3K2DA

Crystal structure of immunogenic lipoprotein a from vibrio vulnificus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
237
structure length
237
Chain Sequence
GHMDTSKVKVGVMAGAEAQVAEVAAKVAKEKYGLDVELVTFTDYVTPNAALDDGSIDMNAFQHKPYLDRQVEDRDYKLTIAGNTFVYPIAGYSKQVKSVAALADGVRIAVPNDPTNLGRSLLLLEQQGLIKLRPEVGLLATVRDIVENPKNITIMELDAAQLPRSLDDVALSIINTTYASSINLTPEKDGVFVEDKESPYVNLIVARQDNVQNENVQNFVKAYQTEEVYTAAKEIFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC-type metal ion transport system, periplasmic component
publication title Crystal structure of Toll-like receptor 2-activating lipoprotein IIpA from Vibrio vulnificus.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Immune system
total genus 64
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k2dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k2dA02
5H8HA 4XKPA 5TP9A 1M5CA 4XKRA 4F3SA 1M5BA 1IXGA 3WAFA 3OMBA 1S9TA 2XD3A 1IITA 3CFLA 1USYE 1L5TA 1MG1A 2KLFA 4OXVA 3IOUA 3ZSFA 1JEUA 2Q9TA 2I6EA 1WVJA 1B1HA 1PB9A 3TCGA 4QSCA 1UTBA 1B3FA 3PU5A 3RTFB 1VFDA 1MQGA 4U2RA 3RY3A 4KYEA 3H6TA 4LZ5A 1ZIUA 2UVGA 3KOSA 2I4CA 3FV2A 2DP8A 2ZNUA 3EF7A 1QKAA 3PMXA 1LB9A 1SW1A 4BDLA 4M4GA 1LFGA 3TTMA 1LBCA 1SW5A 3LSFB 4IB2A 4QSDA 1YAEA 2X26A 5TU0A 1NH8A 4POXA 3T22A 3OOAA 3LUYA 4C1TA 4NF5B 3SETA 4TOZA 4UA8A 1MY1A 1B58A 2F7BA 1B40A 2PX1A 4ZEBA 3OEKA 3MVYA 3U72A 4KD5A 3GLBA 4OFJA 3TZAA 4OESA 3QUJA 2DWJA 4R2BA 1EZOA 3Q26A 4KHZE 4PFWA 3FVGA 2P1SA 1EZ9A 1WODA 3MQ9A 4QHQA 4MLVA 1UTHB 4YKKA 1ZBMA 3R6UA 3KOTA 3W9WA 4ONYA 1N7XA 4R2FA 4ZS9A 3PD9A 2DSFA 1IEJA 1OVBA 3ZKLA 1SBPA 4IY6A 2DS9A 4QSEA 2HZLA 2QS1A 3N6UA 3OO8A 4DIGA 2I49A 5KDTB 4OERA 5HM4B 4WXJA 3HV1A 3K0VA 4NF4B 4JWYA 4LONB 4GRKA 4ELPA 3I6VA 1IUDA 3C31A 3V8XB 4YB5A 1IXIA 3DP6A 1B7ZA 2ZNSA 2GHAA 3KEIA 3LSWA 3S9MC 3T9XB 2DVZA 1SI0A 3TFLA 4C0RA 3S9LC 4PP0A 1IQ7A 4BDOA 2VHAA 4ELOA 1N3XA 5H8QB 3C4MA 3IJXB 2I3WA 3VVFA 3Q28A 4F2QA 1SD3A 5K2XA 2QRYA 4Q0CA 3SEYA 1WDNA 5KCJA 3FATA 4GLIA 2QS3A 3PGFA 5I57A 1NNTA 3WAEA 2NXOA 1B51A 1ZKBA 1OIBA 3M3KA 1Y3QA 1MXVA 4PETA 3ZS6A 3PD8A 1TWYA 3UORA 1R6ZA 3KN7A 4EDPA 4OEUA 3FJMA 5TPAB 3H6VA 3QK6A 5DVJA 1GR2A 2PT2A 4U1OA 3RT6B 3PUXE 1JVXA 1LFHA 1FQAA 5L9SA 4RA1A 2F8DA 4KCCA 4G8MA 4DCYA 2RCAA 1OQGA 1BKAA 3CFZA 3OSQA 4NWCA 4OMBA 3G3KA 3KJTA 1US5A 3CI8A 3OEMA 2NVUB 1MH3A 5H8HB 4IGTA 4AQ4A 5ICTA 1N0TA 3S4UA 4TLMB 2RF1A 3UA8A 3M3LA 4QFOA 1FQDA 1QKBA 5DVFA 1DPPA 3CRBA 1MQJA 1II5A 1NNKA 2G29A 3B6TA 2I48A 3IB2A 1F9BA 2Z8DA 4F1UA 4FORA 5I59A 2P0SA 1UTBB 2HEUA 3AXFA 4FEDA 4GF8A 2F34A 1I69A 2NUVA 4KR5A 2X7PA 4G68C 3HN0A 3BKIB 1DPEA 1Y20A 2FYIA 1R1NA 3PPRA 1JW5A 5K2YA 2QMXA 2F36A 3O6GA 5CRYA 2R71A 1TT1A 4AB6A 4R6HA 2HAUA 2I4BA 1IXCA 3TELA 3LC8A 3E13X 4KQPA 3W9VA 1MDP1 1CE2A 3FXQA 3OO7A 2WKYA 3FD3A 1KWHA 3HPIA 3VLVA 1S50A 4X1DA 5H8NA 5DEXA 1O64A 2QJEA 2D21A 5AA4A 5H8SA 1RYXA 5EYFA 3QAXA 1ZMGA 4NMYA 4NE4A 3MVXA 4YKJA 1YTVA 2OWSA 3EN3A 1XOCA 4U23A 4I62A 3K1MA 4XIGQ 3U93A 1B05A 3C35A 1IZ1A 2YJPA 3CG3A 5L9MA 1ELJA 3CG1A 3PPNA 1FQCA 4EXLA 4H0WA 1B46A 4LATA 1NFTA 3UGWA 1MQDA 1A55A 5EHMA 2FA7A 3HSTA 1CB6A 2ALUA 4M1VA 4C1UA 2E0SA 3FVNA 4GQOA 3JZJA 2XXTA 1AL3A 2ZYMA 4R73A 4K3FA 3MZ1A 1IIWA 2B65A 2V84A 3SKPA 2UVJA 1SW4A 2D5WA 4QFNA 1Q1KA 1PC3A 4HS7A 4HW8A 2DWIA 2DXRA 1LAXA 3VE1B 2W7YA 1VFEA 3G3HA 3VVEA 2P2AA 3N26A 4JB7A 3C33A 1DSNA 4GIZA 3FIRA 4G68A 2OLBA 1ZJLA 4G77A 1A7LA 3SDFA 4F1VA 1AOVA 5JTYA 3RN8A 4OTEA 4I8CA 1MXYA 4E0WA 5CBRA 3FUZA 2XXUA 4PFUA 4Z0IA 4R6YA 2ZNTA 3PMVA 5HBCA 1LAGE 3BBRA 5H8FB 1US4A 2F35A 3G3IA 4LZ7A 2ABHA 3LR1A 4KYSA 5KCJB 2ONSA 1D3KA 1Y4TA 2V93A 4DE8A 5I57B 1B7UA 4P0GA 3SERA 3LSXA 4ZE8A 1OQHA 1JEVA 1Y3PA 4OQOA 2H25A 1LFIA 2DWAA 3USDA 1URGA 5ELVA 4H8IA 1PB7A 1OMPA 1GGGA 2O68A 3S9EA 3RTWB 3MPKA 1B32A 1XC1A 1BP5A 4YICA 4ZZEA 4NTLA 3FJ7A 3SEUA 3V83A 1M5DA 2UYFA 4JSDA 4H5GA 2XXXA 5IKBA 4THIA 4NF8A 4EUOA 4PFTA 1FTMA 4RYAA 4ZEKA 3TCHA 2LAOA 1LAFE 2GRVA 3BFUA 1B4HA 2PT1A 1H44A 3N5LA 3O28A 2ONRA 1UQWA 1JQFA 4WKMA 3VDFA 2ONKE 3TEPA 2ZXTA 2OJTA 3VXBA 1Q35A 3HHFA 2F7CA 3K6XA 3F11A 2I58A 3EHSA 5FTHA 1QW0A 1MQIA 1P1OA 3HHGA 3PV0E 3GZGA 2B3FA 1ATGA 2Y7IA 2OK2A 2O84X 2M8CA 3RPWA 1LCFA 3K6VA 1JW1A 4H1XA 1Z7NE 1AIVA 3TPAA 4R74A 2YPNA 3ZKKA 1Z7ME 4IY5A 1MXWA 2VGQA 3B6WA 2O1LA 2VD3A 5FHOA 1M5EA 2XXIA 3L6HA 2GFEA 3VXCA 5FTIA 1PBQA 3KG2A 2RCBA 2F97A 1MPBA 1R9QA 4DXUA 3SEWA 4GL0A 3TDJA 3T9VA 3K01A 5CI5A 3FVKA 1OLAA 4L17A 2PVUA 1D9YA 3T66A 3IR1A 3K1NA 4I1DA 4XKQA 2AL4A 3RGYA 3JV9A 3CSBA 4NF6B 5DEXB 4H67A 3MPLA 4ZE9A 3MP6A 3SESA 5AA4B 3GBBA 4KCDA 2Q89A 4G8NA 2V3UA 4HCWA 1B3HA 4R72A 2VP1A 1VSOA 3Q25A 1MH4A 3C36A 3RT8A 1GV8A 3MZ9A 4F39A 1XVXA 1JVYA 4XKNA 1NKXA 1Y1MA 4UACA 1QVSA 4MFIA 1MM6A 1NNFA 3TAJA 2DXYA 2XXPA 3H6WA 1DTGA 3KN3A 3I3VA 3IO4A 2BJJX 1DTZA 2Q2CA 4U21A 3E9XA 5I56A 4ELRA 3C9HA 4X9TA 4HCYA 4OFLA 3TTKA 1S7YA 3O66A 1M5FA 1MXZA 2F6PA 1XHYA 1B2HA 2HQ0A 1JNFA 4RXLA 2XX8A 3O9PA 1URDA 4OWDA 4FATA 1R9LA 4YMBA 5I2NA 2Y7KA 1B1XA 4GVOA 2XXVA 3TKDA 1QUIA 2AIXA 4DDDA 2H4IA 1XT8A 5ICQA 4FECA 4IO4A 3OXNA 1NH7A 4XTCQ 3OO9A 4LQ5A 4JSOA 2F6GA 4QFPA 2RC8A 5ITOA 3G7WA 4RNSA 5DYHA 3MVZA 1QJMA 4U22A 5TP9B 2PBWA 1H76A 3IB0A 4F19A 3QIMA 4IGRA 2UVIA 3G3FA 3QUFA 1ZLQA 3K6WA 4NEDA 3IO6A 1FW0A 3U92A 3FASA 1TXFA 3JYRA 4JWOA 3IAZA 3O2AA 4RPOA 1QULA 2R9JA 1MM7A 1QUJA 2RKMA 3H7MA 1MQHA 4ZZAA 4YKIA 1NL5A 2NWJA 1QUKA 4IO2A 4ZEFA 1BIYA 2O7UA 3N94A 2Z8EA 1LSTA 4GXSB 4DLDA 2HXWA 3RUMA 1MRPA 1SI1A 3KFMA 2GH9A 3ILTB 5J1DA 3P7IA 3IB1A 1MS7A 1FTLA 5F7VA 1PDAA 3T9HB 2VD2A 2DOJA 2XX7A 3G3JA 1SVXB 5KDTA 4U4SA 1NNPA 2Z23A 2Y7RA 3K1PA 1B3LA 4YAHX 2XX9A 4JWXA 3MZBA 3PMWA 3GXAA 5B7DA 3KZGA 1B7HA 3DP8A 3KJ7A 2V3QA 4F3PA 5DT6A 4ZEIA 2RC9A 3MVWA 4TLLB 4YU0A 3IOWA 2QPQA 4EQ9A 2F7AA 3B7DA 4GFRA 5I58A 2F5XA 4R6KA 3TTNA 2Y7WA 1OLCA 1EH3A 1A8EA 3ILUB 3MAMA 1T0KA 4H8JA 2XXRA 5LOMA 4G2ZA 2V3TA 4G4PA 3MP1A 1USYH 2UXAA 4GXAA 1P1NA 3H03A 2Y7PA 1ANFA 3ECRA 1GVCA 1HSLA 3EHUA 4HTGA 1OVTA 1N7WA 1N3WA 3MJNA 1B5HA 2CZLA 2HCAA 5I84A 1DMBA 1Y3NA 1PEBA 2HFBA 1SYIA 4F22A 5HPQA 3VVDA 4ZECA 3D4CA 2RINA 4IO7A 3QSLA 5CMBA 4FAJA 1A99A 1LBBA 4N07A 3TYHA 1N84A 3RLFE 1B3GA 3PUYE 2VOZA 4ZDMA 3B6QA 3TODA 4LQ2A 4EQBA 3QXMA 3H4ZA 4PE5B 4BDMA 1ZTYA 1VE4A 3K00A 3O29A 4LP2B 4F31B 3C34A 4ESXA 1PBPA 3OENA 5F1QA 1B0LA 4Q5TA 1LAHE 5AA2D 3KBRA 2OWTA 3HO7A 1LB8A 1TFAA 2QS4A 2HZKA 2E1SA 3PPPA 4MLQA 4DXBA 1N04A 3TUSA 3A3CA 4BLAA 3MWBA 1AH5A 5B70A 4FIMA 5I56B 3TQLA 3IK6B 3SEVA 1URSA 1H3DA 3UIFA 2ZYOA 2I3VA 4EQ7A 3DLNA 4R9GA 1MDQA 2O6AA 3BFTA 3IX1A 5M2VA 3N6TA 4O3BA 1B52A 1Y4CA 4XXUA 3R26A 2O1MA 4U1ZA 2ZYKA 3K6UA 1POY1 5I2NB 2XXYA 2H9BA 1MY2A 1LGBC 3U1OA 4OETA 1A8FA 3C32A 3GBAA 1UIVA 3PUZE 1FQFA 1P99A 3FJGA 4LUBA 5ISUA 3ONMA 2RC7A 2H99A 3LBSA 3MW0A 4EF2A 4TQUQ 1TFDA 3DP4A 1B5IA 4AB5A 1O7TA 1MY0A 4QFLA 4N13A 4R75A 4F3GA 1IXHA 1BLFA 3EQ1A 3MBPA 4YB6A 3FXUA 1B3EA 5CMCA 4EF1A 1BTJA 2OBGA 3A09A 4JDFA 3TQWA 3SEXA 4GOTA 3RNNA 5AA2A 5I59B 4RK2A 2A5TA 4H65A 2ESNA 5ITPA 4BDNA 1J1NA 3MUQA 1P1QA 3T93B 2XXQA 2THIA 3PPOA 3MC2A 1B6HA 4X1BA 4QRZA 2CMOA 4E0XA 4IO5A 4P11A 1SQYA 3V5AA 1JETA 1SYHA 1FCKA 2PYYA 3FXRA 2REJA 3VLWA 1HSEA 5I2KA 5A5XA 2FNCA 3E3KA 2QL3A 3QYTA 5L8DA 4F18A 4DCXA 4ND9A 3A3UA 3K02A 1O63A 3IOVA 1ZU0A 4FE8A 3KSXA 3KGCA 4BDRA 3FGSA 5JEIA 4F1YA 1PB8A 1DOTA 4WEPA 5H8NB 5AE4A 4IO6A 4RPNA 3FZVA 2PMSA 5I58B 2A5SA 3CR9A 3ODBA 4OENA 5DVIA 2Y84A 3PPQA 4H5FA 4YMAA 1Y1ZA 5AA1A 4PFYA 1B4ZA 2Q8JA 3DELB 2D3IA 2O69A 4LZ8A 4I9DA 3K4UA 2AYSA 1Y9UA 4OEVA 4YKPA 3G3GA 1I6AA 5H8FA 2XHDA 1SDXA 4FJPA 4LVQA 1FTKA 1MXXA 3TTLA 1AMFA 3TMGA 3UN6A 3FV1A 2B3BA 1I6BA 3T96B 1MY4A 5KZTA 2QSXA 1MY3A 3TTRA 4GWOA 3THIA 1FQEA 3DM0A 4JXIA 4MF3A 2DVCA 2DYXA 2H5YA 3R7XA 3OO6A 4G68B 2F78A 4ZEDA 3VV5A 4MBPA 2DWHA 2XXWA 3O6HA 1MPDA 2Q88A 5JTYB 4GL8A 4Z7EA 3VLUA 1NMUA 2G93A 3M8UA 3T9UA 4JBZA 1I6QA 3HCQA 1RYOA 5AA3A 1XS5A 4G8HA 3OD7A 2ZMBA 1MXUA 1N76A 3L6GA 4O3AA 4R9FA 5DTBA 3E4RA 4Q30B 2V25A 4NF5A 3K2DA 1D4NA 4ESWA 4RJZA 1FTOA 2NOOA 1LLSA 4O3CA 3KSJA 3W15C 3CIJA 4PQJA 5CBSA 3EPEA 3S2VA 2YLNA 3D4GA 2IEEA 3KN8A 1UTHA 3UK4A 1VR5A 1EZPA 5BUUA 2X7QA 4GD5A 2IA4A 2O51A 3CFXA 2ZYNA 2Z22A 5JK4A 1FQBA 4ECFA 2DE3A 3IL1B 4KI0E 2H98A 4X48A 1LCTA 2OCUA 4ELQA 3MP8A 3OELA 2DE2A 3H06B 3M3FA 4NF8B 1H45A 4NF4A 5L9OA 3U8QA 2UVHA 1P1UA 2I0BA 4FEBA 5CM6A 4QFKA 2QS2A 1H43A 5FHNA 1YCJA 3O6IA 2DQVA 3CVGA 4YB7A 4F2OA 4LA9A 3U94A 1UIUA 2GHBA 4ISUA 4NF6A 1B5JA 2XXHA 3EHTA 1XVYA 1JW4A 3S9NC 2Q2AA 3V89B 5AA2B 2REGA 2DE4A 5H8QA 1D9VA 2A5TB 3RQTA 4OFOA 4F3BA 3PUVE 4N6PA 5EHSA 1B0HA 2I0CA 4KPTA 4RY1A 4KFQA 4BDQA 4WEDA 1YPNA 4IO3A 4OVJA 3UP9A 4OZ9A 4POWA 1EU8A 3IOTA 3PUWE 4F29A 3Q27A 5CMMA 3H6UA 1SW2A 2OZZA 5I2KB 5A5XB 5FHMA 1P1WA 1GTKA 1MPCA 4RK9A 3CSGA 2ANJA 2QMWA 2HAVA 3OSRA 5BWJA 5CC2A 3VFJA 1B9JA 4U4XA 1POTA 4H6DA 5IAIA 3I5OA 2Z8FA 2XD2A 2R6GE 1FTJA 4MH5A 4YZZA 5TPAA 4OYVA 4DXCA 2UYEA 2O7IA 3LSLA 3TCFA 5CMKA 4Q8RA 1A40A 3IJOB 3H3GA 1HSJA 4OHNA 4P0IA 3IORA 4QF9A 3Q29A 4NWDA 4KYDA 3O97A 4DZ1A 3FVOA 1RKMA 2AL5A 1A54A 4EXKA
chains in the Genus database with same CATH superfamily
5H8HA 4XKPA 5TP9A 1M5CA 4XKRA 4F3SA 1M5BA 1IXGA 3WAFA 3OMBA 1S9TA 2XD3A 4IR8A 4N6DA 1IITA 3CFLA 1USYE 1L5TA 1MG1A 2CZIA 2KLFA 4OXVA 3IOUA 5EQ9A 3ZSFA 1JEUA 2Q9TA 2I6EA 1WVJA 1B1HA 1PB9A 3TCGA 4QSCA 1UTBA 2DDKA 1B3FA 3PU5A 3RTFB 1FPLA 2GQ1A 1VFDA 1MQGA 4U2RA 3RY3A 4KYEA 3H6TA 4LZ5A 1ZIUA 2UVGA 3KOSA 2I4CA 2ZZVA 3FV2A 2DP8A 2FIEA 2ZNUA 3EF7A 1QKAA 1D9QA 3PMXA 1LB9A 1SW1A 4BDLA 4MMPA 5EQ7A 4M4GA 1LFGA 3TTMA 1LBCA 1SW5A 3LSFB 4IB2A 4QSDA 4PFBA 1YAEA 2X26A 4NAPA 5TU0A 1NH8A 2XWOA 4POXA 3T22A 3OOAA 3LUYA 4C1TA 4NF5B 3SETA 1FPDA 4TOZA 4UA8A 2Q8MA 1MY1A 1DBZA 1B58A 4GWZA 2F7BA 1B40A 2PX1A 4ZEBA 3OEKA 3MVYA 3U72A 4KD5A 1JP4A 3GLBA 4OFJA 3TZAA 4OESA 3QUJA 2DWJA 4R2BA 1EZOA 3Q26A 4KHZE 4PFWA 3FVGA 2P1SA 1KZ8A 1EZ9A 1WODA 3MQ9A 4QHQA 4MLVA 1UTHB 4MNCA 4YKKA 1ZBMA 3R6UA 3KOTA 4ONYA 3W9WA 1N7XA 4R2FA 4ZS9A 3PD9A 1G0HA 2DSFA 5J16A 1IEJA 1OVBA 3ZKLA 1SBPA 2P3NA 4IY6A 1FBEA 2DS9A 4QSEA 2HZLA 2QS1A 3N6UA 3OO8A 4DIGA 2I49A 5KDTB 4OERA 5HM4B 4WXJA 3HV1A 3K0VA 4AS4A 4NF4B 4JWYA 4LONB 4GRKA 5ET7A 4ELPA 3I6VA 1IUDA 2QVVA 3C31A 3V8XB 4YB5A 1IXIA 3DP6A 1B7ZA 2ZNSA 2GHAA 3KEIA 3LSWA 3S9MC 2PFYA 3T9XB 2DVZA 1SI0A 3TFLA 4C0RA 3S9LC 4PP0A 1IQ7A 2CEXA 1RDYA 1INPA 4BDOA 3LUZA 2VHAA 4ELOA 4GWXA 1N3XA 5H8QB 4O8MA 4MCOA 3C4MA 4UABA 5F24A 3IJXB 2I3WA 3VVFA 3Q28A 4F2QA 1SD3A 5K2XA 2QRYA 5T3JA 5LTCA 4Q0CA 3SEYA 2HHMA 1WDNA 1NUZA 5KCJA 3FATA 4GLIA 2QS3A 3PGFA 5I57A 1NNTA 3WAEA 4P47A 2NXOA 3SZPA 1B51A 1ZKBA 1OIBA 3M3KA 3RPLB 1Y3QA 1FJ6A 1MXVA 4N8GA 4PETA 3ZS6A 3PD8A 1TWYA 3UORA 1R6ZA 3KN7A 4EDPA 4OEUA 3FJMA 5TPAB 3H6VA 3QK6A 5DVJA 1GR2A 2PT2A 4U1OA 3RT6B 3PUXE 5FBPA 1JVXA 1LFHA 1FQAA 5L9SA 4PGNA 2ZZXA 4RA1A 2F8DA 4KCCA 4G8MA 4DCYA 2RCAA 1OQGA 1BKAA 3CFZA 3OSQA 4NWCA 4OMBA 3G3KA 3KJTA 1FPFA 1US5A 3CI8A 3OEMA 3FXBA 2NVUB 1MH3A 5H8HB 4IGTA 4AQ4A 5ICTA 1N0TA 3S4UA 4TLMB 2RF1A 3UA8A 3M3LA 4QFOA 1FQDA 1QKBA 5DVFA 1DPPA 3CRBA 1MQJA 1II5A 1NNKA 4OVPA 1RDXA 2G29A 3B6TA 4MX6A 4NHBA 2I48A 3IB2A 1F9BA 2Z8DA 4F1UA 4FORA 5I59A 2P0SA 1UTBB 2HEUA 3AXFA 4FEDA 4GF8A 2F34A 1I69A 5IZ3A 2NUVA 4PAFA 4GWYA 4KR5A 2X7PA 4G68C 3HN0A 3BKIB 1DPEA 1Y20A 1FBDA 1LBZA 1R1NA 2FYIA 3PPRA 1JW5A 5K2YA 2QMXA 2F36A 3O6GA 5CRYA 2R71A 1TT1A 2F3BA 5IGAA 4AB6A 4R6HA 1QGXA 2HAUA 2I4BA 1IXCA 3TELA 1FBFA 3LC8A 3E13X 4KQPA 3W9VA 1MDP1 1SPIA 1CE2A 3FXQA 3OO7A 4GX3A 2WKYA 4PGPA 3FD3A 1FBPA 1KWHA 3HPIA 3VLVA 1S50A 4X1DA 5IM2A 4MJOA 5H8NA 5DEXA 1O64A 2QJEA 3B8BA 2XXKA 2D21A 4N81A 4P56A 5AA4A 2L5VA 5H8SA 1RYXA 5EYFA 3QAXA 1ZMGA 4NMYA 4NE4A 3MVXA 4YKJA 1EYKA 1YTVA 2OWSA 3EN3A 1XOCA 4XF5A 4U23A 4I62A 3K1MA 4XIGQ 4N15A 3U93A 1B05A 4NQ8A 4HE0A 3C35A 1IZ1A 2YJPA 3CG3A 5L9MA 1ELJA 3CG1A 3PPNA 1FQCA 4GBWA 4EXLA 4H0WA 1B46A 4LATA 1NFTA 3UGWA 1MQDA 1A55A 5EHMA 2FA7A 3HSTA 1CB6A 2ALUA 2WBBA 3MSTA 4PTKA 4M1VA 4C1UA 2E0SA 3FVNA 1IMEA 4GQOA 3JZJA 2XXTA 1AL3A 2ZYMA 4R73A 4K3FA 3MZ1A 1IIWA 2B65A 2V84A 2QVUA 3SKPA 2UVJA 1SW4A 1NV6A 2D5WA 4QFNA 1Q1KA 1PC3A 4HS7A 2Q74A 1NI9A 5ESYA 4HW8A 2DWIA 2DXRA 1FPIA 1LAXA 3VE1B 4P8BA 2W7YA 1VFEA 3G3HA 3VVEA 2P2AA 3N26A 4JB7A 3C33A 1DSNA 2P3VA 4GIZA 1FPGA 3FIRA 4G68A 2OLBA 1ZJLA 4G77A 1A7LA 3SDFA 4F1VA 1AOVA 5JTYA 3RN8A 2KR0A 4OTEA 4I8CA 1MXYA 4E0WA 5CBRA 3FUZA 5IZ1A 2XXUA 4OVQA 4GBVA 4PFUA 4Z0IA 4R6YA 2ZNTA 3PMVA 5HBCA 1FBGA 1LAGE 3BBRA 5H8FB 1US4A 2F35A 3G3IA 4LZ7A 2ABHA 3LR1A 1DCUA 4KYSA 5KCJB 2ONSA 1D3KA 2JJKA 1Y4TA 2V93A 4DE8A 5I57B 1B7UA 4P0GA 3SERA 3LSXA 4ZE8A 4OA4A 1OQHA 1JEVA 1Y3PA 4OQOA 2VPNA 2H25A 4GWWA 1LFIA 2DWAA 1NV7A 3USDA 1URGA 5ELVA 4H8IA 1PB7A 1OMPA 2BJIA 1GGGA 2O68A 4GWUA 3S9EA 4FBPA 1EYJA 3RTWB 3MPKA 1RDZA 1B32A 1Q9DA 1XC1A 1BP5A 4YICA 4ZZEA 2HPGA 4NTLA 3FJ7A 3SEUA 3V83A 1M5DA 2XWVA 3EKIA 2UYFA 4JSDA 2V4CA 4H5GA 2XXXA 5IKBA 3D1RA 4THIA 4NF8A 4H45A 4EUOA 4PFTA 1FTMA 4PCDA 4RYAA 4ZEKA 5EYHA 3TCHA 2LAOA 1LAFE 2GRVA 3BFUA 1B4HA 2PT1A 1H44A 3N5LA 3O28A 2ONRA 1UQWA 3IFCA 1JQFA 4WKMA 3VDFA 2ONKE 4H46A 3TEPA 2ZXTA 2OJTA 3VXBA 1Q35A 3HHFA 2F7CA 3K6XA 1BK4A 3F11A 2I58A 3EHSA 5FTHA 1QW0A 1MQIA 1P1OA 3HHGA 3PV0E 3GZGA 2B3FA 1ATGA 2Y7IA 2OK2A 2O84X 4N8YA 2M8CA 3RPWA 1LCFA 3K6VA 1JW1A 2FIXA 4H1XA 1Z7NE 1AIVA 3TPAA 4R74A 2CEYA 5IZ3B 2YPNA 3ZKKA 1Z7ME 4IY5A 5A5LA 1MXWA 2VGQA 3B6WA 2O1LA 2VD3A 5FHOA 1M5EA 2XXIA 3ROJA 3L6HA 2GFEA 3CHGA 3VXCA 5FTIA 1PBQA 3KG2A 2RCBA 2F97A 1FJ9A 4MAGA 1MPBA 1R9QA 4DXUA 3SEWA 4GL0A 4GX4A 3TDJA 3T9VA 3K01A 5CI5A 3FVKA 1OLAA 4L17A 1LEVA 2PVUA 1D9YA 4PC9A 3T66A 3IR1A 3K1NA 4I1DA 4XKQA 3U65A 2AL4A 3RGYA 3JV9A 3CSBA 4NF6B 5DEXB 4H67A 3LV0A 3MPLA 3A29A 4ZE9A 3MP6A 3SESA 5AA4B 3GBBA 4KCDA 2Q89A 4G8NA 2V3UA 2CZKA 4HCWA 1B3HA 4R72A 2VP1A 1VSOA 3Q25A 2XWIA 4P1EA 1MH4A 3C36A 3RT8A 1GV8A 3MZ9A 4F39A 1XVXA 3KC0A 1JVYA 2QFLA 4XKNA 1NKXA 1NUXA 1Y1MA 1FRPA 4UACA 1QVSA 4QBAA 4MFIA 1MM6A 1NNFA 4PAKA 3TAJA 2DXYA 2XXPA 2FHYA 3H6WA 4I40A 1LBYA 1DTGA 3KN3A 3I3VA 3IO4A 2BJJX 1DTZA 2Q2CA 4U21A 3E9XA 4KXPA 5I56A 4ELRA 3C9HA 4X9TA 3HFUA 1IMFA 4HCYA 4OFLA 3TTKA 1S7YA 3O66A 1M5FA 1MXZA 2F6PA 1XHYA 1B2HA 2HQ0A 2HXRA 1JNFA 3KBZA 4RXLA 2XX8A 1NV3A 3O9PA 1URDA 4OWDA 4FATA 1R9LA 4YMBA 5I2NA 2Y7KA 1B1XA 1FPKA 4GVOA 1NV0A 2XXVA 3TKDA 1QUIA 2AIXA 4DDDA 4X04A 2H4IA 1XT8A 5ICQA 4FECA 4IO4A 4N17A 3OXNA 1NH7A 4XTCQ 3OO9A 4LQ5A 4JSOA 2F6GA 4QFPA 2RC8A 5ITOA 3G7WA 4RNSA 5DYHA 3MVZA 1QJMA 4U22A 1FSAA 1LBVA 5TP9B 2PBWA 1H76A 3IB0A 4F19A 3QIMA 4IGRA 2UVIA 3G3FA 3QUFA 1ZLQA 3K6WA 4NEDA 3IO6A 1NUYA 1FW0A 4P1LA 3U92A 3FASA 1TXFA 3JYRA 4PBQA 4JWOA 3IAZA 3O2AA 4RPOA 1QULA 2R9JA 1MM7A 1QUJA 2RKMA 3H7MA 1MQHA 2XWKA 4ZZAA 4NG7A 4YKIA 1NL5A 2NWJA 1QUKA 4IO2A 4PF6A 4OVSA 4ZEFA 3FBPA 2Y5KA 1BIYA 2FBPA 2O7UA 1FBHA 3N94A 2Z8EA 1LSTA 4GXSB 4DLDA 2HXWA 3RUMA 1MRPA 1SI1A 4JVIA 3KFMA 2GH9A 3ILTB 5J1DA 3P7IA 3IB1A 1MS7A 1FTLA 5F7VA 1PDAA 3T9HB 2VD2A 2DOJA 2XX7A 5EQAA 3G3JA 4AS5A 1SVXB 5KDTA 4U4SA 1NNPA 2Z23A 2Y7RA 3K1PA 1B3LA 4YAHX 2XX9A 4JWXA 3MZBA 3PMWA 1NV1A 3GXAA 5B7DA 3KZGA 1B7HA 3DP8A 3QMFA 3KJ7A 2V3QA 4F3PA 5DT6A 4ZEIA 2RC9A 3MVWA 4TLLB 4YU0A 3IOWA 2QPQA 4EQ9A 2F7AA 3B7DA 4GFRA 5I58A 2F5XA 4R6KA 3TTNA 2Y7WA 1IMDA 1OLCA 1EH3A 1A8EA 3ILUB 2MKZA 4N6KA 3MAMA 1T0KA 2QVRA 4H8JA 2XXRA 1CNQA 5LOMA 4JVCA 4G2ZA 2V3TA 2CZHA 5ET6A 4G4PA 3MP1A 1USYH 2UXAA 2Y5LA 4GXAA 1P1NA 3H03A 2Y7PA 2FVZA 1ANFA 3ECRA 1GVCA 1HSLA 2VT5A 3EHUA 4HTGA 4PFIA 1OVTA 1N7WA 4X8RA 1N3WA 3MJNA 1B5HA 2CZLA 2HCAA 5I84A 1DMBA 4MNPA 1Y3NA 1PEBA 2HFBA 1SYIA 4F22A 5HPQA 3ISPA 5I5PA 3VVDA 4ZECA 3D4CA 1IMBA 2RINA 4IO7A 3QSLA 5CMBA 4FAJA 1A99A 1LBBA 4N07A 3TYHA 3KC1A 1N84A 3RLFE 1B3GA 3PUYE 2VOZA 1NV5A 4ZDMA 3B6QA 3TODA 4LQ2A 4EQBA 3QXMA 3H4ZA 4PE5B 4I3EA 4BDMA 1ZTYA 1VE4A 3K00A 3O29A 4LP2B 4F31B 3C34A 4ESXA 1PBPA 3OENA 5F1QA 1B0LA 4Q5TA 1LAHE 5AA2D 3KBRA 2OWTA 2ZZWA 1XI6A 3HO7A 1LB8A 1TFAA 2QS4A 2HZKA 2E1SA 3PPPA 4MLQA 4DXBA 1N04A 4XFEA 4I3YA 3TUSA 3A3CA 1NV4A 4BLAA 4PE3A 3MWBA 1AH5A 5B70A 4FIMA 5I56B 3TQLA 3IK6B 3SEVA 1URSA 1H3DA 3UIFA 2ZYOA 2I3VA 4EQ7A 3DLNA 4R9GA 1K9ZA 1MDQA 2O6AA 3BFTA 3IX1A 5M2VA 3N6TA 4O3BA 3GYYA 1B52A 1G0IA 4MNIA 1Y4CA 4XXUA 3R26A 2O1MA 4U1ZA 1IMAA 2ZYKA 3K6UA 2WYKA 5DW8A 1POY1 5I2NB 1AWBA 2XXYA 2H9BA 1MY2A 3T0JA 1LGBC 3U1OA 4OETA 1A8FA 3C32A 3GBAA 1UIVA 3PUZE 1FQFA 1P99A 3FJGA 4LUBA 5ISUA 3ONMA 4O7MA 2R8TA 2RC7A 4DI3D 5I3SA 1VDWA 2H99A 4XEQA 3LBSA 5ET5A 3MW0A 4MHFA 4PDHA 4EF2A 4TQUQ 1TFDA 3DP4A 4MIJA 1B5IA 4AB5A 1O7TA 1MY0A 4NF0A 4QFLA 4N13A 4R75A 4F3GA 1IXHA 1BLFA 3EQ1A 3MBPA 4YB6A 3FXUA 1B3EA 5CMCA 4EF1A 1BTJA 3MYUA 1FPBA 2OBGA 3A09A 4JDFA 3TQWA 1FTAA 3SEXA 4GOTA 3RNNA 5AA2A 5I59B 4RK2A 2A5TA 4H65A 2ESNA 5ITPA 4BDNA 1J1NA 3MUQA 1P1QA 3T93B 2XXQA 2THIA 3PPOA 3MC2A 1B6HA 5EYGA 4X1BA 4QRZA 4HXVA 2CMOA 4E0XA 4QXDA 4IO5A 4P11A 1SQYA 3V5AA 1JETA 1SYHA 1FCKA 2PYYA 3FXRA 2REJA 4GX6A 3VLWA 1HSEA 5I2KA 5A5XA 2FNCA 3E3KA 2QL3A 3QYTA 5L8DA 4F18A 4DCXA 4ND9A 5I7IA 3A3UA 3K02A 2VPOA 1O63A 3IOVA 1ZU0A 4FE8A 3KSXA 3KGCA 1DK4A 3FGSA 4BDRA 5JEIA 4F1YA 1PB8A 1DOTA 4WEPA 5H8NB 5AE4A 4IO6A 3NOHA 4RPNA 4P9KA 3FZVA 2PMSA 5I58B 2A5SA 3CR9A 3ODBA 4OENA 5DVIA 2B4LA 2Y84A 3PPQA 4H5FA 4YMAA 5LDZA 1Y1ZA 5AA1A 4PFYA 1B4ZA 1IMCA 2Q8JA 3DELB 2D3IA 4DI4B 1LBXA 2O69A 3BIHA 4LZ8A 4OVTA 4PFRA 4I9DA 2PFZA 3K4UA 2AYSA 1Y9UA 4OEVA 2WBDA 4YKPA 3G3GA 3T1BA 1I6AA 2KQZA 4P3LA 5H8FA 2XHDA 4HE2A 1SDXA 4FJPA 4LVQA 1FTKA 5IZZA 1MXXA 3TTLA 2F3DA 1AMFA 3TMGA 4GWSA 3UN6A 3FV1A 2B3BA 1I6BA 3T96B 1MY4A 5KZTA 2QSXA 1MY3A 3TTRA 4GWOA 3THIA 1FQEA 4PDDA 3DM0A 4JXIA 4MF3A 2DVCA 2DYXA 2H5YA 4PF8A 3OO6A 3R7XA 4G68B 2F78A 4ZEDA 3VV5A 4MBPA 2DWHA 2XXWA 3O6HA 1MPDA 2Q88A 5JTYB 4GL8A 4Z7EA 3VLUA 1NMUA 2G93A 3M8UA 3T9UA 4MEVA 4JBZA 1I6QA 3PTYA 4PAIA 3HCQA 1RYOA 5AA3A 3RYDA 1XS5A 4G8HA 3OD7A 2ZMBA 1MXUA 1N76A 1YZ0A 3L6GA 4O3AA 1FPEA 4R9FA 5DTBA 3E4RA 4Q30B 2V25A 4NF5A 3K2DA 1D4NA 4ESWA 4RJZA 1KA0A 1FTOA 2NOOA 1LLSA 4O3CA 3KSJA 3E79A 4NN3A 3W15C 3CIJA 4PQJA 1FBCA 5CBSA 1FPJA 3EPEA 3S2VA 2YLNA 3D4GA 2IEEA 3KN8A 1UTHA 3UK4A 1VR5A 1EZPA 4OVRA 2OX3A 2X7QA 5BUUA 4GD5A 2IA4A 4G61A 2O51A 3CFXA 2ZYNA 2Z22A 5JK4A 1FQBA 4ECFA 2DE3A 3IL1B 4KI0E 2H98A 4X48A 1LCTA 2OCUA 4ELQA 3MP8A 1YXIA 3OELA 2DE2A 3H06B 2B4MA 3M3FA 4NF8B 1H45A 4NF4A 5L9OA 1KA1A 1EYIA 3U8QA 4LN5A 2UVHA 2PCRA 1P1UA 2I0BA 4FEBA 5CM6A 4QFKA 4O7IA 2QS2A 1H43A 5FHNA 1YCJA 3O6IA 2DQVA 3CVGA 4YB7A 4F2OA 3IFAA 4LA9A 3U94A 1UIUA 2GHBA 4ISUA 1K9YA 4NF6A 1B5JA 2XXHA 3EHTA 1XVYA 1JW4A 3S9NC 2Q2AA 3V89B 5AA2B 2REGA 2DE4A 5H8QA 1D9VA 2A5TB 3RQTA 4OFOA 4F3BA 3PUVE 4N6PA 5EHSA 5ET8A 1B0HA 2I0CA 4KPTA 1NV2A 1NUWA 4RY1A 4KFQA 4JVDA 4BDQA 4WEDA 1YPNA 4IO3A 4OVJA 3UP9A 4OZ9A 4POWA 4NX1A 2WEFA 1EU8A 3IOTA 3PUWE 4OANA 4F29A 3Q27A 5CMMA 3H6UA 1SW2A 2OZZA 5I2KB 5A5XB 5FHMA 1P1WA 1GTKA 1MPCA 4RK9A 4NGUA 2WX9A 3CSGA 2ANJA 2QMWA 2HAVA 3OSRA 3RPLA 5BWJA 5CC2A 3VFJA 1B9JA 4U4XA 2XA5A 1POTA 4H6DA 5IAIA 3I5OA 1LBWA 2Z8FA 2XD2A 4O94A 2R6GE 3B50A 1FTJA 4MH5A 4YZZA 5TPAA 4OYVA 2WYPA 4DXCA 2OWZA 5EQ8A 2UYEA 2O7IA 3LSLA 3E78A 3TCFA 5CMKA 4Q8RA 1A40A 3IJOB 3H3GA 4N4UA 1HSJA 4OHNA 1YYZA 4P0IA 3IORA 4QF9A 3Q29A 4NWDA 4KYDA 4N91A 3O97A 4DZ1A 4HE1A 3FVOA 1RKMA 2AL5A 1A54A 4PBHA 4EXKA 3BIGA
chains in the Genus database with same CATH topology
5H8HA 4XKPA 5TP9A 1M5CA 4XKRA 4F3SA 1M5BA 1IXGA 3WAFA 3OMBA 1S9TA 2XD3A 1IITA 3CFLA 1USYE 1L5TA 1MG1A 2KLFA 4OXVA 3IOUA 3ZSFA 1JEUA 2Q9TA 2I6EA 1WVJA 1B1HA 1PB9A 3TCGA 4QSCA 1UTBA 1B3FA 3PU5A 3RTFB 1VFDA 1MQGA 4U2RA 3RY3A 4KYEA 3H6TA 4LZ5A 1ZIUA 2UVGA 3KOSA 2I4CA 3FV2A 2DP8A 2ZNUA 3EF7A 1QKAA 3PMXA 1LB9A 1SW1A 4BDLA 4M4GA 1LFGA 3TTMA 1LBCA 1SW5A 3LSFB 4IB2A 4QSDA 1YAEA 2X26A 5TU0A 1NH8A 4POXA 3T22A 3OOAA 3LUYA 4C1TA 4NF5B 3SETA 4TOZA 4UA8A 1MY1A 1B58A 2F7BA 1B40A 2PX1A 4ZEBA 3OEKA 3MVYA 3U72A 4KD5A 3GLBA 4OFJA 3TZAA 4OESA 3QUJA 2DWJA 4R2BA 1EZOA 3Q26A 4KHZE 4PFWA 3FVGA 2P1SA 1EZ9A 1WODA 3MQ9A 4QHQA 4MLVA 1UTHB 4YKKA 1ZBMA 3R6UA 3KOTA 3W9WA 4ONYA 1N7XA 4R2FA 4ZS9A 3PD9A 2DSFA 1IEJA 1OVBA 3ZKLA 1SBPA 4IY6A 2DS9A 4QSEA 2HZLA 2QS1A 3N6UA 3OO8A 4DIGA 2I49A 5KDTB 4OERA 5HM4B 4WXJA 3HV1A 3K0VA 4NF4B 4JWYA 4LONB 4GRKA 4ELPA 3I6VA 1IUDA 3C31A 3V8XB 4YB5A 1IXIA 3DP6A 1B7ZA 2ZNSA 2GHAA 3KEIA 3LSWA 3S9MC 3T9XB 2DVZA 1SI0A 3TFLA 4C0RA 3S9LC 4PP0A 1IQ7A 4BDOA 2VHAA 4ELOA 1N3XA 5H8QB 3C4MA 3IJXB 2I3WA 3VVFA 3Q28A 4F2QA 1SD3A 5K2XA 2QRYA 4Q0CA 3SEYA 1WDNA 5KCJA 3FATA 4GLIA 2QS3A 3PGFA 5I57A 1NNTA 3WAEA 2NXOA 1B51A 1ZKBA 1OIBA 3M3KA 1Y3QA 1MXVA 4PETA 3ZS6A 3PD8A 1TWYA 3UORA 1R6ZA 3KN7A 4EDPA 4OEUA 3FJMA 5TPAB 3H6VA 3QK6A 5DVJA 1GR2A 2PT2A 4U1OA 3RT6B 3PUXE 1JVXA 1LFHA 1FQAA 5L9SA 4RA1A 2F8DA 4KCCA 4G8MA 4DCYA 2RCAA 1OQGA 1BKAA 3CFZA 3OSQA 4NWCA 4OMBA 3G3KA 3KJTA 1US5A 3CI8A 3OEMA 2NVUB 1MH3A 5H8HB 4IGTA 4AQ4A 5ICTA 1N0TA 3S4UA 4TLMB 2RF1A 3UA8A 3M3LA 4QFOA 1FQDA 1QKBA 5DVFA 1DPPA 3CRBA 1MQJA 1II5A 1NNKA 2G29A 3B6TA 2I48A 3IB2A 1F9BA 2Z8DA 4F1UA 4FORA 5I59A 2P0SA 1UTBB 2HEUA 3AXFA 4FEDA 4GF8A 2F34A 1I69A 2NUVA 4KR5A 2X7PA 4G68C 3HN0A 3BKIB 1DPEA 1Y20A 2FYIA 1R1NA 3PPRA 1JW5A 5K2YA 2QMXA 2F36A 3O6GA 5CRYA 2R71A 1TT1A 4AB6A 4R6HA 2HAUA 2I4BA 1IXCA 3TELA 3LC8A 3E13X 4KQPA 3W9VA 1MDP1 1CE2A 3FXQA 3OO7A 2WKYA 3FD3A 1KWHA 3HPIA 3VLVA 1S50A 4X1DA 5H8NA 5DEXA 1O64A 2QJEA 2D21A 5AA4A 5H8SA 1RYXA 5EYFA 3QAXA 1ZMGA 4NMYA 4NE4A 3MVXA 4YKJA 1YTVA 2OWSA 3EN3A 1XOCA 4U23A 4I62A 3K1MA 4XIGQ 3U93A 1B05A 3C35A 1IZ1A 2YJPA 3CG3A 5L9MA 1ELJA 3CG1A 3PPNA 1FQCA 4EXLA 4H0WA 1B46A 4LATA 1NFTA 3UGWA 1MQDA 1A55A 5EHMA 2FA7A 3HSTA 1CB6A 2ALUA 4M1VA 4C1UA 2E0SA 3FVNA 4GQOA 3JZJA 2XXTA 1AL3A 2ZYMA 4R73A 4K3FA 3MZ1A 1IIWA 2B65A 2V84A 3SKPA 2UVJA 1SW4A 2D5WA 4QFNA 1Q1KA 1PC3A 4HS7A 4HW8A 2DWIA 2DXRA 1LAXA 3VE1B 2W7YA 1VFEA 3G3HA 3VVEA 2P2AA 3N26A 4JB7A 3C33A 1DSNA 4GIZA 3FIRA 4G68A 2OLBA 1ZJLA 4G77A 1A7LA 3SDFA 4F1VA 1AOVA 5JTYA 3RN8A 4OTEA 4I8CA 1MXYA 4E0WA 5CBRA 3FUZA 2XXUA 4PFUA 4Z0IA 4R6YA 2ZNTA 3PMVA 5HBCA 1LAGE 3BBRA 5H8FB 1US4A 2F35A 3G3IA 4LZ7A 2ABHA 3LR1A 4KYSA 5KCJB 2ONSA 1D3KA 1Y4TA 2V93A 4DE8A 5I57B 1B7UA 4P0GA 3SERA 3LSXA 4ZE8A 1OQHA 1JEVA 1Y3PA 4OQOA 2H25A 1LFIA 2DWAA 3USDA 1URGA 5ELVA 4H8IA 1PB7A 1OMPA 1GGGA 2O68A 3S9EA 3RTWB 3MPKA 1B32A 1XC1A 1BP5A 4YICA 4ZZEA 4NTLA 3FJ7A 3SEUA 3V83A 1M5DA 2UYFA 4JSDA 4H5GA 2XXXA 5IKBA 4THIA 4NF8A 4EUOA 4PFTA 1FTMA 4RYAA 4ZEKA 3TCHA 2LAOA 1LAFE 2GRVA 3BFUA 1B4HA 2PT1A 1H44A 3N5LA 3O28A 2ONRA 1UQWA 1JQFA 4WKMA 3VDFA 2ONKE 3TEPA 2ZXTA 2OJTA 3VXBA 1Q35A 3HHFA 2F7CA 3K6XA 3F11A 2I58A 3EHSA 5FTHA 1QW0A 1MQIA 1P1OA 3HHGA 3PV0E 3GZGA 2B3FA 1ATGA 2Y7IA 2OK2A 2O84X 2M8CA 3RPWA 1LCFA 3K6VA 1JW1A 4H1XA 1Z7NE 1AIVA 3TPAA 4R74A 2YPNA 3ZKKA 1Z7ME 4IY5A 1MXWA 2VGQA 3B6WA 2O1LA 2VD3A 5FHOA 1M5EA 2XXIA 3L6HA 2GFEA 3VXCA 5FTIA 1PBQA 3KG2A 2RCBA 2F97A 1MPBA 1R9QA 4DXUA 3SEWA 4GL0A 3TDJA 3T9VA 3K01A 5CI5A 3FVKA 1OLAA 4L17A 2PVUA 1D9YA 3T66A 3IR1A 3K1NA 4I1DA 4XKQA 2AL4A 3RGYA 3JV9A 3CSBA 4NF6B 5DEXB 4H67A 3MPLA 4ZE9A 3MP6A 3SESA 5AA4B 3GBBA 4KCDA 2Q89A 4G8NA 2V3UA 4HCWA 1B3HA 4R72A 2VP1A 1VSOA 3Q25A 1MH4A 3C36A 3RT8A 1GV8A 3MZ9A 4F39A 1XVXA 1JVYA 4XKNA 1NKXA 1Y1MA 4UACA 1QVSA 4MFIA 1MM6A 1NNFA 3TAJA 2DXYA 2XXPA 3H6WA 1DTGA 3KN3A 3I3VA 3IO4A 2BJJX 1DTZA 2Q2CA 4U21A 3E9XA 5I56A 4ELRA 3C9HA 4X9TA 4HCYA 4OFLA 3TTKA 1S7YA 3O66A 1M5FA 1MXZA 2F6PA 1XHYA 1B2HA 2HQ0A 1JNFA 4RXLA 2XX8A 3O9PA 1URDA 4OWDA 4FATA 1R9LA 4YMBA 5I2NA 2Y7KA 1B1XA 4GVOA 2XXVA 3TKDA 1QUIA 2AIXA 4DDDA 2H4IA 1XT8A 5ICQA 4FECA 4IO4A 3OXNA 1NH7A 4XTCQ 3OO9A 4LQ5A 4JSOA 2F6GA 4QFPA 2RC8A 5ITOA 3G7WA 4RNSA 5DYHA 3MVZA 1QJMA 4U22A 5TP9B 2PBWA 1H76A 3IB0A 4F19A 3QIMA 4IGRA 2UVIA 3G3FA 3QUFA 1ZLQA 3K6WA 4NEDA 3IO6A 1FW0A 3U92A 3FASA 1TXFA 3JYRA 4JWOA 3IAZA 3O2AA 4RPOA 1QULA 2R9JA 1MM7A 1QUJA 2RKMA 3H7MA 1MQHA 4ZZAA 4YKIA 1NL5A 2NWJA 1QUKA 4IO2A 4ZEFA 1BIYA 2O7UA 3N94A 2Z8EA 1LSTA 4GXSB 4DLDA 2HXWA 3RUMA 1MRPA 1SI1A 3KFMA 2GH9A 3ILTB 5J1DA 3P7IA 3IB1A 1MS7A 1FTLA 5F7VA 1PDAA 3T9HB 2VD2A 2DOJA 2XX7A 3G3JA 1SVXB 5KDTA 4U4SA 1NNPA 2Z23A 2Y7RA 3K1PA 1B3LA 4YAHX 2XX9A 4JWXA 3MZBA 3PMWA 3GXAA 5B7DA 3KZGA 1B7HA 3DP8A 3KJ7A 2V3QA 4F3PA 5DT6A 4ZEIA 2RC9A 3MVWA 4TLLB 4YU0A 3IOWA 2QPQA 4EQ9A 2F7AA 3B7DA 4GFRA 5I58A 2F5XA 4R6KA 3TTNA 2Y7WA 1OLCA 1EH3A 1A8EA 3ILUB 3MAMA 1T0KA 4H8JA 2XXRA 5LOMA 4G2ZA 2V3TA 4G4PA 3MP1A 1USYH 2UXAA 4GXAA 1P1NA 3H03A 2Y7PA 1ANFA 3ECRA 1GVCA 1HSLA 3EHUA 4HTGA 1OVTA 1N7WA 1N3WA 3MJNA 1B5HA 2CZLA 2HCAA 5I84A 1DMBA 1Y3NA 1PEBA 2HFBA 1SYIA 4F22A 5HPQA 3VVDA 4ZECA 3D4CA 2RINA 4IO7A 3QSLA 5CMBA 4FAJA 1A99A 1LBBA 4N07A 3TYHA 1N84A 3RLFE 1B3GA 3PUYE 2VOZA 4ZDMA 3B6QA 3TODA 4LQ2A 4EQBA 3QXMA 3H4ZA 4PE5B 4BDMA 1ZTYA 1VE4A 3K00A 3O29A 4LP2B 4F31B 3C34A 4ESXA 1PBPA 3OENA 5F1QA 1B0LA 4Q5TA 1LAHE 5AA2D 3KBRA 2OWTA 3HO7A 1LB8A 1TFAA 2QS4A 2HZKA 2E1SA 3PPPA 4MLQA 4DXBA 1N04A 3TUSA 3A3CA 4BLAA 3MWBA 1AH5A 5B70A 4FIMA 5I56B 3TQLA 3IK6B 3SEVA 1URSA 1H3DA 3UIFA 2ZYOA 2I3VA 4EQ7A 3DLNA 4R9GA 1MDQA 2O6AA 3BFTA 3IX1A 5M2VA 3N6TA 4O3BA 1B52A 1Y4CA 4XXUA 3R26A 2O1MA 4U1ZA 2ZYKA 3K6UA 1POY1 5I2NB 2XXYA 2H9BA 1MY2A 1LGBC 3U1OA 4OETA 1A8FA 3C32A 3GBAA 1UIVA 3PUZE 1FQFA 1P99A 3FJGA 4LUBA 5ISUA 3ONMA 2RC7A 2H99A 3LBSA 3MW0A 4EF2A 4TQUQ 1TFDA 3DP4A 1B5IA 4AB5A 1O7TA 1MY0A 4QFLA 4N13A 4R75A 4F3GA 1IXHA 1BLFA 3EQ1A 3MBPA 4YB6A 3FXUA 1B3EA 5CMCA 4EF1A 1BTJA 2OBGA 3A09A 4JDFA 3TQWA 3SEXA 4GOTA 3RNNA 5AA2A 5I59B 4RK2A 2A5TA 4H65A 2ESNA 5ITPA 4BDNA 1J1NA 3MUQA 1P1QA 3T93B 2XXQA 2THIA 3PPOA 3MC2A 1B6HA 4X1BA 4QRZA 2CMOA 4E0XA 4IO5A 4P11A 1SQYA 3V5AA 1JETA 1SYHA 1FCKA 2PYYA 3FXRA 2REJA 3VLWA 1HSEA 5I2KA 5A5XA 2FNCA 3E3KA 2QL3A 3QYTA 5L8DA 4F18A 4DCXA 4ND9A 3A3UA 3K02A 1O63A 3IOVA 1ZU0A 4FE8A 3KSXA 3KGCA 4BDRA 3FGSA 5JEIA 4F1YA 1PB8A 1DOTA 4WEPA 5H8NB 5AE4A 4IO6A 4RPNA 3FZVA 2PMSA 5I58B 2A5SA 3CR9A 3ODBA 4OENA 5DVIA 2Y84A 3PPQA 4H5FA 4YMAA 1Y1ZA 5AA1A 4PFYA 1B4ZA 2Q8JA 3DELB 2D3IA 2O69A 4LZ8A 4I9DA 3K4UA 2AYSA 1Y9UA 4OEVA 4YKPA 3G3GA 1I6AA 5H8FA 2XHDA 1SDXA 4FJPA 4LVQA 1FTKA 1MXXA 3TTLA 1AMFA 3TMGA 3UN6A 3FV1A 2B3BA 1I6BA 3T96B 1MY4A 5KZTA 2QSXA 1MY3A 3TTRA 4GWOA 3THIA 1FQEA 3DM0A 4JXIA 4MF3A 2DVCA 2DYXA 2H5YA 3R7XA 3OO6A 4G68B 2F78A 4ZEDA 3VV5A 4MBPA 2DWHA 2XXWA 3O6HA 1MPDA 2Q88A 5JTYB 4GL8A 4Z7EA 3VLUA 1NMUA 2G93A 3M8UA 3T9UA 4JBZA 1I6QA 3HCQA 1RYOA 5AA3A 1XS5A 4G8HA 3OD7A 2ZMBA 1MXUA 1N76A 3L6GA 4O3AA 4R9FA 5DTBA 3E4RA 4Q30B 2V25A 4NF5A 3K2DA 1D4NA 4ESWA 4RJZA 1FTOA 2NOOA 1LLSA 4O3CA 3KSJA 3W15C 3CIJA 4PQJA 5CBSA 3EPEA 3S2VA 2YLNA 3D4GA 2IEEA 3KN8A 1UTHA 3UK4A 1VR5A 1EZPA 5BUUA 2X7QA 4GD5A 2IA4A 2O51A 3CFXA 2ZYNA 2Z22A 5JK4A 1FQBA 4ECFA 2DE3A 3IL1B 4KI0E 2H98A 4X48A 1LCTA 2OCUA 4ELQA 3MP8A 3OELA 2DE2A 3H06B 3M3FA 4NF8B 1H45A 4NF4A 5L9OA 3U8QA 2UVHA 1P1UA 2I0BA 4FEBA 5CM6A 4QFKA 2QS2A 1H43A 5FHNA 1YCJA 3O6IA 2DQVA 3CVGA 4YB7A 4F2OA 4LA9A 3U94A 1UIUA 2GHBA 4ISUA 4NF6A 1B5JA 2XXHA 3EHTA 1XVYA 1JW4A 3S9NC 2Q2AA 3V89B 5AA2B 2REGA 2DE4A 5H8QA 1D9VA 2A5TB 3RQTA 4OFOA 4F3BA 3PUVE 4N6PA 5EHSA 1B0HA 2I0CA 4KPTA 4RY1A 4KFQA 4BDQA 4WEDA 1YPNA 4IO3A 4OVJA 3UP9A 4OZ9A 4POWA 1EU8A 3IOTA 3PUWE 4F29A 3Q27A 5CMMA 3H6UA 1SW2A 2OZZA 5I2KB 5A5XB 5FHMA 1P1WA 1GTKA 1MPCA 4RK9A 3CSGA 2ANJA 2QMWA 2HAVA 3OSRA 5BWJA 5CC2A 3VFJA 1B9JA 4U4XA 1POTA 4H6DA 5IAIA 3I5OA 2Z8FA 2XD2A 2R6GE 1FTJA 4MH5A 4YZZA 5TPAA 4OYVA 4DXCA 2UYEA 2O7IA 3LSLA 3TCFA 5CMKA 4Q8RA 1A40A 3IJOB 3H3GA 1HSJA 4OHNA 4P0IA 3IORA 4QF9A 3Q29A 4NWDA 4KYDA 3O97A 4DZ1A 3FVOA 1RKMA 2AL5A 1A54A 4EXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8H A;  4XKP A;  5TP9 A;  1M5C A;  4XKR A;  4F3S A;  1M5B A;  1IXG A;  3WAF A;  3OMB A;  1S9T A;  2XD3 A;  1IIT A;  3CFL A;  1USY E;  1L5T A;  1MG1 A;  2KLF A;  4OXV A;  3IOU A;  3ZSF A;  1JEU A;  2Q9T A;  2I6E A;  1WVJ A;  1B1H A;  1PB9 A;  3TCG A;  4QSC A;  1UTB A;  1B3F A;  3PU5 A;  3RTF B;  1VFD A;  1MQG A;  4U2R A;  3RY3 A;  4KYE A;  3H6T A;  4LZ5 A;  1ZIU A;  2UVG A;  3KOS A;  2I4C A;  3FV2 A;  2DP8 A;  2ZNU A;  3EF7 A;  1QKA A;  3PMX A;  1LB9 A;  1SW1 A;  4BDL A;  4M4G A;  1LFG A;  3TTM A;  1LBC A;  1SW5 A;  3LSF B;  4IB2 A;  4QSD A;  1YAE A;  2X26 A;  5TU0 A;  1NH8 A;  4POX A;  3T22 A;  3OOA A;  3LUY A;  4C1T A;  4NF5 B;  3SET A;  4TOZ A;  4UA8 A;  1MY1 A;  1B58 A;  2F7B A;  1B40 A;  2PX1 A;  4ZEB A;  3OEK A;  3MVY A;  3U72 A;  4KD5 A;  3GLB A;  4OFJ A;  3TZA A;  4OES A;  3QUJ A;  2DWJ A;  4R2B A;  1EZO A;  3Q26 A;  4KHZ E;  4PFW A;  3FVG A;  2P1S A;  1EZ9 A;  1WOD A;  3MQ9 A;  4QHQ A;  4MLV A;  1UTH B;  4YKK A;  1ZBM A;  3R6U A;  3KOT A;  3W9W A;  4ONY A;  1N7X A;  4R2F A;  4ZS9 A;  3PD9 A;  2DSF A;  1IEJ A;  1OVB A;  3ZKL A;  1SBP A;  4IY6 A;  2DS9 A;  4QSE A;  2HZL A;  2QS1 A;  3N6U A;  3OO8 A;  4DIG A;  2I49 A;  5KDT B;  4OER A;  5HM4 B;  4WXJ A;  3HV1 A;  3K0V A;  4NF4 B;  4JWY A;  4LON B;  4GRK A;  4ELP A;  3I6V A;  1IUD A;  3C31 A;  3V8X B;  4YB5 A;  1IXI A;  3DP6 A;  1B7Z A;  2ZNS A;  2GHA A;  3KEI A;  3LSW A;  3S9M C;  3T9X B;  2DVZ A;  1SI0 A;  3TFL A;  4C0R A;  3S9L C;  4PP0 A;  1IQ7 A;  4BDO A;  2VHA A;  4ELO A;  1N3X A;  5H8Q B;  3C4M A;  3IJX B;  2I3W A;  3VVF A;  3Q28 A;  4F2Q A;  1SD3 A;  5K2X A;  2QRY A;  4Q0C A;  3SEY A;  1WDN A;  5KCJ A;  3FAT A;  4GLI A;  2QS3 A;  3PGF A;  5I57 A;  1NNT A;  3WAE A;  2NXO A;  1B51 A;  1ZKB A;  1OIB A;  3M3K A;  1Y3Q A;  1MXV A;  4PET A;  3ZS6 A;  3PD8 A;  1TWY A;  3UOR A;  1R6Z A;  3KN7 A;  4EDP A;  4OEU A;  3FJM A;  5TPA B;  3H6V A;  3QK6 A;  5DVJ A;  1GR2 A;  2PT2 A;  4U1O A;  3RT6 B;  3PUX E;  1JVX A;  1LFH A;  1FQA A;  5L9S A;  4RA1 A;  2F8D A;  4KCC A;  4G8M A;  4DCY A;  2RCA A;  1OQG A;  1BKA A;  3CFZ A;  3OSQ A;  4NWC A;  4OMB A;  3G3K A;  3KJT A;  1US5 A;  3CI8 A;  3OEM A;  2NVU B;  1MH3 A;  5H8H B;  4IGT A;  4AQ4 A;  5ICT A;  1N0T A;  3S4U A;  4TLM B;  2RF1 A;  3UA8 A;  3M3L A;  4QFO A;  1FQD A;  1QKB A;  5DVF A;  1DPP A;  3CRB A;  1MQJ A;  1II5 A;  1NNK A;  2G29 A;  3B6T A;  2I48 A;  3IB2 A;  1F9B A;  2Z8D A;  4F1U A;  4FOR A;  5I59 A;  2P0S A;  1UTB B;  2HEU A;  3AXF A;  4FED A;  4GF8 A;  2F34 A;  1I69 A;  2NUV A;  4KR5 A;  2X7P A;  4G68 C;  3HN0 A;  3BKI B;  1DPE A;  1Y20 A;  2FYI A;  1R1N A;  3PPR A;  1JW5 A;  5K2Y A;  2QMX A;  2F36 A;  3O6G A;  5CRY A;  2R71 A;  1TT1 A;  4AB6 A;  4R6H A;  2HAU A;  2I4B A;  1IXC A;  3TEL A;  3LC8 A;  3E13 X;  4KQP A;  3W9V A;  1MDP 1;  1CE2 A;  3FXQ A;  3OO7 A;  2WKY A;  3FD3 A;  1KWH A;  3HPI A;  3VLV A;  1S50 A;  4X1D A;  5H8N A;  5DEX A;  1O64 A;  2QJE A;  2D21 A;  5AA4 A;  5H8S A;  1RYX A;  5EYF A;  3QAX A;  1ZMG A;  4NMY A;  4NE4 A;  3MVX A;  4YKJ A;  1YTV A;  2OWS A;  3EN3 A;  1XOC A;  4U23 A;  4I62 A;  3K1M A;  4XIG Q;  3U93 A;  1B05 A;  3C35 A;  1IZ1 A;  2YJP A;  3CG3 A;  5L9M A;  1ELJ A;  3CG1 A;  3PPN A;  1FQC A;  4EXL A;  4H0W A;  1B46 A;  4LAT A;  1NFT A;  3UGW A;  1MQD A;  1A55 A;  5EHM A;  2FA7 A;  3HST A;  1CB6 A;  2ALU A;  4M1V A;  4C1U A;  2E0S A;  3FVN A;  4GQO A;  3JZJ A;  2XXT A;  1AL3 A;  2ZYM A;  4R73 A;  4K3F A;  3MZ1 A;  1IIW A;  2B65 A;  2V84 A;  3SKP A;  2UVJ A;  1SW4 A;  2D5W A;  4QFN A;  1Q1K A;  1PC3 A;  4HS7 A;  4HW8 A;  2DWI A;  2DXR A;  1LAX A;  3VE1 B;  2W7Y A;  1VFE A;  3G3H A;  3VVE A;  2P2A A;  3N26 A;  4JB7 A;  3C33 A;  1DSN A;  4GIZ A;  3FIR A;  4G68 A;  2OLB A;  1ZJL A;  4G77 A;  1A7L A;  3SDF A;  4F1V A;  1AOV A;  5JTY A;  3RN8 A;  4OTE A;  4I8C A;  1MXY A;  4E0W A;  5CBR A;  3FUZ A;  2XXU A;  4PFU A;  4Z0I A;  4R6Y A;  2ZNT A;  3PMV A;  5HBC A;  1LAG E;  3BBR A;  5H8F B;  1US4 A;  2F35 A;  3G3I A;  4LZ7 A;  2ABH A;  3LR1 A;  4KYS A;  5KCJ B;  2ONS A;  1D3K A;  1Y4T A;  2V93 A;  4DE8 A;  5I57 B;  1B7U A;  4P0G A;  3SER A;  3LSX A;  4ZE8 A;  1OQH A;  1JEV A;  1Y3P A;  4OQO A;  2H25 A;  1LFI A;  2DWA A;  3USD A;  1URG A;  5ELV A;  4H8I A;  1PB7 A;  1OMP A;  1GGG A;  2O68 A;  3S9E A;  3RTW B;  3MPK A;  1B32 A;  1XC1 A;  1BP5 A;  4YIC A;  4ZZE A;  4NTL A;  3FJ7 A;  3SEU A;  3V83 A;  1M5D A;  2UYF A;  4JSD A;  4H5G A;  2XXX A;  5IKB A;  4THI A;  4NF8 A;  4EUO A;  4PFT A;  1FTM A;  4RYA A;  4ZEK A;  3TCH A;  2LAO A;  1LAF E;  2GRV A;  3BFU A;  1B4H A;  2PT1 A;  1H44 A;  3N5L A;  3O28 A;  2ONR A;  1UQW A;  1JQF A;  4WKM A;  3VDF A;  2ONK E;  3TEP A;  2ZXT A;  2OJT A;  3VXB A;  1Q35 A;  3HHF A;  2F7C A;  3K6X A;  3F11 A;  2I58 A;  3EHS A;  5FTH A;  1QW0 A;  1MQI A;  1P1O A;  3HHG A;  3PV0 E;  3GZG A;  2B3F A;  1ATG A;  2Y7I A;  2OK2 A;  2O84 X;  2M8C A;  3RPW A;  1LCF A;  3K6V A;  1JW1 A;  4H1X A;  1Z7N E;  1AIV A;  3TPA A;  4R74 A;  2YPN A;  3ZKK A;  1Z7M E;  4IY5 A;  1MXW A;  2VGQ A;  3B6W A;  2O1L A;  2VD3 A;  5FHO A;  1M5E A;  2XXI A;  3L6H A;  2GFE A;  3VXC A;  5FTI A;  1PBQ A;  3KG2 A;  2RCB A;  2F97 A;  1MPB A;  1R9Q A;  4DXU A;  3SEW A;  4GL0 A;  3TDJ A;  3T9V A;  3K01 A;  5CI5 A;  3FVK A;  1OLA A;  4L17 A;  2PVU A;  1D9Y A;  3T66 A;  3IR1 A;  3K1N A;  4I1D A;  4XKQ A;  2AL4 A;  3RGY A;  3JV9 A;  3CSB A;  4NF6 B;  5DEX B;  4H67 A;  3MPL A;  4ZE9 A;  3MP6 A;  3SES A;  5AA4 B;  3GBB A;  4KCD A;  2Q89 A;  4G8N A;  2V3U A;  4HCW A;  1B3H A;  4R72 A;  2VP1 A;  1VSO A;  3Q25 A;  1MH4 A;  3C36 A;  3RT8 A;  1GV8 A;  3MZ9 A;  4F39 A;  1XVX A;  1JVY A;  4XKN A;  1NKX A;  1Y1M A;  4UAC A;  1QVS A;  4MFI A;  1MM6 A;  1NNF A;  3TAJ A;  2DXY A;  2XXP A;  3H6W A;  1DTG A;  3KN3 A;  3I3V A;  3IO4 A;  2BJJ X;  1DTZ A;  2Q2C A;  4U21 A;  3E9X A;  5I56 A;  4ELR A;  3C9H A;  4X9T A;  4HCY A;  4OFL A;  3TTK A;  1S7Y A;  3O66 A;  1M5F A;  1MXZ A;  2F6P A;  1XHY A;  1B2H A;  2HQ0 A;  1JNF A;  4RXL A;  2XX8 A;  3O9P A;  1URD A;  4OWD A;  4FAT A;  1R9L A;  4YMB A;  5I2N A;  2Y7K A;  1B1X A;  4GVO A;  2XXV A;  3TKD A;  1QUI A;  2AIX A;  4DDD A;  2H4I A;  1XT8 A;  5ICQ A;  4FEC A;  4IO4 A;  3OXN A;  1NH7 A;  4XTC Q;  3OO9 A;  4LQ5 A;  4JSO A;  2F6G A;  4QFP A;  2RC8 A;  5ITO A;  3G7W A;  4RNS A;  5DYH A;  3MVZ A;  1QJM A;  4U22 A;  5TP9 B;  2PBW A;  1H76 A;  3IB0 A;  4F19 A;  3QIM A;  4IGR A;  2UVI A;  3G3F A;  3QUF A;  1ZLQ A;  3K6W A;  4NED A;  3IO6 A;  1FW0 A;  3U92 A;  3FAS A;  1TXF A;  3JYR A;  4JWO A;  3IAZ A;  3O2A A;  4RPO A;  1QUL A;  2R9J A;  1MM7 A;  1QUJ A;  2RKM A;  3H7M A;  1MQH A;  4ZZA A;  4YKI A;  1NL5 A;  2NWJ A;  1QUK A;  4IO2 A;  4ZEF A;  1BIY A;  2O7U A;  3N94 A;  2Z8E A;  1LST A;  4GXS B;  4DLD A;  2HXW A;  3RUM A;  1MRP A;  1SI1 A;  3KFM A;  2GH9 A;  3ILT B;  5J1D A;  3P7I A;  3IB1 A;  1MS7 A;  1FTL A;  5F7V A;  1PDA A;  3T9H B;  2VD2 A;  2DOJ A;  2XX7 A;  3G3J A;  1SVX B;  5KDT A;  4U4S A;  1NNP A;  2Z23 A;  2Y7R A;  3K1P A;  1B3L A;  4YAH X;  2XX9 A;  4JWX A;  3MZB A;  3PMW A;  3GXA A;  5B7D A;  3KZG A;  1B7H A;  3DP8 A;  3KJ7 A;  2V3Q A;  4F3P A;  5DT6 A;  4ZEI A;  2RC9 A;  3MVW A;  4TLL B;  4YU0 A;  3IOW A;  2QPQ A;  4EQ9 A;  2F7A A;  3B7D A;  4GFR A;  5I58 A;  2F5X A;  4R6K A;  3TTN A;  2Y7W A;  1OLC A;  1EH3 A;  1A8E A;  3ILU B;  3MAM A;  1T0K A;  4H8J A;  2XXR A;  5LOM A;  4G2Z A;  2V3T A;  4G4P A;  3MP1 A;  1USY H;  2UXA A;  4GXA A;  1P1N A;  3H03 A;  2Y7P A;  1ANF A;  3ECR A;  1GVC A;  1HSL A;  3EHU A;  4HTG A;  1OVT A;  1N7W A;  1N3W A;  3MJN A;  1B5H A;  2CZL A;  2HCA A;  5I84 A;  1DMB A;  1Y3N A;  1PEB A;  2HFB A;  1SYI A;  4F22 A;  5HPQ A;  3VVD A;  4ZEC A;  3D4C A;  2RIN A;  4IO7 A;  3QSL A;  5CMB A;  4FAJ A;  1A99 A;  1LBB A;  4N07 A;  3TYH A;  1N84 A;  3RLF E;  1B3G A;  3PUY E;  2VOZ A;  4ZDM A;  3B6Q A;  3TOD A;  4LQ2 A;  4EQB A;  3QXM A;  3H4Z A;  4PE5 B;  4BDM A;  1ZTY A;  1VE4 A;  3K00 A;  3O29 A;  4LP2 B;  4F31 B;  3C34 A;  4ESX A;  1PBP A;  3OEN A;  5F1Q A;  1B0L A;  4Q5T A;  1LAH E;  5AA2 D;  3KBR A;  2OWT A;  3HO7 A;  1LB8 A;  1TFA A;  2QS4 A;  2HZK A;  2E1S A;  3PPP A;  4MLQ A;  4DXB A;  1N04 A;  3TUS A;  3A3C A;  4BLA A;  3MWB A;  1AH5 A;  5B70 A;  4FIM A;  5I56 B;  3TQL A;  3IK6 B;  3SEV A;  1URS A;  1H3D A;  3UIF A;  2ZYO A;  2I3V A;  4EQ7 A;  3DLN A;  4R9G A;  1MDQ A;  2O6A A;  3BFT A;  3IX1 A;  5M2V A;  3N6T A;  4O3B A;  1B52 A;  1Y4C A;  4XXU A;  3R26 A;  2O1M A;  4U1Z A;  2ZYK A;  3K6U A;  1POY 1;  5I2N B;  2XXY A;  2H9B A;  1MY2 A;  1LGB C;  3U1O A;  4OET A;  1A8F A;  3C32 A;  3GBA A;  1UIV A;  3PUZ E;  1FQF A;  1P99 A;  3FJG A;  4LUB A;  5ISU A;  3ONM A;  2RC7 A;  2H99 A;  3LBS A;  3MW0 A;  4EF2 A;  4TQU Q;  1TFD A;  3DP4 A;  1B5I A;  4AB5 A;  1O7T A;  1MY0 A;  4QFL A;  4N13 A;  4R75 A;  4F3G A;  1IXH A;  1BLF A;  3EQ1 A;  3MBP A;  4YB6 A;  3FXU A;  1B3E A;  5CMC A;  4EF1 A;  1BTJ A;  2OBG A;  3A09 A;  4JDF A;  3TQW A;  3SEX A;  4GOT A;  3RNN A;  5AA2 A;  5I59 B;  4RK2 A;  2A5T A;  4H65 A;  2ESN A;  5ITP A;  4BDN A;  1J1N A;  3MUQ A;  1P1Q A;  3T93 B;  2XXQ A;  2THI A;  3PPO A;  3MC2 A;  1B6H A;  4X1B A;  4QRZ A;  2CMO A;  4E0X A;  4IO5 A;  4P11 A;  1SQY A;  3V5A A;  1JET A;  1SYH A;  1FCK A;  2PYY A;  3FXR A;  2REJ A;  3VLW A;  1HSE A;  5I2K A;  5A5X A;  2FNC A;  3E3K A;  2QL3 A;  3QYT A;  5L8D A;  4F18 A;  4DCX A;  4ND9 A;  3A3U A;  3K02 A;  1O63 A;  3IOV A;  1ZU0 A;  4FE8 A;  3KSX A;  3KGC A;  4BDR A;  3FGS A;  5JEI A;  4F1Y A;  1PB8 A;  1DOT A;  4WEP A;  5H8N B;  5AE4 A;  4IO6 A;  4RPN A;  3FZV A;  2PMS A;  5I58 B;  2A5S A;  3CR9 A;  3ODB A;  4OEN A;  5DVI A;  2Y84 A;  3PPQ A;  4H5F A;  4YMA A;  1Y1Z A;  5AA1 A;  4PFY A;  1B4Z A;  2Q8J A;  3DEL B;  2D3I A;  2O69 A;  4LZ8 A;  4I9D A;  3K4U A;  2AYS A;  1Y9U A;  4OEV A;  4YKP A;  3G3G A;  1I6A A;  5H8F A;  2XHD A;  1SDX A;  4FJP A;  4LVQ A;  1FTK A;  1MXX A;  3TTL A;  1AMF A;  3TMG A;  3UN6 A;  3FV1 A;  2B3B A;  1I6B A;  3T96 B;  1MY4 A;  5KZT A;  2QSX A;  1MY3 A;  3TTR A;  4GWO A;  3THI A;  1FQE A;  3DM0 A;  4JXI A;  4MF3 A;  2DVC A;  2DYX A;  2H5Y A;  3R7X A;  3OO6 A;  4G68 B;  2F78 A;  4ZED A;  3VV5 A;  4MBP A;  2DWH A;  2XXW A;  3O6H A;  1MPD A;  2Q88 A;  5JTY B;  4GL8 A;  4Z7E A;  3VLU A;  1NMU A;  2G93 A;  3M8U A;  3T9U A;  4JBZ A;  1I6Q A;  3HCQ A;  1RYO A;  5AA3 A;  1XS5 A;  4G8H A;  3OD7 A;  2ZMB A;  1MXU A;  1N76 A;  3L6G A;  4O3A A;  4R9F A;  5DTB A;  3E4R A;  4Q30 B;  2V25 A;  4NF5 A;  3K2D A;  1D4N A;  4ESW A;  4RJZ A;  1FTO A;  2NOO A;  1LLS A;  4O3C A;  3KSJ A;  3W15 C;  3CIJ A;  4PQJ A;  5CBS A;  3EPE A;  3S2V A;  2YLN A;  3D4G A;  2IEE A;  3KN8 A;  1UTH A;  3UK4 A;  1VR5 A;  1EZP A;  5BUU A;  2X7Q A;  4GD5 A;  2IA4 A;  2O51 A;  3CFX A;  2ZYN A;  2Z22 A;  5JK4 A;  1FQB A;  4ECF A;  2DE3 A;  3IL1 B;  4KI0 E;  2H98 A;  4X48 A;  1LCT A;  2OCU A;  4ELQ A;  3MP8 A;  3OEL A;  2DE2 A;  3H06 B;  3M3F A;  4NF8 B;  1H45 A;  4NF4 A;  5L9O A;  3U8Q A;  2UVH A;  1P1U A;  2I0B A;  4FEB A;  5CM6 A;  4QFK A;  2QS2 A;  1H43 A;  5FHN A;  1YCJ A;  3O6I A;  2DQV A;  3CVG A;  4YB7 A;  4F2O A;  4LA9 A;  3U94 A;  1UIU A;  2GHB A;  4ISU A;  4NF6 A;  1B5J A;  2XXH A;  3EHT A;  1XVY A;  1JW4 A;  3S9N C;  2Q2A A;  3V89 B;  5AA2 B;  2REG A;  2DE4 A;  5H8Q A;  1D9V A;  2A5T B;  3RQT A;  4OFO A;  4F3B A;  3PUV E;  4N6P A;  5EHS A;  1B0H A;  2I0C A;  4KPT A;  4RY1 A;  4KFQ A;  4BDQ A;  4WED A;  1YPN A;  4IO3 A;  4OVJ A;  3UP9 A;  4OZ9 A;  4POW A;  1EU8 A;  3IOT A;  3PUW E;  4F29 A;  3Q27 A;  5CMM A;  3H6U A;  1SW2 A;  2OZZ A;  5I2K B;  5A5X B;  5FHM A;  1P1W A;  1GTK A;  1MPC A;  4RK9 A;  3CSG A;  2ANJ A;  2QMW A;  2HAV A;  3OSR A;  5BWJ A;  5CC2 A;  3VFJ A;  1B9J A;  4U4X A;  1POT A;  4H6D A;  5IAI A;  3I5O A;  2Z8F A;  2XD2 A;  2R6G E;  1FTJ A;  4MH5 A;  4YZZ A;  5TPA A;  4OYV A;  4DXC A;  2UYE A;  2O7I A;  3LSL A;  3TCF A;  5CMK A;  4Q8R A;  1A40 A;  3IJO B;  3H3G A;  1HSJ A;  4OHN A;  4P0I A;  3IOR A;  4QF9 A;  3Q29 A;  4NWD A;  4KYD A;  3O97 A;  4DZ1 A;  3FVO A;  1RKM A;  2AL5 A;  1A54 A;  4EXK A; 
#chains in the Genus database with same CATH topology
 5H8H A;  4XKP A;  5TP9 A;  1M5C A;  4XKR A;  4F3S A;  1M5B A;  1IXG A;  3WAF A;  3OMB A;  1S9T A;  2XD3 A;  4IR8 A;  4N6D A;  1IIT A;  3CFL A;  1USY E;  1L5T A;  1MG1 A;  2CZI A;  2KLF A;  4OXV A;  3IOU A;  5EQ9 A;  3ZSF A;  1JEU A;  2Q9T A;  2I6E A;  1WVJ A;  1B1H A;  1PB9 A;  3TCG A;  4QSC A;  1UTB A;  2DDK A;  1B3F A;  3PU5 A;  3RTF B;  1FPL A;  2GQ1 A;  1VFD A;  1MQG A;  4U2R A;  3RY3 A;  4KYE A;  3H6T A;  4LZ5 A;  1ZIU A;  2UVG A;  3KOS A;  2I4C A;  2ZZV A;  3FV2 A;  2DP8 A;  2FIE A;  2ZNU A;  3EF7 A;  1QKA A;  1D9Q A;  3PMX A;  1LB9 A;  1SW1 A;  4BDL A;  4MMP A;  5EQ7 A;  4M4G A;  1LFG A;  3TTM A;  1LBC A;  1SW5 A;  3LSF B;  4IB2 A;  4QSD A;  4PFB A;  1YAE A;  2X26 A;  4NAP A;  5TU0 A;  1NH8 A;  2XWO A;  4POX A;  3T22 A;  3OOA A;  3LUY A;  4C1T A;  4NF5 B;  3SET A;  1FPD A;  4TOZ A;  4UA8 A;  2Q8M A;  1MY1 A;  1DBZ A;  1B58 A;  4GWZ A;  2F7B A;  1B40 A;  2PX1 A;  4ZEB A;  3OEK A;  3MVY A;  3U72 A;  4KD5 A;  1JP4 A;  3GLB A;  4OFJ A;  3TZA A;  4OES A;  3QUJ A;  2DWJ A;  4R2B A;  1EZO A;  3Q26 A;  4KHZ E;  4PFW A;  3FVG A;  2P1S A;  1KZ8 A;  1EZ9 A;  1WOD A;  3MQ9 A;  4QHQ A;  4MLV A;  1UTH B;  4MNC A;  4YKK A;  1ZBM A;  3R6U A;  3KOT A;  4ONY A;  3W9W A;  1N7X A;  4R2F A;  4ZS9 A;  3PD9 A;  1G0H A;  2DSF A;  5J16 A;  1IEJ A;  1OVB A;  3ZKL A;  1SBP A;  2P3N A;  4IY6 A;  1FBE A;  2DS9 A;  4QSE A;  2HZL A;  2QS1 A;  3N6U A;  3OO8 A;  4DIG A;  2I49 A;  5KDT B;  4OER A;  5HM4 B;  4WXJ A;  3HV1 A;  3K0V A;  4AS4 A;  4NF4 B;  4JWY A;  4LON B;  4GRK A;  5ET7 A;  4ELP A;  3I6V A;  1IUD A;  2QVV A;  3C31 A;  3V8X B;  4YB5 A;  1IXI A;  3DP6 A;  1B7Z A;  2ZNS A;  2GHA A;  3KEI A;  3LSW A;  3S9M C;  2PFY A;  3T9X B;  2DVZ A;  1SI0 A;  3TFL A;  4C0R A;  3S9L C;  4PP0 A;  1IQ7 A;  2CEX A;  1RDY A;  1INP A;  4BDO A;  3LUZ A;  2VHA A;  4ELO A;  4GWX A;  1N3X A;  5H8Q B;  4O8M A;  4MCO A;  3C4M A;  4UAB A;  5F24 A;  3IJX B;  2I3W A;  3VVF A;  3Q28 A;  4F2Q A;  1SD3 A;  5K2X A;  2QRY A;  5T3J A;  5LTC A;  4Q0C A;  3SEY A;  2HHM A;  1WDN A;  1NUZ A;  5KCJ A;  3FAT A;  4GLI A;  2QS3 A;  3PGF A;  5I57 A;  1NNT A;  3WAE A;  4P47 A;  2NXO A;  3SZP A;  1B51 A;  1ZKB A;  1OIB A;  3M3K A;  3RPL B;  1Y3Q A;  1FJ6 A;  1MXV A;  4N8G A;  4PET A;  3ZS6 A;  3PD8 A;  1TWY A;  3UOR A;  1R6Z A;  3KN7 A;  4EDP A;  4OEU A;  3FJM A;  5TPA B;  3H6V A;  3QK6 A;  5DVJ A;  1GR2 A;  2PT2 A;  4U1O A;  3RT6 B;  3PUX E;  5FBP A;  1JVX A;  1LFH A;  1FQA A;  5L9S A;  4PGN A;  2ZZX A;  4RA1 A;  2F8D A;  4KCC A;  4G8M A;  4DCY A;  2RCA A;  1OQG A;  1BKA A;  3CFZ A;  3OSQ A;  4NWC A;  4OMB A;  3G3K A;  3KJT A;  1FPF A;  1US5 A;  3CI8 A;  3OEM A;  3FXB A;  2NVU B;  1MH3 A;  5H8H B;  4IGT A;  4AQ4 A;  5ICT A;  1N0T A;  3S4U A;  4TLM B;  2RF1 A;  3UA8 A;  3M3L A;  4QFO A;  1FQD A;  1QKB A;  5DVF A;  1DPP A;  3CRB A;  1MQJ A;  1II5 A;  1NNK A;  4OVP A;  1RDX A;  2G29 A;  3B6T A;  4MX6 A;  4NHB A;  2I48 A;  3IB2 A;  1F9B A;  2Z8D A;  4F1U A;  4FOR A;  5I59 A;  2P0S A;  1UTB B;  2HEU A;  3AXF A;  4FED A;  4GF8 A;  2F34 A;  1I69 A;  5IZ3 A;  2NUV A;  4PAF A;  4GWY A;  4KR5 A;  2X7P A;  4G68 C;  3HN0 A;  3BKI B;  1DPE A;  1Y20 A;  1FBD A;  1LBZ A;  1R1N A;  2FYI A;  3PPR A;  1JW5 A;  5K2Y A;  2QMX A;  2F36 A;  3O6G A;  5CRY A;  2R71 A;  1TT1 A;  2F3B A;  5IGA A;  4AB6 A;  4R6H A;  1QGX A;  2HAU A;  2I4B A;  1IXC A;  3TEL A;  1FBF A;  3LC8 A;  3E13 X;  4KQP A;  3W9V A;  1MDP 1;  1SPI A;  1CE2 A;  3FXQ A;  3OO7 A;  4GX3 A;  2WKY A;  4PGP A;  3FD3 A;  1FBP A;  1KWH A;  3HPI A;  3VLV A;  1S50 A;  4X1D A;  5IM2 A;  4MJO A;  5H8N A;  5DEX A;  1O64 A;  2QJE A;  3B8B A;  2XXK A;  2D21 A;  4N81 A;  4P56 A;  5AA4 A;  2L5V A;  5H8S A;  1RYX A;  5EYF A;  3QAX A;  1ZMG A;  4NMY A;  4NE4 A;  3MVX A;  4YKJ A;  1EYK A;  1YTV A;  2OWS A;  3EN3 A;  1XOC A;  4XF5 A;  4U23 A;  4I62 A;  3K1M A;  4XIG Q;  4N15 A;  3U93 A;  1B05 A;  4NQ8 A;  4HE0 A;  3C35 A;  1IZ1 A;  2YJP A;  3CG3 A;  5L9M A;  1ELJ A;  3CG1 A;  3PPN A;  1FQC A;  4GBW A;  4EXL A;  4H0W A;  1B46 A;  4LAT A;  1NFT A;  3UGW A;  1MQD A;  1A55 A;  5EHM A;  2FA7 A;  3HST A;  1CB6 A;  2ALU A;  2WBB A;  3MST A;  4PTK A;  4M1V A;  4C1U A;  2E0S A;  3FVN A;  1IME A;  4GQO A;  3JZJ A;  2XXT A;  1AL3 A;  2ZYM A;  4R73 A;  4K3F A;  3MZ1 A;  1IIW A;  2B65 A;  2V84 A;  2QVU A;  3SKP A;  2UVJ A;  1SW4 A;  1NV6 A;  2D5W A;  4QFN A;  1Q1K A;  1PC3 A;  4HS7 A;  2Q74 A;  1NI9 A;  5ESY A;  4HW8 A;  2DWI A;  2DXR A;  1FPI A;  1LAX A;  3VE1 B;  4P8B A;  2W7Y A;  1VFE A;  3G3H A;  3VVE A;  2P2A A;  3N26 A;  4JB7 A;  3C33 A;  1DSN A;  2P3V A;  4GIZ A;  1FPG A;  3FIR A;  4G68 A;  2OLB A;  1ZJL A;  4G77 A;  1A7L A;  3SDF A;  4F1V A;  1AOV A;  5JTY A;  3RN8 A;  2KR0 A;  4OTE A;  4I8C A;  1MXY A;  4E0W A;  5CBR A;  3FUZ A;  5IZ1 A;  2XXU A;  4OVQ A;  4GBV A;  4PFU A;  4Z0I A;  4R6Y A;  2ZNT A;  3PMV A;  5HBC A;  1FBG A;  1LAG E;  3BBR A;  5H8F B;  1US4 A;  2F35 A;  3G3I A;  4LZ7 A;  2ABH A;  3LR1 A;  1DCU A;  4KYS A;  5KCJ B;  2ONS A;  1D3K A;  2JJK A;  1Y4T A;  2V93 A;  4DE8 A;  5I57 B;  1B7U A;  4P0G A;  3SER A;  3LSX A;  4ZE8 A;  4OA4 A;  1OQH A;  1JEV A;  1Y3P A;  4OQO A;  2VPN A;  2H25 A;  4GWW A;  1LFI A;  2DWA A;  1NV7 A;  3USD A;  1URG A;  5ELV A;  4H8I A;  1PB7 A;  1OMP A;  2BJI A;  1GGG A;  2O68 A;  4GWU A;  3S9E A;  4FBP A;  1EYJ A;  3RTW B;  3MPK A;  1RDZ A;  1B32 A;  1Q9D A;  1XC1 A;  1BP5 A;  4YIC A;  4ZZE A;  2HPG A;  4NTL A;  3FJ7 A;  3SEU A;  3V83 A;  1M5D A;  2XWV A;  3EKI A;  2UYF A;  4JSD A;  2V4C A;  4H5G A;  2XXX A;  5IKB A;  3D1R A;  4THI A;  4NF8 A;  4H45 A;  4EUO A;  4PFT A;  1FTM A;  4PCD A;  4RYA A;  4ZEK A;  5EYH A;  3TCH A;  2LAO A;  1LAF E;  2GRV A;  3BFU A;  1B4H A;  2PT1 A;  1H44 A;  3N5L A;  3O28 A;  2ONR A;  1UQW A;  3IFC A;  1JQF A;  4WKM A;  3VDF A;  2ONK E;  4H46 A;  3TEP A;  2ZXT A;  2OJT A;  3VXB A;  1Q35 A;  3HHF A;  2F7C A;  3K6X A;  1BK4 A;  3F11 A;  2I58 A;  3EHS A;  5FTH A;  1QW0 A;  1MQI A;  1P1O A;  3HHG A;  3PV0 E;  3GZG A;  2B3F A;  1ATG A;  2Y7I A;  2OK2 A;  2O84 X;  4N8Y A;  2M8C A;  3RPW A;  1LCF A;  3K6V A;  1JW1 A;  2FIX A;  4H1X A;  1Z7N E;  1AIV A;  3TPA A;  4R74 A;  2CEY A;  5IZ3 B;  2YPN A;  3ZKK A;  1Z7M E;  4IY5 A;  5A5L A;  1MXW A;  2VGQ A;  3B6W A;  2O1L A;  2VD3 A;  5FHO A;  1M5E A;  2XXI A;  3ROJ A;  3L6H A;  2GFE A;  3CHG A;  3VXC A;  5FTI A;  1PBQ A;  3KG2 A;  2RCB A;  2F97 A;  1FJ9 A;  4MAG A;  1MPB A;  1R9Q A;  4DXU A;  3SEW A;  4GL0 A;  4GX4 A;  3TDJ A;  3T9V A;  3K01 A;  5CI5 A;  3FVK A;  1OLA A;  4L17 A;  1LEV A;  2PVU A;  1D9Y A;  4PC9 A;  3T66 A;  3IR1 A;  3K1N A;  4I1D A;  4XKQ A;  3U65 A;  2AL4 A;  3RGY A;  3JV9 A;  3CSB A;  4NF6 B;  5DEX B;  4H67 A;  3LV0 A;  3MPL A;  3A29 A;  4ZE9 A;  3MP6 A;  3SES A;  5AA4 B;  3GBB A;  4KCD A;  2Q89 A;  4G8N A;  2V3U A;  2CZK A;  4HCW A;  1B3H A;  4R72 A;  2VP1 A;  1VSO A;  3Q25 A;  2XWI A;  4P1E A;  1MH4 A;  3C36 A;  3RT8 A;  1GV8 A;  3MZ9 A;  4F39 A;  1XVX A;  3KC0 A;  1JVY A;  2QFL A;  4XKN A;  1NKX A;  1NUX A;  1Y1M A;  1FRP A;  4UAC A;  1QVS A;  4QBA A;  4MFI A;  1MM6 A;  1NNF A;  4PAK A;  3TAJ A;  2DXY A;  2XXP A;  2FHY A;  3H6W A;  4I40 A;  1LBY A;  1DTG A;  3KN3 A;  3I3V A;  3IO4 A;  2BJJ X;  1DTZ A;  2Q2C A;  4U21 A;  3E9X A;  4KXP A;  5I56 A;  4ELR A;  3C9H A;  4X9T A;  3HFU A;  1IMF A;  4HCY A;  4OFL A;  3TTK A;  1S7Y A;  3O66 A;  1M5F A;  1MXZ A;  2F6P A;  1XHY A;  1B2H A;  2HQ0 A;  2HXR A;  1JNF A;  3KBZ A;  4RXL A;  2XX8 A;  1NV3 A;  3O9P A;  1URD A;  4OWD A;  4FAT A;  1R9L A;  4YMB A;  5I2N A;  2Y7K A;  1B1X A;  1FPK A;  4GVO A;  1NV0 A;  2XXV A;  3TKD A;  1QUI A;  2AIX A;  4DDD A;  4X04 A;  2H4I A;  1XT8 A;  5ICQ A;  4FEC A;  4IO4 A;  4N17 A;  3OXN A;  1NH7 A;  4XTC Q;  3OO9 A;  4LQ5 A;  4JSO A;  2F6G A;  4QFP A;  2RC8 A;  5ITO A;  3G7W A;  4RNS A;  5DYH A;  3MVZ A;  1QJM A;  4U22 A;  1FSA A;  1LBV A;  5TP9 B;  2PBW A;  1H76 A;  3IB0 A;  4F19 A;  3QIM A;  4IGR A;  2UVI A;  3G3F A;  3QUF A;  1ZLQ A;  3K6W A;  4NED A;  3IO6 A;  1NUY A;  1FW0 A;  4P1L A;  3U92 A;  3FAS A;  1TXF A;  3JYR A;  4PBQ A;  4JWO A;  3IAZ A;  3O2A A;  4RPO A;  1QUL A;  2R9J A;  1MM7 A;  1QUJ A;  2RKM A;  3H7M A;  1MQH A;  2XWK A;  4ZZA A;  4NG7 A;  4YKI A;  1NL5 A;  2NWJ A;  1QUK A;  4IO2 A;  4PF6 A;  4OVS A;  4ZEF A;  3FBP A;  2Y5K A;  1BIY A;  2FBP A;  2O7U A;  1FBH A;  3N94 A;  2Z8E A;  1LST A;  4GXS B;  4DLD A;  2HXW A;  3RUM A;  1MRP A;  1SI1 A;  4JVI A;  3KFM A;  2GH9 A;  3ILT B;  5J1D A;  3P7I A;  3IB1 A;  1MS7 A;  1FTL A;  5F7V A;  1PDA A;  3T9H B;  2VD2 A;  2DOJ A;  2XX7 A;  5EQA A;  3G3J A;  4AS5 A;  1SVX B;  5KDT A;  4U4S A;  1NNP A;  2Z23 A;  2Y7R A;  3K1P A;  1B3L A;  4YAH X;  2XX9 A;  4JWX A;  3MZB A;  3PMW A;  1NV1 A;  3GXA A;  5B7D A;  3KZG A;  1B7H A;  3DP8 A;  3QMF A;  3KJ7 A;  2V3Q A;  4F3P A;  5DT6 A;  4ZEI A;  2RC9 A;  3MVW A;  4TLL B;  4YU0 A;  3IOW A;  2QPQ A;  4EQ9 A;  2F7A A;  3B7D A;  4GFR A;  5I58 A;  2F5X A;  4R6K A;  3TTN A;  2Y7W A;  1IMD A;  1OLC A;  1EH3 A;  1A8E A;  3ILU B;  2MKZ A;  4N6K A;  3MAM A;  1T0K A;  2QVR A;  4H8J A;  2XXR A;  1CNQ A;  5LOM A;  4JVC A;  4G2Z A;  2V3T A;  2CZH A;  5ET6 A;  4G4P A;  3MP1 A;  1USY H;  2UXA A;  2Y5L A;  4GXA A;  1P1N A;  3H03 A;  2Y7P A;  2FVZ A;  1ANF A;  3ECR A;  1GVC A;  1HSL A;  2VT5 A;  3EHU A;  4HTG A;  4PFI A;  1OVT A;  1N7W A;  4X8R A;  1N3W A;  3MJN A;  1B5H A;  2CZL A;  2HCA A;  5I84 A;  1DMB A;  4MNP A;  1Y3N A;  1PEB A;  2HFB A;  1SYI A;  4F22 A;  5HPQ A;  3ISP A;  5I5P A;  3VVD A;  4ZEC A;  3D4C A;  1IMB A;  2RIN A;  4IO7 A;  3QSL A;  5CMB A;  4FAJ A;  1A99 A;  1LBB A;  4N07 A;  3TYH A;  3KC1 A;  1N84 A;  3RLF E;  1B3G A;  3PUY E;  2VOZ A;  1NV5 A;  4ZDM A;  3B6Q A;  3TOD A;  4LQ2 A;  4EQB A;  3QXM A;  3H4Z A;  4PE5 B;  4I3E A;  4BDM A;  1ZTY A;  1VE4 A;  3K00 A;  3O29 A;  4LP2 B;  4F31 B;  3C34 A;  4ESX A;  1PBP A;  3OEN A;  5F1Q A;  1B0L A;  4Q5T A;  1LAH E;  5AA2 D;  3KBR A;  2OWT A;  2ZZW A;  1XI6 A;  3HO7 A;  1LB8 A;  1TFA A;  2QS4 A;  2HZK A;  2E1S A;  3PPP A;  4MLQ A;  4DXB A;  1N04 A;  4XFE A;  4I3Y A;  3TUS A;  3A3C A;  1NV4 A;  4BLA A;  4PE3 A;  3MWB A;  1AH5 A;  5B70 A;  4FIM A;  5I56 B;  3TQL A;  3IK6 B;  3SEV A;  1URS A;  1H3D A;  3UIF A;  2ZYO A;  2I3V A;  4EQ7 A;  3DLN A;  4R9G A;  1K9Z A;  1MDQ A;  2O6A A;  3BFT A;  3IX1 A;  5M2V A;  3N6T A;  4O3B A;  3GYY A;  1B52 A;  1G0I A;  4MNI A;  1Y4C A;  4XXU A;  3R26 A;  2O1M A;  4U1Z A;  1IMA A;  2ZYK A;  3K6U A;  2WYK A;  5DW8 A;  1POY 1;  5I2N B;  1AWB A;  2XXY A;  2H9B A;  1MY2 A;  3T0J A;  1LGB C;  3U1O A;  4OET A;  1A8F A;  3C32 A;  3GBA A;  1UIV A;  3PUZ E;  1FQF A;  1P99 A;  3FJG A;  4LUB A;  5ISU A;  3ONM A;  4O7M A;  2R8T A;  2RC7 A;  4DI3 D;  5I3S A;  1VDW A;  2H99 A;  4XEQ A;  3LBS A;  5ET5 A;  3MW0 A;  4MHF A;  4PDH A;  4EF2 A;  4TQU Q;  1TFD A;  3DP4 A;  4MIJ A;  1B5I A;  4AB5 A;  1O7T A;  1MY0 A;  4NF0 A;  4QFL A;  4N13 A;  4R75 A;  4F3G A;  1IXH A;  1BLF A;  3EQ1 A;  3MBP A;  4YB6 A;  3FXU A;  1B3E A;  5CMC A;  4EF1 A;  1BTJ A;  3MYU A;  1FPB A;  2OBG A;  3A09 A;  4JDF A;  3TQW A;  1FTA A;  3SEX A;  4GOT A;  3RNN A;  5AA2 A;  5I59 B;  4RK2 A;  2A5T A;  4H65 A;  2ESN A;  5ITP A;  4BDN A;  1J1N A;  3MUQ A;  1P1Q A;  3T93 B;  2XXQ A;  2THI A;  3PPO A;  3MC2 A;  1B6H A;  5EYG A;  4X1B A;  4QRZ A;  4HXV A;  2CMO A;  4E0X A;  4QXD A;  4IO5 A;  4P11 A;  1SQY A;  3V5A A;  1JET A;  1SYH A;  1FCK A;  2PYY A;  3FXR A;  2REJ A;  4GX6 A;  3VLW A;  1HSE A;  5I2K A;  5A5X A;  2FNC A;  3E3K A;  2QL3 A;  3QYT A;  5L8D A;  4F18 A;  4DCX A;  4ND9 A;  5I7I A;  3A3U A;  3K02 A;  2VPO A;  1O63 A;  3IOV A;  1ZU0 A;  4FE8 A;  3KSX A;  3KGC A;  1DK4 A;  3FGS A;  4BDR A;  5JEI A;  4F1Y A;  1PB8 A;  1DOT A;  4WEP A;  5H8N B;  5AE4 A;  4IO6 A;  3NOH A;  4RPN A;  4P9K A;  3FZV A;  2PMS A;  5I58 B;  2A5S A;  3CR9 A;  3ODB A;  4OEN A;  5DVI A;  2B4L A;  2Y84 A;  3PPQ A;  4H5F A;  4YMA A;  5LDZ A;  1Y1Z A;  5AA1 A;  4PFY A;  1B4Z A;  1IMC A;  2Q8J A;  3DEL B;  2D3I A;  4DI4 B;  1LBX A;  2O69 A;  3BIH A;  4LZ8 A;  4OVT A;  4PFR A;  4I9D A;  2PFZ A;  3K4U A;  2AYS A;  1Y9U A;  4OEV A;  2WBD A;  4YKP A;  3G3G A;  3T1B A;  1I6A A;  2KQZ A;  4P3L A;  5H8F A;  2XHD A;  4HE2 A;  1SDX A;  4FJP A;  4LVQ A;  1FTK A;  5IZZ A;  1MXX A;  3TTL A;  2F3D A;  1AMF A;  3TMG A;  4GWS A;  3UN6 A;  3FV1 A;  2B3B A;  1I6B A;  3T96 B;  1MY4 A;  5KZT A;  2QSX A;  1MY3 A;  3TTR A;  4GWO A;  3THI A;  1FQE A;  4PDD A;  3DM0 A;  4JXI A;  4MF3 A;  2DVC A;  2DYX A;  2H5Y A;  4PF8 A;  3OO6 A;  3R7X A;  4G68 B;  2F78 A;  4ZED A;  3VV5 A;  4MBP A;  2DWH A;  2XXW A;  3O6H A;  1MPD A;  2Q88 A;  5JTY B;  4GL8 A;  4Z7E A;  3VLU A;  1NMU A;  2G93 A;  3M8U A;  3T9U A;  4MEV A;  4JBZ A;  1I6Q A;  3PTY A;  4PAI A;  3HCQ A;  1RYO A;  5AA3 A;  3RYD A;  1XS5 A;  4G8H A;  3OD7 A;  2ZMB A;  1MXU A;  1N76 A;  1YZ0 A;  3L6G A;  4O3A A;  1FPE A;  4R9F A;  5DTB A;  3E4R A;  4Q30 B;  2V25 A;  4NF5 A;  3K2D A;  1D4N A;  4ESW A;  4RJZ A;  1KA0 A;  1FTO A;  2NOO A;  1LLS A;  4O3C A;  3KSJ A;  3E79 A;  4NN3 A;  3W15 C;  3CIJ A;  4PQJ A;  1FBC A;  5CBS A;  1FPJ A;  3EPE A;  3S2V A;  2YLN A;  3D4G A;  2IEE A;  3KN8 A;  1UTH A;  3UK4 A;  1VR5 A;  1EZP A;  4OVR A;  2OX3 A;  2X7Q A;  5BUU A;  4GD5 A;  2IA4 A;  4G61 A;  2O51 A;  3CFX A;  2ZYN A;  2Z22 A;  5JK4 A;  1FQB A;  4ECF A;  2DE3 A;  3IL1 B;  4KI0 E;  2H98 A;  4X48 A;  1LCT A;  2OCU A;  4ELQ A;  3MP8 A;  1YXI A;  3OEL A;  2DE2 A;  3H06 B;  2B4M A;  3M3F A;  4NF8 B;  1H45 A;  4NF4 A;  5L9O A;  1KA1 A;  1EYI A;  3U8Q A;  4LN5 A;  2UVH A;  2PCR A;  1P1U A;  2I0B A;  4FEB A;  5CM6 A;  4QFK A;  4O7I A;  2QS2 A;  1H43 A;  5FHN A;  1YCJ A;  3O6I A;  2DQV A;  3CVG A;  4YB7 A;  4F2O A;  3IFA A;  4LA9 A;  3U94 A;  1UIU A;  2GHB A;  4ISU A;  1K9Y A;  4NF6 A;  1B5J A;  2XXH A;  3EHT A;  1XVY A;  1JW4 A;  3S9N C;  2Q2A A;  3V89 B;  5AA2 B;  2REG A;  2DE4 A;  5H8Q A;  1D9V A;  2A5T B;  3RQT A;  4OFO A;  4F3B A;  3PUV E;  4N6P A;  5EHS A;  5ET8 A;  1B0H A;  2I0C A;  4KPT A;  1NV2 A;  1NUW A;  4RY1 A;  4KFQ A;  4JVD A;  4BDQ A;  4WED A;  1YPN A;  4IO3 A;  4OVJ A;  3UP9 A;  4OZ9 A;  4POW A;  4NX1 A;  2WEF A;  1EU8 A;  3IOT A;  3PUW E;  4OAN A;  4F29 A;  3Q27 A;  5CMM A;  3H6U A;  1SW2 A;  2OZZ A;  5I2K B;  5A5X B;  5FHM A;  1P1W A;  1GTK A;  1MPC A;  4RK9 A;  4NGU A;  2WX9 A;  3CSG A;  2ANJ A;  2QMW A;  2HAV A;  3OSR A;  3RPL A;  5BWJ A;  5CC2 A;  3VFJ A;  1B9J A;  4U4X A;  2XA5 A;  1POT A;  4H6D A;  5IAI A;  3I5O A;  1LBW A;  2Z8F A;  2XD2 A;  4O94 A;  2R6G E;  3B50 A;  1FTJ A;  4MH5 A;  4YZZ A;  5TPA A;  4OYV A;  2WYP A;  4DXC A;  2OWZ A;  5EQ8 A;  2UYE A;  2O7I A;  3LSL A;  3E78 A;  3TCF A;  5CMK A;  4Q8R A;  1A40 A;  3IJO B;  3H3G A;  4N4U A;  1HSJ A;  4OHN A;  1YYZ A;  4P0I A;  3IOR A;  4QF9 A;  3Q29 A;  4NWD A;  4KYD A;  4N91 A;  3O97 A;  4DZ1 A;  4HE1 A;  3FVO A;  1RKM A;  2AL5 A;  1A54 A;  4PBH A;  4EXK A;  3BIG A; 
#chains in the Genus database with same CATH homology
 5H8H A;  4XKP A;  5TP9 A;  1M5C A;  4XKR A;  4F3S A;  1M5B A;  1IXG A;  3WAF A;  3OMB A;  1S9T A;  2XD3 A;  1IIT A;  3CFL A;  1USY E;  1L5T A;  1MG1 A;  2KLF A;  4OXV A;  3IOU A;  3ZSF A;  1JEU A;  2Q9T A;  2I6E A;  1WVJ A;  1B1H A;  1PB9 A;  3TCG A;  4QSC A;  1UTB A;  1B3F A;  3PU5 A;  3RTF B;  1VFD A;  1MQG A;  4U2R A;  3RY3 A;  4KYE A;  3H6T A;  4LZ5 A;  1ZIU A;  2UVG A;  3KOS A;  2I4C A;  3FV2 A;  2DP8 A;  2ZNU A;  3EF7 A;  1QKA A;  3PMX A;  1LB9 A;  1SW1 A;  4BDL A;  4M4G A;  1LFG A;  3TTM A;  1LBC A;  1SW5 A;  3LSF B;  4IB2 A;  4QSD A;  1YAE A;  2X26 A;  5TU0 A;  1NH8 A;  4POX A;  3T22 A;  3OOA A;  3LUY A;  4C1T A;  4NF5 B;  3SET A;  4TOZ A;  4UA8 A;  1MY1 A;  1B58 A;  2F7B A;  1B40 A;  2PX1 A;  4ZEB A;  3OEK A;  3MVY A;  3U72 A;  4KD5 A;  3GLB A;  4OFJ A;  3TZA A;  4OES A;  3QUJ A;  2DWJ A;  4R2B A;  1EZO A;  3Q26 A;  4KHZ E;  4PFW A;  3FVG A;  2P1S A;  1EZ9 A;  1WOD A;  3MQ9 A;  4QHQ A;  4MLV A;  1UTH B;  4YKK A;  1ZBM A;  3R6U A;  3KOT A;  3W9W A;  4ONY A;  1N7X A;  4R2F A;  4ZS9 A;  3PD9 A;  2DSF A;  1IEJ A;  1OVB A;  3ZKL A;  1SBP A;  4IY6 A;  2DS9 A;  4QSE A;  2HZL A;  2QS1 A;  3N6U A;  3OO8 A;  4DIG A;  2I49 A;  5KDT B;  4OER A;  5HM4 B;  4WXJ A;  3HV1 A;  3K0V A;  4NF4 B;  4JWY A;  4LON B;  4GRK A;  4ELP A;  3I6V A;  1IUD A;  3C31 A;  3V8X B;  4YB5 A;  1IXI A;  3DP6 A;  1B7Z A;  2ZNS A;  2GHA A;  3KEI A;  3LSW A;  3S9M C;  3T9X B;  2DVZ A;  1SI0 A;  3TFL A;  4C0R A;  3S9L C;  4PP0 A;  1IQ7 A;  4BDO A;  2VHA A;  4ELO A;  1N3X A;  5H8Q B;  3C4M A;  3IJX B;  2I3W A;  3VVF A;  3Q28 A;  4F2Q A;  1SD3 A;  5K2X A;  2QRY A;  4Q0C A;  3SEY A;  1WDN A;  5KCJ A;  3FAT A;  4GLI A;  2QS3 A;  3PGF A;  5I57 A;  1NNT A;  3WAE A;  2NXO A;  1B51 A;  1ZKB A;  1OIB A;  3M3K A;  1Y3Q A;  1MXV A;  4PET A;  3ZS6 A;  3PD8 A;  1TWY A;  3UOR A;  1R6Z A;  3KN7 A;  4EDP A;  4OEU A;  3FJM A;  5TPA B;  3H6V A;  3QK6 A;  5DVJ A;  1GR2 A;  2PT2 A;  4U1O A;  3RT6 B;  3PUX E;  1JVX A;  1LFH A;  1FQA A;  5L9S A;  4RA1 A;  2F8D A;  4KCC A;  4G8M A;  4DCY A;  2RCA A;  1OQG A;  1BKA A;  3CFZ A;  3OSQ A;  4NWC A;  4OMB A;  3G3K A;  3KJT A;  1US5 A;  3CI8 A;  3OEM A;  2NVU B;  1MH3 A;  5H8H B;  4IGT A;  4AQ4 A;  5ICT A;  1N0T A;  3S4U A;  4TLM B;  2RF1 A;  3UA8 A;  3M3L A;  4QFO A;  1FQD A;  1QKB A;  5DVF A;  1DPP A;  3CRB A;  1MQJ A;  1II5 A;  1NNK A;  2G29 A;  3B6T A;  2I48 A;  3IB2 A;  1F9B A;  2Z8D A;  4F1U A;  4FOR A;  5I59 A;  2P0S A;  1UTB B;  2HEU A;  3AXF A;  4FED A;  4GF8 A;  2F34 A;  1I69 A;  2NUV A;  4KR5 A;  2X7P A;  4G68 C;  3HN0 A;  3BKI B;  1DPE A;  1Y20 A;  2FYI A;  1R1N A;  3PPR A;  1JW5 A;  5K2Y A;  2QMX A;  2F36 A;  3O6G A;  5CRY A;  2R71 A;  1TT1 A;  4AB6 A;  4R6H A;  2HAU A;  2I4B A;  1IXC A;  3TEL A;  3LC8 A;  3E13 X;  4KQP A;  3W9V A;  1MDP 1;  1CE2 A;  3FXQ A;  3OO7 A;  2WKY A;  3FD3 A;  1KWH A;  3HPI A;  3VLV A;  1S50 A;  4X1D A;  5H8N A;  5DEX A;  1O64 A;  2QJE A;  2D21 A;  5AA4 A;  5H8S A;  1RYX A;  5EYF A;  3QAX A;  1ZMG A;  4NMY A;  4NE4 A;  3MVX A;  4YKJ A;  1YTV A;  2OWS A;  3EN3 A;  1XOC A;  4U23 A;  4I62 A;  3K1M A;  4XIG Q;  3U93 A;  1B05 A;  3C35 A;  1IZ1 A;  2YJP A;  3CG3 A;  5L9M A;  1ELJ A;  3CG1 A;  3PPN A;  1FQC A;  4EXL A;  4H0W A;  1B46 A;  4LAT A;  1NFT A;  3UGW A;  1MQD A;  1A55 A;  5EHM A;  2FA7 A;  3HST A;  1CB6 A;  2ALU A;  4M1V A;  4C1U A;  2E0S A;  3FVN A;  4GQO A;  3JZJ A;  2XXT A;  1AL3 A;  2ZYM A;  4R73 A;  4K3F A;  3MZ1 A;  1IIW A;  2B65 A;  2V84 A;  3SKP A;  2UVJ A;  1SW4 A;  2D5W A;  4QFN A;  1Q1K A;  1PC3 A;  4HS7 A;  4HW8 A;  2DWI A;  2DXR A;  1LAX A;  3VE1 B;  2W7Y A;  1VFE A;  3G3H A;  3VVE A;  2P2A A;  3N26 A;  4JB7 A;  3C33 A;  1DSN A;  4GIZ A;  3FIR A;  4G68 A;  2OLB A;  1ZJL A;  4G77 A;  1A7L A;  3SDF A;  4F1V A;  1AOV A;  5JTY A;  3RN8 A;  4OTE A;  4I8C A;  1MXY A;  4E0W A;  5CBR A;  3FUZ A;  2XXU A;  4PFU A;  4Z0I A;  4R6Y A;  2ZNT A;  3PMV A;  5HBC A;  1LAG E;  3BBR A;  5H8F B;  1US4 A;  2F35 A;  3G3I A;  4LZ7 A;  2ABH A;  3LR1 A;  4KYS A;  5KCJ B;  2ONS A;  1D3K A;  1Y4T A;  2V93 A;  4DE8 A;  5I57 B;  1B7U A;  4P0G A;  3SER A;  3LSX A;  4ZE8 A;  1OQH A;  1JEV A;  1Y3P A;  4OQO A;  2H25 A;  1LFI A;  2DWA A;  3USD A;  1URG A;  5ELV A;  4H8I A;  1PB7 A;  1OMP A;  1GGG A;  2O68 A;  3S9E A;  3RTW B;  3MPK A;  1B32 A;  1XC1 A;  1BP5 A;  4YIC A;  4ZZE A;  4NTL A;  3FJ7 A;  3SEU A;  3V83 A;  1M5D A;  2UYF A;  4JSD A;  4H5G A;  2XXX A;  5IKB A;  4THI A;  4NF8 A;  4EUO A;  4PFT A;  1FTM A;  4RYA A;  4ZEK A;  3TCH A;  2LAO A;  1LAF E;  2GRV A;  3BFU A;  1B4H A;  2PT1 A;  1H44 A;  3N5L A;  3O28 A;  2ONR A;  1UQW A;  1JQF A;  4WKM A;  3VDF A;  2ONK E;  3TEP A;  2ZXT A;  2OJT A;  3VXB A;  1Q35 A;  3HHF A;  2F7C A;  3K6X A;  3F11 A;  2I58 A;  3EHS A;  5FTH A;  1QW0 A;  1MQI A;  1P1O A;  3HHG A;  3PV0 E;  3GZG A;  2B3F A;  1ATG A;  2Y7I A;  2OK2 A;  2O84 X;  2M8C A;  3RPW A;  1LCF A;  3K6V A;  1JW1 A;  4H1X A;  1Z7N E;  1AIV A;  3TPA A;  4R74 A;  2YPN A;  3ZKK A;  1Z7M E;  4IY5 A;  1MXW A;  2VGQ A;  3B6W A;  2O1L A;  2VD3 A;  5FHO A;  1M5E A;  2XXI A;  3L6H A;  2GFE A;  3VXC A;  5FTI A;  1PBQ A;  3KG2 A;  2RCB A;  2F97 A;  1MPB A;  1R9Q A;  4DXU A;  3SEW A;  4GL0 A;  3TDJ A;  3T9V A;  3K01 A;  5CI5 A;  3FVK A;  1OLA A;  4L17 A;  2PVU A;  1D9Y A;  3T66 A;  3IR1 A;  3K1N A;  4I1D A;  4XKQ A;  2AL4 A;  3RGY A;  3JV9 A;  3CSB A;  4NF6 B;  5DEX B;  4H67 A;  3MPL A;  4ZE9 A;  3MP6 A;  3SES A;  5AA4 B;  3GBB A;  4KCD A;  2Q89 A;  4G8N A;  2V3U A;  4HCW A;  1B3H A;  4R72 A;  2VP1 A;  1VSO A;  3Q25 A;  1MH4 A;  3C36 A;  3RT8 A;  1GV8 A;  3MZ9 A;  4F39 A;  1XVX A;  1JVY A;  4XKN A;  1NKX A;  1Y1M A;  4UAC A;  1QVS A;  4MFI A;  1MM6 A;  1NNF A;  3TAJ A;  2DXY A;  2XXP A;  3H6W A;  1DTG A;  3KN3 A;  3I3V A;  3IO4 A;  2BJJ X;  1DTZ A;  2Q2C A;  4U21 A;  3E9X A;  5I56 A;  4ELR A;  3C9H A;  4X9T A;  4HCY A;  4OFL A;  3TTK A;  1S7Y A;  3O66 A;  1M5F A;  1MXZ A;  2F6P A;  1XHY A;  1B2H A;  2HQ0 A;  1JNF A;  4RXL A;  2XX8 A;  3O9P A;  1URD A;  4OWD A;  4FAT A;  1R9L A;  4YMB A;  5I2N A;  2Y7K A;  1B1X A;  4GVO A;  2XXV A;  3TKD A;  1QUI A;  2AIX A;  4DDD A;  2H4I A;  1XT8 A;  5ICQ A;  4FEC A;  4IO4 A;  3OXN A;  1NH7 A;  4XTC Q;  3OO9 A;  4LQ5 A;  4JSO A;  2F6G A;  4QFP A;  2RC8 A;  5ITO A;  3G7W A;  4RNS A;  5DYH A;  3MVZ A;  1QJM A;  4U22 A;  5TP9 B;  2PBW A;  1H76 A;  3IB0 A;  4F19 A;  3QIM A;  4IGR A;  2UVI A;  3G3F A;  3QUF A;  1ZLQ A;  3K6W A;  4NED A;  3IO6 A;  1FW0 A;  3U92 A;  3FAS A;  1TXF A;  3JYR A;  4JWO A;  3IAZ A;  3O2A A;  4RPO A;  1QUL A;  2R9J A;  1MM7 A;  1QUJ A;  2RKM A;  3H7M A;  1MQH A;  4ZZA A;  4YKI A;  1NL5 A;  2NWJ A;  1QUK A;  4IO2 A;  4ZEF A;  1BIY A;  2O7U A;  3N94 A;  2Z8E A;  1LST A;  4GXS B;  4DLD A;  2HXW A;  3RUM A;  1MRP A;  1SI1 A;  3KFM A;  2GH9 A;  3ILT B;  5J1D A;  3P7I A;  3IB1 A;  1MS7 A;  1FTL A;  5F7V A;  1PDA A;  3T9H B;  2VD2 A;  2DOJ A;  2XX7 A;  3G3J A;  1SVX B;  5KDT A;  4U4S A;  1NNP A;  2Z23 A;  2Y7R A;  3K1P A;  1B3L A;  4YAH X;  2XX9 A;  4JWX A;  3MZB A;  3PMW A;  3GXA A;  5B7D A;  3KZG A;  1B7H A;  3DP8 A;  3KJ7 A;  2V3Q A;  4F3P A;  5DT6 A;  4ZEI A;  2RC9 A;  3MVW A;  4TLL B;  4YU0 A;  3IOW A;  2QPQ A;  4EQ9 A;  2F7A A;  3B7D A;  4GFR A;  5I58 A;  2F5X A;  4R6K A;  3TTN A;  2Y7W A;  1OLC A;  1EH3 A;  1A8E A;  3ILU B;  3MAM A;  1T0K A;  4H8J A;  2XXR A;  5LOM A;  4G2Z A;  2V3T A;  4G4P A;  3MP1 A;  1USY H;  2UXA A;  4GXA A;  1P1N A;  3H03 A;  2Y7P A;  1ANF A;  3ECR A;  1GVC A;  1HSL A;  3EHU A;  4HTG A;  1OVT A;  1N7W A;  1N3W A;  3MJN A;  1B5H A;  2CZL A;  2HCA A;  5I84 A;  1DMB A;  1Y3N A;  1PEB A;  2HFB A;  1SYI A;  4F22 A;  5HPQ A;  3VVD A;  4ZEC A;  3D4C A;  2RIN A;  4IO7 A;  3QSL A;  5CMB A;  4FAJ A;  1A99 A;  1LBB A;  4N07 A;  3TYH A;  1N84 A;  3RLF E;  1B3G A;  3PUY E;  2VOZ A;  4ZDM A;  3B6Q A;  3TOD A;  4LQ2 A;  4EQB A;  3QXM A;  3H4Z A;  4PE5 B;  4BDM A;  1ZTY A;  1VE4 A;  3K00 A;  3O29 A;  4LP2 B;  4F31 B;  3C34 A;  4ESX A;  1PBP A;  3OEN A;  5F1Q A;  1B0L A;  4Q5T A;  1LAH E;  5AA2 D;  3KBR A;  2OWT A;  3HO7 A;  1LB8 A;  1TFA A;  2QS4 A;  2HZK A;  2E1S A;  3PPP A;  4MLQ A;  4DXB A;  1N04 A;  3TUS A;  3A3C A;  4BLA A;  3MWB A;  1AH5 A;  5B70 A;  4FIM A;  5I56 B;  3TQL A;  3IK6 B;  3SEV A;  1URS A;  1H3D A;  3UIF A;  2ZYO A;  2I3V A;  4EQ7 A;  3DLN A;  4R9G A;  1MDQ A;  2O6A A;  3BFT A;  3IX1 A;  5M2V A;  3N6T A;  4O3B A;  1B52 A;  1Y4C A;  4XXU A;  3R26 A;  2O1M A;  4U1Z A;  2ZYK A;  3K6U A;  1POY 1;  5I2N B;  2XXY A;  2H9B A;  1MY2 A;  1LGB C;  3U1O A;  4OET A;  1A8F A;  3C32 A;  3GBA A;  1UIV A;  3PUZ E;  1FQF A;  1P99 A;  3FJG A;  4LUB A;  5ISU A;  3ONM A;  2RC7 A;  2H99 A;  3LBS A;  3MW0 A;  4EF2 A;  4TQU Q;  1TFD A;  3DP4 A;  1B5I A;  4AB5 A;  1O7T A;  1MY0 A;  4QFL A;  4N13 A;  4R75 A;  4F3G A;  1IXH A;  1BLF A;  3EQ1 A;  3MBP A;  4YB6 A;  3FXU A;  1B3E A;  5CMC A;  4EF1 A;  1BTJ A;  2OBG A;  3A09 A;  4JDF A;  3TQW A;  3SEX A;  4GOT A;  3RNN A;  5AA2 A;  5I59 B;  4RK2 A;  2A5T A;  4H65 A;  2ESN A;  5ITP A;  4BDN A;  1J1N A;  3MUQ A;  1P1Q A;  3T93 B;  2XXQ A;  2THI A;  3PPO A;  3MC2 A;  1B6H A;  4X1B A;  4QRZ A;  2CMO A;  4E0X A;  4IO5 A;  4P11 A;  1SQY A;  3V5A A;  1JET A;  1SYH A;  1FCK A;  2PYY A;  3FXR A;  2REJ A;  3VLW A;  1HSE A;  5I2K A;  5A5X A;  2FNC A;  3E3K A;  2QL3 A;  3QYT A;  5L8D A;  4F18 A;  4DCX A;  4ND9 A;  3A3U A;  3K02 A;  1O63 A;  3IOV A;  1ZU0 A;  4FE8 A;  3KSX A;  3KGC A;  4BDR A;  3FGS A;  5JEI A;  4F1Y A;  1PB8 A;  1DOT A;  4WEP A;  5H8N B;  5AE4 A;  4IO6 A;  4RPN A;  3FZV A;  2PMS A;  5I58 B;  2A5S A;  3CR9 A;  3ODB A;  4OEN A;  5DVI A;  2Y84 A;  3PPQ A;  4H5F A;  4YMA A;  1Y1Z A;  5AA1 A;  4PFY A;  1B4Z A;  2Q8J A;  3DEL B;  2D3I A;  2O69 A;  4LZ8 A;  4I9D A;  3K4U A;  2AYS A;  1Y9U A;  4OEV A;  4YKP A;  3G3G A;  1I6A A;  5H8F A;  2XHD A;  1SDX A;  4FJP A;  4LVQ A;  1FTK A;  1MXX A;  3TTL A;  1AMF A;  3TMG A;  3UN6 A;  3FV1 A;  2B3B A;  1I6B A;  3T96 B;  1MY4 A;  5KZT A;  2QSX A;  1MY3 A;  3TTR A;  4GWO A;  3THI A;  1FQE A;  3DM0 A;  4JXI A;  4MF3 A;  2DVC A;  2DYX A;  2H5Y A;  3R7X A;  3OO6 A;  4G68 B;  2F78 A;  4ZED A;  3VV5 A;  4MBP A;  2DWH A;  2XXW A;  3O6H A;  1MPD A;  2Q88 A;  5JTY B;  4GL8 A;  4Z7E A;  3VLU A;  1NMU A;  2G93 A;  3M8U A;  3T9U A;  4JBZ A;  1I6Q A;  3HCQ A;  1RYO A;  5AA3 A;  1XS5 A;  4G8H A;  3OD7 A;  2ZMB A;  1MXU A;  1N76 A;  3L6G A;  4O3A A;  4R9F A;  5DTB A;  3E4R A;  4Q30 B;  2V25 A;  4NF5 A;  3K2D A;  1D4N A;  4ESW A;  4RJZ A;  1FTO A;  2NOO A;  1LLS A;  4O3C A;  3KSJ A;  3W15 C;  3CIJ A;  4PQJ A;  5CBS A;  3EPE A;  3S2V A;  2YLN A;  3D4G A;  2IEE A;  3KN8 A;  1UTH A;  3UK4 A;  1VR5 A;  1EZP A;  5BUU A;  2X7Q A;  4GD5 A;  2IA4 A;  2O51 A;  3CFX A;  2ZYN A;  2Z22 A;  5JK4 A;  1FQB A;  4ECF A;  2DE3 A;  3IL1 B;  4KI0 E;  2H98 A;  4X48 A;  1LCT A;  2OCU A;  4ELQ A;  3MP8 A;  3OEL A;  2DE2 A;  3H06 B;  3M3F A;  4NF8 B;  1H45 A;  4NF4 A;  5L9O A;  3U8Q A;  2UVH A;  1P1U A;  2I0B A;  4FEB A;  5CM6 A;  4QFK A;  2QS2 A;  1H43 A;  5FHN A;  1YCJ A;  3O6I A;  2DQV A;  3CVG A;  4YB7 A;  4F2O A;  4LA9 A;  3U94 A;  1UIU A;  2GHB A;  4ISU A;  4NF6 A;  1B5J A;  2XXH A;  3EHT A;  1XVY A;  1JW4 A;  3S9N C;  2Q2A A;  3V89 B;  5AA2 B;  2REG A;  2DE4 A;  5H8Q A;  1D9V A;  2A5T B;  3RQT A;  4OFO A;  4F3B A;  3PUV E;  4N6P A;  5EHS A;  1B0H A;  2I0C A;  4KPT A;  4RY1 A;  4KFQ A;  4BDQ A;  4WED A;  1YPN A;  4IO3 A;  4OVJ A;  3UP9 A;  4OZ9 A;  4POW A;  1EU8 A;  3IOT A;  3PUW E;  4F29 A;  3Q27 A;  5CMM A;  3H6U A;  1SW2 A;  2OZZ A;  5I2K B;  5A5X B;  5FHM A;  1P1W A;  1GTK A;  1MPC A;  4RK9 A;  3CSG A;  2ANJ A;  2QMW A;  2HAV A;  3OSR A;  5BWJ A;  5CC2 A;  3VFJ A;  1B9J A;  4U4X A;  1POT A;  4H6D A;  5IAI A;  3I5O A;  2Z8F A;  2XD2 A;  2R6G E;  1FTJ A;  4MH5 A;  4YZZ A;  5TPA A;  4OYV A;  4DXC A;  2UYE A;  2O7I A;  3LSL A;  3TCF A;  5CMK A;  4Q8R A;  1A40 A;  3IJO B;  3H3G A;  1HSJ A;  4OHN A;  4P0I A;  3IOR A;  4QF9 A;  3Q29 A;  4NWD A;  4KYD A;  3O97 A;  4DZ1 A;  3FVO A;  1RKM A;  2AL5 A;  1A54 A;  4EXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...