZA 3PIIA 3K5PA 1K6XA 1PZGA 3PFWO 4OM8A 3WX0A 4BMVA 3IL2A 1FDTA 2DC1A 1QSGA 2PY6A 4FJ0A 4QEDA 4YJGB 3RKUA 2QZ9A 3JQ6A 3JQEA 4W7HA 3JCZA 3RFXA 5C37A 2YFQA 3H9QA 3FTPA 4M86A 3QE3A 3KB6A 1EFKA 4I1IA 4PLCA 2EGGA 4YAGA 4ID9A 1PGPA 5TRTA 5A9TA 1QORA 2QG4A 3HADA 3NT4A 3HE3A 3TNLA 1FDUA 4GMFA 2BD0A 3IOYA 4CM8A 4FJ1A 5TC4A 4HNGA 1BTOA 1MFZA 4EEXA 4KWIA 4CMCA 2J6IA 5KOIA 3OQ6A 3ZN2A 4LK3A 1EFLA 4BV9A 3E03A 1R4MA 1JAYA 4UUMA 2I3GA 4R1SA 1IPEA 3GVIA 2E37A 3NGLA 5L53A 1P1IA 3HFGA 3OJOA 5TIIA 3JQAA 3BA1A 1IL0A 3D4PA 1XSEA 4FC7A 2WD7A 5KWEA 4WLOA 5GZ6A 1U5AA 4WE3A 5JDIA 2QQ5A 4NU5A 4WEOA 2WSBA 1TEHA 4GX1A 5T8KC 4ZD6A 1NPTO 3WLEA 1GQ2A 4R5HA 1U7TA 3KLMX 4WPGA 5TT0A 4DYVA 4AFNA 3GA0A 2W98A 4J4TA 1I3NA 3W6ZA 3S2IA 8LDHA 3PEFA 3SX2A 3CEAA 1M2WA 1DC3A 3GEGA 3GVPA 4I5EA 2QRKA 3KV3O 4J43A 2J5RA 4D45A 4DIFA 3PJFA 1GUZA 3H4VA 1MC4A 4J9UE 3GLQA 1IUKA 3N74A 3DO5A 1LRLA 3V2HA 1TT5A 3M2PA 4XQCA 4BUCA 1FDVA 2AG8A 1H93A 1SC6A 1VE9A 2HMWA 4UVHA 4PG5A 4PIVA 2IE0A 1FJHA 4GWGA 1EVZA 3PQEA 4RF4A 3M1LA 4CMEC 3H5RA 4Z3KA 3KM0A 4M89A 2EIHA 4YJHB 3MJ4A 3IUSA 3RC2A 4LRSB 5DCYA 1P44A 3UF0A 2PKQO 2HU2A 2AE2A 3TZHA 3H65A 4BGIA 2YJZA 4MO2A 5I9NA 1OBFO 4XRRA 2JJYA 4YAKA 5JAZA 4ZJUA 2JHFA 4CM6A 5HM8A 1A9YA 5K6AC 5JE8A 1RM0A 2DBVO 1M75A 5BNFA 3ZWPA 3QWFA 3ZU3A 1E92A 1ORRA 3UFXA 4E30A 3V1UA 4AJJA 3I9LA 2VHYA 3UVEA 4OQYA 2BELA 1GV0A 4WEQA 3TQHA 4KDEA 3H9EO 2ZB3A 1PJ2A 3P2OA 3AU8A 1B3RA 4RPGA 1FXSA 3ZU2A 4ALNA 4D3FA 3ZHXA 1YGYA 4Y98A 1A5ZA 1XG5A 4DLAA 4DRYA 3WQSB 3JD0A 1O89A 4J49A 4B3HA 4JP2A 1DPGA 1KYQA 2O7QA 1NWHA 5BSEA 1VPDA 1O6ZA 5KCZA 1NXQA 5A1TA 4GLOA 2Q2VA 4TRRA 4Z6KA 3AI1A 1DRVA 3ZW9A 3AW9A 2UUOA 1BMDA 3VZPA 2NVBA 4KTVE 1YL5A 4ALKA 2EKLA 3NYWA 4UAGA 2IYPA 3JD3A 3L0DA 3HG7A 4TRNA 1UP7A 4CQMB 3PIDA 1NAIA 3NDJA 4GH5A 4W9NA 3RWBA 3TWOA 3GHYA 2CMDA 2VQ3A 1BVRA 5F1OA 2EHDA 4NFSA 1FF9A 3I83A 4XYLA 1TA4A 5MDHA 3EK2A 1OAAA 3M1AA 3OF2A 4TSKA 4MVJM 4AL4A 1PGJA 3ROQA 5DOVA 1GD1O 4LMPA 3HDJA 4XZ3A 4RVFA 5G0UA 1CF2O 3QIVA 3H9GA 5T57A 2NSDA 3ONEA 2HRBA 4BNTA 4GX2A 3JQDA 5JDCA 1PX0A 1LSSA 5DP2A 2HCTA 1UXKA 3EUWA 4U7WA 2EEZA 3DZJA 2XXJA 1ZJYA 3AWDA 4I9UA 2CD9A 3SJ7A 4DREA 3ZHYA 4CQMA 3NT5A 1G0OA 3VVBA 4AJIA 2DKNA 4XR9A 2B4TO 4E5KA 1OC4A 4PG8A 2D2IA 4HKTA 4E0BA 4BQPA 2PD6A 3W8DA 1P31A 1RWBA 1S6YA 3AI3A 3HB5X 4A2CA 4CLRA 3OJLA 5A3VA 4CL8A 1H0KA 2AXQA 4XIYA 1I2ZA 1AGNA 4HBGA 3U9LA 3D4NA 4B8WA 1ENPA 2OO5A 1PJ3A 2G17A 3B1KA 3VH3A 3TL3A 4LMRA 3WGHA 3IQDB 4FFLA 3EYWA 1NFQA 4BKQA 5KTKA 1IHXA 1YB1A 3DBLB 4YRBA 1T4BA 1V3UA 2I9PA 1HXHA 2BFOA 2C59A 4K9DA 1E1NA 3ETGA 4ZU3A 2B69A 5EQDA 3P19A 3UGKA 1AHHA 1ZXLA 2NACA 2RHRA 1E1MA 1X1TA 1DDOA 1YS4A 2FR0A 3GAZA 4JX8A 1F06A 1V9LA 4TZTA 4CL3A 2V65A 4YJFB 1U4SA 3OFSA 2C0CA 5IFLA 3MJSA 2WMDA 1ADFA 1WVGA 3COSA 3IP1A 3DZIA 4E2XA 1Z82A 2B37A 2B4QA 1DBVO 2AG5A 1E7WA 3VVCA 2ET6A 3JYLA 1B15A 3GN1A 4HNHA 3B70A 2VCYA 4HUJA 1TT7A 4GSLA 4GLLA 4C7JA 3OIGA 5L7WA 4M1QA 1E77A 4CUZA 5A02A 3NTQA 2WD7B 1P1HA 5GMOA 4E5MA 1X1EA 1E3LA 3RFTA 2VWGA 2NU8A 3PRJA 5C7OO 3UHAA 1NR7A 3KEOA 3C3XA 5I9MA 5L7TA 1J5PA 2OBYA 2W8ZA 2X1HA 5TLSA 4FGWA 4UEKA 1CEQA 5FI5A 1R4MB 3PHLA 4NIMA 3BXXA 5L4LA 1LDBA 1B3BA 3CSDA 3WTCA 4D79A 2NVWA 4MDHA 1T2AA 4EDFA 3F9IA 4YJDA 3WG9A 4R68A 1GZ3A 4CM8B 5TT1A 3RROA 1JAXA 5EQFA 3RBVA 5JO9A 3QWAA 2WD8A 1PGQA 4JP3A 4DTIA 4DC1A 3UCEA 2NU7A 1ONNA 3OA0A 5EESA 3ENKA 3N58A 4QFDA 5BNIA 2Q1WA 3GUYA 3O8QB 1XU7A 3RJ5A 3JQBA 1NP3A 2RH8A 1P1RA 4OKNA 2P9EA 4RVGA 3PWKA 4RPJA 3KYBA 3PFFA 3VH2A 4CM1A 3DOCA 5HWSA 1N1GA 4BV8A 2O3RA 2FPGA 1J0XO 3ZNQA 3K92A 1GAEO 2NQ8A 4FDAA 4EZBA 5GZ3A 1XELA 2HRZA 5AXDA 4ZN6A 3DBHA 1HDXA 2P9CA 5KVSA 3VZQA 2O4CA 4D3SA 3TN7A 3QQPA 1EMDA 3INGA 1LXCA 4BOYA 5TQVA 4ND1A 4PZDA 1KVTA 1ZMTA 1R0SA 2ZCUA 4G2NA 3RVDA 4IZHA 2IEDA 1HDYA 3PPIA 4XEHA 1QYCA 3E9QA 2DBRA 2X0JA 2D0IA 3JD1A 3L77A 1E5LA 1KVRA 5JBIA 2HUNA 5F5NA 1MFPA 3TFQA 1T1SA 1ULUA 2W2KB 1L1FA 2JKVA 3KVOA 2X0IA 1R37A 1VL0A 4CM9D 4MVJA 4BO1A 4UULA 1WP4A 3ZWWA 3A9WA 4N5LA 4BKUA 1R12A 3WGGA 3U5TA 3U62A 5IAAA 5DNAA 3GT0A 3RUIA 3UOGA 4CPDA 4B7UA 4BNIA 1GUFA 1GYRA 1D7OA 4PFJA 2W4QA 3QSGA 4YVFA 5HS6A 4F6CA 4MVJE 2DTDA 3RC7A 1YRLA 2P68A 2BGMA 3ENNA 3C1AA 3JD4A 1E1LA 2PGJA 3BMCA 4J1QA 4UUOA 4Z9FA 1H5QA 5IN4A 4IS3A 4ND4A 3GH3A 1QYWA 2Y1FA 4NJOA 4PLPA 4I9NA 4TWRA 4R1TA 2HAEA 3ZI0A 4NPCA 4PN3A 5EMHA 1EK6A 1PEDA 4CMAA 4J0EA 3DOOA 3E5MA 3RUHA 4FC6A 4XB1A 1I01A 3GZNA 1LA2A 3SLGA 4I08A 1WZEA 5JDIC 4BS9A 3AM5A 1VJ1A 2CUKA 1E1KA 3DL2A 4WCDA 1H9AA 3QV1A 5T67A 3GMDA 4DPKA 4CM7A 5L4NA 4OXYA 1J4AA 3ITDA 1LX6A 2OP0A 4A73A 4GKBA 4L76A 1W6UA 3WFJA 4DBVO 4IS2A 3EY4A 1JVSA 2V7PA 2VOJA 2QRLA 3ZCXA 3I9JA 1F8GA 2B36A 2DVMA 4RQTA 3DB2A 3UICA 3UUWA 4IPTA 2DPGA 3WMWA 4XX0A 4A27A 2OL4A 3DWFA 3PDUA 4WJZA 5JFOA 1KEWA 3C1TA 3WB9A 3GEDA 4YJGA 5B4VA 3VZRA 2DUWA 3AUSA 2VNSA 5ITVA 4NBVA 1PJ4A 4CODB 1D8AA 4RCVA 4DPMA 5A03A 1DFIA 2B35A 1PS9A 4M87A 1T2EA 4CQMD 1T4DA 3X2FA 1P1KA 4B4OA 3D0OA 1H94A 4BL5A 4RO0A 1Y8QA 2EW2A 3PJEA 3MTJA 1Q0LA 4GGOA 4CMEA 5L95A 5TJ9A 1IZ9A 1IHYA 1GQYA 1MGOA 2UVDA 2G82A 2VYNA 4MKRA 4N5NA 3UH1A 1SOWA 1C0IA 3HUDA 3O38A 2BGLA 1VKOA 2PD4A 4UVDA 4KUEA 5CAEA 5JSFA 1DC4A 4NZ9A 1U1IA 2IXAA 3PYLA 3JQ9A 4R69A 2E48A 3Q2KA 1BXZA 2I99A 2CDAA 2CF6A 2PGDA 1I2CA 4GAEA 1UDBA 2V6BA 4ILKA 5L3ZA 4DQVA 5TJHA 4K28A 4MIYA 5H82A 1KBZA 5CEEA 1T24A 2DAPA 3WGZA 1YONA 4Z0HO 2C5AA 1Y1PA 3OM9A 3OJEA 3VDQA 1HE4A 2NTVA 4UEJA 3AU9A 3ZNPA 1ZVMA 4DLLA 4IJVA 1XHLA 4FS3A 1BXKA 2EG9A 3QW2A 3K96A 4D46A 5JS6A 4XD2A 4LSMA 3JQGB 3E8XA 4FN4A 2ZB4A 1G1AA 5MGBA 1B7GO 3OEYA 2Q4EA 4D0SA 4W99A 1BVUA 1E7YA 1JWAB 4IDBA 4YAEA 5IF3A 3Q3CA 5JCJA 1Q7GA 1LRKA 5DOZA 5AXAA 4MKXA 2LDBA 4DPLA 4CM4B
chains in the Genus database with same CATH superfamily
2UYYA 5C52B 3AR7A 2XUIA 1T5HX 1B16A 3AVOA 1OB2A 5BNTA 1F6BA 2QPAA 3AX6A 721PA 2ZBVA 2XRYA 3PSHA 4JS0A 3KVRA 2ZJZA 2VJDA 1CUSA 4XYMA 4XPIA 4ARSA 1Y9EA 4CMGA 1WG8A 5AOCA 2OZLB 5J4HA 1RS0A 2CLLB 3FN4A 4FW8A 5FL7D 3WSWA 1SUAA 1E6WA 2FSSA 2HZBA 3OTQA 4IUYA 2H1IA 2IPNA 4LY0A 4Q4HB 2F3TA 1BXGA 1O1YA 4NJMA 3GFSA 2FZ5A 4Q4JA 4W8HA 2ZKIA 3YASA 3U5ZB 3GYGA 2OWEA 3EFEA 4KV7A 3Q12A 1LC0A 1M2VA 1BCSB 4L0DA 4GP7A 4JI8B 1ODTC 1O7JA 1XQ1A 1ZQ9A 2V55B 2ZR8A 3AO0B 2BGJA 2QTAA 3LI2A 3IS3A 1L5VA 1QV6A 5CMLA 4FKMA 2ASVA 2PQ0A 3Q8WA 3ZWXA 1W0JD 4W6ZA 4Q1DA 2HNBA 1J42A 1ZK2A 1KR5A 3EBLA 1QGYA 1Y8ZA 1YZ3A 1AZTA 3L5KA 5DHTA 1PR9A 4QQKA 3T0IA 3UTCA 4TYWA 3OG9A 4KE9A 1FMFA 1P7CA 1TO6A 1KSHA 2PS3A 2CFCA 5EZQA 4AUMA 5CK4A 4TUYF 2Z8XA 2LW7A 1FA9A 3E1KA 1OGYA 1U5BA 1XV5A 2IE8A 3CW2A 4L5AA 3SSMA 3TX6A 5CG2A 4MRVA 1A88A 4OA8A 1BN7A 3MB8A 4R8LA 4FMBB 3C1OA 4HH1A 5DIZA 4BPRA 4QQRA 4KHPB 4P9NA 4YT2A 5CB4A 3EISA 2YUIA 4WUVA 1I9GA 3FNFA 3B9PA 5CXSA 4CNQA 1AKWA 1RXYA 5KVQA 2V58A 3JQRA 2RGYA 5I9IA 3AM1A 4HADA 1M1YA 4ZCLA 1GV1A 4AKGA 1KDVA 4V24A 3DMHA 1Y42X 2Z5VA 3N2EA 5L7YA 2FU5C 1U3WA 4DY4A 4NU8X 2F64A 4P36A 4WOPA 1TL7C 5K3FB 2WFLA 3QUTA 4D9EA 5JXGA 2YKGA 3L0BA 2DUUA 3WISA 1MZVA 3FHCB 3HO8A 5KWSA 1GPDG 2HF2A 3NHAA 3CLRC 5D5PA 4OFWA 5CYFA 3KQNA 1VM6A 1YDHA 3O8QA 4OXNA 2J31A 5EPOA 4FLMA 4RQUA 3ZD9A 1C9JA 1IOZA 1HT0A 1G21E 5ECDA 5IJWA 1VL8A 4C05A 1SH7A 4WSOA 2C9YA 4I50A 5ALHA 3QRWA 4DIDA 4PWZA 2NIPA 2MSCB 1DB3A 5BW8A 1KXZA 3QPAA 1T0IA 1UR5A 1ARZA 1PVVA 3AR4A 3GWGA 2HO4A 3FUCA 5HJEA 1SY7A 3LLCA 2FP3A 1LU9A 1C7IA 1EZ1A 1NW6A 2CLCX 2EG5A 4WLVA 4MKIA 4MUBA 1RLOA 4DA6A 4NICA 3PFBA 2WIKA 2GHIA 3Q9SA 2BZ1A 2HSGA 2OOSA 2QE7D 1W6RA 2F1KA 1MB2A 4OMCA 3SDZA 4DNQA 1AMNA 3N6VA 4RUKA 4FINA 5ANRB 5ARBA 1YMVA 4LNAA 4ERXA 3QLJA 4DMHA 5FWXB 2BHTA 4XGNA 3C6QA 1ZXXA 2WE8A 4BEVA 4C20A 4D41A 3LNCA 4WASA 2D4HA 4HFNA 4CHTA 3H83A 1W44A 1K1EA 1P3Y1 1D5WA 4B44A 3GR6A 4FI3F 4INJA 5B55A 5HKAA 1KEVA 2QS9A 4J7XA 4KN9S 4LGVA 5A05A 5MN6A 3CZMA 3HA5A 1C2YA 3OM0A 3CJQA 3LQ2A 1U0NA 1DVRA 3QX8A 4FK8A 1B0UA 1UFRA 2H2AA 3FWNA 4QQNA 3WYDA 4B34A 1AS0A 4FHCA 5LR6A 3C4QA 2WJYA 2W42A 4GKKB 3H19A 1B8VA 4HQRA 1MXHA 2ZWMA 4HLDA 3ZCTA 5BNWA 1M73E 1RAEA 3V7YA 4Q01A 1P2TA 2PUHA 1G66A 2FLVA 3LT0A 2ZSUA 1LVGA 3O73A 4O1HA 2H2IA 4EG4A 4L4SA 5F7ZA 1T2VA 4EYGA 1B41A 5ADHA 3RVPA 4B7CA 3QYPA 4NYIQ 3R40A 4NU0A 4MK4A 5AKYA 1T5TA 2QLNA 4D1YA 4C87A 3GDGA 4XQEA 2QN7A 3DHVA 1E2JA 1PFUA 4GVLA 4WY5A 4GMXA 1K98A 2PWYA 1T15A 4Y2GA 2DPYA 3IPCA 4KBYA 4ZQCB 5BSGA 2V6IA 3JSAA 4FEEA 4KACA 4A26A 1U28A 1A9XA 3CQ9A 4I19A 1VL1A 1GPYA 1QWSA 1L6IA 3AIOA 1CEXA 4HZUB 1JPJA 3JQ9C 2VSXA 3QU7A 4OOFA 1XAJA 3BMNB 1FTSA 4LWPA 5EHNA 3K70B 2O5CA 2Z56A 4PZEA 3BFPA 1NRIA 3LKZA 2V9PA 5ALMA 2NYRA 1JKIA 3V1YA 4J4BA 3T7SA 2YN2A 1JR3A 1L5SA 2ZB8A 3WRYA 1U1CA 4QSMA 1O6CA 1NR5A 3AL2A 3IO3A 2PKYX 1R6BX 3OMWA 4NBSA 1QWOA 2BGIA 2AE1A 3WIBA 5AVSA 1S9DA 4KJZA 3QTTA 2RG1A 5I4KA 2H18A 3GDOA 3RJMA 8GPBA 2A8YA 3FYTA 4GPEA 3E9CA 3C3DA 3GCDA 1J00A 1OFTA 3ILSA 5LIRA 3FAKA 3GJTA 1H8HA 5FPQA 2CVZA 1OYWA 1KFJB 4JLOA 2Z83A 4LOIA 3Q7PA 2ZOSA 1DPFA 3FFXA 4PLGA 4Q0MA 2OECA 3BL5A 4R1MA 3ZLUA 1PNRA 3LCRA 4DJJA 2YFYA 1A9ZA 1H22A 4TTIA 3RV4A 3ZBUA 4ID3A 5JD5A 2YN4A 3C3MA 3OKPA 4RTSA 1W4CA 4NR0A 2QN1A 2A0FA 5HFNA 1CR2A 5P8WA 2OAGA 2DPMA 2EARA 2YNMC 3G79A 3ZDEA 4ATNA 4DG5A 3I42A 2VSQA 1J6UA 4M1TA 2FOXA 4WD3A 4E14A 1EJ2A 3IEVA 1UFQA 1X1SA 1FPQA 4Z7NB 3QLVC 1FNNA 3HO6A 4N3CA 4RIIA 2BOVA 4YMUA 1NOKA 2D1QA 4OAPA 2I78A 4AP6A 3LX8A 3HNOA 4V38A 3OM1A 5JNLA 5KJEA 3PHCA 4OHZA 2FUCA 1PUXA 1S96A 2X8LA 1SUFA 2ZXEA 1NC3A 4WOBA 3UKOA 3C8DA 1FUEA 1Z88A 5JYEA 1GPUA 1QP8A 1UBHS 4RFSB 4H08A 4R9SA 1D2HA 3DHNA 1HFEL 4CF3A 1VL2A 1AJEA 3MB5A 2BPOA 3UV6A 3PDWA 1J23A 2D2FA 4G81A 3KUKA 4ME6A 1KZ7B 3H1PA 2P9FA 3MT0A 4H0NA 4HMOA 4UQLA 1BEUB 4GR9A 1C3VA 4LS3A 4ZVTA 2AKEA 5ADVA 4Z51A 4MWTA 1RYEA 1JIKA 1GA4A 3RCBA 3NAQA 3GRZA 3Q1LA 4XYGA 1AXGA 3U4CA 2XAAA 1P2FA 3M4JA 4QRHA 4LY3A 4KOAA 4NL4H 1U7XA 4MQLA 3AJRA 3FTNA 3TFWA 4JQCA 4KIGA 4NARA 4ZI7B 4I0WB 1OFHA 2ZIEA 4GZ3A 4ALLA 4HDSA 4ZVQA 4U5QA 1BDBA 1XYYA 4XWYA 3O8BA 1R66A 3E7WA 1NI5A 1L5HB 4ASUA 4IYRA 3D3WA 3S1SA 2J3KA 4DCPA 1CZHA 4K9QA 1M2OA 2EW8A 2EFCB 3AESB 4UE6A 4UHHA 3VDMA 2LRHA 1KRWA 1N9ZA 2AMFA 2GD0A 2D1TA 3AC0A 2OEPA 4M0UA 4AO7A 4DZTA 3Q7EA 1DOAA 1QHNA 4P7KA 3K0KA 2VJKA 3K6SB 1E1RD 1TQ4A 3DUWA 3FPKA 2EZUA 5I7SA 2UUCB 1PWXA 5CJ2A 3EIEA 3O8NA 5B6JA 3ES9A 3ZWCA 4GE3A 2DKFA 5K0TA 1JFFA 1AKQA 3SJBA 4MV4A 5JFGA 4YBRA 1A71A 3A32A 4IG4A 1ZMBA 1AKNA 3H87A 3EA5A 2G6BA 2YXEA 3EYAA 3T5GA 7REQB 1QF6A 1H69A 5D7NA 1J2JA 4G4IA 2P35A 2J8ZA 4BO4A 5DNCA 3OSZA 4KKXB 1N7IA 3F5SA 4HMPA 4I5DA 2OCYC 3TCXB 4K81B 4CW7A 1NQVA 1UWLA 5BW5A 5C3MA 3NGXA 3H5LA 1E7SA 4M8KA 4NY1A 4DEYA 1CEEA 3ZH2A 4C4OA 3TZKA 4D25A 4M0KA 3U60B 5CU7A 5EG5A 2FA9A 1MF7A 3FCEA 3R7NA 5IWAB 1C3XA 4QYWA 5TS3A 1UJMA 1KO8A 4HATA 3VV3A 1BU8A 3EARA 4FN5A 1YT5A 3SMQA 4BNZA 4D02A 3RC8A 4Q3BA 5ICSA 1PFGA 1EX7A 3FVVA 3H7IA 4L6CA 3MGGA 2WWVD 2QBYB 2O19A 3ABOB 3TX2A 4M1OA 3U26A 1U2GA 5CT6A 4ZA2A 2CBGA 2JIOA 5KAPA 2ZRLA 5HX7A 3NKLA 5JFTA 4Q03A 2QRHA 3EMDA 4IQFA 1A4IA 4IHKA 1T5IA 4R98A 1ZONA 1VPTA 3A0UA 5GV8A 3T5MA 3KTDA 4X3PA 2VF8A 2VQ6A 3K0CC 3PXXA 2DY1A 4BU0A 4EAQA 4ODIA 4Z9XA 4E5NA 4DWOA 4UTRA 2ZJ7A 2JL1A 4IRUB 2C94A 3I9KA 2VK2A 4OLBA 2HJHA 2AOTB 4QLOA 1QZTA 3LCJA 1GPLA 1U3CA 4QD3A 1KNQA 1HQKA 3PJDA 4OXKA 4F5DA 1RHJA 4REOA 2R65A 1IOLA 1ZW6A 2IHJA 4CMHA 1WDLA 4D9MA 1HRKA 2J5KA 4WKGA 3U39A 1CRLA 3K7EA 5CEJA 1TQ2A 1UJNA 3WB2A 3HP4A 3ZWDA 2XMRA 3HN7A 1GXSA 6GPBA 2B2CA 2V6GA 3NRCA 2O2ZA 2QNIA 4TSFA 1PDOA 2BFCA 2OV3A 3OCUA 4XUCA 4M0EA 4QTTB 3UJHA 1ZRHA 1EP1B 2BP7A 4G5HA 4DJFC 2CVHA 2B9EA 4BZWA 2VHTA 2F6RA 1ZH8A 1TF2A 4AMZA 4MS1A 1PT6A 3LRTA 3L84A 2ECOA 1I1QB 3E0QA 2Z2YA 1PR3A 1LJLA 3LLUA 3ZH9B 4BC1A 2QQ0A 5K0ZA 5C80A 2P77A 1NY6A 4FR2A 1O5IA 5DWQA 1NI3A 1KJYA 3O4RA 3FCSB 2AHRA 3ETJA 3C3WA 2PL1A 3A4VA 4BNVA 5C9ZA 1RW4A 4ZAZA 1Z2AA 3L0PA 4HC4A 1Q0PA 1E0DA 1RAHA 3A4NA 4O4LA 2WTBA 1DTWA 2Q5CA 4BDSA 4W1RA 2YTZA 3MWGA 4OI4A 3VHXA 3VAAA 2Q62A 5BWMA 1IUNA 4WNCA 5FNVA 3WVNA 4QUDA 1CB7A 1GCOA 1RPJA 3V8EA 1L4UA 5DTQA 2XA9A 4WN9A 1G8PA 4MOWA 3RH0A 5BW4A 2QMHA 1DKPA 2GVNA 3SF0A 4J76A 4UE3S 4UOQA 4IQ0A 2E7ZA 2OGTA 3MEQA 1WIWA 3M5CA 2Q5QA 3I32A 3CHYA 3QVJA 4GPTA 1ZCBA 2BHNA 2BSXA 3G49A 4AMUA 3I37X 5KTOA 4Q1FA 4KAFA 4Y6QA 3OQPA 1OA1A 3LX5A 1YSCA 1WUTA 3OMXA 4DR1B 2IBSA 1OBHA 3ACDA 3M2TA 1NR1A 4OHVA 1OC2A 3JVVA 3C8ZA 5HCUA 1VKJA 2ZLBA 3CLRD 4G8JA 5L45A 1IN4A 4I8XA 1FMTA 5AW8A 2GB4A 1NQWA 5C53B 3LXUX 1A2OA 4JBGA 3M8KA 1YDFA 4TQ9A 1YQUA 1QOPB 2B4AA 4EHNA 1JXAA 5J5CA 4KPFC 1OQAA 2OGZA 1GZ4A 2DQ4A 3NTVA 5E7MA 3WK8A 4UAJA 3W2EA 4NNJA 1BDHA 1ZI9A 2R6DA 4F97A 2VPTA 2XCRB 5EKSA 4JVNA 1Z28A 3KVYA 4B09A 2XDAA 3OZAA 5BR7A 1C3EA 2HNAA 4FHFA 4KU4A 4UQPA 5L6MB 1IM2A 2UYCA 1BJRE 1MZPA 3G7NA 1NUHA 2HGZA 1E94E 1NAHA 3BTOA 5DZSA 2GETA 2XB6A 5CDSA 2VRNA 1OZAA 1YI8A 5AKXA 5M2QA 4ZVKA 4ZVPA 2FPXA 3D43A 4R41A 1AKVA 4ZK2A 2R47A 2ZTUA 1W0CA 3JATB 2LWIA 4FU0A 4QXQA 1VJ5A 4JBYA 3RVQA 1QIKA 1IK6A 2ZSIA 3OF5A 5JAQA 4ML3A 1UC5B 4LOAA 4LRTB 2DWCA 3WDKA 1V35A 4F12A 1KC1A 1EJ0A 4WK2B 1T0UA 1LDNA 2X19A 4NEGA 3U7GA 4IGIA 3RLIA 2OG2A 5CT4A 3ZEAA 3EW7A 4RHEA 1N7JA 3MCTA 4V1CI 1F1BA 3TM5A 3PNYA 3GCZA 4TZ0A 1IN7A 2K2WA 3OHPA 4JLBA 4YIKA 4YIHA 2QM3A 1VPLA 4GVPA 3BBPA 2PMFA 3H9UA 3K0AA 4MWGA 4TXNA 4AG6A 5EGNA 4ZDIA 1K5PA 1Y3FE 3I52A 3ACBA 4ZHSA 2Z6AA 3CE6A 2RGCA 3GA5A 5LQNA 3P20A 1D3AA 1YAJA 3PA6A 1XFDA 1MV8A 2OXRA 4R71A 3DXZA 5DRTA 2Q3JA 3ZD7A 4CQLA 2PRYA 3N05A 5DX1A 1GLGA 4BN5A 2V3WA 3OQHA 4UCQA 1KYVA 3CURA 2C82A 1LGYA 3D6AA 1Z6QA 1T5LA 2CNNA 9LDTA 1XD2B 5CLIA 1RMQA 4ED9A 2BL4A 1I2MA 2JAWA 4YNBA 5K8UA 1DUVG 1SVUA 1OT3A 2VP5A 4JBXA 4Y1RB 1SM4A 1U3TA 2GZSA 3NAMA 4R1NA 4H6PA 1WDTA 3KG2A 2I3AA 4JK3A 3JZFA 4UBNA 4B81A 1H1TA 4JLPA 1DCFA 1Y8CA 2C7QA 4Q3EA 5JJCA 5ETJA 2OV8A 3OKCA 1NP6A 3N5KA 3H11A 4L4RA 1NA5A 1ZDMA 2ZANA 5KC9A 3UJ3X 3DV9A 3ZS9A 2JI4A 3M70A 2GUWA 2XMSA 5EP1A 3TYXA 1KR2A 2OVFA 4D44A 1K68A 2C0QA 2V6MA 5L3SA 4I55F 2VUIB 2PZLA 3DFZA 5IKEA 1CZLA 2R9VA 4BQQA 3L49A 4IICA 3V1LA 5KVCA 2Q4RA 4JJGA 3IR5A 4GEGA 5FI0B 1NBMD 2WTXA 2ACKA 2PMEA 3W8RA 1P77A 1R0YA 2A1TS 3ZJ4A 1YXMA 4RORA 3DV0A 1DINA 1ZVKA 4JHXA 3S70A 1U6IA 2TRSB 2O2EA 4QARA 5LYJB 1N2SA 3M83A 3DW3X 1PZXA 1XT6A 4R9VA 4RSRA 3DE6X 2XE7A 1NN5A 1F3LA 5EPUA 1JHUA 4HB3A 4CYMA 1T9DA 4F6LA 1Q22A 4JDPA 3MUEA 2OZPA 4UMFA 4X44A 1CPYA 1Q1EA 1PZMA 3GHHA 2AD5A 4ZEOA 3T4UA 4OPMA 4MW2A 1KI6B 1D2MA 1TUGA 3ET5A 3UCXA 3WRYC 1CUEA 4KG7A 3D31A 3JWPA 2XOXA 1HC7A 3ONVA 1DKNA 1GU7A 2DBZA 2YRXA 4RD2A 1IDN1 5EJGA 5G0TA 5JAPA 2RGWA 5TVKA 4AG3A 4B3TB 1WBJB 4BU1A 4CQJA 1W4AA 3M34A 5B58C 4OJMX 3QVMA 4PO1A 1OYYA 3RK4A 2H08A 1KRHA 4K0KB 3C8MA 1HQCA 3WZLA 5JATA 2ACWA 3D1VA 4MMZB 3AB3A 2C92A 4WZAA 3JS5A 2VHCA 2BGTA 4TMTA 2O8FA 4MGEA 3QYJA 3P0RA 4E13A 3M4XA 2P9GA 5CH3A 5GINE 1YJBA 2QMZA 3M3DA 3RS2A 4S04A 4O3MA 3AONB 4HX5A 1PDVA 3TLAA 3T1YB 1XOIA 4Y2XA 2O5EA 3W2HA 1UPUA 4ZKEA 3GRAA 5KREA 3KJIA 2FX5A 1LDMA 3R20A 3KJQA 4BO8A 2MSLA 3IKLA 4KRGA 2G9RA 1VSUA 3V4RA 2P7IA 3QXGA 3D0QA 1MEEA 5JG7A 4IIVA 3U56A 4H0FA 4UU8A 3TS1A 5IT5A 2BEKA 1B6GA 4BNUA 2J1LA 3FMGA 4RZHA 3KV1A 4ON9A 4AY6A 1SCAA 2RJ3A 4MJ3A 2XT6A 2FR1A 2E6UX 1AZSC 1U8TA 5FUWA 3UGQA 4DXAA 1A1VA 3U3RA 5H83A 4Q9LA 1E3TA 4M8IA 2ACEA 3FTFA 2YASA 2G6TA 2AL7A 2FSVA 4Y6RA 2A3RA 1P1FA 4NECA 4DC0A 4TTQA 3AKEA 5FRDA 1QAMA 4S1NA 1DQNA 2GZAA 1UXJA 4GPAA 1PWZA 1SK8A 4II2A 4XVCA 1AQJA 1XP5A 2GERA 4B2PA 3G6WA 2YH2A 4JQSA 2C3OA 2WU3A 1EQ2A 3SM3A 5IJ0B 1EA5A 1IXZA 1VLMA 2J09A 4ZWNA 3C4JA 2FMIA 3G2HA 3PEVA 1ZMRA 4NNOA 3CLTC 4E03A 4H2DA 2WJPA 3WIUA 3A3YA 4M22A 4D4JA 4QA9A 1PF7E 2HA6A 1OJ7A 4ZV4A 1IEXA 4MARA 1M0WA 1CVIA 1A4XA 4ND2A 3AFIA 1RHKA 5JAUA 5KI6A 4D42A 2IIPA 3I23A 4YCBA 2HN9A 2PAAA 3ZNNA 2GARA 3R0JA 4B6OA 1U81A 4W5JA 4B6JA 4KVZA 1JRLA 4BGVA 4DM3A 2Z3ZA 5BVHA 1LBEA 1EXWA 2IZ7A 2PV7A 3L2OB 3C7KA 4YECA 1PJSA 3UWKA 4DRZA 5A4MS 5JR3A 1VA5A 2QUBA 1O97C 4MYDA 2D59A 3I3OA 4H1WA 4RETA 4EG8A 2SKEA 3RTGA 2ZT5A 4GOND 1KF0A 2XI4A 3WWCA 5KHLB 5GVSA 2BFPA 1VJGA 2YHIA 4IJ6A 4IHJF 3BTSA 4BVHA 1ACLA 1E2LA 4MWOA 4ZHQF 1ZOPA 2RAFA 3C41J 1E96A 1N9GA 2JASA 2P9TA 2PZBA 3LQFA 3OCZA 1GG2A 4WMLA 4ZALA 1JQJC 3BRWD 2QV7A 3AYZB 2Z8ZA 3ABZA 2F4VB 5DULA 5CA0F 4KXFB 4QBGB 1CJMA 1ZSYA 3HNPA 3BICA 4EK9A 3RODA 1JG3A 1RLMA 4MVJI 1XDUA 1V6CA 1NY5A 3BQNB 1B76A 1EUCA 3LL4A 4DUYB 1NXSA 5FXMA 3WOHA 3I4FA 3HBJA 4E12A 1H1LB 3BL6A 2IF0A 5JROA 3I12A 2O3UA 4RIHA 3ENVA 4G1EB 3T9AA 1KY2A 3ANNA 5E4JA 2BKUA 4OF4A 5FT9A 1RXUA 1VTKA 1ZP6A 2NUPA 3HYTA 2GBPA 1K8YB 1E79A 2VDNB 1O94C 5DHSA 3FDZB 1DO2A 4QDOA 1XKQA 4PC7A 1DAKA 1G41A 1P29A 1ZZEA 2AA3A 2B94A 2YQZA 4LZAA 1GT6A 5FI3A 1GCIA 1DFGA 2G83A 3OCWA 3NBZC 4D8UA 1OF1A 4GC9A 3C39A 4IDAA 3OIDA 1QP4A 1JU3A 3JAWB 1P0PA 1W2GA 1KMHA 1VYVA 3NP7A 4BYGA 1CUBA 1PUIA 4N9WA 1YI1A 5G4KB 3VJKA 5A0TA 2IYSA 3LP6A 3E4DA 2E1PA 5KNBD 4QULA 4WESB 2CJWB 4HAIA 4NMXB 3GEMA 3QJ5A 4J9VA 1XCLA 2EF0A 3SP1A 3RT9A 3WL6A 2XVZA 1ONOA 1ODJA 2DGDA 2PS1A 1E1QD 5IBPA 3FMVA 2CJWA 3ENWA 3FPEA 3QE9Y 4DE5A 5EMKA 2GN9A 1NUAA 1JHXA 3MUNA 4BAGA 4JL5A 4NNPA 4IJ5A 1THZA 1S2MA 1KMHB 3GB9A 4QOSA 3TNYA 3D6NB 3K1TA 5BWLA 4G63A 5IZ4A 1MW9X 4CMIB 1N34B 5E7JA 4OH1A 5EHXA 3UJDA 1A82A 2VDQB 5ALFA 3EFBA 3KVNA 5AW5A 3D64A 4LKOA 1FDSA 2Y3IA 4BMNA 4EUFA 2EX1A 3KLOA 2R3SA 4XWAA 1T43A 1Z37A 3S40A 2HCBA 4OX9B 1H05A 3DF7A 2QR2A 1GZ6A 4LSZA 5JARA 4D56A 1ZUNA 3LT2A 1Z2CA 2FZEA 2QROA 3IWDB 2W2VA 4EPYA 5T41A 1RI1A 2JI6A 4GSKA 2HL6A 2PXXA 4KQMA 1K6JA 4IIEA 3KIPA 2O8BB 4P2GA 2OORC 3GF4A 1GQQA 3L6OO 5KDDA 3WMXA 1NDUA 4NI5A 3VPSA 3L0OA 2YNMA 4WZBE 4K3VA 4XSVA 2GOYA 2MINA 3A3OA 3OBIA 1H2EA 1K0UA 4MQFA 1JHVA 1GGJA 4QYMA 1XKLA 5ALWA 4HNAB 4C1NA 1WXXA 4J6FA 2AQHA 5ALSA 3FCCA 2CT8A 1UYJA 1KGSA 2Q2NA 2YHUA 3H3JA 4RPKA 5K0CA 1OB5A 1ZNQO 3TSWA 2KI5A 4DLTA 5KNDH 1CETA 2FMHA 3PTLA 2H2WA 3IB3A 3M4ZA 1T1GA 1QLJA 2ISQA 1P8AA 2JH3A 1ULHA 3H11B 5FBKA 3VMMA 1SXPA 1Z6GA 3AVWA 2EBUA 3LC1O 1P45A 4HX2A 4AG5A 2FMUA 4RY2A 4WKPA 5CIQA 3UHOA 2O23A 2BKEA 4X0EA 1WBBA 4BAZA 4IQGA 2G7MC 3EODA 4GNRA 1Q0RA 5SV2A 3HM9A 3EEFA 1U0LA 3I4CA 3GD7A 1DDIA 2FWPA 3LT1A 3N75A 4JROA 2AJDA 5JVDB 5F77A 1TTHA 1P6XA 4K3UA 4KQ1A 5BV0A 2JIDA 5CM2Z 4UKDA 4CM9A 1RI5A 1RIIA 1Z3IX 5JSKA 2LKDA 1VE3A 2WWFA 4L9AA 5A5GA 1AK1A 4B82A 3CZPA 4H4CA 3KLPX 1GKIA 4OLAA 1YHZA 3BF7A 3GNQA 1Z4OA 2ZM5A 3GPIA 4G0OA 1FP2A 3BJRA 2C2ZA 3D2BA 3DTTA 2IYAA 2J3HA 2JEYA 5A4DA 3ZDBA 2EP7A 1I33A 3DWEX 2C5GA 1WTAA 1J2TA 3GEPA 3VU9B 3SDBA 1PK8A 3QKIA 4JYAB 1JG6A 4UNRA 2QVZX 3IMGA 4KPEC 4O02B 4RH1A 1FS6A 3E3OA 4ARCA 1F9EA 4P2BA 2LD4A 4ZCQA 3ZW7A 1HE2A 5JI2E 1FDRA 3UQYS 3GLFE 1WXWA 4NENA 3QFRA 4MINA 1CUCA 1RQXA 4N8SA 1RQGA 1L4MA 1H3FA 2FWIA 2ZUVA 4NE9A 3T7DA 2A5FA 4D9FA 2JEOA 5CBPB 4AQYB 5SYNA 3AVYA 4I3HA 1WZCA 3G2LA 2C07A 2HHHB 3QXXA 4AK1A 1M6YA 4MVJF 5CCEA 4JZKA 4RVDA 2Q6IA 2AX3A 3QW4B 5E2BA 1QGED 3HH8A 4X85A 5U9CA 1ZGJA 1CZNA 4EB3A 1RQLA 1Y6QA 3IXLA 3L4JA 4U6SA 5AW7A 2QTMA 3L6EA 1WPXA 4RH3A 3KL2A 3SE0A 1Z07A 3LECA 4FE3A 3UZUA 1O87A 1YS9A 1P6QA 2X58A 3Q7SA 2DR2A 5EJ7A 3T1VA 1AKEA 1BCRB 2AQ8A 2GF0A 2C1EA 3KKLA 1PFVA 3KQOA 4EUKA 1AHIA 1CP3A 2W22A 3PHIA 5AKIA 1RM4A 4FEYA 1T34A 2BUAA 2VTVA 5THKA 5CDGA 4J0HA 4RMJA 2Z1NA 1UMDA 4RZIA 3Q3IA 2QRPA 1WJGA 2AQIA 2RK6A 3GRPA 4LXUA 4FFPA 1QU3A 1NRWA 2O7NA 4ND8A 5IG2A 1VJRA 2UVPA 2FGKA 1YR1A 3JQFA 3ROFA 2Z2KA 2D5AA 1Y3DE 1HFKA 1BKYA 2MTBA 3BMOA 1N7GA 3AF0A 4XVRA 3GG9A 5HK8A 2ZUTA 1ZOSA 4A03A 4YT5A 2P6UA 4BMCA 4KZKA 1ZNWA 2GVDC 3H2HA 2BFEB 4JSYA 2B4KA 1K3TA 1C41A 3HCOA 3C6MA 4FKBA 4NAUA 2H4ZA 5FNVB 2DUJA 4YQZA 2P2LA 4CV0A 2ZS7A 4TS4A 4G1BA 3H5IA 3PEYA 1WD7A 2HK8A 2HPVA 1B0ZA 4FMDB 1ECPA 5KKAA 1NLFA 2D06A 2V7WA 3GELA 2JRLA 4AW9A 1E18A 2PUVA 5D84A 3TJRA 2LCIA 3W1WA 2TSYB 1Y9ZA 5I8PA 2XD4A 2BV3A 4QU9A 3E81A 5AHXA 2NU9A 3TZ6A 1VKZA 3F7TA 2WMOB 2J30A 2GILA 4OXXA 1KWGA 4RHUA 3VPGA 5LBUA 5DYYA 3CMMA 3Q0EA 3ZKWB 5B1EA 1N32B 1ZNXA 2ZJFA 3LHKA 2PN1A 3CZ9A 3L7CA 1UJ2A 3DMTA 2I29A 3DFKA 2O8VA 4TTRA 2FW6A 4NYMR 1ITZA 2H4XA 5T3UA 3C98A 4F9EA 1NW7A 3R0QA 5FF9A 5JCZA 4O8ZA 2UXBB 3L7JA 1GZ7A 1N6KA 3BD9A 5C34B 3EEOA 4L2IA 3TV1A 5B6PA 4U8HA 1MQAA 2EWVA 1JA1A 2XA1A 5HG0A 4ZJPA 2NTJA 3DUFA 5BR8B 2YHAA 4WOJA 1IU9A 1Y6JA 4R2WA 1PJZA 1TQHA 2JK1A 5T64A 3KOUA 2BY4A 4OU5A 4LOJA 3F6YA 1TRHA 2VWQA 3V2GA 3ANMA 3OUTA 2H00A 2XNDA 4UNNA 2A86A 3FF4A 1DIGA 2JCYA 5U4XA 3UATA 4EJ2A 3ZLJA 1RLIA 4M9ZA 1RCUA 3W79A 5C8YF 1NMYA 2VHJA 3QKSA 1M8FA 4JAVC 3AFMA 2YWCA 4QGBA 2NX2A 4QTZA 2QX6A 4L3VA 4YJ2F 1WF3A 1BGWA 5DNVA 1WZIA 1ZIOA 1DDGA 1YB7A 1ZITA 3OX2A 3VSCA 4ZYYA 4RHFA 3ZQ6A 3ZWOA 3PNSA 1K88A 5KYNA 2R5NA 4IL5A 2PLRA 2P67A 5FPYA 4D3DA 1JI0A 1OW3B 1A2KC 2Y66A 1HMPA 2NW6A 1N2XA 3FCUB 3R6GA 3BTVA 1GY8A 1R5JA 3FSRA 2C97A 1Z8HA 3RT1A 1HRDA 1Y9DA 3H9JA 5FWYA 3UMFA 3DZ2B 1E9AA 1X39A 5DLPA 4LI0A 3TLZA 3FPHA 1UBGA 1Z2DA 3KKQA 2X14A 1O08A 1ML4A 5AVTA 3CPSA 3ED5A 4BJ5A 1AXRA 1U8EA 3V4ZA 1MO3A 1YBHA 2QSUA 2X8WA 2IYNA 2WSMA 4ITUA 5KJ1A 3ZE0B 4IUDS 1UJ6A 2C2YA 3ETDA 1Y5NA 3KJEA 3FNEA 2FQXA 4Q66C 5MN4A 2BONA 1K92A 5DISB 3ZQ4A 3MUFA 2LVBA 4MO9A 3T3PB 2WHEA 3K6JA 2ONCA 3FVTA 5TQJA 4E7PA 4ZQEA 5EWMA 4TQAA 3VUFA 2HMSA 2W2NA 4YJ3F 2P1DA 4HAUA 1KK3A 3UMMA 1V5EA 4DQXA 1CUDA 1T1IA 4ENUA 2HYDA 1MH1A 1PUJA 2VZEA 2WBLC 3HWSA 1CE8A 3DE7X 5DCUA 3TLCA 4PINA 1AK9A 1GSAA 1JDZA 1SVWA 3FDJA 4KFSA 4M1MA 4WJKB 4FT2A 2ID9A 2NZUG 3ZGNA 4WQMA 2V9CA 4KN5A 3K0BA 1RMTA 3UC5A 3PI7A 3QBVA 2HXGA 4FDMA 2BGRA 3F6SA 5AJZA 2TMGA 4FD3A 4UBOA 4BO7A 3WYFA 1WVIA 2GN1A 4L5CA 1UKEA 4D8XA 2ZRIA 2H4YA 4C0AC 3QA3E 4D9KA 4TS3A 2PXAA 4FCTA 3ROGA 3GIWA 1Z73A 2RH9B 2ZSJA 4Z7JA 5D6NA 1YQ9A 3C87A 4QC2A 5JEDA 1SCKA 4R7TA 1Q3TA 3GPLA 2L19A 3AILA 3HKDB 3VHRA 4AROA 2X3FA 3HRIA 4K6KA 4EJ0A 1I7NA 2ZU0C 4JKOA 2DETA 4QBHA 1EB8A 1BMTA 3LUPA 5FOXA 2Y9PB 2IZ0A 5F7OA 4KUGA 2A59A 1T91A 3EXHC 2WSYB 5HILA 4BLQA 3B12A 2AMYA 1R0ZA 3FUWA 3KZNA 3PYXA 5EJ6A 5IDWA 2ZI9A 1WAMA 4IV5A 1Q1NA 3I1JA 2DLDA 2DTEA 4LA4A 1EG2A 4M6WA 3LPCA 4R1QA 3UK0A 4AZTA 5C4IA 1UT6A 2P9QA 2E4XA 1JTFA 5EKUA 4D98A 4L9SA 4TUYA 3CUSA 3WMGA 3CT6A 4HN2A 4ES6A 1QXSA 1ZLYA 4NCAA 3NDIA 1KK2A 4UMVA 1HZZC 3V34A 2J46A 2RGXA 2VJPA 4DMUB 3A3NA 2CXOA 3LE8A 2W6MA 5EINA 2H5JA 1ZHHA 4E15A 5J23A 1Z36A 2FZGA 3PENA 4HV4A 1ZD5A 1X2BA 4M60A 3KZMA 2OG1A 2HGSA 2QVCA 2B8EA 2KS6A 4PTZA 1ZRSA 3IAS1 1A3CA 3O1JC 4Q02A 3B3AA 3ZWMA 2IEAA 2EAUA 3GG2A 1OXXK 3FJOA 1HA3A 3OCVA 3NV9A 2WFAA 2WJHA 3T7KA 1YL7A 3EN0A 1DRUA 2OFXA 3OOEA 4UDXX 4TGLA 1NVVR 1TYEB 1YV9A 1GRVA 3GBVA 5CVJA 2YVUA 4DN6A 4OFXA 5AWFC 2IZOA 3ADPA 2E4YA 5TX7A 3WBBA 1V8PA 1R4NA 3F5FA 4ZGWA 4OXIA 1CS0B 2OWDA 4NC9A 4AJNA 1CKEA 1R5NA 4ZANA 1C3OB 3EIFA 1KFEB 1WCV1 3SHOA 1C7EA 2IYOA 1TLTA 5ALYA 2WNIA 3PGJA 4FFSA 1ZR2A 3RBXA 5AW0A 3LZDA 3ZDYB 1IE3A 3IEIA 3HS3A 1RTKA 4MP8A 2AD1A 2EP5A 1TZKA 2ZUWA 3B7PA 3FNGA 3IV7A 1EIZA 1C3JA 1FNCA 2G07A 1JLKA 4LBYA 3S1AB 3TIIA 2I80A 5B4TA 2KLBA 1JJIA 3L4BA 2INGX 1L4YA 4MJ7A 2B7BA 1GPJA 2OKGA 4YUXA 4I4CA 4UOZA 4XDGA 1YC5A 3R7LA 1P4JA 1ANKA 1J33A 3JYHA 2FJ0A 3ESDA 2MSDB 1EGHA 1ZOLA 1KJNA 3A25A 5DDIP 4KVGA 2V03A 1XTRA 3HR7A 4MRPA 2PUCA 2XBLA 1ID8A 2P91A 1F4VA 2QHXA 1D4ZA 4C2AA 1QGZA 1X0XA 1FVOA 1I7LA 2GN0A 2I1WA 3P8ZA 3Q9UA 4KE8A 3U4HA 4Y0VA 4PZYA 4BQNA 4RZUA 2O1XA 2QZJA 1FTNA 3ROTA 1NG1A 2E5FA 3V7WA 2RGAA 3HC7A 1DIOB 3UHPA 3WGUA 3PGLA 5G0WA 2GM3A 3OLWA 4Q3CA 4LGCA 4REQA 2OORA 5TMDA 1QIFA 2PGIA 3UC9A 1JIXA 4CMIA 4DKJA 3TAXA 1KJ8A 3AESA 3VR0A 3QMWA 1UZNA 4CJXA 3NUGA 2UZIR 1R6TA 2EQAA 4FQ8A 4EB0A 4YRCA 4YDQA 4BNNA 2B4RO 4FS8A 4B3XA 4ER3A 4YRGA 1RRKA 4IOJA 5HXAA 4KE7A 3H8SA 3C3JA 3GFTA 1XTBA 3W5BA 5AVZA 1HKUA 5KOHB 1SZJG 5AK3A 3ZY6A 2I54A 5JISA 1YJQA 1AA6A 4I8DA 1TJ4A 3SYLA 2FWRA 3U4QB 1ISSA 5LZ7A 4AS3A 5LQKA 1QO0A 1QKJA 5MGNA 1MX5A 2O4UX 1G20E 3ML1A 5ITZB 2BUBA 3VRHA 4M9UA 1SQFA 1YMQA 3WRWA 2LZ0A 2QX8A 4JR1A 1IRXA 4KBFA 2OYRA 4DMCA 4KNYA 4FNMA 3BKWA 3DZBA 3MGBA 1BWRA 4XQ9A 2IXEA 2Z1MA 3PF8A 5FPKA 5JQGA 2BBWA 4WN9B 3U4AA 3AIKA 4U7GA 1G8JA 4ESOA 2ODQA 1OROA 1MG5A 2XMBA 3VHXB 1JAZA 2WF7A 1PTJA 1ZU4A 4O4LB 5HGXA 3C5WP 3COPA 4FE4A 1PD0A 4KQ6A 1I3MA 2O3TA 5KUTA 4OX9Y 4OHWA 4ZEVA 4GYWA 3C6BA 1IEWA 3HV0A 1FP4A 4RV9A 2DPHA 4OYHA 2EJVA 4EY4A 2PWAA 3Q15C 4NYMQ 5CDTA 3H5NA 4PFKA 4INPA 1GDHA 1K6IA 2XYGA 2Y0CA 3KT0A 2XUQA 3MQFA 2XYVA 4V39A 8ADHA 4IVQA 3DKVA 1U02A 4S35A 4HVLA 3AQ4A 2E49A 3CNEA 4HDCA 2ZQ5A 5E2IA 1SNYA 2CWWA 3NVDA 4KLCA 1J70A 4RXUA 4BKMA 5HYVA 3LA8A 1C30A 1VIMA 4OP3A 5INTA 1O54A 4K6FA 1WMFA 2ZDGA 3B6ZA 3NIDB 4BP9A 4ARIA 2G08A 3DBIA 4C03A 1Z15A 4W9MC 3ITKA 3FHTA 2FPLA 5H4GA 5FADA 1CFZA 3Q3GE 3GAFA 5ERXA 3KZCA 5F7JA 1E3WB 1L5RA 1F4LA 1C81A 1KAMA 1WDKA 1MO5A 1DXYA 1ZAYA 1A9OA 1ZGBA 3V7UA 5AD1A 1YE3A 4BB9A 5HIAA 5HJ2A 3LH5A 5CFMA 3EXG2 4H6WA 3CRQA 4I1UA 1A76A 5J59A 4TL9A 5BMVB 4V1CA 1CTQA 4BX2A 4KR6A 5L4SA 2FZWA 4G1VA 1H6CA 1HDIA 2BF7A 2VRCA 1VI2A 2H1WA 4EJMA 3RC9A 4IIYA 4IZ6A 4N5IX 3UMYA 4XUEA 2ZW9A 1WMSA 3A1VA 4S1VA 3U81A 2IXGA 2FH5B 4YP9A 1C1XA 2VOEA 3KZXA 3LHDA 3G2NA 4H4EA 2Q7OE 4JXXA 1YOVB 4TKMA 4KGXA 3ZHBA 1XZ8A 1QVWA 4J91A 4YRDA 4JJ6A 2PVCA 1PYDA 1JXOA 1L7EA 2FPIA 1DMSA 4S24A 4WFJA 1A50B 4ZVVA 5FYDA 3VR3A 5BN3A 3GLIE 2PWZA 4JODA 1IWPB 1D09A 5LQDA 2JJ8A 3DHEA 4XFJA 4F21A 1SPBS 1IBRA 2AC7A 4M8NE 3O93A 4BMPB