3K35A

Crystal structure of human sirt6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
274
Chain Sequence
KGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVCRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase sirtuin-6
total genus 89
structure length 274
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3k35A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3k35A01
3GLUA 4IF6A 4COKA 3HWX1 3ZG6A 4JT9A 1S7GA 4K9MA 1OZGA 4L3OA 4RMJA 5DGTA 2AG1A 3CLSD 4BN4A 1DJLA 4JSRA 4C7BA 1YBHA 1O97D 5DGDA 2B4YA 1UPAA 1YNOA 4MPRA 2EZTA 3GLSA 1M2KA 1Z8NA 2EZ8A 2JI9A 2PANA 1T9DA 2VJYA 1V5GA 4FEGA 4BVHA 2Q5JA 2OORC 1PT9A 5K6RA 2EZUA 4D5EA 4HDAA 2A1UA 1YHZA 3ZGVA 2H2IA 4K9OA 5MF6A 2H4JA 2IHVA 2H2DA 3CF4G 2Q27A 4J1TC 4MPJA 5DEIA 1JSCA 4QPZA 4UUAA 2Q5LA 2Q28A 2JI7A 5FEMA 4Y6QA 3ZGOA 3FSJX 4BN5A 2PGOA 3JWPA 2IHUA 4X3PA 3CLRD 1UPCA 3GLTA 3IAFA 2UZ1A 1T9CA 1OZFA 3E9YA 4GM4A 1U31A 4UTZA 3RIYA 1M2JA 2EZ9A 1M2GA 4UUBA 2H4FA 1SZCA 1YC5A 4V1CI 2H2GA 2H2FA 1QPBA 5EJ4A 4UTRA 2FN3A 1EFPA 4MPPA 1V5EA 4RJIA 2JLCA 3K35A 4JT8A 4BVEA 4UU7A 4JUAA 3EY9A 3PKIA 4TWJA 4UU8A 4D5GA 2FSVC 4K9LA 4IAOA 2IHTA 2WVHA 4RMGA 2FR8C 1YI0A 3D4BA 4RJKA 2FRDC 2X7JA 1S5PA 2AG0A 4IG9A 4BV3A 5EJ8A 5K2OA 5K3SA 4FZ3A 1M2HA 1MCZA 2OD2A 2Q5QA 4K9PA 4GM1A 2QQFA 1PTJC 1YHYA 4GPEA 1YI1A 4GP9A 4V1CA 4JD5A 5IMSA 4I5IA 4O8ZA 1M2NA 1EFVA 2A1TR 5EJAA 1PI3A 2JI6A 2OO5C 2NYRA 1XLTC 3FLMA 2VBGA 4KXQA 5EJ5A 3OE1A 3EA4A 1HZZC 1Y9DA 4JUDX 4K9NA 2QQGA 3D81A 4L2IA 1NM5C 1T9AA 1ICIA 1YC2A 3F6EX 2PGNA 4HD8A 2EZ4A 2Q29A 3GLRA 3JR3A 5BWNA 1Q6ZA 2JI8A 2W93A 1Q17A 3LQ1A 4FEEA 2DJIA 4X3OA 2VK1A 1Q1AA 1OZHA 2H2HA 1PO7A 2VBFA 5EJ6A 2HJHA 1MA3A 1O96B 2BRUC 4JUFA 1ZPDA 4Y6OA 4F4UA 2H4HA 3PDHA 5EJMA 4V1CB 1U2GC 1V5FA 4MQ5A 4Y6LA 2NXWA 2H59A 4QELA 4RMIA 3U31A 3F6BX 4JU9A 1PNQA 1YTLA 4C78A 2WVGA 5MFPA 3CLTD 4JUBA 4BVGA 1PNOA 1U2DC 2V3WA 4K9QA 1U28C 4UTVA 4ZP1A 5EJ9A 1J8FA 5D7NA 4FVTA 2VBIA 4QQ8A 4JUCA 4RJJA 3IAEA 5FYQA 3RIGA 1POWA 4ZZIA 3FZNA 5BWOA 1BFDA 4UTNA 2Q5OA 5EJ7A 2VK4A 1T9BA 1N0HA 2FWNA 1SZDA 4BVFA 3EYAA 3U3DA 1UPBA 4RMHA 5MGNA 5MFZA 1PYDA 2JIBA 4TWIA 1D4OA 2WVAA 4UTXA 3PKJA 4Q9DA 4R8MA 2OD7A 2OD9A 4F56A 4BV2A 3D7KA 4KGDA 2UZ1B 5BWLA 3HWWA 1OVMA 4BVBA 2VK8A 4G1CA 1E3TA 4GG1A 1POXA 2JLAA 1PVDA 4K9KA 4KPUA 4MZXA 4BUZA 5K6TA 4JU8A 5AHKA 3CLUD 2C31A 4J16C 4GM0A 1Q14A
chains in the Genus database with same CATH superfamily
1BQ3A 1T8RA 1NM5A 5EMNA 5JYDA 1QLHA 3QUCA 2JFZA 4GBJA 2AYZA 2HQBA 4PO8A 5JVH1 2PPVA 3D64A 3RVSA 3ER9A 1DEAA 5KNBH 4M0CA 3Q8KA 1ZRPA 2VHXA 1X38A 1FFCA 3L8GA 4CM5A 3BTSA 1VBKA 4A8HA 1JXQA 3DOJA 1ZYUA 4WACA 1UDWA 1NR7A 1ZP6A 2C9OA 5LB2A 4KOEC 5KC9A 1H1DA 2HRDA 1Z6YA 3JQGA 4EJSA 4D9MA 2XTMA 3UH1A 1IPFA 3B3FA 5C52B 2X0IA 1J90A 1RHQA 1NPYA 4EK9A 1U0RA 4OMUA 5L4LA 1EDBA 3BIOA 4OLJA 4WZBE 3SS9X 3UXHA 3VR5D 2PZBA 1A96A 4E1VA 4Y1RB 1QP7A 3NDRA 4FIZA 1CY8A 1SG6A 2ZAIA 1U0HC 3CLUC 1S2MA 4D02A 5GJBA 2DBVO 3F7OA 2ZXEA 4QRIA 4FHEA 4NYMR 3ICCA 4JLVA 1MABB 4Q3CA 4BEVA 2GDZA 3TOXA 2GPTA 4XWGA 1OYVA 2CLIB 2VP4A 2X9QA 5JEDA 2VN8A 3QKUA 4Q37A 1IOZA 1E0AA 4YAWA 1TJ4A 5HZGA 2BV3A 4UUOA 5K2OA 3A6HA 3ZHOA 1J8MF 5K8UA 5LZ4A 5ED0A 4ZQFA 2REBA 3AH8A 1T0HB 1VJDA 3T1QA 4CN9A 4ITRC 1WCWA 2Z4RA 1OH5A 2BH9A 2JIOA 4ZEXA 5DU2A 5B6JA 4QUGA 1QAQA 1QCVA 1AKNA 3OCUA 4BCDA 2XVAA 3WLNA 2OGZA 3NIFB 5REQA 4D4HA 5HPYB 2G80A 4MGHA 4HAWA 2F9LA 4RM2A 4XB6B 2GLUA 3JAMA 3AERA 4NRDA 2ZUBA 2QXYA 3Q3EA 5CLQA 5DASA 3CR8A 2Y1LA 1VYUA 1JDBB 1JI3A 2BF7A 2W6NA 2XUAA 5AICA 1EXNA 2RGNA 1PUIA 10MHA 1P4SA 3PU6A 5KPJA 1TKBA 3HWRA 3N59A 3BWBA 4I9UA 4TOIA 1YZGA 1JLLA 3R0VA 5JFGA 4OTZA 5J2UA 1UBOS 4MVXA 5JSHA 2CVQA 3KXPA 4RD4A 4QJBA 1FTQA 1Z0DA 3ETLA 5GOZA 3LGXA 4UBNA 4JI6B 5F77A 5J5AA 5JDIC 3WKBA 1R16A 5JTUA 2P1RA 2LXNA 4FFBA 1VMAA 5FPPA 4MQ5A 4RAOA 5GAGc 2JPDA 3FKIL 2D1RA 2FR8A 1YTLA 4QECA 4HWOA 4ROTA 3JCZA 5PNTA 2AQKA 4DRXB 4QXQA 1JKXA 3CUUA 3V55A 1U28C 3WYAA 4Q05A 4D4GA 3H6HA 1ABBA 3NW9A 4FHFA 2OBXA 3EXEB 1XZDA 4EM6A 5FV4A 5JRJA 4MW6A 3RYHA 1MIOB 3ANYB 1XMOB 2A2ZA 2PGDA 5B5SA 1NYLA 2EWVA 1YB1A 2M4VA 1I1QB 3VAYA 1SY7A 4UNPA 2AHOA 3BB4A 3K1AB 3FOFC 3OZRA 1XZBA 4FCWA 4LN1A 3T15A 1PKXA 1N5OX 2HJWA 3E9ZA 4L0QA 4MKZA 2CL5A 3E15A 4K6GA 4UZSA 4Q4DA 1NSTA 3LXXA 4M1EA 2UVPB 2HA4A 3BTUA 1H2RS 2ZB4A 3NB0A 3PDIA 4KIJA 5CT4A 5CD1A 3ZIAD 2VUTA 1DB3A 3QYFA 4PICA 5IKMA 4YUYA 4ZVSA 4CKBA 4EY8A 2OGWA 1SXGA 4QYSA 3NP9A 2CLKB 3NHKA 3TLXA 1RDGA 2ZRMA 2PGJA 3VSBA 1H22A 3H17A 3I9KA 1UBLS 2X5KO 3T7SA 3FF4A 3W2FA 1WULS 1JJVA 1LJLA 1X7GA 3FBTA 1M8PA 4KAXA 3H3XA 2Z1NA 1NZJA 1N6NA 3VR4D 5IN4A 3A9SA 1X1RA 1YE5A 2RHBA 1MRNA 2QZPA 3LUKA 5GGYA 4EY3A 4DV2B 4OGWA 3TLCA 5JQGA 2UXDB 1ISRA 3CQZL 1V8FA 1W75A 1NVTA 3AY6A 3Q87B 3WNQA 5LM3A 1CPYA 3IX7A 3SR4A 4IXWA 7REQA 2Q4OA 1KYXA 2NVTL 2NM0A 2P79A 4HN2A 1FJGB 1M2GA 2A35A 3IVMA 4HY3A 4TXNA 3O9MA 4LY9A 1Z0IA 4WBNB 2ZWOA 1L4LA 1GY8A 4LMBA 4LYYA 3IXLA 2Y1CA 4YUAA 5JC8A 3JASB 3CH4B 3PE3A 3L7OA 5FL7A 4WOPA 4A0FA 2WIBA 1C0IA 3OBIA 4NBSA 3KQHA 2I1QA 2SNIE 4L7VA 4M1KA 2Q6VA 4S2UA 4XYMA 4AZ3B 4YCSA 1AUOA 2HQ1A 4PZAA 4RJKA 4O4LB 2B2XA 1ESCA 2AG0A 1QYBA 1BDJA 2WABA 4MVJA 5EL0A 4LJSA 2X0EA 1GRCA 1MO5A 3ZS8A 1U0EA 2CXSA 1GUBA 4K9PA 2Z2JA 1US8B 1BMFD 1BW9A 2XJ4A 1ANKA 2IHNA 1PV2A 1AXGA 4B7CA 3ZU2A 1WX1A 4HFJA 1NQWA 4JT4A 4XWTA 2OILA 3QXXA 1P60A 5K4GA 4KAFA 5JC1A 3T3PB 4DCCA 1XTZA 3DH0A 1RHJA 1NI5A 4RD6A 4QG3A 1ZGAA 4IKEA 3F46A 1NAIA 2CZGA 1H2XA 1CWUA 1XAGA 2LNDA 3NDPA 3DMHA 4ISBA 3PFGA 3IYLW 5A9SB 2CLEB 1NM5C 3QE3A 2ZJZA 4YECA 1VFPA 1TVMA 4NATA 2Y66A 2Z8YM 3RF6A 1TLTA 2EHDA 2VL7A 1Y7PA 1F5NA 4DV0B 1GGNA 3LCRA 4YTEA 5KVSA 3ZZMA 3LA8A 2XAAA 2KKDA 5DVZA 1HXHA 3H13A 1TB4A 3LPNA 4O63O 3WK8A 4B4WA 4R9RA 2IUUA 4MWZA 1JDJA 5CP8A 4J94A 1C7QA 3QA3E 5AHRA 4IILA 1BE8A 2C4NA 4R68A 4EI9A 5KVCA 3EVGA 4YIHA 5LDHA 4NBUA 5AM0A 1QDUA 2WA1A 3S81A 3ZDXB 3OPMA 1RLIA 4JLJA 3DAGA 4N01A 4N3BA 1R5JA 2GAJA 3T9EA 3CIFA 1ACJA 3FYUA 1WR8A 2VK2A 1PT6A 4AY2A 1XDBA 1DJQA 1TQ2A 2P1ZA 2TECE 3A3NA 1OLUB 3FBWA 2NTYC 3GEPA 4UTXA 1DXYA 3OCYA 3RZTA 3R7WB 2F1HA 4R81A 3EARA 5J2UB 4YRFA 3CRNA 3SX2A 5KYYB 1EUQA 3BUSA 2DR2A 4LC9A 1NQOA 1HE2A 2ZIAA 3QE4A 1GTL1 3KTAA 1AVTA 2HC9A 5HW0A 3EODA 4HVCA 1WKVA 2RHOA 1FSPA 4CODB 3EFOA 4AP9A 1NW6A 1S7GA 4Z9XA 1EK5A 4ZN6A 1LCIA 1QQ7A 1YR6A 5CXUA 2CNKA 1SXJC 4AWAA 3U4MA 2LUOA 2QNRA 3H4MA 4R1MA 4Q02A 1UBUS 1PJSA 3UPTA 2CT8A 1P7YA 4I8DA 4UEWA 3FCUB 2PUEA 2PKQP 4MW4A 5E1DA 5C5DA 5G4LA 4QTXA 4AFNA 3EZ7A 1CZUA 3OEED 4R6XA 5ALRA 4G37A 5C7LO 3MWYW 1KI3A 1ZZEA 4RE6A 3KL2A 1MIOA 1A9SA 3DTNA 4OH7A 4DLUA 3JALA 4V0OA 3DDOA 2XSZD 2GWRA 2B9EA 2NOAA 2M1XA 3GCZA 4CTJA 2PMFA 3H11A 4YROA 2HRRA 3IAM1 5FUVA 4R69A 3WWEA 4ZD6A 4XOUA 2J30A 3HB4X 4KQKA 4UFOA 4X7RA 1EFKA 1N32B 1ODKA 1V16B 1VL8A 1T0BA 4IMIB 1P5HA 1WHTA 2H1LA 5G4KB 1JR3D 2NUAB 1TA0A 3PT9A 1XWWA 4OBXA 5K05A 5LZ9A 1F4LA 4DS3A 2F67A 3FPFA 1G8SA 3OFKA 5EXDA 3R41A 4J3NA 4I8XA 3B51X 3H6GA 1X1QA 3MQFA 4L72A 5ECDA 4B71A 3ZD7A 4IYRA 2M6SA 3AHCA 1A82A 4ZQIA 4FWTA 1Z25A 3W8DA 4C5BA 2Q0HA 2OHXA 2VSQA 3E61A 1QIMA 2X2PA 4X6XA 1T43A 3I4NL 1QF7A 5IYBL 1CERA 4U7WA 5F5LA 3EQ7A 4AMYA 2EBFX 1KJ8A 3ZCVA 4B48A 5A5GA 2CHFA 2FW9A 3UT5B 1W5AA 5ERGB 3QKSB 5E2IA 4HHEA 5HEKA 1JIQA 2ZUUA 2XCQA 3BN3A 1CDOA 3U7EB 2AJDA 3LOUA 1IROA 2QWXA 4FP9A 4UHJA 3EVAA 3ELBA 3M4NA 4KXWA 3ACBA 4L0MA 3K9WA 5H5JA 5IC6A 2GA9A 4C5AA 3F7NA 3GY0A 4RIIA 3OKAA 3I01M 2Y1OA 5KYXB 1FEZA 2EP8A 4J49A 1LD3A 3I4ML 1KETA 1KI1A 2BMEA 2I2AA 1ND5A 2FPPA 3FXAA 3G2QA 2Q29A 3LRTA 4KLNA 2ZBPA 4M89A 4ETWA 4BNZA 4TKMA 2HA5A 2JFUA 4PLYA 1UDRA 3CISA 5I7WA 3NPAA 3EW9A 1C3XA 5LP1A 2YS6A 2HSJA 1EJBA 3BGSA 2CB0A 3KR1A 2HHLA 1VRWA 3U26A 3V1MA 3RABA 5CG2A 5LPNA 1I30A 4GVLA 1NJ6A 4AKGA 1Y7LA 1L5OA 3IH5A 1Q7CA 1CJKC 1BQ9A 1U04A 4K8OA 5JQGF 1T9HA 1XKXA 3G0DA 4EYOA 4RXUA 5FQOA 4AZ3A 1RYEA 4PG5A 3VXKA 4PU0A 3L9XA 3KKEA 4PWZA 5DWVA 3VX3A 3U37A 3F96A 5CX1A 3WRYC 1TE2A 5KDDA 4MVJE 1ZJ4A 4K6OA 5LP6F 3AVWA 1PFGA 1R3UA 2P91A 3F7MA 4R1TA 2WAYA 2FYTA 5D7NA 3AOGA 5JNRA 3DS8A 1AB5A 1ULTA 3KVYA 4OHRA 3RKSA 2JCYA 4QT4A 2IPMA 2UKDA 3G59A 3MWDB 1Q95A 1J0EA 2Z1MA 1VBNA 5SV2A 2A94A 2WM3A 3QFTA 4GWGA 5DLYA 1DMRA 4HOYA 1YRWA 4IZ6A 1RAGA 4KWTA 4U2EA 4B2LA 2IV7A 2RGUA 1SB9A 1U80A 2NTVA 5EWMB 1TVEA 2Z43A 2JLUA 4NZYA 2XBUA 4CLRB 4TXLA 4EGCB 1UBMS 3GNSA 3HUTA 1F3OA 2A5DA 3W5VA 1BHQ1 4R1NA 1JBKA 4QYMA 1JKIA 1XZGA 3JZIA 1H2HA 4IHJF 2C00A 2HJSA 5TMBA 4YJFB 4COKA 4RTQA 4Q1BA 2VHJA 4J8PA 3IKVA 4L51A 4WLNA 4QGSA 3GIWA 1B3BA 3K0CA 4YH1A 3ZLTA 2WHQA 1ORHA 1PFQA 4MJ3A 1YKGA 4P3YA 3W7BA 2JZNA 3L7KA 1ODCA 1W34A 5EFZA 3TLZA 1KHHA 3QUTA 1IHUA 3EMKA 4Q66C 4PHFA 4RIEA 2EP5A 3HU3A 3FYUB 4XFKA 3L7JA 2E85A 4D5EA 3HPQA 1E58A 5CU7A 1NYRA 3IJPA 2FQYA 3UO8B 1I10A 2ST1A 1OBHA 3EUFA 2GD2A 4MEBA 4ZOEA 4D82A 4BMOB 3GBPA 2DSTA 3M3PA 3GNTA 1KJIA 2DQSA 2YJGA 4MP8A 2HDNB 3PRHA 3SBDA 1ZEJA 4XI9A 3FZQA 1JYSA 1GTMA 3V7YA 2QD1A 4X41A 2FN4A 2TYSB 4JR1A 5KO2A 3OURA 3PIDA 3W5JA 2H18A 1GDTA 4UAUA 2X9LA 4EUSA 2ZJ3A 3PEVA 2I1VB 2VDMB 3ILHA 4OO3A 1E1DA 1J42A 1QKJA 3IPRA 3K20A 3OZVA 4LE1A 4S12A 3R0JA 2X1HA 4MYSA 4B17A 4E5MA 2IW3A 2VUML 1GRVA 2CMKA 1XL0A 2OAGA 3AUJB 5CVJA 3A2KA 2G07A 2XMZA 5BR7A 3SK0A 4CM9A 3BMNB 4Z4EA 3OLVA 3OICA 4FDLA 1M6WA 4NH4A 7GPBA 4PYNA 2NYAA 2F59A 4DMLA 1EI9A 2W2KA 4LV6A 4P7GA 4WK4B 3QXJA 2JDID 2H12A 4MO9A 1E2DA 1TUIA 4GP9A 1BOFA 2XUOA 2EF0A 1XZ8A 4YRRA 1JPUA 2RGCA 1MFZA 5F76A 5F23A 3I6ZA 1H3NA 4N8DA 3VNUA 4XM2A 2ODQA 3ND6A 4MRSA 2ZIUB 1EVJA 4YRCA 3W6PA 5BN4A 1I2ZA 2QYHA 4BVJA 2IH4A 1NBMD 2FN7A 3N2GA 1LI4A 1H5QA 1GILA 2WP0A 1NE7A 3FTCA 3KYVA 2Y1FA 4DJTA 3O8QB 4HD8A 4TMFA 4QBGB 4DABA 1UKCA 1DZIA 1XD8A 3ANMA 1ZC4A 5DV9A 3KYIB 2CYAA 2O7VA 4AJEA 3DEZA 4XLLA 2C2HA 1KOLA 3ANXA 3DP9A 1KMNA 5CK4A 5KQMA 4I2NA 1LDGA 3GQBB 4BFZA 2BRUC 4E12A 5LKAA 3SJBA 2RONA 1ZCFA 3A1NA 4WE3A 3WMFA 4CM6A 3DWIA 4LJ6A 2CJFA 3FHLA 1TZKA 2J5BA 3N74A 1L7QA 3BSSA 2JJ1A 3M6WA 3MG9A 3RT9A 1XQXA 2H2WA 1L5FA 3RTEA 2PIDA 4H31A 1YZLA 3PYXA 2G71A 2PRSA 1RB9A 2FRVA 2G08A 5FOSA 3A9RA 3BTVA 2ZYIA 4GPBA 4HEJA 2PRZA 1P72A 1XNHA 1WTAA 2JAHA 1HFJA 2BEWA 1FMCA 4M21A 4YUVA 5CFLA 5FR2A 2WG0A 4NZNA 4OKIA 4TQGA 4BY7L 3M6LA 2KHZA 2BGJA 3VR6D 1VXRA 2QRVA 3LBIA 1DQNA 2RH4A 1SKQA 1J09A 3KQVA 3WBBA 2OV1A 2ZRCA 3MSCA 2WJGA 1XZQA 5BN3B 5IXSA 3ZD6A 5EPOA 5CB0A 2Q3CA 1HNZB 3M4JA 5AM1A 3T1VA 2C29D 4P0TA 1MW9X 3OI7A 1XT6A 1D1PA 3QM1A 3FI0A 1JW9B 2JI2A 4H3KB 1DC3A 5C8XA 1JSLA 1LZKA 2R1TA 4J7CA 4UMDA 4LWPA 4RELA 4MGZR 1AY0A 3FSGA 3WWNB 1QIEA 4FX2A 3HA2A 5B7NA 1MX1A 3R5KA 4C7JA 1FUEA 1O95A 4L8VA 4AJLA 3K70D 3FWKA 1UCFA 3IHKA 4CF3A 4AIRA 2RHLA 4LVCA 4EHHA 2HQRA 2ORED 3T9FA 3OZSA 2ONZA 3DCYA 1V6SA 1N5RA 1TMGE 3FGOA 4G1VA 4JCOA 4DDTA 5DTJA 1OI3A 1RJGA 4AO7A 4AR3A 1C4KA 2YQ5A 4Y9RA 2RGWA 5TJHA 1JHQA 1OE0A 3W6UA 3I64A 1JLMA 5TT1A 4I4LA 5FBHA 2B4QA 3V4LA 4MROA 3F5FA 1AQUA 1G2PA 4MS1A 3I53A 4PZCA 2PJRA 3QMWA 3NVAA 3LC2O 2GF2A 4MKHA 4HAXA 5JR3A 2WYWA 2Q0SA 4YB8A 1NBME 2Q3DA 3IOYA 1HDGO 1R00A 3AFNA 4AAYA 4ZICA 1UPCA 3H2BA 4V0KA 4IGKA 3GGCA 4DIDA 3THRA 5AW8A 3ZDRA 1SB8A 1X0XA 2C4HA 3AUAA 4HH3C 2VZ8A 4YXWD 5JAZA 2EKQA 3N87A 1ECJA 5DBHX 2OG1A 1WDWB 4I50B 3NTRA 3QJGA 3HO1A 5C3EL 3FWYA 4GNKA 4TN5A 4KUHA 3S1AA 4Z7QB 2DKNA 3WLRA 1JFLA 1Q84A 4MQLA 1NTOA 2VR1A 3D6MA 3EW7A 2Q9AA 1IONA 1RWNA 5BSMA 1FP4B 3N39C 5AVXA 1AQNA 3BRQA 3OKCA 2WG1A 4KR7A 4IINA 5IAKA 1GGEA 4WPGA 4AJKA 3MRSA 1O6GA 5YASA 5M34A 2ZUDA 3OVMA 3J7Y1 1AKMA 3KPYA 4GI1A 2A4KA 1RS0A 3LC0A 2A69D 1ZM3A 3IP8A 3WYBA 4C6TA 1ADFA 3KR2A 3DVRX 2QUAA 4P3NA 3GDHA 1S4QA 1IHOA 1CR2A 4OA8A 1ZXXA 1NY6A 4PG7A 4YUZA 4TLAA 4FFWA 2MU1A 1E2LA 3SDZA 2VTVA 1C1YA 4JP8A 2XZOA 4F12A 2G40A 3GW8A 3L01A 4M60A 1TYAE 3V6MA 3K7AL 1P7VA 2OK8A 2WMYA 4MKRA 1WSBA 4E88A 2IODA 1X8KA 2PR2A 2QQ5A 3B3GA 5JH7A 3P9CA 5CIYA 3K8QA 3PDJA 3M9XA 3PNMA 4YO7A 1GPKA 2FMTA 1CK4A 4FE3A 4HZIA 1FDIA 4JS0A 3IBCA 3S68A 1J5XA 5LBIA 3FM9A 3PC2A 3LT4A 4G0OA 4Q3AA 3TL2A 1MIHA 2WTUA 4KR6A 5KREA 1HF3A 3KJHA 1P19A 4CKEA 1O6FA 2QLTA 4GOMD 2PMCA 3ZDDA 3TMAA 1RKVA 4MKFA 1C7FA 3GTQL 2GHQA 1CU1A 1JVNA 1W6UA 1RP7A 2A30A 2YVKA 3AHDA 3BMNA 4NEQA 4MZDA 3WGKA 4R6WA 1X1EA 2HZBA 2E2WA 3M6AA 4IQ0A 3O4RA 3OIGA 3KQSA 1USGA 3NS7A 1ECGA 4IHKA 3B60A 3BWMA 5ISMA 4WINA 2VNAA 4X5OA 3HY3A 1U5BA 5B3AA 1XRQA 4ZANA 1F8GA 3RAPR 3VNRA 2YZNA 3TZKA 4CIXA 2FWNA 1IM8A 1ISGA 2J6HA 3P8BA 1SVUA 2XMGA 2F00A 2JDIA 3FYUC 3S2GA 2GBLC 4HRYA 4R98A 3TXYA 3S14L 4GC5A 3AP3A 4J2HA 4EG7A 4M7PA 4WJZA 4M7RA 5HJ2A 1PT8A 2XUHA 3QXCA 3FVWA 3JW8A 4L50A 4V38A 5CNKA 5IARA 2QAIA 5P21A 4D9GA 3Q8LA 4LKRA 3VU9A 5KYTA 2A3NA 2A0FA 3MTEA 3RSZA 2GLXA 1TZ2A 2YYSA 2C7RA 2X0RA 2HYDA 3VPBA 1K9SA 1RYFA 1XRLA 3OH8A 2VP5A 3ELWA 3HA7A 4GL4A 1Q1GA 1ESZA 1I1HA 1DJNA 1KSGA 3J7Z1 4XIJA 3B5JA 3GDWA 2ZTHA 3O2SB 1R12A 5EZSA 4C4XA 3L0OA 4TQAA 1H1LB 2RI0A 2Z0MA 2C1ZA 3TXAA 1YB7A 1VJGA 1RLUA 1F48A 1Z39A 2HQOA 3EIUA 3HEBA 2IITA 2BLLA 2N42A 5KOIA 1MUUA 3IL2A 1U0SY 4Z6KA 4JUIA 4YR9A 1N33B 2IHUA 2VPIA 5A5EA 1ISPA 3I2JA 3CLSC 1Z63A 5E3IA 4KTVE 1CR1A 1YZHA 1FMLA 1G4AE 3JPWA 4MQ4A 3S2DL 1EP2B 1P1CA 3R3SA 2IV2X 4CG3A 4Y2UA 5BOSA 3VU0A 3WLHA 5FUYA 1UJ6A 4PYJA 1AQ6A 1DAIA 2I5PO 2GXSA 4IVNA 4POAA 4LDRA 2BMVA 3B6KA 5LDGA 2RKBA 2QR3A 2XB8A 3K94A 1TU0A 3ITNA 2QEQA 2WC1A 1S8AA 3DZJA 4GGMX 1JNXX 2B5OA 1KP3A 1NW8A 2H57A 2ZT5A 3D7RA 1N2CE 4LJYA 2Y0SP 3H9QA 5J2TA 3UWMA 1CQZA 2NMVA 4GR5A 3WOHA 2YHSA 1O77A 5HK9A 3P9ZA 3RTDA 1J33A 5JD3A 1JR3E 2XW6A 1ESMA 1WL8A 2OZVA 2YWBA 3HRIA 4LSGA 2C9DA 4YGXB 3VZRA 2WD7A 1UJNA 3FWNA 1E63A 1J9GA 1WWKA 2P2CA 1WF3A 3I6MA 1MB4A 1P0IA 1DAKA 1XNGA 2CFCA 1PLJA 2JZOA 2A5JA 2DKFA 2IKQA 2ZR9A 3C48A 1H0RA 5BW4A 3S8MA 1CZKA 1NQVA 2B7LA 2XJUA 1DCFA 4D6YA 5KHLB 1B74A 1JB9A 2CXOA 4INZA 3TRHA 2QPAA 3VSEA 4DIUA 3CRQA 4I4TB 2RE8A 4BNJA 1J8QA 1HYHA 3AUUA 1NLUA 2G3YA 3WWYA 4JOQA 2H0QA 4XSVA 5CLGA 4P54A 2D5LA 4GKVA 4F97A 5GJCA 5MLC3 1O2DA 1U1IA 3BZBA 3QU5A 2EEZA 3AY3A 4UY81 1FP4A 4TV9F 3WLAA 2B37A 2QW0X 4MW7A 4YRTA 3SJUA 4B87A 1N57A 3GCDA 4CKBB 2ONYA 1J25A 1OFTA 2J9XB 3W06A 2WVGA 1ADYA 2HZ7A 4G0PA 4JVMA 3RT1A 3TRJA 2D1YA 4QXOA 1J24A 1J7KA 5CM8B 4DXAA 1WCYA 3TFWA 1P2UA 1J8FA 1MVLA 3CX3A 3GJ3A 2FPRA 4YI3A 3UGKA 4J43A 1IHYA 4ZN1B 1WU7A 4M22A 4HAZA 1Y9AA 2ZPAA 4S35A 1YA4A 3QFFA 3D9QX 2PWZA 2BBSA 1WMFA 1J99A 1X0VA 1SCIA 3LDFA 3VVBA 3WJ2A 2FW8A 4F2WA 5GZ3A 2UYHA 4CIBA 3U7FB 3QVGA 2GUGA 5TPZD 1NF2A 2VJQA 3NOVA 4GX1A 4PAMA 3AUFA 5DEOA 7REQB 2NO0A 3URMA 2UAGA 1IHXA 2OUKA 1N6IA 1NN3A 4JBLA 4C9BA 2C92A 3V8MA 4CGZA 2R00A 1DHTA 2R4UA 2XB6A 1PZGA 3IQWA 1QHXA 3LVQE 4BC1A 4KSYA 4PN7A 1H6DA 5ED4A 3KJQA 3VM6A 2FOIA 4JT9A 5IXJA 5DCLA 1U8EA 1CVIA 2HT1A 1NNSA 2FZGA 4YMIA 3FTQA 1YVPA 3LXUX 1UPUA 3I6YA 3M1YA 1A8UA 1TK2A 3EVFA 5F4ZA 3OZBA 3BJIC 4XXBB 1IBLB 2OV6A 3FHTA 2WF5A 3C3CA 3QX9A 4HNSA 1DRKA 1KO5A 4QQRA 4LRSB 5L9AA 3ZV7A 5TR9A 4JBHA 2WHPB 3IB6A 4C88A 5J23A 4CCYB 4JJAA 3WL5A 5AW1A 4YAUA 3KE9A 1Y48E 3KNZA 3LMKA 1GO2A 2OQRA 1FRFS 4HT3B 2B7CA 5LLSA 4JLWA 4PX5A 4ZMRA 1UAYA 2YINC 5A4KA 1GEEA 4AKHA 1BRTA 3RIYA 5LOVB 4H0FA 4NK5A 4LJ4A 1YBMA 5IVHA 4ZA2A 1QJ4A 2IXFA 5B7GA 3D6VA 2RH8A 2JHPA 1F2DA 2HF7A 1YQDA 1XRPA 4TYPA 1E66A 3RBAA 4KAJA 1YZNA 1KP9A 3IESA 2GEJA 4MWDA 3LUDA 5L40A 4BLTA 3A1TA 2V9ZA 3H65A 3WKCA 2H63A 3NFPI 3PEFA 2FUNB 4B8WA 1YB2A 3EH2A 2PU7A 2H5LA 4NBTA 4MI9A 2YRXA 2R8YA 1S4MA 2OD2A 1RWPA 1YIDA 1UKBA 2GAAA 2F1RA 2Q4EA 5CMLA 4DCUA 3LP8A 5JHHB 3AF2A 2YHIA 3TSZA 4RTSA 3NT4A 4OXNA 1GL6A 1FFSA 2Q21A 4JQYA 4B40A 2VHTA 4PCLA 1USUA 2CJPA 1QQAA 2BI4A 1SVLA 2ZANA 2WU8A 4N0EA 4PVDA 5E38A 5LYYA 2FMKA 4QOFA 4ZJUA 1L5WA 4PSDA 5BSEA 5FOTA 3L8DA 4GEGA 1M1XB 3OEHA 1RJ9A 2YXEA 1W96A 3P32A 5EPEA 1HOXA 2GSDA 3I04A 5CNIA 1R0HA 2JBHA 5DK6A 4UBJA 2P6OA 1D09A 3VRHA 4YXFA 4AMZA 2E18A 2P5SA 3VBEA 3OAAA 5KYYA 3WDSA 5FXMA 4ZI7F 2V8BA 3DT8A 2NVUA 2ECQA 4KO3S 4MV5A 3JQCA 1MG0A 4LSMA 3LLVA 3DNPA 4L5YA 5L7TA 1U6JA 1H69A 3O6VA 4J29A 3ROGA 4HLUA 3DM9B 3IUNA 4FGJA 4YQZA 2C5AA 2CLLB 4MIEA 3G5LA 2V3WA 1EGQA 2V97A 3DEFA 4JEUA 2Z6UA 3U2QA 3TOVA 2CDCA 1G66A 4ZV9A 1QP4A 5CVVA 2H5EA 1T4MA 3EE6A 4MW5A 2R85A 1CDDA 5BWOA 1K97A 4YASA 4ZALA 4AN4A 2X1MA 1TPZA 3CS3A 4PYOA 5EYPA 2PX8A 3UCEA 2IF0A 1L7DA 5J3JA 5FUMA 5AXDA 1S2OA 3L1HA 2I8AA 3DOHA 3EHDA 2HWKA 3DM5A 1FA9A 4NBLA 1RW4A 3R20A 4J0IA 1GZ6A 5M3FL 1XHLA 1TIBA 2IHJA 5FYDA 5SYAA 4DYVA 1B23P 2ZTSA 3QHAA 3WBFA 2YXDA 2CUNA 3DE0X 4DA4A 2E4WA 3EG9A 1NUSA 4TYMA 4DSNA 2JJ8A 2JLAA 2D7CA 2JJMA 3KOYA 1JLRA 1CAAA 2J07A 4XPIA 3I8XA 3FPGA 3ILXA 4MAFA 4R0VA 3TSAA 1T3TA 4IOLA 4UTPA 5IDWA 1S89A 2O3TA 4TX1A 4G8JA 2E4AA 4D9KA 4YAFA 2ID9A 4FOTA 1NQAO 5TEVA 1P5FA 3NKVA 5EERA 5GONA 4YWHA 4EG5A 2O3JA 1A9ZA 2BHSA 2AH5A 1YNOA 3JVVA 5KMGB 1BXRB 2C9ZA 3WIOA 3WQHA 4ENVA 2OA0A 1Q0PA 2ZJ6A 3P2JA 2JI1A 2K87A 1J8VA 4KWCA 4OGFA 3SP1A 4M83A 3TTVA 1SBTA 1GNLA 1EUZA 3DTVB 3RJ5A 2WB2A 3PQ8A 2A1UA 1NV8A 1HURA 1P5JA 3CZ9A 1YK1A 2HSGA 5MN5A 1PJLA 4QYIA 1G8HA 4UUNA 2JGDA 5TRTA 4P36A 1RNLA 1BXKA 1PW7A 5JBIA 3WKAA 1PLLA 3W3AD 3WGVA 2GKSA 4NAHA 5L45A 1LDYA 1UMDA 1DSSG 3KEFA 1QPBA 4KZPA 4EJMA 1LJ8A 2AW3A 3JRXA 3OCJA 3Q8MA 1MHPA 1R0YA 2WHXA 3QKWA 1RLMA 1X9HA 3N58A 4F6LA 1IZ0A 2IYZA 5A02A 1BHSA 1L2TA 2EIXA 2E1PA 3MJSA 3RUIA 4JA0A 1ZWLA 3G85A 4G97A 1Q0UA 4C07A 2VPXA 3FNBA 3EDMA 3LF2A 1XZKA 1NDUA 1EPUA 1E2KA 2IEBA 3GU3A 1P81A 3DFUA 3I30X 3NHYA 4JB2A 4XYBA 4URFA 5HQJA 4YRSA 1GNVA 3L0ZA 5F7XA 4UVGA 1M6HA 2D54A 1JDBC 1BS1A 4BO7A 4CF7A 1ZGZA 3DFZA 3K5PA 4NCNA 4BQFA 1PG0A 1QAOA 1FLVA 1VIDA 2HV8A 4YACA 1ZAKA 2AI3A 5GV7A 4M7WA 2RHCA 3LOPA 2WILA 1WRBA 5TX7A 1PZEA 3ETDA 5FF9A 4DC9A 2CV2A 1OBCA 2ZQ5A 2DFKB 4OY3A 3RVQA 4M9CA 4U3JA 3LWVB 1J5EB 4QQFA 1Q0LA 3QOXA 2HRQA 4LXQA 4IDPA 5LWQA 2ZM6B 3JARB 1FRZA 2D7JA 2I3ZA 2PX0A 2QM3A 4GOLD 5U9CA 2V3BB 1MABA 1CE8B 4E21A 5L3ZA 4FYVA 4R54A 4KVFA 1U8UA 2GPSA 2Z5LA 3G9ZA 1JDTA 1NJ5A 2OK7A 2AYXA 4G4SO 4G5YA 4I7EA 4MIKA 4XDZA 2IEGA 4ARCA 3ICEA 4W5QA 2ZTUA 4YHHB 2F3TA 2H3HA 4B3SB 5ALDA 2WOOA 4HNHA 1JFVA 4Y0NA 2EKBA 3MNFA 5IJ9A 4XCXA 4KNYA 3DBLB 4GICA 1E2MA 1RIFA 1V5IA 1ZI6A 3FB1A 1FOEB 3HLTA 3IEKA 4ND2A 4OXYA 2P4QA 1W9MA 1DBQA 4N18A 2EP7A 2CZQA 5KJEA 1SC9A 3M6UA 3UIEA 1GPUA 2YZMA 2XQJA 1CY0A 1VE6A 4H4EA 1ZKDA 2EFCB 4HPXB 3O73A 1NVEA 5I6DA 1H1TA 1IBCA 4RD2A 4M1SA 1HZZA 2WFLA 4YAJA 1IEVA 4DLSA 2VJMA 2DVMA 3IV6A 1T9PA 1P1JA 1GSIA 2I4OA 2O2XA 4MUBA 2EFEB 4MHOA 4XQGA 5ARCA 2IYTA 2OORA 3HJNA 4ZXPA 3E2MA 4Q15A 2PZMA 3IEUA 1V2GA 4LYJA 2H4YA 3KHSA 4FN5A 4O4IA 2QN9A 1MOSA 1C0KA 4LOKA 2YJ3A 4D0SA 2NXJA 2BFWA 1EJ6A 4YPFA 2X5XA 3VDNB 3DEKA 1W4LA 2JEZA 3MOGA 2GTHA 5T6BA 3U49A 4DRXA 1N6RA 3RAFC 3S2EA 4F6RA 4PC3A 2P6UA 4HWTA 2NSJA 4B9EA 1SUDA 2EQ5A 3BHMA 4MQFB 1JXOA 4KIGA 3TCXB 4V0ME 4XOIA 2Z2YA 2B7BA 5EWJB 2ODPA 4HRVA 5IN5A 4LRWA 3NWEA 1UZMA 2C2MA 3LUAA 4JA2A 3WA7A 1L4MA 2Q5LA 1UOOA 5AIBA 1GPAA 3AJ9A 2IVFA 1WHSA 5BR1A 2VH2A 3SLGA 2G4CA 3OP4A 4CWAA 1IWPB 4W5WA 3QUSA 1M3SA 3HL0A 4GM4A 4G0MA 1YR2A 1JR4A 1P7PA 3EG9B 6GPBA 4KGZA 3IPLA 1CZNA 4BASA 2QL7A 3UW3A 1CC1S 3EXAA 4XYEA 1EB9A 3KYCA 2O1WA 2ISQA 1Y8RA 2J9FB 1X19A 2VF4X 1Z4OA 4C4RA 3HDVA 1JDUA 3BYZA 1A2KC 2DXIA 3RB8A 4FCVA 1Y3AA 4MRPA 4K81B 3RODA 1L7MA 2XB4A 3OWXA 2CEKA 4GW3A 3K16A 5EHQA 4A0GA 2GVDC 1ZH4A 4FUQA 1RQRA 2ZJAA 4LZAA 1KC3A 2BCEA 3L1VA 1VJTA 4QEZA 4QOJA 2NSYA 4PHTA 3OE7D 2QD4A 2WAOA 2WU3A 1XDWA 3HDYA 4RH3A 3KQMA 4KI0A 5DM1A 2ZJ2A 3BB3A 4Q19A 1DJPA 4BO0A 3CNBA 1WJVA 2HMUA 1KZ1A 2Z8YA 4AMGA 1N0VC 3QEMA 3Q6NA 3P97A 1P7WA 5IJ0B 1CNMA 1KAGA 1MD9A 1X1SA 4B5LA 3DZBA 4RF5A 4UC0A 2AMFA 3R0XA 4LTMA 1JGTA 1I7NA 1UFKA 2YWXA 1YASA 4Q1VA 3T3OA 1USIA 1MEJA 2E9SA 1NKVA 1OWLA 2GK7A 4WTOA 3EOZA 4EVQA 3WP0A 4WKBA 4BJHB 1YQ9A 4GZLA 2QRHA 4A23A 1Y8ZA 2FGKA 5B3JC 2B63L 1GTVA 2FWAA 3D8TA 1PR9A 5KQPA 4AYTA 1ULBA 1T35A 2M1ZA 1P33A 2ZS9A 4CT0A 1V35A 3FLAA 3BFPA 2VKTA 1REQA 1AUVA 4HH0A 3VZCA 2HHCA 3RYIA 4FBMA 1NW3A 2VZ9A 3RFXA 5B6PA 1PGOA 2Z8ZA 1B76A 1K0FA 3LAWA 3L7MA 2EJTA 3N8KA 3NHLA 4ZEWA 1FX0B 3LLMA 4FNGA 2QORA 1BFDA 5DT2A 2AVNA 2P2SA 1XLUA 3UUGA 3E3MA 3GZ4A 3E8XA 3ES9A 3W04A 4ZKDA 4JAVC 4JIGA 2FV8A 4TM7A 4F4FA 1IOVA 4TGLA 2FGJA 3FFAA 4XSHA 1H85A 1HE5A 2IF2A 2VXOA 2EX4A 3ZCPA 2QTLA 2JH8A 3G0HA 4NCXA 4ZYVA 2GF0A 5LVAA 1Q7EA 1GPLA 5BV0A 1OXMA 4EY5A 2MSCB 1EDDA 4QUJA 3ZDCA 4WCFC 2E6KA 1JMKC 5CBPA 1OLXB 1Q14A 1QORA 3O3MB 1ODIA 1BGXT 2ANBA 3S1AB 3SIPA 4RTNA 1PAUA 4HNGA 3GWGA 2QL5A 4JR0A 1XMQB 1ONNA 3D3QA 1QWSA 4X63A 5AT1A 3L4SO 1Z22A 5BNFA 3WWOA 5DRYA 1DJLA 3DXXA 1DV1A 4WECA 3LUCA 3BIJA 3HLKA 5IJ9B 3K2EA 4W5OA 1T9DA 3LS2A 4NU5A 1DAEA 1QV9A 2P90A 1EX9A 2W48A 2VCEA 3HPRA 4AZWA 3PC6A 1XVUA 3U16A 4HWPA 3S5JA 1ZQ9A 4RIHA 1ULZA 5E6UB 2YHBA 5J43A 3AV3A 3BWEA 4PHCA 4UW9A 3JPYA 1Z0ZA 1SZJG 1VJCA 1VCXA 2J8ZA 2VQSA 2VWHA 1OGIA 3A0RB 4WBXC 4A6XA 3IAFA 3B1FA 2P3OA 2Z2KA 3LU1A 2ZUTA 2A9RA 3TUJC 2XVZA 3IUBA 4IXMA 1ADGA 2XWPA 3OLXA 4U2CA 3WL6A 1F1JA 2AN4A 3THXA 3AZPA 4AK9A 1U0GA 2EFHB 4KXYA 2P2YA 3P9SA 2NU8A 5AUNB 3DDUA 7AT1A 1XCBA 4EHLA 1IUPA 3VYUB 2D13A 2RCYA 4LZOA 5LQNA 1JHXA 1BQEA 2GZHA 2JIPA 4Y0AA 2EL9A 4WIAA 1CF4A 1LNSA 1XTVA 4UU8A 1RAHA 4TTSA 1M34A 3VJLA 2R9VA 3LT1A 4ND4A 1ZJJA 4AROA 1MC4A 2QMUA 1FUKA 3RUCA 3S6JA 4Q4HA 4TRNA 3AM1A 1QH9A 4TQ9A 4WLEA 2Q6OA 5JS1A 4C87A 5C1BA 3N8HA 4H7IA 2FDXA 2L82A 3I01A 2BKXA 3LT5A 4MMZB 1G2IA 3PPYA 3SIWA 3T8YA 4CM4B 5AWFC 2PZGA 4D2IA 3T3MB 1TFUA 5LP6C 1F8XA 4KMMA 4O4HA 1I4WA 3LW7A 3D0QA 5FNVB 4DWWA 3VZQA 1NQUA 2CHQA 3MD0A 4RPHA 1NL3A 5H3CA 5BV8A 2PFSA 2BFDB 5WRFA 1P4GA 1VQ1A 4KDRA 4B0OA 1MDFA 3BMQB 4N7JA 2VHUA 3UMYA 3MM4A 2HHAA 3OQNA 2GCNA 3M89A 4GVXA 4V0RA 1XR3A 3MGKA 1LPOA 3K32A 3JD1A 1E3SA 4I3FA 2VHWA 1GA1A 4H2DA 1DBWA 5G41A 1QRRA 1I33A 1A4XA 1P1FA 4P6VF 5I7FA 4AX8A 3WYEA 3VU9B 2WJJA 4W5NA 1S3FA 1MVOA 2QU8A 1KQGA 3GLHB 4HZUB 4MAAA 5CNMA 3L43A 4YCDA 5FO1A 2JAXA 3B08B 2K2QB 3O1LA 3NKFA 5A71A 1EMDA 2PWBA 3IO3A 2O52A 1ZK4A 3LJKA 3HOXL 3HAXC 4QX6A 3EG5A 3CVJA 3OOSA 2DLDA 2DWCA 1SXJA 1FSFA 1QYVA 1U3DA 1GZUA 1P0PA 4QBKA 1XD9A 1GM5A 1H1LA 5A7FA 5KINB 3HY6A 4TLMB 3G2KA 3FSEA 4K3UA 1KEUA 3OIDA 4NHOA 1N7IA 3H42B 2W11A 2GBIA 3A14A 3DKPA 2HXYA 3ZXSA 2Q1WA 2B82A 4LXTA 1OLSB 1P2GA 1DG3A 1SEPA 1E1RD 2CMHA 2K7ZA 2YFKA 3KHKA 3QVJA 4LGMA 4Y2XA 3NBMA 3RU7A 3T94A 4R71A 3GCXA 2GS9A 5F3WB 3O92A 1SCKA 4X8MA 2O48X 1WPQA 1RI4A 2W83A 4G84A 5I9BA 5A5VA 1ZC3A 3ESRA 4JU8A 5BMVF 2P9QA 4FU0A 4PHGA 1OZ0A 2X14A 3FDIA 3NV7A 1AHHA 2QJTA 2G88A 1JIXA 4ZCIA 3EZ6A 1XF1A 1KJNA 4MGEA 1JT9A 1RM4A 2G8LA 4OHBA 4RF4A 3SSNA 4TMXA 3ZCQA 5CA1A 3ETCA 1FE8A 5GONF 4YMTA 2UYOA 2EEPA 1UEIA 1UPAA 5K3BA 4QNNA 4CTKA 2HXGA 4UXHA 1EK6A 1ZDMA 2WWHA 4RVDA 1G55A 2PS3A 5EXEA 1FLAA 2FG5A 3SS2A 3LYAA 2G4VA 1JEYA 1UFQA 4NPCA 3PFIA 1HRKA 2Q0QA 2AJLI 5E4YA 5LC1A 1UBFA 4BBZA 3HG7A 4J1TC 1U7DA 4KCGA 4WI1A 4FFLA 4KYVA 5BN5B 3EB9A 1ULSA 5AJTA 1OC4A 2VHCA 4RNCA 4I1VA 4LZNA 1RMQA 1UT6A 3WWCA 4AP5A 4X6YA 2FDCA 1W8IA 4JJ6A 1L5VA 5LYJA 2IZ1A 4QICA 5HOQA 1QH8B 1CF9A 3GF4A 3HOYL 2DRIA 3EF0A 1PEDA 4LXHA 3HXKA 3QPVA 4IDNA 3UKDA 2JIZA 4C06A 2O3SA 1QR2A 3GDFA 5LLTA 4JOCA 4E1AA 4QEKA 4IXDA 1NJ1A 5IRCD 4BLSA 4UBMA 3PHGA 1YA6A 1EQAA 2VWQA 2AE1A 4O25A 4DMFA 3UTDA 1OH6A 5A9RA 3C3JA 4HGYA 5FWXA 3QG1A 2DUJA 2CK3D 4DFDA 5J1SB 4LECA 3M5DA 2RHWA 2P9BA 5DGIA 4BXXL 2W4QA 1Z4NA 5ALUA 4C1BA 2XI4A 4UE3S 4LGVA 2YH2A 3K0AB 3IUEA 3TQQA 1Q77A 1S1CA 1DKQA 4EUEA 2PGIA 1IZ7A 1V11B 4P32A 2ZSAA 1EWRA 3D2AA 5HF8A 4U7TB 1GLVA 3PHIA 2P9JA 1EAYA 4UOEA 1I4DD 2WF9A 2GEBA 5CYGA 4P2GA 4QJ5A 1A4UA 3ZHCA 1E1NA 4GR4A 4GXNA 1VSUA 3C3YA 4HDMA 1GR0A 4B6RA 1DQPA 1KIFA 3MUFA 1I51A 2O0LA 2QT9A 4P1ZA 3PNSA 1A2BA 1DKPA 2YX1A 2O07A 1XDUA 4BZZA 4V1CB 3EDQA 4QELA 3QYJA 3A26A 2FVXA 1LK5A 3UVEA 4Q4HB 4D1YA 3IDAA 3ZGXA 4C78A 1N7GA 3UMGA 2XUFA 1Z4JA 3S17L 1XD2A 2M9MA 4YJ3B 4Z7OB 4P4SA 1ORIA 3VU3A 3S1SA 4R9NA 1W7AA 1JKMA 3IUSA 1GU7A 4IDDA 2OM2A 1ECFA 1F4VA 5DM71 2ZXUA 1JKFA 3SSOA 3UJDA 9LDBA 2IU3A 4XJSA 2WHPA 5GOTA 5AOBA 3UENA 3WY9A 4HGNA 4OLAA 2E0IA 3B1KA 1ZVMA 3JYHA 4GMFA 4N0DA 4H59A 4LOAA 1P62B 1ZOOA 3V1YA 1JECA 1BCRB 1CRQA 2GBCA 2H17A 2WYHA 4JKIA 3LBNA 1Y3DE 2R93L 3HL4A 3A4NA 4FWIB 1C9JA 1U11A 5BXYA 2PMEA 1N0UA 2BKVA 4P0QB 1ZUNB 3GVHA 3K09C 1THZA 2E7ZA 4LHZA 1DX6A 1PVDA 3K72B 2IXAA 2PMDA 4FW9A 5TSDA 4ER6A 1BH2A 1YUZA 2GDJA 4HPWA 3QLVC 3U6BA 4EMUA 3G7NA 5CGQB 4A82A 5IP5A 4MMYB 3UNXA 2ERSA 1KMHB 3ZLBA 4AXXA 2GM9A 2LRHA 4C22A 3D7NA 1FY2A 4FK8A 4LGYA 1ZNZA 4R40A 2WWWA 1T2VA 3FDJA 3A9UA 3HJTA 2WD9A 2PKQO 4WKOA 1RJWA 3IIJA 1PK7A 1SXJB 1T4BA 4NENB 1RU3A 4CL0A 5KJ1A 3AI7A 4DUZB 4KBGA 5BNIA 2B99A 2BEWB 5B58T 1SCUB 2E89A 1KBQA 4MJ7A 1U3FA 4P4TA 4D44A 2EIHA 4ZYUA 3K0KA 3HCFA 3KUXA 5DNCA 3RUHA 5CA0F 4XGIA 5CAEA 3R23A 5IT5A 1JIUA 2NV0A 1FDSA 2Z8XA 3BJZA 5D1HA 3AOEC 4GRIA 4K40A 1QYWA 4KVGA 4EL5A 2XJSA 3L46A 2I2DA 5D2CA 1T0JB 4AI2A 4CQMD 1QQTA 2QJOA 3QU4A 5G2OA 3VYWA 4BJ6A 4QGGA 3N2YA 2JNWA 3OT1A 3U0VA 4DQUA 5I4CA 4C0HA 3WO0A 4QRDA 3R9XB 1Q12A 1TTPB 4JLKA 4H6VA 3IPCA 2AX4A 5DWQA 4MPDA 4HFNA 3ETHA 4EFKA 3NBFA 4CRWB 4QLBA 2E49A 4W9RA 5C4GB 5CCDA 4Z51A 3W8EA 4BKMA 1M1ZA 8AT1A 3L18A 1SXQA 4LCBA 2OQVA 1YFKA 1K7FB 2EDAA 2AXQA 4RY8A 4EMBA 2HCFA 1KVRA 4RZ2A 2R6R1 5HDBB 2IOFK 2PKYX 1PTJC 1SVSA 3R0ZA 4JJFA 2WSIA 3E9QA 3PGLA 3WRVA 1UH5A 2VAWA 1A72A 2I2CA 3U1BA 5DMXA 3IKMB 3NHAA 4GBED 5BN5A 4RA6B 1A5ZA 5EJAA 3RWMB 3W05A 4QO8A 1EBUA 1J9ZA 5IJAA 3LV8A 3UOGA 4Q3OA 1TCCA 5CDUA 4E6PA 3H2YA 4OLHA 1EUDB 1RYMA 3H4TA 1CJCA 1NVFA 2XQGA 4JC8A 1I94B 1EXMA 4MDEA 2N75A 4ENUA 4IV5A 3COWA 3LQ1A 3DJFA 3UWOA 4B3FX 1T2FA 3LECA 3ZNOA 2IPNA 3VPSA 2J45A 3BE8A 3DW3X 4MV0A 421PA 5IT9A 1F8YA 2ZVPX 5SICE 3QLEA 4GYKA 4PIMA 3AILA 4Q6BA 4TTRA 4EB0A 1RZRA 1N3IA 1TJYA 3ZHRA 2UXBB 3MERA 4DXDA 1GNRA 1KYYA 5J2TF 2O8BB 4J1TA 3VKGA 5INTA 4DQKA 4EELA 3U60B 3NBYC 4V02A 4YS6A 1M0WA 4R9UC 1PS9A 3MWJA 3S1QL 3FROA 4I4NA 4R1LA 4BMXA 3UJ3X 5L3QB 1P74A 3IT2A 5BRNA 4K6FA 2UZ4A 3PR1A 3PXGA 1T2NA 2WW8A 3KQKA 2QG6A 4WMLA 4DAOA 3PX7A 1K8XB 4FFMA 3VU1A 3QX3A 4B3XA 4QJ4A 3WZLA 5EIXA 3FDXA 3M1LA 1U2PA 3CUKA 4P80A 4EP1A 3I4LA 1ZD4A 1ZONA 4PVCA 4UEJA 4WOBA 5AKGA 3P2IA 4EW3A 2DBQA 1NZFA 4MPTA 2ECPA 2Q0XA 3QVMA 5ADVA 1QRDA 3KZOA 4H77A 1SC6A 1L4GA 4O6VA 3GEMA 3AF0A 5JWOA 3W5DA 1OFVA 1VCMA 2XDQA 5TQJA 1I4EB 2X13A 2GNOA 3LSTA 1GPMA 4ILKA 1O3YA 1L4KA 3KALA 2HAEA 1G38A 4H6WA 2EFYA 5BQXA 1SMWA 3D8RA 1TW3A 2YL2A 3EDCA 4KQ9A 1XQ9A 2X5NA 2VNSA 4E22A 1OAKA 1WKBA 2FEAA 3K2BA 5FWYA 3O91A 3LLSA 1XA3A 1NMYA 2VPYA 4Z3OA 2OMEA 1CS0B 1U5BB 1ZXBA 4K1XA 4R8LA 5B1YA 2WTBA 1JXAA 1WMAA 1Z6QA 3R75A 1RVDA 2PH5A 1V7PC 3K09A 4RX1A 3VNQA 1BZYA 3E8SA 4ECEA 1Y7TA 2UXCB 2PO5A 3SC3A 4C05A 2Q5EA 1UDXA 4BN5A 2UZ0A 1O89A 3RSFA 1SOVA 1V41E 2R47A 4ZJPA 3GRPA 3TSOA 3BSWA 1NW7A 1R1DA 1EK2A 1WMBA 1E79A 3U4GA 4BJ3A 5I7AA 4HLUC 2Z56A 3TW4A 1GV1A 1YC5A 2C9CA 2C42A 3JARA 4RXTA 5HQ3A 3JSAA 4DR5B 4I9HA 1KWGA 2V7XA 3KT0A 4LF5B 3F6RA 3TK1A 3ZPXA 1ID8A 4HO1X 1ZN7A 4JBGA 4XQCA 1TYEB 1GUFA 4L5CA 3VJMA 4ABTA 1GQRA 3PIO1 1BD4A 3R77A 4H4DA 4J4TA 4DNFA 3KFLA 4ER0A 1SQGA 2WY2D 2YZ7A 5G40A 4GRDA 1P0CA 3R9IA 1JMVA 1TT7A 2CEAA 5ETJA 1Q0TA 3BRWD 1MKYA 1UL1X 2C5FA 4QATA 4I5DA 2QQFA 1PS0A 1GQQA 3DBLA 3GLKA 4Y9UA 3GTGL 3QYAA 3WNBA 3GGPA 5CUQA 3K8ZA 4B3CA 4YCLA 4Z4HA 5KWSA 4IDAA 4KG7A 3RFCA 4Y7DA 2FUKA 4FMBB 2P9YA 1V45E 2ETXA 4LE0A 4P2BA 4U63A 4XWWA 4DZRA 5LD2C 4GR9A 4Q9LA 1ZKMA 1QH1A 2GN1A 2VBGA 1COZA 1T9ZA 2UUPA 1H8HD 2HOQA 2BGWA 2R2GA 4J3FA 4B35A 1J8DA 2GZSA 3GLRA 1PVVA 3T1YB 2G17A 5EWLB 1PDWA 1FS4A 4PPYA 4WK6A 4ZVVA 4YCMA 5DGXA 4JLOA 3EC2A 4HG2A 3QELB 3PIIA 3VPHA 4BQIA 5A03A 4M7OA 4IIDA 1RZUA 2DPHA 4N0MA 5IKOA 4ZCRA 1KIMA 1OKKA 2HO5A 4PYLA 4INOA 4PXYA 5EUCA 1IU5A 1PP4A 1V96A 2ZREA 1L7PA 2GPYA 2J7KA 4LXUA 3AFOA 4AJ2A 5JVG1 1IAQA 2DCMA 4LVNA 3HDHA 5F5NA 1SK8A 1GZ5A 1Q1ZA 2JIDA 2E21A 4L9AA 4D74A 3A28A 1QOQB 1BMFA 1YV9A 2NZJA 1UJ2A 3U3JA 3LGSA 4MQFA 4NC9A 3WLSA 3ANNA 4MB2A 5JYCA 2B1IA 3C98A 2VPPA 4OHZA 3E3LA 5DNWA 5M5YL 1DEXA 1OJLA 4UPVA 1CIVA 2X0NA 4IR7A 2PN1A 3SS8A 2C96A 3F5MA 4I5EA 2R1ZA 3Q2KA 1QJCA 2AZMA 3MC1A 4MK4A 4Z86A 3NMUF 4BZWA 2ET6A 3U44A 2XQIA 3CRW1 5FADA 1FDRA 2FW1A 3LRXA 4MUJA 4MVJF 1FRQA 3EN0A 4PZ9A 4DWOA 1V6AA 5D51S 2VH5R 2YNMC 2CMGA 4NZ9A 1R4NA 3A6DA 5LU8A 5EIWA 3WQQA 1EVQA 3F6SA 4H7JA 4UVEA 1WSWA 2QVXX 1ONBA 5CNJA 5D5HA 2PRIA 1YQQA 3P9YA 3LZ6A 2W5UA 2ZJFA 1KK1A 4BMZA 3NPMA 5DTQA 2X5OA 3EHEA 5D84A 3UTCA 1KNQA 4YGYA 3DPUA 2FQXA 3ZZ0A 1E6KA 4Q5IA 1B73A 3CINA 4GQAA 4UHFA 2F6RA 3ZHYA 2JHFA 4WN9B 2E2JL 4PM4A 2IYNA 2QGNA 1PNVA 4FFVA 1T15A 2D5AA 4DMUB 3KU4A 4DRZA 2PZEA 1R4MA 5E1BA 4C7XA 3LPEB 4LF6B 3IB3A 1UFVA 4L7QA 3CRZA 3R40A 5SY6A 2EW8A 1LDEA 3A9CA 2WUEA 1BN7A 2HBQA 4LRTB 2DTXA 3LBAA 4CKWB 1YS4A 4EW1A 4TV9A 5EJ2A 4G9GA 3TNLA 2G5PA 1E6MA 2PBLA 3GVPA 1ECLA 4D7AA 4X1OA 1EGMB 3K15A 2XUDA 4DZTA 1GZVA 3FKSA 4INAA 1MAHA 4EW6A 4KX3A 2NV2B 4R2IA 2C54A 1V4VA 5CLIA 5IK2A 1LKMA 4RMGA 4YP6A 3N6VA 3ZWVA 1PW5A 4NJEB 1ZUD1 1X7ZB 2II6A 4HBGA 4C3JL 1V1MB 4U4AA 4CR7A 8LDHA 3IE1A 2ZI7A 1UOEA 3IQGX 1UK6A 2HA3A 3OPYI 1BD3A 4KE8A 1F7UA 4E6YA 1P4AA 1D2RA 1Z6TA 1Z18A 2XSZA 3OZUA 1Z82A 4MVWA 4N7BA 5J63A 3TAHA 1Y8AA 4MDHA 2AUMA 5LUAA 5ELMA 5HF9A 4LZZA 4QOIA 3QU9A 5CHYA 1BN6A 1IM2A 1L3CA 5KOHB 3B3QA 4G5QA 3UUEA 1JHVA 5LOVA 2GN9A 2MINB 3TBKA 3CLRC 4TSKA 4BNNA 3A0UA 1Z33A 2X77A 3T1TA 3NANA 1J9EA 3QJYA 2ZS8A 4EHAA 1OREA 3R6TA 5ALPA 2PL5A 1ZD3A 3ER6A 3FPJA 3QXSA 5HZHA 4XWYA 4KQCA 3K6SA 1EUCB 2F8SA 4Z4CA 5BNZA 1FXUA 3NZEA 1T8TA 1K7EB 2WF6A 1E79D 1QRAA 3C5EA 1SJ9A 3JQQA 1DBVO 4FLMA 5J9FA 4BMDA 1M10A 4CQMB 1J56A 2FJPA 3NAQA 2WHRA 2ZSIA 2AT1A 3F6BX 4GS7D 1Y3IA 4Q48A 4ZO6A 4ZDJA 1H8ED 2HGZA 3L1IA 1R2QA 1M73E 4WXEA 3HKEA 1G6HA 3RM3A 1L4BA 4KN8A 1I9CA 3ZWNA 2ACVA 3OTOB 4CEHA 1OX4B 1FP6A 2R7MA 2HTEA 4INPA 1L7BA 1H7VA 1X3SA 1G2QA 2PTGA 3DR3A 4GZ6A 3B2QA 5K03A 3HCEA 3CEHA 1IZYA 1AA6A 2Y76A 3TW0A 3EPKA 2NO7A 1KA9H 3LX8A 3R6GA 4KFSA 2OD9A 4LY0A 3C0KA 1YAHA 5EMMA 2XHEA 5FWDA 2WFMA 1CB7A 5AK4A 5EWLA 4AUEA 1GT91 1KF0A 2G9UA 2X1VA 3FPEA 1JHOA 5L4NA 2CF6A 1XK7A 1URPA 4RQTA 2ACKA 1THTA 2I2BA 1IFXA 6RXNA 1AS0A 1G9TA 3AONB 3D4IA 4NIMA 1NLYA 1H8HA 1F14A 3BD6A 3MJRA 3QVXA 4OHUA 3CPHA 2XJVA 1IU6A 2P4HX 1V8DA 4MARA 2IYQA 4KXMA 1N2CB 1CP3A 2IY8A 1TT5B 4A6DA 1WLSA 3C1UA 5DYTA 5C0OE 4DT1B 3AHJA 2IH2A 2XD4A 4MRNA 4QXPA 1HLGA 1Z29A 5JD4A 3PFBA 3TECE 1EM6A 4BVHA 4YRPA 1EH5A 4FLFA 4RJ2A 4YDHB 2JLXA 3RHFA 5T4FA 1GJRA 1JHPA 1C1XB 1FQOA 5CRIA 1FSSA 1E94E 1W94A 3NC4A 2GM5A 2ZT6A 2PR7A 1G3MA 4FC6A 5IDQA 1KE2A 2OXCA 1ISHA 4RABA 1VG9B 1RDVA 3SKYA 4YREA 1RRCA 1DIRA 4ARIA 2OFPA 2OV4A 1I14A 4G5SA 4NL4H 5G53C 4UZFA 4GP7A 3M6FA 4HQLA 4AULA 4G41A 4TV8B 3SC2B 1IBSA 4X64B 1APBA 5AKZA 4BX2A 4EKNB 3JTEA 3VC7A 2H4ZA 2NZYA 3JQDA 5J1TB 1WA5A 3SDSA 3JVUA 4DWVA 2WJ6A 7RXNA 2JFVA 1BE1A 3Q7IA 1HYGA 1P9WA 3WTCA 1EBFA 3I32A 2KBEA 3L8FA 1JLLB 2YRFA 3DMDA 3KYUA 3KUDA 1KAEA 1E96A 2Q41A 4KLCA 4B6FA 1O5TA 2OBNA 5HF5A 2BH2A 5A4JA 5K1ZA 5IBCA 5EKSA 3HK2A 3DT6A 1QGED 5AR1A 4WA8A 1XCPA 5IK2D 3MT7A 4AW9A 1R7RA 1Y9ZA 1GRRA 3M6MD 4LXIA 4XAQA 4OXQA 3A9VA 4NOLA 3ASUA 3F98A 3FDFA 1A9QA 4RYDA 5AJYA 3R3YA 1OFUX 4RETA 1RHUA 1GAQA 1YQEA 4E3WA 2WB4A 2GH1A 4K03A 3UK7A 2PSEA 1FFYA 1VE1A 1KOFA 5KX5B 3LWOB 2CUZA 1LXCA 2CY0A 3CF0A 3T0GA 3FOEC 4MHTA 2RAVA 4Q9IA 2O1XA 3E81A 3OZ7A 4HI0E 5EZ6B 1XHFA 3RYHB 4E09A 1CUUA 2B25A 4YJGB 4CV3A 4G1UC 4IDOA 5JCOC 5KEIA 2ZRNA 3FDZA 1OV6A 3MWEB 2VJAA 3H9JA 5AK5A 1SUAA 3T3GA 2JG3A 4E7PA 4H6XA 3ORQA 3SZRA 1WSDA 4CIAA 4P3KA 2BISA 4TQUS 3WLFA 1U7WA 1XMSA 3D4OA 3CX7A 2PS0A 3JAKA 5D7BA 1FIUA 4C4YA 4AECA 4ZMSA 3GVCA 2IYAA 3DDHA 2BGTA 1BEEA 1VIAA 3R44A 4E07A 5LD2B 5HE8A 4E2FA 1KPHA 5FWAA 3LHIA 4LF9B 1JAIA 4Y7NL 4W99A 1TUBA 3PUZA 5E1OA 3SSMA 3ZWOA 3A06A 3O94A 3I76A 1T2EA 2FDRA 2HLDD 3NQ41 2QTTA 1UJBA 3GQVA 2IUSA 3NHUA 2G04A 1PYDA 4LOLA 5DXJA 4MLZA 4TMZA 5DGHA 4YMHA 4AI6A 3KEGA 2B5ID 5THQA 2HLHA 2VYVD 4TTVA 3W9BA 2DQZA 2GCPA 3UQYS 5TF4A 2J32A 1J1UA 2PX5A 1RWVA 2MSDB 2JB9A 1X1TA 4EKEA 3OE4A 2J3EA 3CZPA 1P3DA 4H0CA 2B94A 2EKDA 4P82A 1MPTA 2Q62A 1V3QE 4IXNA 1FUYB 5IAGA 2QG9A 2UUAB 3UW1A 1OHHA 1Y1SA 2D2FA 2E87A 4ZAVA 3S1NL 3M1AA 2GHTA 1VJ0A 4I66A 2CLOB 2XYRA 1ODHA 4MS3B 3K0BA 3L06A 2SCUA 3QE0A 3T34A 1A8IA 1TK3A 3LWRB 5CA0A 4DDHA 2RJOA 1C3VA 3RVRA 2BKLA 5ICCA 5TVGA 3OFVA 2GQ0A 4LVOA 3ZCUA 1U2ZA 2PX2A 4A0RA 4L1KA 3NM5A 1N8TA 3EQ8A 1TYBE 4IH9A 1RRMA 1SC1A 4JOBA 4ETMA 4EHNA 3D2LA 5EKUA 1KU0A 2XCUA 3NTLA 2VRWA 3THYB 1CUJA 1Y1TA 1V9CA 2Y6UA 1TMKA 5ERXA 1ZW6A 2BW0A 2IKSA 3MJDA 5JS7A 1NA5A 3M4ZA 4CLXA 1MTZA 3UXEA 6PFKA 5ELXA 1IM5A 2R1VA 3E5MA 3R0IA 1XNQB 4DWJA 1TT5A 4ARBA 2G0NA 2VDJA 1KEEA 4IEEA 3DLTA 2R66A 5LN1A 4TL8A 1AGNA 3HJHA 5K3SA 3QVUA 1W76A 2FPWA 1L5RA 3SLKA 2V7WA 3ZOKA 5AKKA 5GGXA 3GO4A 2ZRLA 1G20A 4FX5A 2PEZA 1K1EA 3N70A 1C1XA 5KVAA 1HDEA 3B1ZA 1EFVA 1AE1A 2V59A 3ZJ5A 2D4AA 1JHUA 2G8NA 4I6GA 4B8ZA 1M6VA 1A9RA 1Z34A 2HJ9A 2CD9A 4NCIA 3R1IA 3L6CA 1IAVA 5AP9A 4ZC1A 1Q16A 3U4HA 5ALTA 5JCOA 1R27A 2IHZA 4EZIA 2JLZA 3PGA1 1DWQA 1ZZGA 1E1RA 2XEDA 1YDEA 1PFVA 2QL6A 4JHLA 4PRLA 3U4AA 1ZUNA 1NXVA 1TCAA 1QZUA 1M83A 2EBHX 1XXLA 1ZOPA 4PCAA 2J9FA 4ZOQI 2PUDA 3QEBZ 1ZIPA 4BE7B 2IU0A 3PD0A 1MX9A 4RXNA 1W4BA 3S2IA 4OSOA 2WM8A 2V74B 1JE1A 4C3HL 3V1KA 3U3RA 2YIMA 5I5GA 3ESDA 4Z1MD 4B73A 1NULA 4QU5A 1LPNA 1GFWA 1WVIA 1II8B 5ESWA 3MLAA 3ZY4A 3AJRA 3Q7RA 4JFAA 3J81A 1LK0A 2G1PA 4QHTA 1GZ7A 2B0CA 5DTMA 2DULA 2E37A 4G2NA 4TVSA 4N3GA 4BQPA 2PK3A 3LX5A 2WJPA 2J7PA 4CT4B 1NFRA 4Z4QA 1OT5A 2QM0A 2VJKA 4K1LA 3ROFA 1XZHA 5KX5A 1B8PA 2PTHA 2YZGA 4NEGA 4DF3A 3EF1A 4PGMA 4W63A 4D6XA 3AKZA 1MQ9A 5HCUA 1VGQA 2XE8A 1QIJA 4HB4A 3V46A 3OF2A 3FGNA 3OT1B 4RSMA 3IQEA 4IHJA 2Z83A 3TW6A 1ESDA 3GRZA 3IR6A 4K87A 3WWZA 1D0VA 3ANTA 1EVEA 1M2VA 3FAZA 4IUYA 3UMMA 1J2TA 4L16A 2IYFA 1F0YA 3HZHA 5ILOA 1GN8A 4C2M1 1QF9A 1YMQA 4Z3DA 4M6WB 2LCQA 1NUUA 5PGMA 1IQPA 1QBKC 3VZSA 4C7BA 2JW5A 3DMTC 5CX1B 2GTIA 3X2SA 2REXB 3ZE7A 3JWIA 1ATIA 1JJFA 3ZJYA 1XRNA 2EL7A 4WNAB 5EP3A 2NUTA 1DO8A 1PZNA 3CSSA 3AHGA 1TRHA 2X8JA 3DBHA 1NFFA 2ZIWB 1AQJA 4EY4A 1LKPA 4AY4A 3KWFA 2D1QA 2FPIA 3BREA 5EEHA 1ZLYA 1NXOA 2Q27A 4S1OA 3PDWA 5DEIA 5A2GA 5HJ7A 3A7EA 1UWLA 1XL1A 4A3BL 4K46A 1IY1A 2HIGA 2YWJA 3P8ZA 2LIPA 4FS8A 3UWPA 3H0GL 1B0PA 2B8NA 4PSCA 4G1FA 4BNMA 1Y6FA 1JJAA 4HQ0A 1FC0A 4R2HA 1DOAA 1V7CA 5SY9A 2G1UA 1J0DA 1G63A 4A3ML 2H2FA 2LKDA 5IKEA 1JQ5A 2JAPA 1XTQA 5KYXA 1R8JA 2Q1UA 2VP3A 4FM9A 1RQPA 3FI9A 1MO3A 1KDPA 3I5AA 3UHPA 1Z07A 1Z7BA 3R09A 1U3UA 4NFSA 1IXZA 1T3ZA 5AVKA 4TTJA 1MT3A 4XRGA 3W0LB 1XJ5A 4RVSA 3UUWA 2ZSEA 3HBFA 3P1JA 3MJEA 5AW7A 5JANA 1MEOA 5DX8A 1R6VA 3ASVA 4DA7A 2QNIA 3ZCRA 1A1SA 1DDOA 2YRWA 1JPJA 2FR1A 4F85A 1KXJA 3MELA 1JIJA 2W0MA 4X94A 2P2NA 4GQIA 1TYDE 2P7IA 2E4YA 3IQFA 1OV4A 2MIIA 2UYGA 2WWTA 3LSYA 4W5TA 2HMAA 5JU6A 1EVYA 3G82C 4HGOA 3RI3A 3T1OA 1S3SA 2FF7A 4IS3A 3ILVA 4KQ6A 1BC5A 1W19A 4ZO9A 3LQ2A 3X44A 4PBRA 2PGNA 2HRBA 4OB7A 2A67A 4O3MA 3JD4A 1AOXA 4CUKA 3VX4A 4AC9A 2J59A 2ZSBA 4FEEA 2RHGB 3A6PC 4CVNA 1EA5A 3JTMA 1DJOA 5I8WA 4YP0A 3CX4A 4KV9A 4OM7A 4S3MA 4GXQA 4DANA 4KXVA 3PVZA 1ZMXA 3SHWA 2ATVA 3P4YA 1U2SA 3UC9A 1RJEA 2NYUA 3OUTA 5KUTA 2EFDB 1NJGA 1XLVA 4Y1FA 5LMZA 1EFLA 4G5GA 4JUBA 5DPMA 4E5VA 4X1KB 3IOEA 2WKQA 4Q9AA 2J46A 5ENDA 1TO2E 4HN9A 3ROEA 4RTKA 1Z2EA 1M1UA 1F5SA 2PZAA 4NNPA 3BJMA 5J5VA 3MPUA 4BLRA 1Y4SA 3WLTA 1E2QA 3CKMA 3X1DA 4UHEA 5HBRA 1YRYE 2JJQA 3F2VA 2IU6A 5G0SA 2QTHA 3JRNA 5HM6A 3MUOA 2JJ2D 3A1CA 4FQ5A 3NHPA 4LXYA 4RLFA 3IBYA 4ZRNA 4XIYA 2YN0A 3JAWA 1R6DA 5EIBD 1XAHA 1DIGA 1PNRA 3I6BA 4K9RA 5AHWA 1QPGA 4ZDKA 1QO7A 5BSHA 4YIKA 4J1QA 3WB1A 3WGIA 2F55A 5H1Sc 1O0SA 5F5XA 2V6MA 1R88A 5DLQC 3U3MA 3WHPA 1BA2A 1IXRC 3TLYA 1IQUA 1ISJA 2XJPA 1YK0A 3GOQA 2NWQA 3L7IA 3O4HA 2XKAA 1D4FA 4G67A 5DKFA 4BBPA 3L4KA 5DGDA 2WAXA 1PR3A 4XIGS 4XWAA 4ESVA 3BBPA 2HDWA 2DPLA 2N1MA 1H93A 1GZSA 2J9ZB 3NBQA 1SKAA 4P31A 5F3RA 3E4DA 4WKGA 4IIVA 1BEZA 3IP3A 2C4MA 1HLPA 4WHMA 3KKZA 1QHFA 4LJ9A 4R3NA 2R5FA 4Z1MA 3FPLA 3RG8A 3LWQB 4LHEA 2J3DA 5LNK1 1E2HA 4ZRMA 1S30A 1GG9A 3ZXXA 2OBLA 4GXTA 2W2KB 2XWSA 1EGVB 3DAOA 4CYMA 5L95A 2YQZA 4NY1A 4YJHB 4EPTA 5ALFA 1CYEA 4NNJA 5AK0A 3L0SA 3P5BA 1UK9A 4Y6SA 2ODEA 3U7JA 4B84A 3AJ8A 2OZLB 5EHNA 5F4BA 2QMHA 1R9NA 2FFBA 4RZ3A 1KQ3A 4XWOA 2LR0A 4MAMA 4I5GA 4TMVA 3F49S 1KAMA 4COOA 1JU9A 4MJXA 1KI4A 4NYIR 4BVKA 5FTNA 1WETA 2PY6A 1Y4AE 3H5RA 3GPBA 2AEMA 2DC1A 3LVRE 4NYMQ 4D57A 4HQFA 2YFHA 2V0NA 3MILA 1THGA 4BBAA 4BGDA 1G8GA 3PHCA 1TM2A 4GUDA 1A04A 1AKQA 2H3EA 3N2NA 4M49A 4DA9A 1XA0A 4FN4A 3GARA 5M29A 3GEIA 1R3DA 3KYDA 3A4LA 3EK2A 5DLPA 4BKUA 4BNHA 4F8JA 4XJTA 5DNUA 1YFZA 3P2KA 1M1YE 5J4LA 3OQJA 2AWOA 2YMPA 3QVLA 5HG0A 1O57A 2PRYA 3LHDA 3S16L 2FLWA 3OE1A 1GRQA 4R3WA 2I4TA 3HP4A 2IYVA 4Y9SA 4XD7A 3LI2A 3EYWA 4MH0R 3P9XA 1QYXA 2ZWIA 1RI5A 1FJXA 1FYXA 4XXHA 3CVUA 2F1OA 1UK7A 3EIFA 1XJ0A 4KSCA 4UBOA 5U4XA 4CHGA 5HILA 2WBLC 2P9HA 4EFNA 1R4NB 5AM2A 5IYZB 1D6NA 5JSZB 5LQRA 1BDIA 3IERA 3MOSA 1NXWA 1WIWA 2YMMA 3Q1LA 1VPWA 4G5RA 1GP2A 4BY9E 1VLMA 3P2OA 1L5YA 3CNNA 5L51A 1U7HA 2Z4SA 2ZK7A 1XVLA 2GGSA 4KQHA 4O0LA 1U3WA 1IDOA 4KO4S 1O54A 3Q3JB 3KC2A 1YK4A 1HT3A 3A9WA 3Q40A 5FTKA 3IMFA 2HA0A 2O1SA 4Q1DA 3K0AA 5A3VA 3C6YA 4F4CA 1C1DA 1U9JA 1B15A 4RLHA 5H68A 2O2EA 1M6EX 4PGGA 2XRZA 1CUHA 2X2FA 2VHQA 3KQQA 2XCOA 3L7YA 3X1YA 1SRRA 3TFOA 3CRMA 1V3VA 1JA1A 1UPBA 2B0JA 4NE2A 3W90A 1E2UA 3WNDA 3QZUA 1HE4A 3E35A 4KNVA 1KH3A 2DP4E 3MB8A 5HTKA 5CDTA 4N39A 3AYZB 1Z4MA 1XRMA 4WH0A 5I4KA 1FBTA 3DEYX 1NN0A 3KQWA 3RZ6A 3QI2A 2RK4A 4TV9B 5CTAA 1P4JA 4OK3A 1AV6A 1LTHR 4MS1B 4DGSA 3IDZA 3H1FA 2QU7A 4E3ZA 4B31A 4EQZA 2SHKA 2WWFA 3QYPA 2DT8A 5IUJC 3P0RA 1Z68A 5HTOA 2PCLA 1EZZA 3P9KA 1GQ2A 1OZGA 2QT0A 2WFAA 2OSVA 5B4TA 2FUG6 2C5EA 2X4DA 2ZKIA 4YX9A 2B5WA 5M7EA 3W9YA 2XWBF 5BO5A 3H9CA 2PNFA 2X23A 4X1KA 5FTJA 3BGWA 1TK9A 3P9PA 4EA9A 5LR6A 1JHRA 1N5MA 3L7NA 3MCTA 2VXYA 5AD1A 4KPEC 1Q3KA 4FI3F 3E0XA 3HVKA 1XZIA 1S01A 1RAFA 1H05A 2UVDA 1TGYA 3AR4A 5A9TA 4RVUA 4BCBA 1YDWA 4HWGA 3D1LA 3OLQA 1COWA 2PUBA 3DVLA 1M72A 2XMDA 5LQDA 2GBFA 1EESA 1IRNA 4P5DA 2PVXA 4NBWA 4MDFA 3E9YA 4TVMA 1T2DA 1N4AA 3EAQA 3HUEA 4RQUA 3UM9A 1CKEA 4ZO4A 2WLSA 4HMPA 1XFDA 1QOPB 3MLBA 2BYTA 1UWCA 1E1LA 3NC1C 2Q5CA 3J80A 1QUFA 4P7BA 1PDVA 4MWTA 1P6XA 3VC3A 3GAFA 4PGFA 1T5IA 1L7AA 3P0HA 1M2EA 4DDVA 2BBTA 3LBYA 4UQLA 2JLYA 1XCGB 3WRYA 1OXSC 1SD5A 1LTKA 3PQ7A 3Q3GE 1RHMA 3L4BA 3PFNA 4IDBA 3U81A 3MEQA 2IFTA 5EEGA 1H23A 4LY3A 3WFIA 1JJBA 5AVSA 4A10A 1DBPA 4OQ4A 1YT5A 1YXMA 2WTNA 4HEA1 3ZGZA 3CZMA 3WGYA 3LUJA 4QDUA 1Z2OX 1OTYA 4QDOA 2YNMA 2JI6A 1DIOB 1UQUA 5IM4A 3JYQA 1WNFA 2Q49A 1DFHA 5FD8A 4RHCA 1NVBA 1WJGA 3EA4A 2DX7A 4RSGA 1T5HX 2GAIA 3NAMA 4TLDA 4NF2A 4KHZA 3UK0A 4BDSA 3AFMA 4YC7A 3HOZL 4YMLA 1KTIA 1E99A 4A4DA 1FP2A 2GJAA 2OZLA 1KKLA 4JGIA 2R6HA 3Q8WA 1DWUA 2GCOB 1SBZA 3ZU4A 2AEEA 3HCDA 3IURA 1Z0UA 3RHZA 3UYLA 1O96B 2IL1A 5EHIA 2V7QD 2FP4A 5ICEA 1TYZA 5JASA 4K5QA 1W36C 4UMEA 1RWXA 4JB0A 4DPKA 2QD2A 4MR8B 5JOQA 1IRIA 1SU8A 1PGJA 1XZFA 2QV0A 3E9DA 4J75A 4NV3A 4Q16A 3GELA 4J16A 1NRIA 1IY8A 5BYAA 2ID4A 3QU2A 2GCEA 2F2TA 1K5GA 3QV1A 1QQ5A 2JA1A 1T91A 2GJSA 1IEWA 4CBVA 1OFHA 4D0LB 5JO0A 3QE2A 2PS1A 3HABA 4HFRA 2DSNA 2ZFUA 4OMDA 4O0MA 1EUDA 1QHHA 2O7QA 5KWEA 1IQ0A 2XJ9A 4I1PA 1MRSA 4IGAA 3R9WA 3QIAA 3HNPA 1K4KA 1EVZA 4AJ4A 3T1NA 3RFTA 4PN3A 1A3CA 1GPJA 3MWFA 1M2WA 3BKWA 3I34X 3BGIA 1M8GA 4C3OB 4EMTA 2BFMA 4AJ1A 1C9MA 3RUFA 1C9KA 3ZWBA 5CW1A 2AD1A 3JQAD 4JJ4A 2IH5A 1CULC 3QMMA 4BZXA 2EARA 1XJQA 4QC2A 4BQRA 3PQ2A 4H7PA 3WS7A 2X8WA 3ZN2A 2HX1A 3AIIA 3O1IC 3QUQA 4WXPA 3EUAA 3UAWA 1SKMA 2QX6A 1QS0B 2FWPA 4X8HA 3GRKA 4DQDA 1R8SA 1W88B 3NHSA 1B0UA 3JXEA 2GFIA 2R87A 1Z3IX 2CB9A 4Y67A 4LHNA 4RQAA 5E6RA 4WFQA 1RACA 2IY7A 3GX1A 3K1ZA 5A4FS 2UUBB 1X3LA 2W4IA 2J5KA 3BFJA 3GG2A 3KAQA 2B2NA 2QHXA 2DG2A 4KYUA 5DX0A 3TOCA 2WJZB 1N0WA 2CFSA 3QVGB 4TSFA 4ZKEA 1KVQA 1WD5A 2QZZA 2F1KA 3EXG2 2PLFA 3ON5A 5TQ0A 3TH5A 4IV0A 4RV9A 1P80A 3MD9A 1E6CA 3R8XA 3N8NA 5EINA 1W2HA 3LWNA 1RIIA 5LQUA 1WVGA 5JATA 3KOUA 2P2ZA 1FZTA 3EFEA 1I80A 1AQIA 3PI6A 2HB6A 2EQAA 2QIPA 3GJSA 4GQBA 2FTKE 3PF8A 4IHQA 4Q9KA 5JADA 4QFCA 3C3EA 2WJIA 2KS6A 4GO1A 2V45A 4ITVA 4YYZA 4BU1A 2CJWB 3DMYA 4DMGA 3KSBC 1W35A 1GKUB 3GAZA 1RWWA 1UKZA 1IQRA 2OBBA 3AQIA 3DQQA 1KP2A 2IPLA 4UZEA 2X7JA 3ZV4A 3VMMA 2HFKA 4H7DA 3NGLA 4J1NA 1G3RA 2EWMA 3LCVB 4XA8A 3P2YA 1E3LA 2IHBA 3LCCA 3ONEA 2GJ4A 2FEOA 2NU6B 4L6AA 4P08A 5EJEA 1NHWA 1XYGA 1QMGA 1TOAA 1VL1A 5A3QA 3LDGA 1MC5A 3DZGA 1YKFA 1I3KA 1H2WA 2HNKA 2WU1A 3OTHA 4OL0A 4CCYA 4DDMA 4ZVNA 4QLOA 2Q4BA 2QVBA 5HRUA 4U2FA 1NSYA 3EMVA 1PJ2A 1GCUA 1MQSA 5LXTB 2AQ8A 1R6AA 2WUWE 1NVDA 3HUFA 3GRRA 4CEIB 1MNQA 1WAMA 1JQ3A 4C3UA 1XN1A 1RBYA 4BO3A 3A2NA 3LBFA 3TVDA 3LIPA 4Z2YA 3DB2A 5I9LA 1COWD 2H16A 4RK4A 2YV4A 3MCZA 1DV2A 2YDXA 4OJKA 3W9SA 2BFOA 4EHKA 4LF4B 2R8ZA 3HJCA 5TGDA 2ANCA 4BQEA 3KSZO 1UMCB 2G5CA 2QG4A 4NECA 2XBLA 5F7OA 5EC8A 2PSDA 3CW8X 4E5SA 3RTGA 3PFFA 3CEJA 3WGGA 3F3KA 5FLYA 2YVQA 4JVSB 4NYJQ 1C9EA 4IUBS 1JEAA 1QVZA 4JGBA 3H5NA 1HV8A 4N3CA 4LCEA 4ZP1A 1JBQA 3I9V6 1F2VA