3K2BA

Crystal structure of photosynthetic a4 isoform glyceraldehyde-3-phosphate dehydrogenase complexed with nad, from arabidopsis thaliana
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
337
Chain Sequence
b'AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
molecule tags Oxidoreductase
source organism Arabidopsis thaliana
publication title Structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase (isoform A4) from Arabidopsis thaliana in complex with NAD
pubmed doi rcsb
total genus 106
structure length 337
sequence length 337
chains with identical sequence B, C, D, E, F, G, H, O, Q
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3k2bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k2bA01
4YJHA 3EVTA 2O50A 1CJCA 3JQEA 4MDHA 5KVSA 2RHRA 5IN4A 5F21A 3TF5A 1G6KA 1N7HA 5HBRA 1M75A 4IJVA 4OKNA 4BNIA 2FMUA 1H6DA 2Q49A 5GZ6A 3P2OA 4H7PA 3JTMA 4XQEA 4A27A 3IUPA 3JQGA 4S3MA 2BRUA 2X7HA 3ZNNA 3ZWCA 2W2LD 3FPLA 1CEQA 4PIVA 3RASA 4EYEA 3W8EA 4D3SA 1RWBA 4U0JA 3UUWA 1ADBA 1P1HA 1T2EA 1DJQA 1AE1A 3RFTA 4YT2A 5EESA 3UW3A 3K6JA 2CD9A 3LZ6A 2Y1OA 3HE3A 4CQMA 2FPGA 2JHGA 1JU9A 2Q2WA 4ZRMA 3SJ7A 1SMKA 4Z3KA 3HDYA 4FFRA 4ZVVA 1PQWA 4YYZA 1NTOA 2YHUA 2Q4BA 3BHMA 2AE1A 4J0EA 1T1RA 3ZWVA 5A06A 1PEDA 1S6YA 3CH6A 4Y6RA 3ZHZA 3EY4A 4I08A 1NXQA 4UAGA 4M86A 4XR4A 4F46A 1K2WA 2G17A 4YAGA 4YAJA 1JQBA 5TQVA 4BL5A 3PWKA 1R15A 2PNFA 3PVZA 2G82A 2GN4A 3TN7A 2Q3EA 4O59O 4IINA 4YTEA 2VHWA 2Y1DA 1DHTA 3BMCB 1I2CA 4FFNA 1D7OA 2WWRA 5BNFA 2VHZA 4BKUA 3Q3CA 1LEHA 2BGKA 3K2BA 1WAMA 3TDKA 1H0KA 1I33A 1SEPA 5JYEA 4WEQA 3WGHA 3OMLA 3L07A 3FNGA 3E9MA 4DGSA 1BMDA 1A9YA 3NTOA 2P5UA 3L9XA 4Z0TA 3MTJA 3AY3A 4EZBA 3L4SO 1W8DA 3LVFO 1JKJA 3I9JA 2NNLD 1X0XA 3LQFA 3N74A 4IS3A 1UUFA 3VZPA 3PHIA 1ZXBA 4JCOA 4XD2A 3P5SA 4CJXA 2J5QA 4E21A 1ISFA 3C7AA 5CEFA 1HWYA 5BT9A 2NSDA 1ZEMA 1P74A 3I1JA 5L95A 3IKTA 3GMDA 4BGVA 3BMNB 4D41A 1LLCA 3H9QA 4OOEA 4YAEA 4W9NC 2ZTMA 5G4KB 2QZZA 3WBFA 1B3BA 4CLXA 1R37A 1L1FA 1DFGA 3O8QB 1ADFA 4EEXA 1J49A 1E3JA 1H9BA 4J49A 3ZWMA 4P38A 3ZHXA 4I5GA 2Y1FA 2Y99A 3OEYA 1WDMA 2EKPA 2JD0A 1CQIA 3KRTA 1K6XA 4CMHA 3I52A 3TPCA 1DJNA 1PZHA 3RCBA 2HMUA 2NV6A 3FPCA 3FNHA 3HN7A 2OP0A 4LW8A 1Q0QA 5TNXA 2Y67A 4HY3A 4BO8A 3R1IA 5B4UA 4WJZA 3OIFA 3KETA 2AEMA 4CL3A 4UUNA 3QV1A 5F5NA 4E13A 1JDJA 4HP8A 3TFQA 2JD1A 4DC0A 1JWAB 1EVYA 2GRAA 3I6QA 4BNZA 3WICA 1DC6A 4MVJP 5JYAA 1V9LA 3INTA 3DTYA 2E49A 3OJOA 1EFKA 3L77A 5CPBA 4GWGA 1ZK1A 1LSJA 1C0KA 1M66A 4KTVE 1YWGO 1ENOA 3RUCA 4DTIA 3WXBA 1DEHA 3KYBA 2JFFA 1Q7BA 2X5OA 2BI7A 4Q39A 4WEOA 5TIIA 1WP4A 4KZPA 4XYMA 5G4KA 4MP3A 3K9QO 3GGGA 1QV7A 2OHXA 3NGXA 4B3JA 1QG6A 5CHEA 1BTOA 2CF5A 2ZYDA 4CMKA 3ONFA 5EPOA 2Q4EA 2AMFA 4CPDA 1EUCA 2HJSA 1VJTA 1MB4A 3KUXA 4PZDA 4BMSA 4DC1A 3E1KA 2X0IA 1PQPA 4PVDA 3FSRA 1XR3A 1U3TA 3IMFA 4UREA 3CE6A 1PZFA 3PDJA 1H93A 1ZXLA 4WE3A 1SB9A 1NM5A 2P68A 3GAZA 4OL9A 2R00C 3BTOA 3A06A 2X6TA 4IMPA 5J9GA 4A5OA 3RUIA 3ZHYA 3PLRA 2TMDA 1VE9A 4CM6A 3LC1O 4I5DA 3DFUA 3ZWXA 3DL2A 3PYXA 5EIOA 4RVHA 3ANNA 4MVJD 4AJ1A 2WEKA 4BO3A 2D5CA 2LDBA 1NASA 4RVUA 3TOXA 5IF3A 3X2FA 3WTCA 4BNXA 3SLGA 1PGOA 2GCGA 2OOSA 3HDJA 3Q9NA 4J7XA 4FSHA 3NAQA 3WDSA 1MP0A 1XU9A 1AGNA 1UDAA 5LDGA 1IB6A 4R1SA 3V8BA 2XAAA 3RROA 4CMJA 3GEMA 5L4LA 1PJ3A 1HE5A 4QFDA 4XGIA 2ZB4A 1NNUA 4RVDA 3WS7A 4PLTA 3OECA 2E48A 5DN9A 2DUUA 2RH4A 4BNHA 5JAMA 4YRBA 5JPIA 3TZ6A 2P91A 4J43A 1BGVA 1HDZA 1QYDA 1HE4A 5JDIC 1Z82A 1XQ1A 2J3HA 1VM6A 3VZQA 4G81A 1YL5A 1D1SA 4MINA 5FI5A 4MVJM 3JQGB 2GUGA 2NTVA 2HCTA 4LMPA 1OAAA 1E3WA 3F9IA 4CUZA 1UZMA 1GL3A 1I01A 1WVGA 1Z75A 4NBRA 1HYGA 2VUUA 3ZW9A 1HDOA 4B8WA 2FR8A 1QKIA 3C8MA 1WXDA 4RPHA 2GO1A 3F46A 4UVDA 1P1IA 2DKNA 1I2BA 1ENZA 2Y0EA 1LUAA 5CDYA 3NT4A 5JSFA 3WGQA 3OBBA 1I2ZA 2GZ3A 3JD4A 1Q1NA 3QHAA 5T8KC 2GN9A 3JD3A 1VSVA 4OKIA 4AFNA 4B79A 4LCJA 1BXGA 6LDHA 3B1FA 3BYZA 4MIYA 2OORA 3Q11A 3N58A 3PHHA 2GN6A 5JO0A 4XKJA 5T8KA 4I5EA 4BNKA 4IJWA 2X0JA 4NHEA 2EP5A 2GN8A 1X15A 2B35A 1QMGA 2EV9A 3PGXA 1WLYA 4KQXA 3DBHA 2ZQZA 5ITVA 3ZWPA 2B4QA 1ADGA 2BH9A 2JAHA 2O3RA 5AXDA 2XF8A 1X7DA 4ALNA 3LK7A 1E77A 4WCDA 3CPSA 1G0NA 4OYRA 2PZJA 1D3AA 1HYEA 5ADHA 4TROA 5F3RA 1KOLA 4CM9D 4WLNA 5CDTA 1AXEA 1LU9A 1MV8A 3K92A 5EQDA 3ZU5A 4Q3BA 1P9LA 4W99A 4BNMA 3OP4A 2C7GA 4Z6KA 1V3TA 1K89A 3FI9A 3WSVA 4RDIA 5EERA 1WPQA 2PZMA 3JQ6A 3HB4X 4FFMA 2BELA 4C4OA 4BNNA 5MDHA 1KERA 4CQLA 1RM5A 1HXHA 2H6EA 5ILGA 3G79A 2C29D 1EBFA 4NK5A 4ZQHA 2DBZA 4IXTA 2HRZA 3U3XA 3UFXA 1DIHA 4XYEA 3B6ZA 2PKQP 3FHLA 3CZMA 3JV7A 3ZH2A 4UEKA 4IDFA 1FMCA 1EE9A 4GLLA 1NP3A 3DOJA 4B7UA 1SNYA 4I9NA 4ND5A 4YAKA 4MVJH 3WGOA 1U5CA 2VCYA 4XJSA 5JLAA 1BRMA 5B4VA 4U5QA 5CEEA 3VDQA 4I9HA 3IJPA 4G2NA 2NVBA 1GD1O 5IN5A 3T4XA 4PG8A 2PA3A 3PTZA 1QP8A 1HLPA 2RH8A 3LT4A 3AU8A 5TGDA 4J1TA 4N7RA 1R12A 1GEEA 1T2DA 2FR1A 3PLNA 3QWIA 2G1UA 1DFIA 1EK6A 3GG2A 4KUEA 1QYCA 4RLSA 3WBBA 3FTNA 4U0KA 3K73O 5EJ2A 3SC6A 1O8CA 3AM5A 1SO8A 5DDIP 2CDCA 3H9GA 4DPKA 3DFZA 1DHRA 2X86A 3ABIA 1SCUA 2HLPA 3DZHA 4TRJA 3UVEA 5A5FA 1FDUA 8LDHA 1LDNA 1YJQA 4EJ0A 4WNIA 5LCXA 1LDEA 1NPYA 1DC5A 2RCYA 5FWNA 1GZ4A 3H9EO 1LRJA 2C82A 2G76A 1W0CA 2Y93A 3ITDA 3ORFA 5DP1A 4GPD1 4F3YA 2BKAA 3H3JA 4B3IA 1JTVA 1DC4A 3GMSA 3GR6A 1KIFA 4XDYA 2J5KA 5DT9A 1LBEA 1R16A 3WMWA 1GQYA 2R00A 2Y1CA 3MWEB 4YB8A 4CL8A 3IP1A 5C37A 2VRBA 1GCUA 5K0ZA 1VL0A 4DYVA 4JNKA 2Z1NA 1O5IA 3W6ZA 4E2XA 3JQAB 5JAZA 1OOEA 4NU5A 2HO5A 3RUFA 1P33A 4IZIA 4YJHB 4CLEA 4NR0A 2VUTA 4O1MA 1D4FA 4YR9A 5EN4A 2HAEA 5KJEA 4NQZA 1FDWA 3MTGA 5DP2A 3ON5A 2A35A 1IE3A 3GF4A 4DMMA 3D4OA 1ZFNA 2B4TO 2AA3A 3RU7A 1WZEA 4P4LA 4RZHA 3WR5A 2O4UX 3RUEA 1ONNA 1OZAA 1Y9EA 2IYOA 3E8XA 3I9OA 4BV9A 3EHEA 5TS3A 5JXWA 4UVEA 4TVBA 4ND1A 4NBTA 2XOXA 3D64A 1R6DA 2AQIA 4YDRA 1GDHA 1B8VA 3PHJA 1LQTA 5HA5A 4BO7A 2O48X 1IYZA 1N1EA 3QWAA 2NTNA 3LLSA 3WGZA 3H9UA 4CQMB 1LRLA 4GMFA 4YJGA 1C3VA 1PJ4A 2X5JO 1UP7A 5EQFA 3W8DA 3WIEA 1U5AA 4NMHA 1CRWG 1Q7GA 3ROMA 4BO6A 5G4LA 3Q2KA 1N92A 4G65A 3C1OA 3NJ4A 3GNSA 3PFWO 4CM1A 4BNGA 3PZRA 2Q1WA 1RYDA 1PSDA 2Q2VA 1ISGA 2DQ4A 4J16A 1OC4A 2J3JA 2YZ7A 3PYMA 2I3GA 4UVGA 5JCXA 4RQUA 3BA1A 3EMKA 5JYFA 1KEVA 2A9FA 5CPFA 1WDLA 1Q0LA 3PYLA 2OO5A 4QECA 3UF0A 3ZNQA 4HNGA 3PEFA 3E18A 4LRTB 5T57A 4FPXA 2I76A 4FCCA 1O9BA 1ONOA 3UKOA 3TRIA 1KY5A 1P3DA 3AUSA 5JAIA 4E5MA 2GLXA 3DZBA 2VOJA 3FR7A 4OIMA 2ET6A 3W4KA 4D7AA 2QYTA 3IOYA 4M1QA 1C14A 3S2FA 1G1AA 3QSGA 4PLGA 2YV1A 3CZRA 1E1LA 1VC2A 5L51A 1DO8A 4YQZA 4MKZA 1HSOA 2IE0A 3PPIA 3P19A 4YJGB 3ZN2A 1U9JA 4W9NA 3LF1A 2YYYA 1B0AA 3BMOA 4BB6A 4FFLA 5COAA 3RFXA 1E7SA 4MP6A 1YS4A 2VYVD 5IZCA 2AQ8A 4RVFA 4ZQEA 3JYOA 2QRJA 2CUKA 2OBNA 4GBJA 3JD1A 5KVQA 1UDBA 4D42A 2IEDA 2O3SA 3QWFA 4ILKA 1IHYA 3ADPA 3UCXA 3ZZNA 2Y1GA 5A04A 4P8RA 1IZ9A 3JD2A 5JY6A 3QWBA 2YV3A 5C7IO 4AL4A 4TZKA 5I8WA 3MJ4A 1O0SA 4CQLB 5KTKA 1JWBB 2GR9A 3H2ZA 3VH3A 3SXPA 4PN3A 5IFLA 2IRWA 1LC3A 2OBYA 5JMPA 1TB4A 4W7HA 2YQ5A 3VPFA 4R16A 2EJVA 2RAFA 3DZFA 4W82A 1GYRA 3D1LA 2B69A 1YONA 4ITUA 5AQ1A 4UEJA 4FN4A 2RBEA 2NU6A 4CMAA 3JYNA 4EUEA 4A73A 3EZLA 2B4RO 3ONDA 4CMIA 2OFPA 1JKFA 5AVOA 1I3LA 2I67A 1Z7BA 3KO8A 5A1TA 4PG6A 1E7QA 5BNIA 2VT3A 4CV2A 3EVNA 1ZK0A 3JYPA 3TFOA 1W73A 4J4TA 1DIBA 3KYDB 4ALIA 1XELA 1H6BA 4BGEA 3EGOA 5GZ3A 4OQZA 1MG5A 4N18A 4RPLA 3H7AA 3JQ8A 3WGTA 2GD1O 3W4JA 4TWRA 5DOVA 1PS9A 4DRYA 2YDYA 5BSHA 2WJPA 4CMEA 4XYLA 1I10A 1T2CA 4XJTA 4FS3A 1IL0A 5FFFA 3RIHA 1A4IA 1BVUA 2DPHA 3W1VA 3TSCA 3AUUA 1RM4A 3AK4A 4IUYA 4XYBA 3RBXA 2R6JA 5KCZA 1Y6JA 5G0UA 1XLTA 4YT8A 3FBGA 1TLTA 2Q2QA 2V6BA 4UULA 2F00A 3L9WA 4FJ0A 1SBYA 1VI2A 3F6YA 2W98A 3RKUA 4HXYA 3QJ5A 1KY4A 1V0JA 2HRBA 2WYVA 4IIUA 2X23A 3I4CA 2X5KO 2EERA 3LT0A 1BXKA 3QLJA 3DONA 4UUPA 3HSKA 2VHYA 3U0BA 2OL4A 4CMGA 2FSSA 1VLLA 4DMLA 3RJ5A 4FFPA 4FW8A 4PG5A 2HQ1A 2PZLA 1PL7A 4XQCA 3E82A 2PV7A 1HE3A 3JQ9C 3D5QA 4PG4A 1Y8RB 4KTTE 1A72A 4U6SA 1DPGA 5TT0A 4ZN6A 1HDYA 2IDZA 4NBUA 1UH5A 1JA9A 4DL9A 2CF6A 2POQX 5M6DA 2NTJA 1YRLA 3FNEA 4NFSA 3WIDA 1XQ6A 1EEHA 1HL3A 1NR1A 1PX0A 2Q46A 4Q9NA 4GAEA 5B1YA 1HDGO 1XHLA 2X0RA 3GH3A 1GR0A 2I5PO 3K2EA 1MXFA 4M55A 1WW8A 3DZGA 3ZGYA 1KEUA 4Q3DA 1IPFA 4FFOA 4XB2A 4IPTA 4JK3A 3DZIA 2PGJA 3C7DB 3D3WB 3DBRB 2V6GA 1EK5A 3W6UA 4TMFA 5A9RA 4O5OA 3M2TA 1YJ8A 5L4NA 2B5VA 4WK6A 3S2IA 2GZ1A 4DQXA 4BMNA 1EVZA 5TJ9A 3SJUA 1MC5A 5TJHA 4NPCA 2AG5A 3WQRA 3OA0A 3HNPA 3LC7O 3WMXA 3SC4A 1M2WA 4LMRA 1WMAA 5A9SB 3TWOA 4D79A 1DLJA 2CVOA 2QW8A 1BHSA 1PJBA 3JQ9A 1NQTA 2P9EA 5IZ4A 4YBZA 3PDUA 3RKRA 1F0YA 3C7CB 4F45A 4CMCA 2AXQA 3ZWNA 5TF4A 4GX1A 4DIFA 2DTXA 3VZSA 5IDQA 1YBVA 2D1YA 3ENKA 1ZMOA 5CFZA 3IP3A 4JX8A 4U6QA 4BHTA 3GK3A 2BFMA 1NAHA 3I9NA 5COQA 1B16A 2AQKA 4L4RA 4CV3A 4XYGA 1YB5A 1O89A 2EIHA 1Y7TA 1HETA 4WECA 4J7CA 5JY1A 3PQEA 3PHLA 1LSSA 4DPLA 3W8FA 1YL7A 3F4LA 1SB8A 2GNAA 2ZYGA 4G5HA 1HE2A 1DIAA 4CM4A 2E82A 3NX4A 3H8VA 3GT0A 1ISMA 4AJJA 2W2KB 4R3NA 2DPGA 3BMCA 2IZ0A 3ZI0A 1EFLA 4ROSA 4PRLA 3ZU4A 3Q0EA 3DBLB 1XG5A 1ZW1A 3AM4A 1LDYA 4GVXA 1YBAA 2BHLA 4N5LA 1T4BA 1E7WA 5G2OA 2IXBA 3SX2A 4YJDA 4KP7A 1NAIA 5GY7A 3HFSA 3T4EA 4BQPA 2X0NA 3GY0A 4II2A 1BW9A 5A5EA 2OUIA 4XIJA 1FF9A 3EC7A 3C3XA 4HV4A 4XCVA 1I3NA 3OIGA 3L4BC 2Z1MA 1YKFA 2QRLA 1TEHA 4BKPA 2AQHA 4AJIA 2UVDA 3OJEA 4D44A 1VSUA 1U7TA 5JO9A 1T2AA 3JQAD 2FOIA 1YOVB 4QO7A 4B4UA 5IDXA 1PS0A 4CR7A 3EK2A 4M89A 2ZB3A 1OI7A 1U3UA 4ZD6A 3PRJA 3ZV6A 1C1DB 3E9QA 4D46A 5ICSA 2NWQA 1NR7A 4DPMA 2VOEA 3JQ7A 4PLVA 4PLPA 4R9SA 3P7MA 4KDFA 3QE3A 3JD0A 5U4QA 3KEQA 1PWXA 2YJZA 1Y1PA 1U4SA 3ZWYA 3M2PA 1T2FA 3GDOA 1LSOA 3HFGA 2E37A 4R69A 3DBHB 3AY6A 1KETA 4W4TA 4CLRB 1Q0HA 1PJSA 5DNAA 4ND4A 3PJDA 3GAFA 2DAPA 3BAZA 1QYWA 1YB1A 3UCEA 1NBOA 1GTMA 4GLOA 1U8FO 1ZIDA 2O3UA 1YGYA 5BNTA 3AOEA 3CXRA 3MOIA 1E0DA 1PWZA 5KVVA 1N5DA 3ZCXA 3PWZA 5LC1A 4BGIA 2NACA 4CM7A 1PQUA 1YE3A 2WYWA 4FDAA 2IYPA 3G49A 5CP8A 2FR0A 1YXMA 2OMEA 1SEVA 1HF3A 4JN6B 2FPPA 4RCVA 3KHUA 2VWGA 3WQQA 1NQAO 2ZJ0A 5A9SA 2DBQA 3HB5X 3NJ8A 2EP7A 1R4MB 3AJRA 3ASVA 3GVXA 3PZBA 1ZJYA 2GDZA 3OSUA 3O38A 4ZJUA 1OC2A 1YH3A 4HBGA 1QLJA 3F3SA 2FP4A 4FQ8A 2PKQO 3IL2A 3GRKA 4L0QA 2PGLA 2EXXA 3KOUA 1C1DA 3G1UA 3GN2A 3D4PA 4AJLA 1PGPA 4OSOA 3ETDA 2ZTUA 3H9JA 1KEPA 4DREA 4RVSA 3PXXA 1F12A 3JQCA 5U9CA 2WTBA 3OA2A 3HQ4O 1D1TA 3PJGA 5CG1A 3VHRA 3AM3A 4FC7A 1X7HA 2H1SA 4J1QA 3OIDA 1UP4A 1G0OA 4R51A 2Q1SA 4J9VA 3VTFA 2WDZA 4IQGA 4PLZA 5TSDA 4BNVA 3JSAA 1K6JA 4WGGA 4IGEA 4YA6A 5K9ZA 4CV0A 5COBA 5JCJA 3MCVA 2HKIA 2NVWA 1JVSA 2Z95A 4IDEA 2BFOA 3OQ6A 1F14A 2D4AA 1SZJG 2B5WA 3RC7A 4A7PA 2IXAA 4TZTA 4K6FA 3DAPA 1NHGA 3WSWA 4BNLA 9LDBA 2DM6A 2VYND 1H6AA 1GEGA 3IDSA 4DIOA 2DT5A 3OQ1A 2A94A 3GZNB 3PJEA 1TT5A 2Y66A 1YBMA 1MGOA 4J9UE 4U8GA 3RU9A 3ZHBA 4A03A 1Z73A 2FWMX 4BNFA 3BTVA 4CUJA 4EDFA 3VKUA 3RC9A 4DLAA 3HG7A 1PJLA 4CM9A 4O0LA 1H9AA 3GNQA 2O2YA 3LSYA 3A28A 3BMQB 4D0SA 3EUWA 3U62A 2CVZA 5AXBA 4BO1A 4IGFA 3PIDA 4ZQGA 4IMRA 3K8ZA 4RZIA 4Z9XA 3WWYA 1X14A 1E7RA 1YQXA 1KS9A 3CUKA 4IJKA 4BGUA 1EVIA 2FRDA 1P1KA 1QXSA 3F5QA 1F8GA 3AI3A 1QR6A 4FOOA 4ALKA 4OXKA 5A3JA 1DXYA 1J0XO 1VJ1A 3KSDO 2EGGA 3FBTA 3DTTA 4HFJA 1XWFA 3GEDA 3AOGA 1LLUA 4WCFC 4Y98A 1ZNQO 3VAZA 1U8XX 4CM5A 3SLKA 1Z45A 3MJSA 1UR5A 5F5LA 4QTZA 1P31A 1M67A 1GUZA 4MVJF 2PD6A 1VL8A 2IZZA 4FGSA 5ILOA 2VTEA 4W7IA 3N7UA 4BO5A 1A27A 2D3TA 1PGNA 4AJ4A 2PZKA 3DOCA 1P1JA 2HK9A 5JAQA 4J3FA 4Y67A 1IZ0A 2V7PA 3L6DA 3KLMX 2E6UX 5MGBA 4GX0A 1E1MA 2EW8A 4R41A 3B70A 3GRPA 4QSMA 4Y6PA 4IY1A 5T64A 3LDHA 3BHIA 3RAJA 4E5YA 5CEJA 4QFCA 4DLLA 3OQBA 2W2LA 1ISHA 2ZYAA 4H15A 4PZCA 3WNVA 5JYDA 2DBVO 3JQBC 2GYYA 1I3MA 4WUVA 1P45A 5AXAA 1MUUA 1ZCJA 1VL6A 3H65A 1A9ZA 4I5FA 4FR5A 3QW2A 4S1VA 3QRWA 1NX6A 3I83A 2AE2A 1GPDG 1YB4A 2JFGA 4K6CA 4ND3A 2BGLA 4XGNA 1DC3A 4ALJA 4CM8B 3UH1A 3H5NA 4HWKA 4E4YA 3CSDA 3RSHA 5ES3A 4BMVA 4HFRA 3H2SA 4CR6A 3GN1A 2YDXA 2P4HX 4X54A 2DTDA 4KUHA 1PL6A 5JMWA 4CLOB 2EJWA 3FF4A 5K6AA 5G0WA 3VDRA 5I7EA 1KVUA 1BWSA 1PS8A 5AYVA 3SVTA 2UUPA 4PZEA 4IJUA 2J6IA 3IIEA 3RJ9A 3S8MA 3IJRA 1ENPA 3GOHA 4WLOA 2FZWA 4YQYA 4OH1A 1N9GA 3NDIA 5ER9A 1TT5B 2PY6A 4MVJI 3JYQA 1CF2O 5KNLA 4M8SA 4N5NA 1NFFA 3GPIA 4URFA 2NU7A 3HWRA 3AFMA 1Z7EA 3IC5A 3BMOB 2GGSA 3NUGA 1DIGA 5HWSA 5J23A 4LK3A 2PH5A 4Y8VA 2I65A 1YQGA 3GA0A 4UVHA 2OXIA 3W4IA 4JLWA 4TQGA 2WYUA 3CKYA 3VZRA 5C3MA 1UP6A 4O6VA 3HUDA 1E1NA 3GPDG 3E5RA 2BGMA 1PR3A 1EQ2A 4AJKA 3DZKA 3M6IA 4GGOA 4M49A 3OHSX 2QZ9A 2DTEA 1LRKA 2WD8A 2WE7A 4RF4A 1R4NA 2WD7A 3BZUA 1XU7A 5T67A 5BR7A 3OETA 4IDGA 1OFGA 1QLHA 3WB9A 1SPXA 2VHXA 4XZ3A 1M6WA 4R68A 5CG2A 2PLAA 3FWNA 3OJFA 4L8VA 1CWUA 3F5SA 1LX6A 3ETGA 4RF2A 4HKTA 3ICPA 2O7SA 1RJWA 4PLFA 2P5YA 1E3EA 4E30A 4R01A 1T1SA 1B14A 5DCWA 5JDCC 4MKRA 5GMOA 1WWKA 4JBGA 2JFHA 3E03A 4GX2A 2XPCA 2DFVA 3DMYA 1GYQA 3JQFA 3PJFA 4JIGA 4WCFB 3FTPA 4EGFA 3GVIA 4JGBA 3OICA 4OAQA 3ROKA 4A26A 5HRUA 2QX7A 1I3KA 1HT0A 3AU9A 4WLUA 5I8ZA 5I9MA 1H94A 4J91A 3H4VA 4YEDA 3UN1A 3QVWA 5IJZA 1WNTA 1HZJA 4QQRA 4XDZA 3WNQA 5L4SA 1V8BA 4DXHA 4XRRA 4GKBA 1HDCA 4JQCA 4NJMA 3VVCA 2BD0A 4B4VA 2BFPA 4PCVA 4Z3DA 3UICA 4WASA 3RI3A 3ZW8A 1GY8A 5KJCA 1PGQA 1HSZA 4R9RA 2VYNA 2H5LA 4IIVA 4JROA 3KZVA 4Q3EA 3AW9A 5DOZA 4YAIA 1GQQA 1I30A 2WM3A 3FWZA 3AY7A 1VKNA 1YVEI 1Y81A 4FJ2A 4E3ZA 5FI3A 2X9GA 3V2UA 1QYVA 1ZO8A 2C2XA 2XXBA 3TNLA 9LDTA 1OBFO 4IXWA 1NVTA 2QG4A 3O4RA 4L9RA 5ENDA 2UYYA 4TSKA 3E5MA 1NVGA 3UAGA 1E3WB 1XKQA 1ORRA 2C2YA 3OJ0A 4EJ6A 3DB2A 1V3UA 2IODA 4P4NA 2FZEA 3I6IA 5IAAA 3GGPA 1XSEA 3VPXA 1HRDA 4CLOA 1LSUA 5I7FA 3U49A 3DHYA 4FBGA 4RF5A 3MZ0A 2C5AA 1P0FA 2YFHA 3QVOA 5DBIA 4RJTA 5KJFA 1RPNA 4BQRA 1GV0A 4JXKA 4N5MA 2C07A 4ALLA 1ZVMA 3NTQA 3TZKA 4R1UA 3OFSA 1BW9B 4OO3A 4ZRNA 4IBOA 1UXKA 4GWKA 1K5HA 4TRRA 2BF7A 1ZMTA 1KVTA 4K9DA 1SC6A 1DIRA 4PFJA 1YO6A 1DRUA 1U3VA 2ZQYA 1SAYA 3BMNA 1GZ3A 4OMUA 1H6CA 3I23A 3ULKA 4PLYA 1B15A 3DBLA 1T4DA 3FR8A 3WGYA 4EW6A 1T24A 1U28A 4QEDA 2VWQA 3A9WA 2BLLA 5DBGA 2H63A 1AUPA 2QIOA 3I9KA 1ZSYA 3JQ8B 4I8XA 1LXCA 1LTHR 1BSVA 5EINA 2J3IA 4NDNE 3WX0A 4NH4A 1GUYA 1X13A 3DEYX 5H83A 1UXGA 2PD4A 3GUCA 5KVCA 1CETA 5DCUA 3ITKA 3VH2A 3NT5A 5A9TA 2CSUA 4MO2A 2Q22A 1QORA 4J1SA 2XXJA 3H6KA 3GFBA 5B37A 5JE8A 3PK0A 4HFNA 4D3FA 3RD5A 3MJTA 3IUSA 4EBFA 1Z6ZA 1PR9A 1YOVA 2PGDA 1ISIA 2QQ5A 4XQ9A 5C5IA 3QVTA 1TT7A 2W4QA 3S1LA 3B1JA 2O3TA 2O7QA 3M1AA 5F1PA 5JC1A 3WTBA 3AOEC 3JQDA 1SOVA 5IG2A 3PI7A 4TRMA 3V2HA 1K0UA 4O63O 4MPDA 3ZNOA 4H3VA 1J4AA 5I9LA 2I9PA 3DAGA 5TRTA 3F4BA 3EW7A 4PLCA 4A0SA 2HMWA 2OGUA 1BVRA 2GZ2A 2PKRA 5KWEA 1ULSA 2I6TA 1LDMA 4H16A 4NBVA 1T26A 1C1XA 1U3WA 3DQPA 4KWHA 4NI5A 1HDRA 2Q1TA 5IDYA 4KDEA 1O6ZA 2VN8A 3NRCA 3H3FA 3COSA 3QQPA 3GG9A 3PQDA 1MXHA 3DDNA 5ITWA 3ZV4A 5CAEA 4RL6A 3A1NA 3KM0A 3T7CA 4GL4A 1CDOA 1EZ4A 3E48A 4NBWA 3D0OA 3STHA 2OZPA 3D7LA 5TC4A 4AICA 2OP1A 4E5KA 3UXYA 3I9LA 3HN2A 1MFZA 3I4FA 3DWFA 1E6UA 3PQFA 4M87A 3RC2A 4FOSA 1H2HA 1CERA 2PK3A 1E6EA 1Y8RA 2X4GA 4B7CA 4KQWA 4RVGA 1E7MA 1QYXA 4BIIA 1GADO 5KJ6A 2AEFA 3I3OA 1Q2XA 4J6FA 3OH8A 2O4CA 2ZB8A 3WOHA 4Q3AA 4Y9DA 3GDFA 1CYDA 1KVQA 4RPJA 4RV9A 1E3SA 4QO8A 5A4DA 1XCBA 4K1LA 1SOWA 1U1IA 4PLWA 4MVJG 1R4NB 2WD7B 1KEWA 2C7VA 1WMBA 5JNLA 3MWDB 3CMCO 1DRVA 2CVQA 2CDAA 2D59A 1ONPA 4YVFA 4E32A 4IDBA 2HDHA 3AI2A 4AJOA 1HYHA 5KKCA 3ANLA 4XA8A 1EMDA 4NIMA 1YL6A 4OJNA 1Z74A 5IZCC 1DLIA 1KYQA 4D43A 3AUAA 1UXIA 3FD8A 3GZ4A 1B3RA 4MKXA 2NQ8A 3S2GA 3ZWAA 1I8TA 1Y8QB 3LT1A 3V1UA 5HS4A 2JJYA 4BB5A 3WJAA 1TXGA 1DOHA 2WMDA 1HDXA 1PJ2A 4R4JA 4YRAA 1JAYA 1A71A 2A92A 5L53A 2WE8A 3KEOA 2CNBA 1YDEA 4A10A 4YPOA 1EUZA 2FY8A 2QHXA 3NEPX 1FDTA 4L4SA 3GFGA 3INGA 4IQ0A 1ZH8A 2AHRA 4F6LA 2X8LA 4D0RA 1JW9B 1V3VA 1GV1A 1DB3A 2VHVA 3V1TC 1KVSA 5BQFA 1A7KA 1KVRA 3VOSA 4IM7A 4HFMA 4BO9A 1W4ZA 4KMSA 5LDHA 3WFJA 4E5PA 1UZLA 3L4BA 4CM3A 4U7WA 4E12A 3FRJA 3I9MA 5G0TA 3PIIA 2QRKA 4E5NA 4ESOA 3M1LA 1PL8A 2Y05A 1C1XB 1V35A 1PZEA 2EKLA 1PGJA 3UCFA 2P4QA 2GASA 4BNYA 1TI7A 4DQVA 3JQBA 4XIYA 4CMEC 5DCYA 5G0VA 5EMHA 2PD3A 4MVJE 4WOJA 4KOAA 5C7LO 1B8UA 1F17A 3K30A 3G3EA 4BS9A 1WDKA 3KYCB 3O03A 3PGJA 1XIVA 2DFDA 2CZCA 4Y6SA 3D3WA 5KIAA 1IHXA 3RBZA 5I7VA 4XWYA 2W8ZA 2BFAA 4DBZA 3E9NA 2H9IA 4EITA 5JS6A 4YT5A 1U2GA 4NFHA 4ZGWA 1B2LA 1T25A 5DF1A 4BOYA 3KTDA 3TZQA 3JCZA 1HTBA 4IDCA 4WLFA 3G1TA 3U4IA 4LVUA 4NNJA 4JBHA 4JP2A 1XGKA 1XEAA 5L7WA 2VZ0A 2YW9A 1ZKMA 3NKLA 2D2IA 1UXHA 1GUFA 2Y1EA 1R0SA 3RUAA 1N9GB 3P2YA 4WPGA 2DU8A 1E5LA 2CY0A 4WLVA 4AJHA 3DO5A 5JFOA 2V6MA 4BNUA 4DVJA 3GUYA 4JJGA 4AJ2A 2WSBA 2AEJA 2CFCA 4J7UA 4QT0A 4UVIA 3ROPA 1X1TA 3RUDA 4TRNA 1PU2A 2AG8A 2ZATA 2O23A 3CIFA 5TLSA 1PJCA 2HMTA 2V6FA 5F1KA 2LDXA 1HEUA 5K6AC 2JHFA 1NQOA 4GMGA 1FJHA 1X7GA 4NU6A 2DVMA 2PWZA 2Q50A 3D4NA 1NVMB 1E92A 2FPIA 4GI2A 5L3ZA 1MLDA 1BDBA 3UHAA 3DZJA 5CDGA 2I99A 1PJQA 2C0CA 3ZDFA 4D3DA 4E6PA 1NWHA 4FB5A 3OJLA 4RO0A 1AXGA 3R3JA 2RIRA 3ZU2A 4HX5A 3VVBA 2D0IA 1VKOA 1U4OA 2HU2A 1CQJA 3IKVA 1HZZA 4GQAA 4ZHSA 6ADHA 1ZEJA 5G0SA 2IEBA 3V5NA 4CV1A 3WGGA 3K96A 3S2EA 4B4OA 2X9NA 4INAA 3RVDA 2JAPA 3KXDA 2YHIA 3JYLA 3MJVA 4ONEA 2DC1A 4DQUA 1WZIA 4GSLA 3ZWWA 4CLHA 2FHSA 1C0PA 4Q3NA 2NUAA 4WOKA 3KBOA 1I32A 5ER6A 4XRGA 5L45A 1N8KA 3DXFA 3U9LA 3U09A 1GAEO 3WQSB 3DBRA 5H82A 4E33A 4RQTA 3JQ7B 2NLOA 4MJLA 1DDOA 3Q9UA 3FNFA 2BI8A 2IZ1A 3HDHA 4EI2A 3X2EA 2AW5A 3KLPX 5HS6A 1NFQA 1ZJZA 1GCOA 3Q6IA 1ZZEA 3TOZA 3EZYA 1IPEA 3KB6A 4OSPA 2Z5LA 3QP9A 1NPDA 2W2KA 3UOGA 3QIVA 3IS3A 4NK4A 4NJOA 3C85A 3HADA 4AJEA 4BO4A 1FDVA 5THQA 4L74A 2ZJ1A 2X22A 4CQMD 1DBVO 1PZGA 3D3EA 3PFFA 1IULA 4NFYA 4LN1A 5JW6A 4GGPA 1LLQA 1DRWA 5IDWA 1LNQA 1EQUA 5CDUA 1A7AA 1MG0A 2EW2A 4JJIA 4CUKA 5L7YA 4DYDA 2GERA 1DSSG 3VPSA 2RHCA 3ZWOA 4WLEA 3WJ7A 4TKLA 2HMSA 3LT2A 1ZK3A 2ZIZA 1LC0A 4XX0A 4J2OA 1R4MA 4OM8A 2GF2A 3ZWBA 3ONEA 3BTUA 4RF3A 2Y0DA 1EE2A 3F47A 4J90A 8ADHA 3VH1A 1E6WA 2VUSA 1DFHA 3ZNPA 1R0KA 2PR2A 3V2GA 2GPTA 2Q1UA 4D45A 3SBOA 5AXCA 3H5RA 3Q2IA 3R6DA 4GX5A 3NYWA 2JCXA 1CIVA 1IUKA 1NHWA 3C1AA 4B8ZA 1UDCA 3DBVO 4OHUA 3U4DA 4WNCA 1TA4A 3WGIA 1EBUA 2P9GA 1K6IA 2JL1A 1OMOA 4JBIA 4L4XA 1EUDA 4FC6A 4DWVA 4PGFA 1NPTO 3IAHA 2EG9A 1QSGA 4DIBA 1P77A 2B36A 2YY7A 1Y8QA 3RBVA 3KSZO 4YACA 7MDHA 1NYTA 3LLVA 3R0IA 5T6BA 1NWCA 1JAXA 2X58A 3ZV3A 3VH4A 2ZTVA 4MIEA 2DBRA 3MJCA 2DUWA 3F1LA 1H5QA 3WLEA 1AN9A 2FN7A 1MC4A 3WWZA 1Q7CA 4FGWA 3AI1A 3RC1A 1P0CA 2HUNA 2P9CA 2ZCUA 3PHGA 4Z9FA 3BHJA 3RUHA 4DA9A 4QXMA 1N2SA 3BMQA 2VRCD 3O26A 4XEHA 4BKOA 4E0BA 2YV2A 1O95A 3LF2A 1ARZA 4CM8A 3U4HA 4I1IA 2X9VA 4CR8A 5JDIA 3V1YA 4BKQA 4BO0A 1Y5RA 1Y5MA 1B26A 3AWDA 5L40A 5BSFA 1M6HA 2EWMA 2DLDA 3GHYA 1I36A 1LI4A 3UGKA 3NGLA 1YQDA 1S7CA 3PP8A 2YQ4A 4JJFA 1R0LA 3RQSA 4YXFA 1GQ2A 4K26A 1ID1A 4B7XA 2E4AA 4IDAA 4BUCA 3R3SA 4MIOA 1DAOA 2HSDA 4JP3A 1EVJA 3LC2O 3O9ZA 4XB1A 1A4UA 4UUOA 4XGKA 1LQUA 1ZK2A 5FF9A 5L9AA 3VC7A 4BO2A 5KOIA 2JD2A 4IZHA 4R5MA 1A5ZA 3GDGA 3QA9A 4B3HA 4TVOA 5TT1A 1W6UA 4P22A 5DULA 1O94A 1XA0A 4RDHA 1ENYA 1AHIA 1EDOA 2VT2A 3QVXA 3TZHA 2X1HA 3K5PA 5THKA 2VYVA 1B8PA 3GVHA 3MEQA 2A4KA 4C7JA 3WLFA 1QV6A 2ZK7A 1V6AA 4HNHA 1UXJA 2EF1A 4OXYA 1E1KA 1LDBA 3DOOA 5AOVA 2GSDA 3B1KA 1BXZA 4E31A 1UAYA 2FSVA 1FXSA 3DAFA 1ZSVA 4YJFA 3WFIA 3GLQA 1UAGA 2VZ9A 2PFGA 5FYDA 2VNAA 3A4VA 5A02A 4J1NA 1VJ0A 3H5AA 4E2YA 2O3QA 5HTOA 3GQVA 3ADOA 1I24A 4ALMA 4LRSB 3NDJA 4K28A 3WYEA 1P44A 2D8AA 3Q1LA 5B12A 1M76A 3BXXA 4IQ8A 4LSMA 4Z9YA 4QX6A 3GC6A 4II3A 1E7YA 4J4HA 4AJNA 1RM0A 1HLDA 2CDBA 2D5AA 1PTJA 4FJ1A 1KC3A 3BIOA 4CODB 3HHPA 3LYLA 2VRCA 3INRA 2HK8A 2NQTA 2J5RA 3WG9A 1C0IA 1UJMA 5U1PA 4EJMA 2UV8A 3TL2A 5BSGA 1NFRA 4GH5A 2C5EA 4L75A 4R54A 3S55A 3VPHA 4BVAA 2UAGA 5TX7A 4XQGA 3TZCA 3E6AA 2VTDA 4NZ9A 4CMIB 1E3IA 1UZNA 4Q3CA 2VWHA 2Y0CA 3TJRA 3VTZA 5ICMA 1GYPA 4HADA 1F8FA 1E3LA 2UDPA 4LCEA 4A2CA 3L6OO 1BXGB 2B37A 7ADHA 4ID9A 1LDGA 2EGHA 4J4BA 3GEGA 1RM3A 4NJMB 3DMTC 4Z0PA 5B4TA 2ZTLA 4ZU3A 3FCOA 3QY9A 4YCAA 4OGWA 4GSKA 4PLHA 3U4CA 3C24A 2ZB7A 4R1TA 3CMMA 5A03A 2EKQA 2C20A 2Y68A 2NVUA 4CLDA 5JC8A 3WYCA 3D5TA 1K3TA 3GNTA 2G0TA 3DC2A 1YDWA 1MFPA 2SCUA 4R3WA 1I5RA 2G5CA 1VRWA 2YFQA 2PH3A 1BDMA 2ILTA 5FEUA 3GVCA 1ISJA 1J6UA 5F1OA 4M54A 4AJPA 3NTRA 5I7SA 2YUTA 1I0ZA 5HM8A 3A14A 4UEOA 3OM9A 3IQDB 1LA2A 3VKVA 3ENNA 4RPGA 2HJRA 4J2HA 2PTGA 4XR9A 4W6ZA 3ANMA 3LU1A 2VNSA 4E2ZA 1U2DA 3EDMA 3TL3A 1BG6A 4LISA 2JCVA 4ZQFA 1J5PA 3PWSA 5C7OO 1JKIA 1GZ6A 3JQAA 3KV3O 2HK7A 4PG7A 2Q45A 2I3AA 3K31A 1E5QA 2C54A 2ZCVA 3MOGA 3U5TA 2J3KA 2HMVA 1GFSA 5ENVA 3OF2A 4RLHA 4YRDA 3ETEA 4AG3A 3GGOA 1MA0A 3VPGA 4FD3A 4CM4B 4RPKA 4HUJA 2C59A 3EAGA 3ST7A 4EEZA 4YT4A 5JCJD 4BNJA 4R1NA 1C0LA 1IY8A 5DBFA 1ZK4A 4YJFB 1KC1A 3KYCA 4YWJA 3O8QA 3WYBA 3CINA 4I9UA 4FIZA 4QUKA 3ICCA 3KSUA 5T73A 1JN0A 4LSWA 4OOFA 5IXYA 3TQHA 3HZZA 1L7EA 5DZSA 3GHHA 4EUHA 4MOWA 4PRKA 1X0VA 1B7GO 1ZUD1 3L6EA 4B4WA 4R5HA 2VWPA 4L73A 1X1EA 1H2BA 1LJ8A 4J0FA 1KBZA 1XDWA 3FN4A 5A05A 5CDSA 1NQ5A 4ZA2A 1P1RA 4BV8A 4GVLA 1PJTA 3QWHA 4IS2A 1R66A 2NM0A 1Y9AA 3RFVA 3ZU3A 4KUGA 2O3JA 2QYSA 2TMGA 3EYWA 2J8ZA 5H81A 4GKVA 4C7KA 3NDRA 4E2WA 2R2GA 1PIWA 3DHNA 4L76A 3F1KA 5I9NA 4IDDA 3L0DA 3ASUA 1F06A 3B20A 3GZNA 4ND2A 4TKMA 3G17A 4UUMA 5JDCA 2BMAA 3T7EA 1QRRA 4DLBA 3C1TA 2ZKLA 3MJEA 1DAPA 2P2SA 1P1FA 1JVBA 4ZQBA 3KYDA 3GVPA 4BKRA 4DBVO 2O2SA 1D8AA 2W90A 1FK8A 1EDZA 5IXSA 4BNTA 4PVCA 2NU8A 3RWBA 2YHIB 1ZSNA 2NU9A 3BTSA 2EEZA 3NT2A 2UUOA 4NG5A 3NV9A 3DHEA 3SEFA 4CLRA 4OXNA 4RGBA 4LGVA 4CMBA 1GU7A 1HKUA 2NVUB 2F1KA 3AUTA 4AVYA 1ZBQA 4MP8A 5KKAA 5T5QA 3DR3A 2JKVA 5EL0A 5GZ1A 3QVSA 4WCFA 1ULUA 5BSEA 2NADA 1AHHA 1LLDA 5KJ1A 1IOLA 1FDSA 2V65A 3ROQA 4WKGA 2VZ8A 5A3VA 3CTMA 2Q99A 3JQFC 3ZV5A 4DUPA 2JCYA 5L7TA 2I66A 4BNWA 2B0JA 4KWIA 4P4GA 1RYEA 3DMTA 4ZICA 3AFNA 1N1GA 4EUFA 4Z0HO 4RORA 3HJAA 4OQYA 1ADCA 3HDQA 3KVOA 4LVCA 4F6CA 2VQ3A 4N54A 3CEAA 2B83A 1XYGA 3I5MA 1ML3A 1TVEA 4MVJA 1N7GA 1VPDA 5JBIA 2EHDA 3G0OA 1U7HA 1GPJA 1RKXA 2CMDA 1JLLA 1L7DA 1MX3A 3OEWA
chains in the Genus database with same CATH superfamily
1M1NA 1VJDA 4YJHA 2IHNA 2I2WA 3EVTA 3KE8A 1RQ2A 2O50A 1CJCA 1XZGA 5EGNA 3AR4A 3RSOA 2VKQA 5KVSA 4F56A 1P5JA 3G2JA 1U0NA 4JHXA 4B3CA 3C97A 5F21A 4KODA 4K9QA 1FRFS 1RNLA 1G6KA 2MR5A 2QYOA 2VPPA 1N7HA 2ECFA 1ZD3A 3B52X 3FMIA 3JASB 5CUQA 5DTQA 5HBRA 3TTUA 5MFZA 4N76A 3NMUF 3FZYA 4EG6A 1QE0A 2XYGA 3P20A 2P7HA 4P7GA 4ZV7A 4LHWA 3JQGA 2BRUA 1JLMA 3ZWCA 3W2TA 1ZIPA 4H7IA 1PZXA 1W30A 2OHHA 2R97A 3I28A 2Z8YM 4N49A 3E4CA 3EF1A 2JGDA 3W8EA 3NC0C 2CXOA 1AE1A 4GMDA 1U2RA 4PICA 3RFTA 1QVRA 3QKTA 1UFKA 4F7DA 3K6JA 1JE1A 4BLSA 5U4XA 3S2ZA 5IXJA 2XQGA 1GDTA 3P9KA 1JAIA 2QWXA 3C7KA 1NVEA 2BLNA 3MERA 4ZRMA 3ZW7A 4B44A 4Z3KA 5A5VA 4YYZA 2C83A 3BH0A 1NTOA 1TQ8A 1JIVA 2YHUA 2Q4BA 2W2MA 3Q8LA 1Q74A 3V4RA 4F96A 3QITA 4Y2QA 5CFPA 2ZETA 2PHZA 1S6YA 4Y6RA 3ZHZA 1SZPA 5ESRA 3AX6A 3DJYA 3LQKA 3VYVA 4XR4A 1NXVA 1K2WA 4F46A 5LZ2A 1JX6A 1S89A 4AZ0A 4DOMA 4YAGA 3B7GA 3Q1KA 3MWJA 1V39A 3AV0B 3BIJA 1NULA 3PWKA 1PD1A 1R15A 1XQWA 2WP8J 3TN7A 1OHHA 2FPLA 5ARBA 2KLBA 3P32A 4MNTA 5E3HA 2VHWA 3EBOA 2JRLA 1CZRA 2XMDA 3ECCA 1I2CA 3RVPA 1D7OA 1L5FA 1D2NA 1Y37A 2WU8A 1P2DA 3PF8A 1QBKC 2W6PA 1IPHA 2VPYA 2WWIA 1LEHA 1EP9A 2BGKA 4MGZR 4F11A 5K8JB 1EVLA 2YRXA 2H0AA 5FBLB 4FCTA 5K7SA 5KNBA 1R7RA 4MQLA 1AKUA 3N8GA 4REQA 4CBVA 1J8YF 1VPLA 4U2GA 2Q2NA 1KGSA 1J7KA 1VMDA 3NPAA 4HZUB 4ND8B 3VV2A 2FMKA 1Z4IA 3RRBA 1Z2CA 2P5UA 3G7NA 4DLSA 3L9XA 1TMOA 2H65A 3CLUD 5IK2A 3BJZA 3MWKA 3AR9A 4L57A 3W5IA 3I9JA 4WMLA 1X0XA 2P6PA 2SICE 4MH0R 5AHXA 3T06B 1E79A 2FWBA 4IS3A 3HH8A 4LJSA 3VZPA 4KFUA 4ZOLB 4JCOA 3OTQA 3BGDA 2PBFA 1E9CA 3MHPA 3EX7C 2NP7A 3SLRA 5MN5A 1L5VA 2QAJA 4EO7A 3HJBA 1WHSA 1HWYA 1N1DA 2PL3A 2ZAOA 3T0IA 1E5DA 2ESRA 3PR2B 5BT9A 4IRMA 3ZG6A 1ZEMA 4U7FA 3IKTA 1KY3A 3CF6R 4NBKA 4JLOA 2F3UA 1PO7A 1GPH1 5LYJB 3WIOA 2PLNA 3H9QA 5JS7A 1U3CA 3EH2A 1RCFA 5EYPA 3WKEA 2RCNA 4W9NC 2ZTMA 4G01B 4GDFA 1R37A 3MMPA 4JC5A 1BOFA 5P21A 3L1IA 4MK4A 1L1FA 3WRYC 4A0RA 4F2DA 1JEOA 1XZKA 1KU0A 2OV1A 1E3JA 2GCEA 3JALB 4QAQA 3VDXA 4BP8A 4M2LA 3GT4A 1ZD5A 2Y99A 5EFOA 1NNSA 3O2JA 4RHCA 2FSVC 4TN1A 3WK9A 3OEHD 1E9DA 2ZULA 4NG4A 4AG5A 5D2CA 3OE4A 4E09A 1SWWA 1SRQA 1ZUNB 3F78A 1ZZGA 5ED0A 4O4JB 1NURA 4ENVA 1MTZA 4FOLA 1SQSA 5SYNA 2R4UA 1EUYA 4QTYA 4D8WA 3DEHA 4XARA 3L7OA 4K9PA 1FP6A 4LW8A 5GOZA 2G08A 3CLTC 1LZLA 3LFUA 3R1IA 4GG1A 4PR3A 2INGX 4QLAA 5AJWA 3OC0A 1WBJB 3Q4GA 3LOQA 1EUQA 1U6KA 3ETHA 3EIEA 4M88A 4UUNA 2PXAA 1KP3A 3LWBA 4TUYA 4ZOLF 5F5NA 3RU3A 4BRSA 2C5FA 5FTWA 3RYTC 2V0GA 1CUUA 3DOEA 4DLKA 2QVZX 1X19A 3N8KA 3REOA 2GRAA 4OAPA 4R8MA 4E4TA 2PX6A 4KLNA 4PE5B 3WICA 2JGIA 3KWLA 1DBWA 2VJQA 4F2WA 3C3EA 2NU7B 2WB4A 2E49A 3CNLA 4JOBA 4RIEA 5CPBA 1C0EA 5EKTA 4B3GA 3ZVRA 4K0KB 1ZK1A 2CVFA 4NCKA 1C0KA 2R8YA 1AKEA 1EP3B 5DHRA 1ENOA 1OUMA 3RUCA 3O4GA 3U80A 4NMXB 4AJ9A 1V8PA 1FX0A 4MUMA 2JFFA 1Q7BA 1Z6PA 2X5OA 2BI7A 3CNBA 3O84A 5TIIA 1AHNA 1DG3A 3C15C 4KZPA 4CN9A 2PMEA 3ILHA 4P7FA 4GLFA 4HUTA 4UZFA 2V03A 1QV7A 1JBQA 2Z56A 3TO5A 3JZIA 5HUHA 3IDAA 5GOTA 4YMHA 1TAGA 1BH2A 2BFCA 1AGYA 1XVUA 1WVIA 2AN1A 2I0FA 2KWIA 3AR3A 3KT8A 3NHMA 2C2BA 3KKOA 4R2XA 1D09A 4NS4A 5DTRA 5DXFA 3C6QA 4CMKA 1QZZA 3W05A 1V4VA 2HBQA 4OHFA 4A9AA 1OFTA 4C2TA 3CSUA 4BBZA 2HJSA 4OXIA 4B8YA 5I6DA 4DC1A 3IQGX 1XI2A 1U9IC 3CF4A 3I42A 2VT6A 1PQPA 2X0IA 2FZGA 4G5GA 5BMOA 3F49S 5B3KA 1ZR4A 3IMFA 2OFFA 1PZFA 5FOWA 1QIEA 1CTQA 3TW8B 5IKEA 2IW1A 1JLRA 2BGTA 3KSBC 1UBEA 2JFVA 4RKRA 3GAZA 1E6KA 4OL9A 5SYAA 4RZQA 3ER8A 2ENWA 4GYKA 1H5NA 1XCGB 3A06A 1KNXA 1C8VB 1QRTA 3RUIA 3IWBB 3AVWA 2HA4A 4CM6A 3LC1O 5CA0F 721PA 4I5DA 1ECJA 2E7ZA 5AVYA 1RE1A 1UKYA 3LH5A 3NYQA 2ZRKA 5TMDA 3ZWXA 4BN4A 4E1VA 5EIOA 4RVHA 2HUPA 3VSCA 1G8PA 2O7VA 1I2MA 2ZE6A 4M1SA 4ECAA 3QQ5A 3CX4A 3ETCA 4WUTA 2D5CA 5L3QA 1NASA 5DI3A 5HCIA 1E1QD 2BEJA 3TOXA 1H2FA 5IF3A 1M34B 2FUKA 4BNXA 4I19A 1DBQA 3KVRA 4LX0A 3Q9NA 1SKYB 3HDJA 1C1HA 1P7PA 1WV1A 3HMKA 3NAQA 5MN6A 3EXFA 3WDSA 3R5FA 1AUVA 1DDIA 1UDAA 4HDOB 1UAAA 4GU5A 3V8BA 3WIUA 5AK6A 3RSQA 4NY1A 4CMJA 3RS9A 1HE5A 1JLSA 4QFDA 2ZB4A 4BVKA 4RVDA 2RGXA 1T9BA 3DZ8A 4HMOA 3AVOA 2FP3A 1WL8A 1XU4A 1DTWA 4NABA 2PX2A 4PLTA 4K86A 3H1GA 4L2IA 4PX2A 4BIMA 4M76B 1VCOA 1WD7A 2DUUA 1S2OA 1G7SA 2AYXA 2MYUA 2SHKA 5E1DA 4D8TA 5IKPA 5JAMA 4HDRB 3FOAA 1RKVA 1ZN8A 1ZN2A 3NW9A 3T3PB 4YRBA 1BN6A 2H92A 2P91A 4B87A 2Y1KA 4J7AA 4OGFA 5HDQA 1QYDA 3VDMA 2XMZA 1HE4A 2DPYA 3NXSA 1PKXA 1XQ1A 1ZH6A 2P6MA 1CJTC 3DE2X 2Z9DA 5J4VA 3PKIA 1D1SA 4TLEA 4TT3A 3J81k 1FYWA 1PQYA 3DF9A 1QHYA 1TTQB 1GAQA 2VRNA 3I1IA 3MUFA 1I7MB 5CTAA 4D80A 1OAAA 4YMVA 4Z4EA 1CULC 3F9IA 1WB9A 1UZMA 2XIJA 4NBRA 1RWXA 1U7PA 5EUCA 5AXCA 1MW9X 4GR4A 3SDSA 4BCCA 3C8MA 5TVKA 2AN9A 2NSHA 2P41A 4JR2A 1XAJA 4RPHA 1E4EB 3AEQA 3AHFA 3BBLA 3WL3A 1U5BB 3BJMA 1PWHA 5HSGA 1QDUA 5HOEA 1N2CE 1T5OA 2VJMB 4FI3F 2GZ3A 3JD4A 4D9GA 1Q1NA 1BU5A 3QHAA 1EQAA 4OHKA 4RK1A 1KZ1A 3FLAA 1CHNA 3A2LA 1VSVA 1ZN7A 2G7MC 3IVAA 3ASYA 4O1IA 4JP8A 2IHJA 4PSUA 2CUTA 4LJ7A 4F5ZA 5DNWA 1ZQ9A 3W90A 1NW8A 3B1FA 4Q3OA 1FCJA 1MB9A 4CN8A 3Q11A 2ZUVA 3PCXA 4XKJA 3P0IA 3A6EA 4QU0A 3LPDA 4PYQA 3TTSA 4NYIR 2GN8A 4QXAA 3BZBA 4UXIA 1X15A 1K5GA 1G7TA 2B35A 2HGZA 2JA2A 1QMGA 2O8CB 2EV9A 2JZCA 5IHPA 2BEUB 3BC1A 2ZQZA 1T8SA 4R98A 3T7JA 4Z5XA 3MT0A 4CIAA 1ESEA 4ABTA 4D8YA 5AXDA 3V2IA 5FWYA 1V71A 1XZDA 3CPSA 4GRIA 5CA0A 4K6OA 2A57A 4DILA 2HHCA 2AG1A 2FK7A 2QVYX 2W7TA 2E4UA 2Z2XA 2IHVA 2DR2A 4GYWA 1KOLA 3AJAA 4PHTA 2OTCA 4QPPA 2HK6A 5CDTA 1AXEA 1MV8A 3D6TB 4MQEB 1ZI6A 2C00A 2W6IA 3FTCA 1P9LA 4Q3BA 4A3SA 3HCEA 3UBTA 4BNMA 3OP4A 3LY9A 2C7GA 1XA4A 2ORIA 2ZBGA 3KPVA 3ISJA 2H2WA 2E4XA 3FI9A 1AM4D 1PEAA 2DQSA 4ARUA 1BWQA 1NE2A 1WPQA 1G21B 1KZYC 2DUNA 2PZMA 3JQ6A 4KX5A 4I0WB 4LDQA 3PFHA 4IW3B 5CLGA 2O57A 2V7WA 1RM5A 1H85A 1HXHA 2H6EA 4X8HA 1V7PC 1NW5A 1RR6A 4WWHA 5ILGA 4OI1A 3V6MA 3JR3A 5LIRA 3HZRA 2EDAA 4CYMA 4PZZA 1JFRA 4ID3A 1HQYE 1Y1TA 3B6ZA 2PKQP 3JV7A 3ZH2A 4M8IA 4KO8A 2W2OA 3Q98A 3ESXA 4KVAA 3C6MA 3RTBA 2BBWA 1STOA 2V96A 4C7XA 1PVVA 1GZ7A 3G8AA 5JLJA 1IBLB 3L7LA 2AVDA 3A1FA 2K7ZA 2RHDA 3CG4A 1NXWA 3O8LA 4ND5A 4MVJH 5B4VA 1BRMA 1KJ9A 3RS5A 3A9VA 3BQNB 4TT3D 4MYSA 3A1TA 4MGIR 3O94A 1ZC4A 2P5TB 3G9ZA 4QL3A 1UWKA 4PG8A 3T4XA 2PA3A 1PFQA 4H1UA 5H5JA 3OLCX 1JILA 3LT4A 2Q7DA 5CYFA 3BERA 2CNDA 3CQ9A 2Q7OE 4CKBA 1D5CA 3QKIA 4OK6A 1TM2A 2CJWA 2H1FA 5FTMA 4R1OA 1DFIA 4KUEA 2YZMA 4C7BA 2CLDX 4JYBA 4DN6A 4RLSA 2ANBA 2P6UA 3LE8A 3SNHA 3K73O 4DJJA 5JXGA 2R5WA 4OP2A 1O8CA 3OEHA 3OE5A 3H9GA 4DPKA 2I34A 3WISA 1SUAA 1HDEA 2CL5A 4L4ZA 3KJZA 5REQB 4CKZA 1SBZA 2XB8A 3IDOA 3UJNA 2JRCA 1YJQA 2BBOA 4EW3A 4EJ0A 1QTQA 1LDEA 4M0FA 3IA2A 5AKHA 3HKBB 2F1JA 2R4TA 3D0RA 2JFZA 2BWJA 3WKDA 2Y93A 2XGJA 1NF2A 4DDTA 2IZ5A 3H3JA 3L1VA 3NZEA 1YF3A 1JTVA 1DC4A 4HSEA 3GR6A 4XDYA 1B23P 1LI7A 1CRZA 4TV8B 4UW9A 3GJXC 5DT9A 4WINA 1L3IA 3TEJA 2Y1CA 4JH0A 2O1XA 4YB8A 5DSTA 5LJIA 4CL8A 1UK9A 2A5JA 2FVXA 4DLNA 1FLAA 3UJBA 1Q1GA 4M1ZA 4YO8A 3TI9A 3CGWA 3H11B 3DO8A 2FX3A 4MS4B 4DNXA 1YT5A 5K0ZA 4MDEA 3QZUA 1VL0A 2CMHA 3R77A 1VB5A 2XB9A 2X8AA 1JWLA 2Z1NA 1X87A 1O5IA 1C30B 2WJGA 2PQ2A 2HNKA 5IVPA 2PS3A 5AW7A 1ND5A 2I55A 2GEKA 2J33A 1RYFA 3CZQA 2M9MA 2AJDA 4K9NA 5LLDA 2G83A 3UJ6A 4FMDB 4P3PA 4CG1A 4G6ZA 1TO2E 9MHTA 3GV0A 3K9FC 1D4FA 1IM8A 1GGJA 4TLLB 1FIUA 2FUNB 2A5FA 3N07A 3C6XA 1MX5A 4RAQA 1AUQA 2CMKA 4PNPA 4MWCA 3PXGA 3OQPA 4MROA 1C41A 3BX1A 3T7IA 4TM7A 3JAKA 3GCGA 1S2GA 4IGIA 1GN8A 3QFSA 4I99A 2V7UA 4RZHA 4TTIA 3WR5A 4XWOA 2HWXA 3ZJVA 1ONNA 2TMKA 3BD8A 4U8HA 4KHZA 2IYOA 4RFSB 3I9OA 1JHQA 2GEBA 3EHEA 3HMQA 4UVEA 4B4KA 1WU8A 4B3MB 2WNSA 4ND1A 4Q9JA 2XOXA 4Z7JA 2VCEA 4ZTUB 2QXUA 3COPA 3ISVA 3PSAA 1JR2A 2BL4A 3FCAA 4LTNA 5J4LA 5C53B 2QLLA 1VYHA 4L22A 1N1EA 1QTIA 3AZQA 2AK2A 3IIIA 1AA9A 3H9UA 1LRLA 4RMHA 3E9RA 1HM5A 4DM7A 2GFQA 4YJGA 1S2MA 5AUQA 3BKXA 4BCBA 3LCRA 3SDZA 2JLYA 4LHEA 3LUHA 1GKYA 4F72A 4DT1A 4QM7A 3GFTA 5GIPE 1C7ZA 1JALA 1ODLA 5HGJA 4G65A 1T5HX 2LBPA 3C1OA 4UMVA 3VNRA 4MPPA 3T5PA 1M2OB 1K7FB 4TLBA 4C88A 1N34B 1DCMA 1LPPA 4Z1MD 1AKRA 3NONA 4I55A 4ML3A 4MWZA 2QUKA 3L40A 4DVGA 2WUFA 3N9IA 4DZZA 3T3MB 2P79A 2P9ZA 4J16A 4AKEA 1QP0A 2OKGA 2YZ7A 4PSDA 1UIMA 2ODNA 4MV8A 3TUTA 2EAUA 2ATCA 3BGIA 5JYFA 1D6MA 2WWVD 3LLMA 5CPFA 1FNNA 2NGRA 2QR5A 4UAUA 5AUOB 1WDLA 1Q0LA 5C8XA 4EGAA 4EVQA 1FLVA 1PK8A 4EI8A 5BSKA 1RQGA 3IQZA 3KPWA 2QNIA 1O9BA 2FI1A 4ENRA 3U48A 1WPRA 3AUSA 5CXXA 4E5MA 2ZT8A 3ZCVA 1KYXA 3OZBA 1R4ZA 2GFIA 3CY6A 4JBXA 5KYUA 4B75A 1Z8NA 5D86A 3VNSA 4EG0A 1HDIA 4E5VA 2PBZA 3ELBA 2WYIA 5C8YB 3VYWA 2VR1A 4JFAA 1ZD2P 4OBXA 4NU0A 4LJKA 4Z1OA 1XBTA 1VC2A 2J3MA 2IEGA 5AW6A 4PIMA 2IK8A 5JSHA 5LJLA 4XUEA 3MCWA 3GZJA 1QCYA 4HVTA 5TGTA 4ZYYA 1HO3A 2JFYA 3DMPA 4FYPA 4G89A 4LRYA 5T3UA 1GNLA 3V1LA 1T8WA 3QJYA 3ZN2A 1AV7A 4TYNA 3LF1A 1RABA 3CVWA 3R4CA 3D8NA 4BB6A 2FVYA 3RFXA 1E7SA 3TB4A 4RCYA 2YY5A 5IZCA 4YY3B 1YR3A 1VLVA 3GLIE 4R9NA 3STXA 1KOFA 2VFAA 3QE4A 4F9GA 3R0QA 1Z4NA 3AIIA 5FR2A 3WYGA 5AJTA 1O7JA 1JTFA 2ZJ4A 4TVKA 2NUPA 4D42A 1NMSA 4X5OA 2O3SA 2GDJA 4MW6A 4ILKA 4EB6B 5JHHB 2H2DA 3ADPA 3UCXA 3ZZNA 3L1JA 5LD2B 2XZPA 4P8RA 4JIMA 2PFSA 1P4RA 3TW3A 1AS3A 3UJHA 1CS0B 5JY6A 1TVKB 3QWBA 5C7IO 1C9JA 1IIRA 1MGPA 2JARA 3ZJ4A 4E11A 3ESCA 4EF6A 5CFRA 3T3HA 3IUYA 2H0RA 4US0R 2GTIA 4GI3A 2GR9A 2JBAA 1GUAA 1H2ZA 3SXPA 5IFLA 4CF5A 2IRWA 3PVCA 2OBYA 4M22A 5JOQA 1Z88A 2YQ5A 4IJMA 4UBNA 1NVUQ 3ROEA 1UOOA 2RAFA 4W82A 3SPXA 3CKKA 5AUPB 1BRTA 3D1LA 3EC1A 3HR8A 4ITUA 5AQ1A 1GAWA 3A3PA 4UEJA 4AS3A 1QF9A 1QIJA 3H5OA 5CJPA 2RBEA 3AVTA 2NU6A 4LBZA 4CLHA 3JYNA 4CMAA 3EZLA 1E6LA 4C0JA 3CB2A 4RBNA 5DEIA 4DAOA 1SD1A 3L7KA 3T0GA 4RFSA 2I67A 3IMKA 3KO8A 3MA0A 5B1DA 4PG6A 2XHZA 4NBNA 3RVRA 5A1TA 5BNIA 3TS1A 5CVCA 3JYPA 2J0UB 5C8YF 3U19A 3T5MA 3AF4A 4J4TA 3OIVA 4AG6A 3OE1A 1M54A 1MG5A 1G8KA 2BC9A 2ZUCA 3H7AA 4OQZA 3LL4A 4P3KA 5EEHA 3TLJA 3AL3A 3BM5A 4TWRA 2JBHA 3KB1A 1QFZA 1GPKA 4N0EA 4DRYA 5BSHA 1BYIA 1BJTA 5HK8A 5J4HA 2E3JA 4RWEA 1BX3A 4XJTA 3A1UA 4FS3A 4G37A 5IULC 1QHEA 4EG3A 2QRPA 5JVDF 1BVUA 1TCVA 3W1VA 1X7ZB 3TSCA 2XKJE 2JJ8A 3TW8A 4RHYA 1TF2A 1U0SY 2ZBVA 3G0BA 4RANA 4YWHA 4EG8A 2C5BA 2I4LA 2DT8A 3N1UA 4KBFA 1WDWB 2Q2QA 2V6BA 3IL2A 2HWWA 2MSLA 1VCMA 3IO3A 3AUYA 4UULA 3CF0A 2ZAMA 4I50A 4OM7A 4HT3B 5IANA 2JIMA 3WRWA 4E7OA 1SBYA 2VBCA 2VK8A 3A4YA 2QAGA 4WA8A 5B53A 1OLXA 4PXSA 1HLGA 2CXXA 3U3KA 1F4PA 2W42A 2HRBA 4IICA 2WSSD 2PR7A 2WYVA 1VIDA 2PBLA 3EEYA 3IGFA 4RFLA 3TLKA 5BV0A 5CW1A 1XMIA 5ITSA 3EEQA 4LY9A 4YJ3F 3LT0A 2IHBA 3DONA 4I8IA 2YMQA 1O08A 4GS5A 2FSSA 2FQXA 5CH3A 5DLQC 3QSYA 3P52A 3WMFA 2BM9A 2AMYA 3RJ5A 4WKBA 4XQCA 1PL7A 2MR6A 4U6NA 1R9MA 3ROZA 3GGDA 3C5EA 3UQYS 3CIOA 3M1IA 5AKGA 3D5QA 1Y8RB 3O8DA 5AJUA 4JC0A 5BQXA 4Q12A 2PIDA 1A72A 3OPYA 1DPGA 1BROA 4GMKA 5E2BA 4ZN6A 1XYYA 1OB2A 3RREA 2FWJA 3Q6NA 4NBUA 3CBGA 4B3DA 1MAUA 5C1PA 1JA9A 4R2MA 5JARA 1PR4A 4AWXA 2POQX 5M6DA 1Y1SA 3DVLA 3IMGA 3LAWA 3OEED 1Z35A 4HAVA 5FYQA 3X43A 1PX0A 3L0OA 5AM4A 5B1YA 4GAEA 2XB2A 5IMSA 3LP8A 3GCWA 1PNOA 1QVAA 3C3YA 3TAUA 2QD1A 3V7YA 3AY0A 1JFSA 1CCWA 1WHTB 4P7JA 3OHPA 4JL6A 1DX9A 2VAWA 3VI3B 1KEUA 2YBEA 3G2HA 5GVRA 2NXEA 4IDQA 4K87A 5DNYB 4K9RA 4IPTA 2MDTA 3DZIA 4DMCA 4UBKA 4IMIB 3A31A 4Y6LA 4K2HA 3BH7A 5A9RA 1JXMA 3SKYA 2VNIA 4O5OA 1J20A 1YJ8A 4M38A 2HRQA 1CKEA 1NVWQ 4RADA 4WA7A 1XK7A 3S2IA 3UIEA 4AZVA 3N2EA 4PM4A 1G8AA 2XOKD 3AMVA 3SJUA 1KFJB 1MC5A 4EB8A 1NU6A 1GTJ1 4NPCA 3WQRA 2SKCA 3P26A 5CR9A 4XIFA 2W4MA 5CD9A 4HLCA 4EW2A 2B1JA 1FFSA 3DYBA 3AP1A 3TDMA 2OC9A 1U9YA 4XVCA 4XVQA 1IZYA 2PSEA 1CLEA 2HSWA 3DW3X 3EVAA 2O2ZA 3HBFA 4FHEA 4WN9B 5DXJA 1S3FA 1V95A 3TCKA 1RYZA 5IZ4A 4YBZA 3PDUA 1QCDA 2L0XA 4XVHA 3RKRA 4NBLA 3HVRA 4LJRA 2AXQA 2LR0A 4JKYA 5FFMA 1E5XA 3IE1A 2E55A 4IX9A 4PQEA 1RQRA 4YRRA 4ZOBA 5LBTA 3ZTTA 1G66A 1OXUA 4R2HA 5AKZA 3EXHC 5IDQA 4IJQA 4Q4DA 3TOVA 2JANA 4EVRA 3GK3A 3U7QB 1I0IA 4O2LA 1D0IA 4O2BF 3TIGA 4A36A 1APBA 3E0QA 3I9NA 4CV3A 3HYRA 3W7BA 4C0QC 4XYGA 1GPMA 1U2QA 1P5ZB 1YB5A 2ZBPA 4EHBA 1U63A 2EIHA 4OATA 1G8JA 5LVAA 1O6GA 1E2PA 1TVCA 2FPRA 2V54A 3W8FA 1LSSA 4TTAA 1OBVA 1OLSA 2ZYGA 2GNAA 3C3WA 1JYSA 4DR1B 3UZUA 3NX4A 3U37A 3TX2A 5F9FA 3GT0A 2XKAA 5EQTA 4BAGA 1J2YA 3DB1A 2DPGA 3C16C 3HB9A 3FGOA 3QJGA 4E15A 3X1DA 4BWVA 4FINA 3A4LA 3TB6A 5A6SB 2ACWA 4YP1A 3Q0EA 3DBLB 4LXQA 2PU5A 1IXKA 3TVDA 1PLKA 3B5JA 1FTGA 1M34E 3FPHA 3V3TA 3JWJA 5ALLA 2P3QA 4EYSA 4F2HA 5G2OA 2IXBA 2FMXA 3DG9A 1Y1LA 5FO1A 2UYCA 1MX1A 3Q72A 3SQLA 4B33A 4TVSA 3ZE9A 5BSWA 2FZKA 5JD4A 3KZ1E 3IFSA 1RAEA 1QFMA 2XADA 4X1IB 2Y27A 2M1ZA 1J8FA 2EKZA 1FF9A 1KR5A 3CNEA 3RRFA 5GINE 2DETA 2QRLA 4HF7A 2TS1A 4AJIA 3OJEA 4PPNA 3IILA 1KK0A 4B3FX 3K15A 3LX8A 4KMRA 4B4UA 3OF3A 3W2EA 5LP6A 2P3LA 4CR7A 2I6XA 2K4MA 3EK2A 1AGPA 3R8XA 4D46A 1CRLA 2EU8A 3I53A 1C1DB 3D0QA 2BV3A 3ZV6A 2NWQA 4PLPA 4DPMA 1U9IA 2HA6A 2XUFA 3JQ7A 3KUKA 3QVUA 4L28A 4R9SA 4RYDA 4X1KB 6ABPA 2IXTA 2JLZA 5U4QA 1AG9A 2B3TA 4PQFA 1E8DA 4RTJA 3HKDB 2O0HA 4H27A 1FL9A 1MDFA 1U4SA 1Y1PA 1FRNA 3P94A 4P82A 4WSOA 4KI0A 1Z37A 1JV2B 1WMEA 3VX3A 2ZR9A 3K09A 3AY6A 3UV3A 3AL0C 1CK4A 4C6RA 4YLYA 1EYZA 1K5PA 1N6IA 1EPUA 1M2EA 2ZRLA 3OM0A 3HVIA 4OG2A 4RESA 4UUBA 2GBIA 1BWPA 2XJ4A 4G07A 2NUTB 4YAFA 1Q5PA 5J2UB 1WF6A 3TBKA 1NI3A 2I33A 4MGYR 2Q3DA 3D8SA 2X5XA 1NBOA 4G0NA 4GLOA 3E3NA 2PS1A 2CV1A 3THYB 1ZIDA 2FSIA 4K7JA 1LTQA 4BGIA 5AWFC 2NACA 2GZAA 1T1GA 1MB3A 1SKUA 2WYWA 2VUHB 4UXJA 5GVSA 5KC8A 3TIVA 1YXMA 2IZOA 1HF3A 2N1BA 1QQTA 2PA0A 4RCVA 4REQB 1CR0A 4KO3S 2BTEA 1RWQA 5IC5A 2JLAA 3N3BC 5HJ7A 1NYQA 1PW5A 3GJ8A 2DBQA 4WBNF 2EP7A 3G6WA 4BB0A 3ASVA 1A3CA 3GVXA 2CUNA 1ZJYA 1TIBA 3SR4A 4E03A 3I5XA 2L19A 4NYJR 4S1TA 5IVHA 4ZP1A 4ZJUA 3ORRA 3WZMA 4F4CA 5FUQA 1SVWA 4UQOA 3KP1A 2PSDA 1EJ0A 1L5WA 2CC2A 1VG0B 1P2TA 3B8EA 1DC7A 2QLTA 1NDUA 1CQJB 2FP4A 2IELA 4OH7A 4P9NA 1U2TA 5CNMA 3M6WA 5ALQA 3GRKA 1GO2A 4YC7A 4YFYA 3ZZ1A 3R5XA 5AW8A 2CHGA 3WMEA 3N5CA 2J0QA 3KTFA 5K01A 1G63A 1RKBA 2VDQB 4F71A 3ETDA 1SHZA 4KN6A 3O8RA 3KXPA 3H9JA 3I92A 3PXXA 1F12A 1CUEA 3CE9A 3ELYA 4IWYA 3OA2A 2JGAA 4AZTA 3VR5D 5U9CA 4WNYA 1K3UB 3D9QX 3IRUA 3VSEA 3HQ4O 1JDPA 2G9VA 2JDIA 4E51A 2H4JA 1VMKA 1G9TA 1LPBB 3VTFA 2BEVA 3OIDA 4LNHA 4R51A 3G2IA 4DA8A 4PLZA 3HUEA 2WF8A 2W0SA 4L5AA 1II8B 4OQQA 3U3JA 4D26A 4WGGA 4IGEA 4YA6A 5K9ZA 4CV0A 4WZBE 3UT6A 4BV3A 5HUQA 7AT1A 2NVWA 4EY6A 3AHEA 2O6LA 2QTHA 1O8BA 1RXIA 4HTFA 2QENA 4M98A 3I5YA 1U2SA 1WG8A 4WNAA 3L7MA 3OZRA 1YU9A 3C8UA 1RI5A 2BKUA 3SD7A 1BZYA 1QPBA 2REQA 3N7TA 3O75A 4U7PB 5FNVF 1NHGA 3WSWA 4AY5A 1GR1A 4OQXA 3OUUA 3KYIB 3NAGA 2QJWA 3KJEA 5HIJA 1PLLA 4BQIA 4YP5A 1I4TD 2PX5A 4QE3A 3GZNB 2GPYA 4H1WA 1DQYA 2J4DA 4INZA 4FMPA 2G28A 2HQSA 2X1VA 2ZG6A 3NIBA 2F3TA 4CUJA 1XWWA 2GTPA 2VXBA 4LOKA 5HG0A 1Y9ZA 5TV2A 4B81A 3F9RA 1CJKC 3ANXA 3BCUA 4DSOA 3HG7A 5JADA 1PJLA 2IYNA 2F7SA 2C2HA 2CXRA 1QOZA 3B3QA 1RZRD 3V8NA 2OR3A 1MO2A 3C1UA 4JSRA 4ZVUA 1SKAA 3GD7A 5BSMA 1TU0A 2BONA 4B2LA 3PIDA 3ERCA 4DLZA 2WSSA 4PX3A 4FGKA 5EA2A 4B85A 2QY9A 5HNKA 1H3NA 2FRDA 4KWTA 2COEA 1KBQA 4PHHA 3CGGA 1YR2A 3HB7A 1CX9B 1E1YA 4QEKA 4N6NA 1OF1A 3AKDA 4V0OA 3FCUB 1VJ1A 5D3MA 4EYQA 4V1CB 4OGKA 4LSGA 4EATA 3F6PA 2IH2A 4JI8B 4NENB 2GH1A 3DEFA 4LWOA 1NRXA 4N01A 1ZNQO 3CRNA 1R8SA 3VR6A 1IJFA 2XSZA 1OPRA 3EP4B 4PZAA 4RD3A 4NCIA 1Z45A 5DHAA 2XNHA 3SLKA 4E2FA 1E5TA 4X8OA 1P31A 3GFPA 4ZDWA 1H0RA 1GUZA 4MVJF 3LPAA 2HI0A 1VMEA 2VTEA 2JFNA 2Z83A 1MU0A 2G6BA 3N7UA 2HF2A 1Q16A 1PGNA 2CDNA 4WESB 4J0DA 1P60A 2BFEA 4MKIA 2DYKA 5JAQA 5FEMA 3ROXA 1THZA 1XRSB 1JIKA 3NYRA 2RB5A 2ZRDA 4I4TB 4DJTA 3SC2A 2V7PA 2NAPA 4F3NA 4UATA 3HO1A 2E6UX 4NCXA 5LPNA 4GX0A 3T4PA 1P3JA 2EW8A 2XVZA 3GRPA 3OFJA 3RVQA 4H1HA 1NLZA 4Y6PA 1SIWA 3RAJA 3LDHA 4B80A 1CUHA 1YCFA 2KLHA 2ERXA 4AUKA 4QATA 4X62B 1EU1A 4H15A 3SSNA 2TMYA 3GLTA 2DBVO 3QGMA 4DRXB 5AT1A 2V7GA 2WJAA 3MWDA 4FFSA 1K8YB 2HW8A 3K6SA 1II9A 4IQFA 5AXAA 2AR7A 1MUUA 4HGZA 3SVLA 3TW6A 2AMJA 4PZPA 5D1NA 3QW2A 4S1VA 3QRWA 2NUPB 4UNPA 5BV8A 2AE2A 5LOVA 1GPDG 2G40A 3V8VA 4LTDA 4K6CA 4ND3A 1M0TA 4YCMA 5AESA 2D7DA 4UTZA 4F4DA 2FZLA 1KR2A 1WXWA 3FCYA 1NJGA 4IUDS 3PQ6A 3PXEA 1NW7A 1AF7A 2GVDC 2WIFA 4OB7A 4TS4A 3VR4D 5FV4A 4HWSA 3RSHA 5ES3A 3RH0A 4BMVA 1NBEA 2XUDA 3H2SA 1OX4B 3MUNA 4FR2A 5IS2A 4X97A 3N05A 5ALKA 2DTDA 1Q0UA 2FEOA 4MMZB 1FS5A 4MW9A 1PL6A 1E32A 1W9MA 3UK7A 5JMWA 1CC1S 2BJHA 1JHRA 4KQGA 4QJ5A 4AB1A 1R5OA 4KE6A 4UAVA 1E62A 1KVUA 1SBNE 1PS8A 1VHDA 2FPIB 2R86A 4FGZA 4QEZA 1VG8A 5JEEA 2GQ0A 2GXQA 5GGYA 4IJUA 4PX5A 3G9QA 2HZ7A 2PYDA 2R6ZA 1ECLA 3R6LA 2EBWA 3TTXA 1ZIOA 3D2CA 5D3KA 3CRVA 3HP1A 3PHCA 3IJRA 5FV7A 3KAQA 2OMKA 3U5ZB 3FYDA 2JVIA 1QIFA 3NDIA 4MVJI 1QHHA 3OT5A 1DJPA 1QDLB 3FLBA 3IBTA 4URFA 3HWRA 3AFMA 3M6AA 4KPFC 4C87A 1Z7EA 2MSCB 3BMOB 5C7YA 2ONCA 3CUUA 4X90A 5J23A 2XITA 3FOFC 2QN9A 1I94B 1ZLYA 2IBSA 2NSJA 3QU7A 2I65A 2CXSA 1L3CA 5CX1B 3KXIA 4M8LA 4JCCA 2W48A 4TQGA 1Y5LA 2PEZA 3DHWC 5C3MA 2HT1A 4O6VA 2JIRA 2Q8QA 2QTBA 3RTDA 3A4IA 2KM1A 4AK9A 2CL7X 4BEJA 4F21A 3GT3A 4I3GA 2JLVA 4MZXA 4I50B 5LU8A 3M6IA 3FROA 3IRVA 3ZEIA 3RVKA 4MV7A 3EZGA 2HCFA 5BN3A 4PO8A 2WD8A 2WE7A 2WD7A 3WKBA 2F90A 3BZUA 4RZ3A 5T67A 5ICSA 2CV0A 1QAMA 1ZM7A 1B0ZA 2ORVA 3Q2OA 1DCFA 1ND6A 4IDGA 1SPXA 2VHXA 1EVEA 3GLIB 2PSFA 3LXXA 2ZAIA 1RU3A 2ZSFA 4LXHA 5DJ5A 2PLAA 3A1WA 3DZ5B 2H7CA 4X95A 3FHTA 2AXEA 3OJFA 4L8VA 1X80B 2X7JA 1CDDA 3DZ6B 1LX6A 3C45A 3ETGA 3L7CA 1GKIA 4R1MA 1RJWA 5IC6A 1FFAA 3QFTA 1E3EA 3Q7RA 4E30A 1T1SA 2QN2A 1B14A 1CHDA 1N2ZA 3EDQA 3LYAA 5JDCC 3VHLB 1WWKA 1GNPA 2IOFA 2JFHA 3E03A 2W6JA 2LD4A 3PXAA 4JT2A 2XPCA 3JQFA 3A6JA 1V9CA 2WINI 4MR8A 2ECPA 3EF0A 3FTPA 3GVIA 1KFKB 3VV3A 4A26A 4Z86A 4RYLA 1HC7A 2QL7A 2OE2A 1GRVA 1O3YA 1SC3A 3GUUA 5I8ZA 4UM9B 3HWSA 2DHQA 1ISPA 5I9MA 2N3ZA 4CT5A 1JDSA 7GPBA 3TNYA 5BVGB 1MT3A 5KHAA 1U0BB 1QE3A 5GTDA 1TJ4A 1H5UA 5TF0A 4MDYA 2XJ9A 4XDZA 4O4HF 1Z6YA 2RKBA 1XZMA 4XAQA 4CXMA 4NV3A 2AJTA 1V8BA 2J1LA 4N5HX 1M5RA 4LF6B 1M0WA 4XRRA 4GKBA 3FIJA 4NJMA 4U2EA 1T0BA 2IDKA 2R79A 3LUKA 4MQFB 4OU4A 3TCXB 4I3HA 3O2NA 4B4VA 4TSFD 5JJ5A 3QF4A 3FYSA 3RI3A 5B55A 2ETVA 2LW7A 1HSZA 3CN7A 1A5BB 3HL4A 5IWCA 4PFKA 5JJIA 4F06A 1GQQA 1LTKA 1RADA 2PS9A 5F9HA 1I30A 3HJUA 3B9RA 4O3MA 2EZ8A 3FWZA 1MIHA 1OT5A 4FJ2A 1CQZA 1Y81A 4E3ZA 5K0FA 2XXBA 1LWOA 1QYVA 4IH9A 1DO2A 4D9IA 3JAKB 1NVTA 4ZC1A 3O4RA 2II6A 1X3SA 3SEZA 4NPAA 2UYYA 3OUZA 3FOCA 4LYHA 2RE8A 3FLMA 5CBPB 3TUZC 1OVGA 4DS3A 2PKCA 3ZE1B 2J41A 5EUQB 3O90A 3QMMA 3TV1A 4O4LF 2FZEA 3I6IA 5CURA 4EKNB 2JH3A 2XHEA 5IM5A 3ZZUA 5IRCD 1R9NA 1XSEA 1E89A 2HXYA 1J0DA 1SG6A 1YS7A 3JR7A 2BZSA 4J0JA 4JHLA 3UMGA 4G1EB 2YVLA 3MZ0A 2EZUA 2YFHA 2YWEA 2ZAGA 5EHZA 1RPNA 4R84A 3RW9A 1XHEA 2XODA 3TD2A 1Y34E 1U1FA 2YZ2A 3SYNA 5EP1A 4PPFA 3AKZA 4ZRNA 2OHVA 3THXA 2FB9A 1P7WA 1UXKA 1XQYA 2R1ZA 4IQ4A 4H6PA 4GWKA 2BHRA 2XI4A 3GCXA 4DT1B 5KX5A 1OBCA 2AVNA 1KVTA 1SC6A 2YXNA 3IQXA 1RLIA 2V9ZA 1U3VA 1VCNA 1GT91 4K5QA 3ZGNA 1XCOA 1NC3A 2YVAA 2A0WA 4IF6A 1TRHA 4ROTA 4TTQA 3ULKA 4RH1A 2PSSA 1B15A 4PLYA 3DBLA 3FI0A 4KXMA 4CDMA 3FR8A 1U28A 1QANA 5F2EA 2QZSA 5H4HA 3IPAA 2XOEA 3R20A 2QROA 3QVLA 4JVSB 5E8JA 1BSVA 5EINA 4GOMD 1N36B 1K4YA 3K0EA 2BOVA 1D9XA 4PX9A 1CVIA 1HGXA 2KB0A 1UXGA 3W6PA 1A2KC 1ZI9A 1P1BA 3GCZA 4D6XA 4BATA 4AP6A 4HDKA 3L04A 1FNMA 2Q5IA 2CSUA 4MO2A 4DIDA 4EJFA 4UTPA 1DAHA 1JFFA 1DUVG 4RK6A 1JZSA 1RXEA 10MHA 2LCQA 1WKVA 1N8NA 1NF3A 2YOHA 3KXKA 4HFNA 2BKLA 3OFVA 5LL6P 4MQ6A 4NAUA 5JPDA 4E46A 1ZY2A 1X74A 4HBZA 1PR9A 1U90A</