3K35A

Crystal structure of human sirt6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
282
structure length
274
Chain Sequence
b'KGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVCRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase sirtuin-6
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure and biochemical functions of SIRT6.
pubmed doi rcsb
total genus 89
structure length 274
sequence length 282
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.1.-:
pdb deposition date 2009-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3k35A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3k35A01
1YC2A 2VJYA 2IHVA 4FEEA 1PNOA 2OD9A 4IG9A 4Y6OA 4HD8A 5EJ6A 1POWA 2EZUA 4GM0A 1SZDA 4F4UA 5EJ5A 2H59A 2UZ1A 4J16C 5EJ4A 5AHKA 4BN4A 4JT9A 2AG1A 2FWNA 4R8MA 4JT8A 4HDAA 3ZG6A 1J8FA 4BVEA 2FSVC 5MGNA 4L3OA 5EJ7A 3CLUD 1S5PA 5EJ8A 4MPRA 1S7GA 3D4BA 3JR3A 4FEGA 4UUBA 2Q28A 1HZZC 1T9DA 2QQGA 4K9PA 1M2GA 1E3TA 4KGDA 5DGDA 4Q9DA 4BVHA 4QPZA 4X3PA 3CF4G 2VBGA 2A1TR 2IHUA 1Q1AA 5BWLA 4JD5A 1POXA 2B4YA 5MF6A 1V5FA 1OZGA 2H4FA 4UTZA 2IHTA 4Y6QA 4O8ZA 1YI1A 3U31A 5FEMA 5IMSA 3EA4A 2NXWA 1PI3A 3LQ1A 1M2HA 1U31A 1Z8NA 4GM1A 4JUAA 4K9NA 1YHZA 1Q6ZA 2Q29A 2Q5JA 2VBIA 4Y6LA 5K6RA 3D81A 2WVHA 3FSJX 4RMJA 4F56A 5DGTA 4TWIA 4UTNA 2VK1A 4MQ5A 4JU9A 4BVGA 3HWWA 4FZ3A 4BVFA 1UPAA 1Q14A 4L2IA 4ZP1A 2Q5OA 1M2KA 2JLCA 2H2IA 1EFPA 2QQFA 5K6TA 2FN3A 3CLRD 3CLTD 4GM4A 4X3OA 4BVBA 3U3DA 4BUZA 5MFPA 1T9BA 2EZTA 4BV2A 3F6EX 4GP9A 2H2FA 2WVAA 4K9LA 1D4OA 2OD7A 2PGNA 3PKJA 4JUFA 4KXQA 4UTRA 2JIBA 1Q17A 2JI6A 1ICIA 4COKA 1OVMA 2VK8A 2OORC 4UU8A 4G1CA 3RIYA 5EJAA 3IAEA 4K9KA 1JSCA 1YHYA 1T9AA 2X7JA 4JU8A 4RMHA 4FVTA 1PVDA 3PDHA 4JUDX 5FYQA 2EZ4A 1EFVA 3F6BX 4JUCA 4D5EA 4UUAA 2BRUC 1M2JA 3D7KA 1MCZA 2PGOA 3FLMA 5K3SA 3PKIA 2WVGA 1O97D 3ZGVA 2DJIA 5K2OA 2JLAA 4V1CI 2PANA 4UU7A 3ZGOA 5BWNA 1PYDA 3EYAA 1PO7A 4QELA 5DEIA 3E9YA 1NM5C 2EZ9A 2Q5LA 4JUBA 1PTJC 3FZNA 1T9CA 4D5GA 1U2DC 1O96B 1U28C 2OO5C 2UZ1B 2EZ8A 1Y9DA 3GLRA 2H2GA 4JSRA 4RJJA 4UTVA 5EJ9A 3OE1A 2FRDC 1YC5A 4GPEA 1M2NA 2Q5QA 4QQ8A 4RMIA 4IF6A 2W93A 3CLSD 4K9MA 1YTLA 1DJLA 1OZFA 1U2GC 4GG1A 1UPBA 2H4HA 3K35A 2H2HA 2HJHA 5D7NA 2JI9A 1PT9A 4RJIA 2JI8A 2A1UA 4TWJA 2H2DA 4C7BA 1V5GA 5BWOA 4V1CB 5MFZA 1YI0A 1QPBA 1V5EA 1PNQA 2H4JA 4IAOA 3GLUA 4I5IA 4K9OA 4KPUA 4MZXA 4UTXA 4BN5A 1ZPDA 2C31A 4V1CA 3HWX1 1N0HA 1SZCA 2VK4A 2FR8C 1BFDA 2AG0A 1XLTC 1YBHA 4RJKA 3JWPA 3RIGA 3GLTA 4BV3A 1YNOA 2VBFA 3IAFA 4J1TC 2V3WA 1MA3A 4K9QA 1OZHA 4RMGA 2JI7A 4MPPA 4ZZIA 4C78A 1UPCA 3EY9A 2Q27A 4MPJA 2NYRA 2OD2A 5EJMA 3GLSA
chains in the Genus database with same CATH superfamily
1PDVA 1T6YA 2YZGA 1QS0A 4R84A 4Z86A 1GRNA 2G7MC 3GJTA 3R6GA 4U7HA 4YXWD 1N0IA 2IIQA 3QI2A 5DKFA 1JEYB 3OE5A 3K9CA 4NFLA 3BE6A 3ELBA 4PW0A 3RRFA 5EYPB 2V54A 4JC5A 1HE4A 3H7AA 4K6MA 3A25A 4ZGWA 2RHOA 1JA0A 4GU5A 1Y5MA 2NZXA 3IBSA 1RJDA 3KHTA 4RACA 2LKDA 1P80A 3S2UA 1CUFA 2G3YA 3KYCB 1NXQA 3ZDAA 1A95A 1CEQA 3GWZA 1YBVA 1ZI9A 1RE1A 2FF7A 5F77A 1T1EA 3WKDA 3CB2A 5IP7L 4MQBA 2YIDA 2L0ZA 3QEKA 1JU9A 4EYEA 4KQEA 4YUYA 1F7UA 5G02A 3JQFA 3V9AA 1TZKA 3B08B 1BKYA 1PLJA 2ERYA 2PPVA 4G97A 2MTBA 3BREA 4CCAA 4C89A 1IY8A 2NTVA 1T5IA 6AT1A 1ZYUA 3OECA 2FGKA 2UYOA 3ETCA 2WKRA 4C4YA 4N18A 4ZDKA 3PHHA 1W5TA 1ZVQA 2L69A 4H4DA 1VE5A 1MXFA 4N3GA 1PEDA 5FULA 5K0FA 5L6LB 2WAXA 3B60A 2DY1A 3LWQB 2TS1A 3IBYA 4GO1A 1PGPA 3WL7A 1DVRA 4OI1A 1PT7A 2WHRA 2VT2A 3N8DA 4IXWA 1SCDA 3KKNA 2ZYUX 2R0QC 3JQDA 3KYIB 4JUFA 2J33A 4HWKA 4OAQA 1QFZA 1KEPA 2GBLC 4Z49A 1ICIA 2XADA 4M9UA 5F5NA 1UDXA 1EP2B 1OIVA 1RKVA 4IWXA 4DWJA 5JQGF 3K31A 4QBTA 1HSOA 3Q87B 5H1Sc 3P0JA 3FVQA 3MAAC 1BMQA 2QLBA 3LCMA 4WZZA 1X7XA 3JQ6A 3GTKL 2BRUC 3GCGA 1EAYA 4Q7QA 1GCAA 1NFFA 1N2IA 2DJIA 2X9NA 1O5OA 2FPMA 3DBOB 4EATA 3L0IB 1ZHOA 4E1VA 3T9EA 3I5UA 1ZXBA 4EFLA 4I1IA 2JH8A 2WA1A 4M9CA 2PZGA 4PG7A 4QKQA 3CR7A 3ZW8A 5JSZA 1FYXA 1MMFB 4IYJA 1Z5NA 2R44A 1CADA 4H16A 2HTEA 4QTUB 1XJ5A 1WCIA 1A82A 1N6OA 2GAOA 3PUKA 4YJ2F 1UZLA 5MHTA 3SG0A 5K1ZA 4ESHA 2JIZA 3CCCA 4ZYYA 1BH6A 1KOJA 2XPCA 2NT4A 2Q5QA 1XRPA 4HQ6A 5DI3A 4TXLA 4XUEA 2CL5A 3JS5A 4NG4A 5GJBA 3CONA 4PN7A 2AW3A 3A10A 1ZIPA 3I2YX 4XIFA 5FQOA 4FYMA 1M2EA 3OEEA 3RVDA 3ZJ4A 1N2JA 4BY9E 4QGHA 3PXCX 3UPUA 1L3IA 2IYEA 1P3DA 3K9NA 3ZHCA 3ZPXA 3HKCA 5BV0A 1RI2A 2RCNA 3ZHOA 4NV1A 1A7UA 1VKJA 3FF1A 3GIWA 3AW9A 4JJKA 4PLTA 4IDHA 2CWDA 1EUCB 1LK5A 1LC3A 1RWBA 4KUHA 5KSPA 5HXAA 1W35A 2Z6AA 4R68A 3TRHA 4CLHA 4WBNF 2O3RA 3V7NA 1PR1A 4OI2A 5MN6A 4WEOA 5C53B 4LA4A 1BVYF 2RGYA 3K7EA 2AEEA 1EK1A 4TTAA 3SHVA 5CB0A 1WBBA 1DGQA 4ER7A 3M4NA 1TM2A 2EKDA 1UK9A 4E14A 5L4NA 1EXVA 1B0PA 2FR1A 1NTRA 1U3WA 3TZKA 1YOVB 2DSNA 4JQZA 5FA5A 4DPLA 1G6KA 2B5WA 3KQMA 1R0YA 4ITRC 2RHTA 5L95A 2OBFA 1IBSA 3CW2A 2PHZA 4P53A 3K70D 1IUPA 2PX6A 3PF8A 4CLXA 2ZRAA 1JSXA 4RULA 4KWEA 4M1TA 4PG8A 2C82A 4RQTA 4AN0A 5JH7F 4AY5A 2RFLA 1PR5A 2ODBA 3WO0A 3EXIA 2HQSA 5DM61 2MYTA 1OYYA 4URHA 4PYQA 1KAMA 3OA2A 4RLFA 4X1KB 1N9GB 2OYSA 2PXCA 3O1HB 4QBGB 2GN8A 2PYDA 5E1BA 2Y0DA 5E6SA 2HUPA 2QX7A 3O4HA 4KV9A 1HLGA 3SXJA 3I9MA 2PU7A 4MIEA 4N0DA 1DUIA 3ZVRA 3DF9A 3T3DA 4H9GA 3GNTA 3KVNA 3QHPA 3RTBA 1Q0SA 2P6MA 4IV5A 3MJRA 4XH9B 4MV8A 4P7FA 5I8WA 1YIOA 2G67A 1CUSA 2PKWA 1BH2A 4ARIA 3Q9UA 3UA4A 5CA0A 1Q11A 5HCUA 3UOGA 4OFXA 2GN4A 2DM6A 1U90A 3NB0A 4FE7A 2JGKA 3VPGA 1YDFA 1T4GA 4EI2A 3ICWA 3LCRA 2FPGA 4QL3A 3TSZA 4Q9NA 1FDVA 1TVCA 3GPLA 2AE1A 4Q9HA 1DINA 5B37A 1S6YA 3QKSB 1CZOA 3I8XA 1QV7A 3KRTA 2F7SA 1E98A 4H31A 1BMTA 3RJTA 1FDTA 4YMWA 1OLSB 4CL3A 4KXNA 1C9JA 3OO0A 2ORVA 4ZU3A 4I5EA 1XCJA 4RY2A 1G7CA 3OE7D 2PT7A 2XD4A 2HZBA 1BGXT 2PCLA 4CLOB 3VMMA 3BGWA 1GAJA 4D8YA 5FYQA 3HL0A 4PS1A 1Y6GA 1J5EB 2X8LA 1RLUA 5IJZA 1R1DA 2VLBA 3I2IA 5DWDA 5A0FA 3LBAA 4NJOA 1NMSA 4BE9A 4EGQA 2QTAA 5IN4A 1KERA 4AMVA 5L45A 2QIOA 4LDZA 4R05A 1MVNA 1PJBA 1WW3A 3F0TA 4EHFA 4I1PA 2WTMA 1NUPA 3ZHSA 1U1IA 2B37A 1BKDR 2NUAA 1DUVG 4N5DA 4CDNA 3BXZA 3O8OA 1XC7A 3TXAA 4G9GA 4L85A 1JU4A 5HK8A 4CIVA 3IIKA 3N59A 3TLGA 1ZCJA 3H04A 3LUJA 2QRLA 3HRKA 4O1IA 3WGVA 1V0JA 1G6HA 3ZU5A 3HDQA 2B63L 3E7DA 3KB8A 2VRCA 4GZMA 3ZXUB 3SM3A 2JA6L 3PQDA 4NLLA 3OQOA 3MYYA 5KWVA 3GGOA 4KCGA 2GK4A 1UBKS 1CDDA 1YAJA 2GDJA 2VBCA 4LYDA 2HBQA 3JQ8B 2CY0A 3AL3A 2JIPA 3O1LA 4ZT6A 3ZWPA 3FNRA 5D51S 3WJ2A 1RWMA 5FADA 4HXYA 1JPJA 3PNPA 4D9MA 1PFWA 5C8ZA 4EMBA 4Q4LA 1E6CA 5IN5A 1A9OA 1XWIA 2FP4B 5JS2A 1W87A 5E3IA 1NF8A 3PT5A 5DCWA 3GDHA 4ID9A 3FPEA 3C3EA 1Y42X 2FSHA 2NO4A 4C78A 2JHAA 4H17A 4RGBA 2X5XA 4YMSA 2F4NA 4ZHQF 4Y6PA 5C7IO 3P5BA 3ZD8A 2QKYA 5BOSB 2GUWA 4V2IA 3FCOA 2NYVA 2UYYA 2AFIE 5G2OA 2BSXA 2YHIB 1EK0A 5EJ5A 3E70C 3I58A 1N5IA 4UVHA 2GZDA 2UZ1A 2PMCA 3PEWA 1GGVA 1QFXA 2FWBA 3CQZL 4WAUA 5CW2A 4OB8A 5IAKA 3LPCA 4FYVA 1XZGA 1HFWA 3A3NA 3P19A 3EWNA 4WOBA 4N3BA 3CFYA 4EPRA 3KKLA 1HT2E 1R66A 4WLFA 4X7RA 3ZDZB 3ZH2A 3M4ZA 2QR2A 2PQ6A 1BCSB 2H5JA 1JIKA 1EFTA 2DBYA 2FW0A 2OCLA 3DAFA 2R6DA 2YQZA 1PRYA 3L02A 1JG3A 3NWBA 4PSAA 4QPZA 3FTCA 3NJ8A 3P0EA 4EF5A 1V8ZA 1M0SA 2NTJA 4RIIA 2C77A 4G4IA 4UOQA 3AU9A 2Q5HA 4JD5A 5IDWA 4MOWA 2OWDA 2EIHA 4FIZA 1B8OA 1FSGA 2AFIA 5L6MB 5JU6A 4MA5A 2YWDA 1HOXA 3UPTA 4U6SA 3ASUA 4UAVA 1ABBA 1HEIA 1Z8NA 4MCIA 2I2AA 2Z1MA 3LT5A 1KAOA 1Y9EA 3UCFA 4IH4A 5IWCA 2ZI7A 3FSJX 1GEEA 1SVIA 4I5DA 1YJ5A 1ZJ4A 2DPHA 1GPNA 1KZ7B 5GM1A 4OXNA 1DXQA 1EFPB 3PZBA 5JCZA 5LYJB 4RGQA 3UEOA 4C7JA 3LQYA 1MRSA 5TT1A 2JDID 3RYHA 1SUCA 4KBFA 1ZSNA 3SNKA 1NQWA 5EZQA 4A93L 1J22A 2WUDA 1JR3A 5FHQA 2HC9A 1B8PA 3PWTA 4EBFA 3NFYA 1T2NA 1YE3A 2W71A 1SA0B 2ZYDA 2IXFA 3A4IA 1JPNA 3JAKB 3T5GA 2C4HA 2YFQA 1JF8A 1FDRA 4BLUA 1U8AA 1XJCA 4N7RA 2WPDA 1DQZA 5TJHA 1RLJA 1G66A 3FCXA 3LP6A 2PUAA 4FMDF 2YN0A 3I39X 5CMLA 1T15A 2FEMA 2LBPA 1U9YA 2QJTA 3LZ6A 1XD2B 3IS3A 5E3JA 2PL5A 4C5CA 3AVWA 3UT0A 1R0BA 2YNMD 3KWMA 4X24A 4TYMA 1N3IA 4X45A 1TADA 4BS9A 1B2RA 1OHHA 2LV8A 2QQ5A 4MYCA 2W11A 1ODFA 4TUYB 1J9EA 5DO9A 3P2YA 3VPAA 4QHYA 2VJOA 4ZICA 4DDWA 5K0TA 2FWRA 3B1YA 3WGKA 3CX8A 1RP1A 1PR6A 2OCYC 2OZEA 2QMUA 2QY9A 1GXSA 2VUTA 3QVOA 4DZRA 1PZGA 3MWYW 5FUYA 3UICA 1EXMA 1QH1A 5JD3A 3TG2A 2K7FA 4EH1A 2GTPA 3JZMA 1V45E 4M49A 3GAZA 2ZJYA 4YDQA 3KR0A 2VL7A 3Q8WA 1C4KA 2RAUA 3HE3A 3LTEA 3QYFA 2DKOA 4F4IA 2OBLA 4KU4A 1M76A 2NUAB 1JBKA 2OQVA 2ZJOA 1MV8A 4B75A 2B0CA 1NW8A 1XELA 3W7VA 4G85A 4FONA 3HKDA 4IOKA 1KC3A 3CUTA 4A2CA 1NMZA 3O9VA 5FNZA 4AVYA 1FRZA 3QV2A 4O3FA 4DYDA 5FWYA 1ODIA 1G16A 2V6MA 4LRYA 3H2JA 5H3LA 3T06B 4RTRA 1GN8A 2QN1A 2G76A 2AJCA 3S1SA 1AZTA 1Q77A 3L0DA 3LYLA 3NGLA 5DCYA 5JVG1 1R9NA 3GFGA 4LXQA 3UY4A 3TW6A 3DMGA 1D2AA 1SBYA 3RGWS 3NONA 1T9KA 3JTMA 3TIVA 2X3YA 1EVJA 1RKQA 4IV0A 5AUPB 5FTJA 3LC2O 2COEA 5SZIA 1WPRA 4MVXA 3BE4A 2LTAA 1UBTS 3VR6H 4M21A 4PPNA 5J2TB 4R1PA 5LA6B 1ECPA 3DUFB 3FUXA 4PZPA 3WLTA 1K98A 2MYUA 1BWQA 3RTGA 5J4VA 2QVBA 3VVLA 1QHXA 3QQCE 1ATIA 1CVRA 1S01A 2VSYA 3IQEA 4E08A 3AF4A 1WHTA 3UB2A 4DUYB 1SCQA 2GAJA 1PT6A 3RS7A 4A3IL 1NI5A 1FNBA 4WY8A 4DDUA 2X9LA 1N78A 1L5QA 2I7CA 3GA0A 3QXXA 3AG5A 4BU1A 2DPGA 3B82A 1A3CA 3HTXA 3ZD6A 4P3YA 3QLUC 5GM2A 2ZIGA 1WXEA 2QM7A 5KOJA 2O20A 1KGDA 1H4QA 1IQUA 3PQ3A 4BQRA 5IWAB 4YALA 1IHYA 1MAUA 2ZSBA 4Y6LA 4KWCA 4NU0A 4Q02A 3RSOA 5FR2A 1IEWA 5CXXA 2HW8A 3NETA 1MHPA 5H80A 4OSOA 4MJXA 4X63A 1UJCA 5LMUB 5K0JA 3VKGA 2POCA 2JLXA 1IQ0A 1G41A 3KOOA 4G1EB 4JASB 3VR2D 1G7SA 3WHPA 5CXQA 1UP6A 3AF6A 2G83A 5H5JA 4NV3A 3E5HA 1FEZA 5KBYA 3G2QA 1E9CA 1X70A 5HFJA 2C83A 2E1PA 2WVAA 4AZ3A 3H2ZA 4PZAA 3EX7C 1QGDA 5C46F 5HJ5A 1WMSA 5FLXA 5CJJA 2CF5A 4MYSA 4V0NA 3A2NA 1BOFA 1E9RA 5B6JA 2PUCA 2FHPA 2PUGA 3UGTA 1FNMA 4Z7JA 3BK2A 2YS7A 4TL7A 5E95A 3WADA 5JY6A 2ZVJA 2QM3A 4KQJA 5JNRA 1NQVA 4KQMA 4XUDA 2HPAA 4V1CI 1YIDA 1FU4A 3UXHA 221PA 4OEHA 1TJ4A 3K6SA 2NZUG 3WGNA 2GQ0A 4AULA 4L07A 1Y6ZA 4NL4H 4WNCA 1KEEA 1ML4A 3DNFA 3L4BA 3DP9A 1FVFA 4WADA 3GXBA 5F5LA 3K0FB 2CJXA 1L4LA 4JJ7A 4BNYA 5A5GA 3EIHA 1RMTA 5LMCA 1GWNA 3AERA 1BE1A 1RYTA 4OREX 3FLBA 1XLVA 2BGMA 3U7JA 1CJTC 4DZZA 1XTRA 3HCFA 4ETWA 4DM4A 1MW9X 4Q37A 2V6JA 4AO7A 2V7TA 3DLAA 5IKXA 4CM5A 4LFAB 3GRYA 2PKEA 1NT2A 4PXSA 5D5QA 3L41A 3VKWA 2ZBRA 5FNVF 4JX8A 1BN6A 5EQFA 5F1YA 1KORA 2AN9A 2O23A 1JDVA 1N0HA 5AKZA 2W4MA 1Y7LA 2HSDA 3AU8A 3MWKA 4RM2A 1BE0A 2YWFA 3ED1A 2KJQA 3FJYA 2GS9A 2R6GA 4M76B 3F6PA 4AS2A 4BB9A 1IN1A 4NCHA 2XVXA 2WZQA 4RD0A 4ZVNA 4HC4A 3HY4A 4TTJA 4ZO8A 3OTOB 2WPNA 4AYTA 2HA7A 2R8ZA 2VVTA 1WU7A 3OZEA 3PD7A 2Q27A 5FL3A 5IYCL 4DM7A 5AJYA 1NZFA 3LWRB 4XWAA 1I32A 3KFLA 1GL6A 1Y9JA 3E5MA 5CFMA 2I91A 1QH1B 3R3SA 5HR5A 1T36A 1U6KA 3BGIA 4BX9A 4UM5A 3NUQA 5DHTA 3MPSA 3C3BA 3CURA 1W88A 3NTLA 4BBJA 1XJWA 3IDQA 3EPRA 3IT0A 3OD5A 3U7QA 2XTMA 3WL6A 3VH2A 4L0CA 1AUOA 1XQYA 4H7PA 4D9HA 2G9VA 4LF7B 1R8QA 2PSDA 2Q1UA 3PUHA 2HJWA 4NNOA 1W5EA 2BV3A 2ZQ5A 1T24A 3JD0A 3MQ4A 4OFBA 2Q1SA 2J30A 16PKA 3O26A 2G0AA 1GV1A 2BM9A 3UXMA 3WV4A 1R3DA 2GEJA 3LKVA 4LVUA 4DCSA 3O3CA 3HJNA 4MWSA 4WSOA 4RD2A 4OK6A 2VTBA 1BIFA 1T34A 2ACWA 2FZ4A 3GVCA 2XWQA 1N3YA 1Y7PA 3BK1A 3TLCA 3R9XA 2YOGA 4BKPA 2BGLA 1S2ZA 3GEHA 4R1QA 4Z2YA 2GBGA 2Q4OA 3B1WA 3PHGA 4K6GA 3SZRA 3ZWVA 5KVAA 2C7BA 2E2IL 1UJ2A 1L5ZA 3P8ZA 4JNKA 4MR9A 4RELA 3WIVA 2WBLC 3IEIA 4ZKDA 3GDGA 5FJJA 5BQ5A 5KOIA 4CIYA 2A14A 3G5MA 1GARA 1GKUB 1Q14A 3PNBA 4ZAFA 5F64A 3BEOA 1ZL0A 2DJ5A 2NP7A 2F1HA 3MGCA 5KNCH 1NVGA 3UC9A 5ITWA 5LCXA 4DV0B 3QFCA 2H18A 5A05A 1XUOA 3T3PB 4QM7A 1VCOA 1QBGA 5L3SB 1ACJA 4K9RA 2I8AA 3TL2A 3HBJA 3BBLA 2PGLA 3D6JA 3H3VM 4Y7NL 1G6Q1 3SEZA 2XUGA 4RXNA 4IDBA 4YPFA 1P4JA 3G8DA 2IITA 1YVDA 2VAWA 4GVLA 4URWR 3WQRA 2G25A 3L46A 5IDYA 4C20A 1P2BA 1L7EA 2ZIWB 3AY6A 1I5EA 1GGMA 1T3LA 4OUDB 3ZE0B 4HGRA 5A03A 3RYGA 2F59A 3NU1A 4JEHA 3GLFB 1OV4A 1KQGA 3K6KA 2VYFA 1GUYA 1CZUA 2UVDA 1U98A 3E9YA 2P4UA 4BB5A 5KHLB 4NZZA 2XGMA 4OI0A 2GF9A 3SJBA 1VHTA 4MWOA 1I2BA 3VHXB 1RPZA 4KPGA 2K4MA 4IDEA 4P0PB 1DLJA 3QU4A 1NLMA 1UMDA 8AT1A 1OLSA 5B58T 2YIJA 4IOJA 4LCBA 3ZXYA 5DI3B 2AS0A 3OURA 1CUGA 2OLEA 4MI9A 4B2LA 1UFQA 5BR7A 4KLAA 5LU9A 3WBKA 1VMDA 4PHFA 1E7MA 1PHRA 3A11A 3G0DA 1E2GA 2H4HA 2JAPA 5GPBA 2G1PA 4A3FL 1DPGA 2JKVA 4FLEA 4KREA 4B6SA 1QPZA 2WC1A 2EFJA 2AJLI 421PA 3SVLA 4JODA 3HLYA 3WTBA 2BOVA 1WUYA 2VEDA 3ZZUA 2OHOA 3AM1A 3EC1A 2V98A 4V0ME 2VATA 2VQ3A 5DSXA 5KYYB 4JV5B 2PD4A 2QUHA 1SK8A 2ALJA 1LLQA 4OP3A 2WINI 3NATA 5DVZA 1HE2A 3QSYA 3QF7A 3MMNA 2KQUA 3PR1A 3PQ4A 2RHMA 2XGGA 3A4VA 3O1IC 2V3WA 4LBYA 4LJ8A 1CVIA 3I2KA 1XSEA 4BFWA 2Q3JA 3ACDA 521PA 4OLAA 4UBNA 4I1SA 3B6JA 2ENUA 3B5IA 3NTRA 5AXCA 2BLLA 4JA0A 4MDFA 3GLSA 2R8XA 2QAGC 2VJYA 1L1QA 3EVZA 1BQ8A 2IYZA 3R24A 1BD3A 4BYMA 4YRMA 3FJOA 3SSMA 4AIRA 5KSOA 5AVWA 2JJ2A 2Q07A 1W9HA 3W9BA 3GNQA 3HB5X 3KLBA 1P1FA 5IHXA 4B79A 4IIEA 3TRKA 2WILA 1TWCL 3GA5A 4WVLA 5PGMA 5M3FL 1W0CA 5BN1A 4XJVA 4WOJA 5A71A 3HFGA 5JS7A 1EFHA 4RK6A 4CBVA 4CMGA 4F38A 1B71A 3GPIA 4IGEA 1N5JA 4DJJA 4HNSA 3DL0A 3HA2A 4HWTA 1L5NA 4PNZA 4MINA 1T36B 1ZX1A 1TTHA 2FEWB 5I9SA 4DZTA 4EFKA 4EHJA 1FFBA 1I3OA 4JAGA 2PJUA 2RC6A 3NHLA 2JARA 2FTKE 5C4IA 3JD4A 3Q5DA 3WK9A 4PQYA 2NXWA 3OT1A 4B47A 4KR9A 4F85A 4DLRA 5LZ9A 4KHPB 1U04A 2PUJA 5JANA 2AOTA 3PG5A 3PITA 3Q2KA 1Z6XA 2WJ3A 4HN9A 1N2ZA 4IP0A 3NM6B 4AYXA 3P9PA 1WXFA 1BW9A 5HPYB 2I76A 1U0SY 1MOQA 1EVLA 3SD7A 1QANA 4MW2A 3G3EA 4NP6A 2GVNA 2UAGA 3EA0A 1BNCA 1QYRA 4HVAA 4RANA 1ZNXA 3CLTD 3AIOA 4W5TA 3PNKA 3SX2A 1I30A 4OHMA 4ESVA 4TYYA 3BB4A 1H2WA 3ESDA 4FFRA 3BORA 1OAOA 4EABA 5KTRA 1ZUNB 1EKXA 4P5EA 3K70C 1T2DA 3L8FA 2AFVA 3VTFA 2PLWA 2GM9A 3TZCA 1G2QA 3PL5A 1TUIA 3G7SA 2GPBA 3INYA 1GG2A 1YHYA 5I9NA 2IBSA 5ALNA 2PZJA 3MXTA 3A32A 2ZATA 5CGQB 1ZITA 1FP4A 1H6AA 4WESA 5G53C 3OCJA 3TFWA 2IUYA 4RS3A 1MW8X 1CW2B 3K20A 2UUOA 4B35A 1Q1EA 1ITZA 2J3LA 2FW7A 4PYKA 3IUQA 3CRW1 1K27A 2GJSA 2I1LA 2II6A 2O1WA 1OYVA 4UD6A 3ROXA 3HDTA 1T3GA 4D43A 1R50A 4DW8A 5IVKA 3NXSA 2YU9L 1TVKB 2CXTA 2A4MA 4ND3A 4RL4A 4O2BB 1ZLYA 4GXNA 3O82A 4IDPA 1UKZA 3M6FA 1U02A 3BH6A 4OP2A 4A8PA 3MCAA 1YWGO 2IEBA 2PSEA 3RIEA 4C08A 2Q2QA 5EZ6B 2ORYA 2FCRA 3HU5A 5L9AA 3IERA 3PHLA 4GPBA 2GPTA 3KK0A 1E9SA 3AUAA 3OPYA 3INGA 2QTNA 1TT7A 4IMJB 2I5PO 2WYOA 4IOLA 4QEKA 1N2CA 4WI1A 5G1OA 3TVTA 1VCNA 1BOOA 2EYUA 5EGSA 5JWOA 1YI0A 2V6IA 3OIWA 1NKTA 1R0GA 2ZWOA 1PNQA 2OAEA 4J43A 4RF5A 4GOLD 2JA2A 2M1ZA 4EFNA 4CG3A 2VQSA 2R6CA 3HLTA 1MT0A 2J5KA 1BS2A 1TZJA 3TLZA 3PFGA 3OBBA 5BR4A 4Z4IA 2YRXA 3G0CA 1ZMTA 1GZVA 1ZD8A 2H65A 2XVAA 3SZLA 2KSQA 1S7CA 3NH9A 4JIGA 1QV6A 1I6MA 1RHUA 4X1IA 2OFOA 1L5LA 4YUAA 4NDNE 5A4IS 3UAXA 1NW6A 4OQNA 2ZCUA 1I7QB 3RSLA 4ER0A 4URYR 4HAXA 1IQPA 5ALLA 1XP8A 4J0QA 2EDAA 5AW5A 2QB5A 2P9EA 3A7EA 3GCDA 1B1AA 2NXCA 4JLUA 1NY6A 4RHTA 4AL4A 2IOFA 2WK1A 3OZCA 2IPNA 4FNGA 1FMLA 1WXXA 3VR3A 1M6HA 1X74A 4BZZA 1M1UA 3AEKA 1LV8A 4OAPA 1C3JA 1I2ZA 2CXHA 5ALRA 4JI6B 2XBMA 2H1HA 1JKJA 2FSVC 3EEIA 2QL6A 5I01A 5D6NA 1E9AA 3GY0A 1HX7A 4BO1A 2H7CA 3KKOA 4ZREA 3WLIA 5JJKA 4EUNA 2BEWB 3F5DA 3NZEA 1ZHHA 4B3RB 3CZQA 4HGNA 2ATCA 3H9GA 3S70A 3E9RA 4BATA 1U94A 4KIJA 4GL2A 1V7CA 1NX6A 1XA4A 2YX1A 3BFJA 5I51A 2HHJA 1DEXA 1S89A 3FUWA 1M0WA 4OLJA 3CVXA 2PUBA 3UO8B 1N1DA 1YF3A 1R0FA 1NJ8A 1NXVA 1C2YA 1M8FA 4RK7A 4MQ4A 5ALMA 4Q3EA 3RHSA 2Y27A 4QUKA 5F9FA 4S1NA 1SU6A 1VJCA 2P5UA 3MSXA 3EPHA 4FYYA 1FFWA 4NU6A 4NCJA 4DLTA 4K05A 3VHQA 3RVOA 2I4LA 3AJ8A 3G2PA 3IXLA 1JFRA 1Z0FA 3ZWKA 1UMBB 3IOYA 3DE5X 4H7KA 5IUKC 1NW4A 1XEWX 1ZBDA 4DV2B 2ZW9A 2FPPB 2O2XA 3V4FA 1JHYA 3OICA 4G5RA 2YY5A 4NI5A 3LA6A 4U7FA 1RZRD 3ANSA 1VGVA 2VK8A 3NYIA 2JAOA 4L4ZA 5JDCA 1TQ8A 3GPCA 4RWZA 1UEJA 4M99A 3QFSA 1AQ6A 4N5IX 4Q01A 5F4ZA 3ICCA 4A6DA 4AUNA 3WB9A 1PWXA 1Z0IA 1AQNA 5HIIA 2PRKA 1L7MA 1T0IA 2EWVA 3KUKA 3VO9A 3TOZA 4F7DA 4X7BA 3VJLA 1C5KA 5HFAA 1D3AA 3G2MA 1LS6A 3TD9A 2JCVA 4KQWA 2FP3A 1PQ4A 2AG8A 3VOSA 4BLWA 2FRVA 1B3BA 3CF6R 4JOSA 5DW3A 4DCVA 5LQDA 1ADYA 2OXFA 3KTOA 3NG1A 4US2R 4AWXA 5DTEA 5GONA 1JG6A 4KHZA 2DAPA 1G1AA 1XYYA 3T1YB 3SR3A 2O48X 2D2FA 5ETJA 3KB6A 1QS0B 3BTOA 1YVUA 2CK3A 2ZUVA 3D5QA 1K06A 2GPAA 1QWSA 2PFGA 1NXXA 3JASB 3RYIB 5AICA 3WHIA 2J4FA 1JL3A 4PGFA 1UANA 3B0AB 4GYYA 4CM8A 4CKWA 1JAZA 3RIHA 2IP2A 3U17A 4FI3F 3CR8A 2JI8A 2XX3A 3A26A 5KMGA 3PCXA 2GAFA 4C88A 5CB4A 5I8PA 1BCRB 2IL1A 2M4YA 4KXUA 5E4JA 2CVOA 4QARA 4TS3A 2YR0A 4GPTA 4BQOA 4EA8A 1RPJA 4Q34A 3L4SO 2D8MA 5T7BA 1A4IA 1IMJA 3ORFA 5AK5A 1NUUA 2QTRA 3F7MA 4Q9IA 4WZAA 4WKBA 3CNNA 3UW3A 1LSSA 2FR8C 3HADA 1XTZA 5TX7A 1DXOA 1Y1TA 3QW4B 1U7XA 3HP1A 4ALIA 5KYWA 5JZ9A 4G1BA 1B41A 2GPYA 1BWPA 4IUCS 3W77A 4DLKA 2FG6C 2O6HA 5BN3B 3L4JA 3ST7A 2QXTA 5C1OA 3I4NL 5FL7D 4AZSA 3T1VA 3WJ1A 1Z29A 1KMMA 1R8JA 1IULA 1T2FA 1Z5WA 2QE7A 3CVOA 4C3UA 2DWPA 4A9AA 1Q57A 2IH5A 3B3AA 4ARZB 4O3MA 1ZCAA 2YKGA 4QM6A 4JS0A 3TSCA 3HBLA 2ATEA 1U1DA 2BISA 1GDDA 1QVZA 2CUKA 2EX1A 2VQDA 2VPYA 3BWXA 4M1OA 1FDSA 4MR8A 1TECE 3WLPA 1WZEA 1K63A 1S5PA 3RLIA 4EGSA 5IFLA 4M83A 2I80A 3HRIA 4MS3A 4CKBA 2V5UA 1F5NA 4II3A 2O9JA 4C4TA 3KPWA 1WDKA 3OX4A 4I9GA 4QU5A 2A9PA 2BEUA 3L79A 3KKQA 1B74A 3BCSA 4S1VA 3TUIC 4EF6A 2ZJ3A 3ZIAD 2E18A 4KXWA 2V9CA 3WLSA 5SYMA 5TPZA 3R7WB 2JHFA 2Z5LA 3FBTA 1J8DA 3LZCA 4W7IA 3M5DA 2NU9B 3IBCA 3BK7A 4XWOA 1L8AA 3M8KA 4NDAA 1M34B 4OHUA 4ZRMA 4D4MA 1G3QA 3WYGA 4HAVA 1E1KA 1YZHA 2ORIA 4LYEA 3EW9A 2VZ0A 3PX2A 2VN8A 2ZUUA 4RTSA 2VJMB 2I34A 1KJ8A 3K53A 3L8YA 4QYWA 4TTQA 2YJ3A 7YASA 5A9TA 1A8IA 4C7XA 1U3FA 2I6GA 1Z7GA 3E05A 1N6RA 2PFSA 3OQBA 1T9BA 2P6PA 5CGZA 1EM6A 2VYVA 3OQMA 3DO6A 1GTMA 1M6VB 3EBOA 1UBHS 3HJYB 1QF6A 3RVSA 3R3WA 3HXKA 3QPVA 3KZCA 2ZOSA 3S1NL 2FPSA 2NMVA 1A9PA 1RIFA 1WXDA 4HTFB 2ZRLA 4L51A 3U1BA 1CU1A 2WWFA 4ZOEA 2R3SA 5JHHB 2EZ4A 4JELA 4BGEA 1Y3FE 4LRQA 2V9ZA 5REQB 5TQ2B 3TBHA 5BYAA 4DNPA 1U8YA 1XZQA 3LHKA 3TXXA 1H0KA 2XYVA 5IEBA 1ZG3A 2VNIA 3FMVA 2Y68A 4RKEA 3HBFA 1M6WA 1WUKS 1SD2A 4IYRA 3H2SA 2K6GA 4ZQIA 3SHFA 1VQ1A 2FFJA 2PLFA 1SBIA 1XVTA 3SHQA 3NIFB 1JILA 4CTOA 1T0BA 3CZCA 3K32A 3PA6A 1SKMA 2P2GA 1XOIA 5K3FA 1AZLA 4RLSA 4DUPA 1A9XB 1RMQA 4LYJA 1QHIA 4GMDA 1I01A 2ZB4A 2VR1A 4TKZA 2AMJA 3Q3HA 4YJ3B 3RASA 1E7WA 1ZSVA 3OLQA 5DGXA 4CQNA 2A88A 4J7AA 3JARA 3QEMA 5CLIA 5FNVB 2J67A 4U7JA 4Z0TA 1E2DA 2VNHA 4H4CA 1EX1A 2PZ8A 4P4GA 3RU2A 3UJHA 3U7FB 2CFIA 4X64B 1SMKA 1IPEA 1O6CA 1JVSA 4Z9FA 3ZE6A 1PK9A 5KDOA 1KOGA 4D8VA 3ODPA 1J5PA 2P8JA 3EQZA 3PDJA 5TC4A 2P0AA 1UDBA 2R62A 3MPOA 4AM8A 2B35A 3QUAA 4O4HF 3EVCA 2O0JA 2VK2A 4MGKR 2Z8ZA 1T2AA 1X19A 4H6WA 4P83A 1XDWA 4Y7CA 3TIGA 1TVMA 3LO5A 1XK6A 3GFRA 3L4KA 1PG5A 1V1RA 4BO0A 4UMFA 4P4SB 1RHKA 4UCFA 2NU8A 1OY1A 2YWEA 4KVFA 4NTZA 4C6HA 1DIOB 2GYYA 2N0SA 1GKKA 1K83L 2PGDA 1GSHA 2GRUA 2O3UA 2ZR7A 3M5WA 4R9NA 4M22A 1PGOA 1Z07A 3HXPA 4NZ9A 5KAPA 3QBTA 3W5IA 2D7JA 1N25A 1YZFA 2DFKB 2IHZA 1Q0QA 1UXHA 2QTLA 1B0ZA 2WI8A 3DG9A 3HXLA 3VFDA 5A6SA 2XJRA 2HEGA 4J16C 3O9ZA 3QTLA 5CLJA 1WABA 2FDCA 3ZW7A 1U8XX 4ZI2A 1QQ6A 1E6MA 4DLNA 3C3XA 1J8FA 3H7IA 2JCGA 4B3MB 3NDPA 3O21A 1OWCA 2P5YA 2NO0A 2VXCA 3Q7PA 2WUWE 1X2BA 1P8AA 4O29A 3U4QA 3NHJA 5TARA 2KLHA 2JFZA 3QUTA 2QYTA 5AM0A 2HCTA 2P2YA 4AW9A 1FFEA 3IXQA 2RHHA 3EVFA 1O4WA 5CVUA 2PUFA 4H7JA 3ORYA 1GG8A 4HNHA 1VBNA 4LKRA 3DVQX 2C61A 5KKAA 2Y4NA 4AR4A 2I7TA 2RBKA 3D4PA 3ICPA 2QRVA 4LMBA 2FUNB 3I42A 1QYCA 1C9KA 1U8UA 1FTSA 1BX1A 1VPDA 3PNQA 5DT2A 3NTQA 4MQ5A 3NHBA 3I1JA 1WV1A 2BJVA 4F4FA 4HUQA 5KWIA 3L43A 2C2BA 2G9RA 3G2HA 4BFUA 4W5QA 2IFTA 4G9BA 3O38A 4DV1B 2H06A 3Q7TA 5AVTA 1IMOA 3LCJA 5DN9A 1XVIA 1DS6A 3JQAD 3U60B 1OHHD 4AKIA 4TV8F 3O47A 2JBWA 4IG4A 2C95A 5J43A 5K0GA 1NN5A 4I2VA 5JIBA 1T8TA 1CF2O 1UBNA 4V39A 4BFXA 2Y66A 1ZONA 5EIAA 3QPBA 2QRMA 2YY6A 4O02B 1ESNA 3RS9A 1VPVA 1C1XB 2WPDD 1CJUC 1A4XA 2DG2A 3C7CB 1Z73A 4OBEA 3K9QO 3PLNA 2QTMA 3WICA 1Q0ZA 3IUJA 2AQIA 2PH7A 2DUNA 4XKJA 4E5DA 5FUQA 3OKPA 1TE2A 1N5DA 4JYMA 5J2TF 2D8AA 4Z0NA 4A16A 4MIKA 3LUFA 1SVWA 5BNFA 4BNHA 5CA0B 1HDOA 1QC5A 1AE1A 3OZIA 3QUBA 2IHKA 4N6OA 4U1RA 4ZKEA 2A1IA 1RYHA 4AK9A 3HGTA 2E82A 2FZKA 4LV6A 2OPBA 4LXGA 5E6RA 1NP3A 1M8GA 2JIQA 4FOLA 4DPMA 1P7VA 4KO8A 5TQVA 1ACMA 4GOXA 2CLKB 4C3HL 3FTFA 3ILXA 1OZFA 3RABA 3SQLA 1LA2A 2WMNB 3WKCA 1EZ4A 1TW3A 1Z25A 4G26A 4TWAA 4MWDA 1OLUB 1FS6A 2JJ1D 1V48A 2OQIA 3FYUA 4ZVOA 4LMAA 2A9JA 2AFHB 1ORVA 5DK6A 3RUEA 5B55A 4HG2A 1Z2OX 3O4GA 4CIWA 2A7QA 4ASUA 2PVPA 5DP2A 1N5MA 3PRYA 1C1XA 2IV2X 5HW0A 1CUUA 4Q1CA 3DMTA 1JXOA 4CFZA 2PKRA 3DTVA 2E4XA 1PNRA 1VIMA 1PFKA 3LQQA 4EG3A 1OZHA 4MPDA 1CS0A 4OKSA 1S1MA 2GZ2A 3BIFA 4D79A 2ACEA 3SZGA 2RE8A 3SOPA 3HY3A 4A5OA 1HQCA 1WB4A 4U0KA 1GGNA 2QP4A 4JGIA 3VTKA 5CDUA 5HKKA 2OHIA 3LLSA 1G38A 4B3JA 3BMOB 3PF9A 4QEDA 3I28A 4G65A 1MJ5A 2VNJA 2X3UA 5DLQC 5JXWA 2PUDA 4W8OA 4YRKA 1RQXA 1E3JA 1TCBA 2QPTA 1PGNA 2XF8A 2FUCA 4MW1A 2AKAB 1NWCA 2XE4A 1CP3A 4QBIA 4QQFA 4RAQA 1YULA 1UH5A 2B36A 2YXBA 3EJ6A 3FYCA 4O59O 4QATA 3TQRA 2J7PD 2FMXA 3HRHA 5E3HA 4JT2A 2QU7A 4KAJA 3R76A 1Y3IA 5DHSA 3EH1A 3FCUB 4Z9BA 4NYJR 1SY7A 4DT1A 3TFOA 1W5FA 5E2AA 4I99A 1F48A 4R1UA 2HQOA 3HFSA 1MTZA 1TJ3A 4UUQA 2WW8A 7GPBA 4JFRA 4HCJA 1AKEA 4O4JF 2HPHA 4GXQA 4RZQA 3UJCA 1DDIA 3S1AA 1B6SA 1DO2A 4IZOA 1IATA 3P4UA 4Q4JA 3W9SA 3IFSA 4EKEA 1UXKA 3DOUA 2J85A 1RKUA 4EPTA 2J3EA 4US0R 4IRMA 2D2EA 5CA1F 3GZJA 1K2WA 4ZCLA 4F4JA 1QX4A 3BXFA 4G5XA 2JFFA 2PXHA 4C22A 2NVWA 3BXOA 3T7RA 5KO2A 3VHRA 1PR9A 4CF5A 2D59A 4JMLA 3UH1A 1T8UA 2R8BA 5IJ9A 5BSEA 1ZMRA 1PKXA 4RPGA 4NYIR 2G08A 4TM8A 1BXGB 3JAMA 1VZHA 4PPGA 4J75A 3IT2A 3QF4B 3N8GA 4RTOA 2Y1XA 4LZPA 5EC8A 1IHDA 1KYIA 4P4UA 5DI9A 5EP4A 4JQSA 4GKAA 2WHPA 1JSCA 4GR9A 2CLFB 3L8GA 4CMAA 2CB9A 1XGKA 3HEAA 4M1SA 1ZK2A 2FH5B 2XA9A 4ADSG 1W6RA 2BGNA 4K8OA 3S2ZA 3TZLA 3GLIE 3S40A 5LDDC 1Q0PA 3ZS9A 1RNLA 4Z7NB 4G0UA 1U9CA 2BJWA 4LN1A 3IT3A 1RIIA 2AMVA 2OZVA 4L4SA 2WJIA 5TQ2A 1PZNA 3DTNA 2JD1A 3VNVA 5TVKA 1IZZA 1FYEA 4TKUB 2H54A 3EZ6A 1DKOA 1SURA 2VT3A 3RZDL 4R8RA 5KPDA 1F8UA 2FZCA 3ET4A 3UXYA 5J2TA 1XFDA 5CYFA 1E5VA 1APBA 2FUKA 1DARA 1XTUA 3D7NA 3LLMA 3DZHA 4B6FA 4QLBA 4HMOA 2P2SA 3AESA 2NVUA 4FHEA 2IY7A 2LW7A 1R0HA 1RLIA 1CUIA 4YC7A 1DIGA 3C6KA 3LXXA 2E4YA 4HWGA 1I6LA 2CHUA 3UMFA 3ZVMA 2X13A 1G6OA 1IAQA 4POGA 4WNIA 1J56A 2Q62A 3THWA 5GAGc 3HYLA 2B7BA 4IHJB 1SD5A 5BMVB 5REQA 4PR0A 1L7QA 2HTFA 2CHEA 2Q2VA 2W6JA 3QFRA 2RARA 2C5LA 9ATCA 4ER3A 2FZVA 5PNTA 1RBMA 1R2QA 3ZCPA 2AG0A 2ZI9A 4X20B 5EHNA 5T64A 3AVYA 4BV3A 3AV0B 3LH5A 2PLRA 3KQTA 3OAAA 1ECFA 4LBZA 4Y2RA 5ILGA 3E6AA 5LQCA 1GCGA 3K5PA 3VVBA 2B25A 4BTLA 3BTUA 3K1ZA 1JDJA 1G7RA 3PK0A 5KYWB 2ZWIA 3VYTB 1HZZA 5KWSA 4PQRA 4YAOA 3HAXC 4PO9A 4KBYA 4FK8A 1LGYA 1FBNA 4RFSB 3O2QB 4YGXB 3TQFA 2PTHA 4QA9A 1E3DA 2W5UA 5EVCA 3U4CA 3DE1X 3IE2A 2HL6A 1NMEA 4G0MA 1GNLA 1NP7A 2FE4A 3BWCA 3FOAA 1Y7IA 3GD5A 3HPQA 4O4JA 4PCVA 3TAXA 1RAFA 3TX2A 1HNNA 2CVFA 4XIJA 3ZE9A 1YT5A 1E1RA 1IBCA 4EUSA 2PU5A 1U7WA 1E2QA 5DM60 4XWTA 2HDWA 1H1TA 1TU0A 3HCAA 4HEQA 1UBEA 4B2IA 3V4LA 2YWGA 4CCWA 3DMFA 3R3HA 4YHBA 2ICAA 3MTAA 1M33A 4GX1A 4J0CA 1P18A 5BUQA 2CLDX 1DADA 3HABA 3V34A 3H3FA 3HJFA 4DXAA 3N2EA 2A92A 4RSHA 4UQLA 2Q6IA 3I9OA 2KE5A 5HOQA 1W93A 1EPUA 1SQFA 1IZ7A 3G0IA 4U3JB 2IE0A 4BAGA 4BNNA 1PT5A 5DTRA 1M7GA 3SS2A 5G0VA 4IIXA 3WZMA 1Y5LA 3O94A 2VTDA 3ZKWA 2NPFA 1HKHA 1ECJA 2A86A 1LTLA 1X1DA 2HSWA 1XKTA 4CF6A 5IKEA 1PUXA 3ACCA 2PFKA 3LSYA 3R74A 2GNAA 4UPDA 3D5EA 3ESXA 4LJSA 2X5KO 3VR5D 5IZCA 4F6LA 4RPKA 3GLGA 2Q9BA 3LPAA 1A8SA 4MV0A 3GBPA 4GLOA 2D13A 2O57A 1KXJA 1PSZA 3M5CA 4WHMA 8ATCA 4J3JA 2AOUA 3SSNA 2QX8A 3WJAA 1UIRA 4LSZA 4S2UA 3SSAA 5ALEA 3ZBTA 1N0UA 1UDWA 1OJLA 1K8RA 4G6ZA 3HL4A 3II6X 4YRQA 5JZOA 4A3KL 2Q4DA 3CZAA 4LZZA 4TTIA 4MTCA 4YRIA 4V0OA 1AF7A 3SYRA 3R5TA 4ETNA 2ID4A 5EUMA 2BFMA 4FKBA 1RQ2A 1JQ5A 2PRZA 5BSGA 4MEBA 4MAMA 3R0QA 5IANA 1SKAA 3GGCA 2UZ1B 1O96B 3PJFA 2IS2A 2E37A 4I6GA 1DNPA 2AHOA 1DTEA 4IDNA 1FJXA 3A31A 3GZNB 4UOZA 3R3JA 5AKIA 2UUAB 3GYGA 3SVTA 1Z36A 1U5BB 5AK4A 1J21A 3VZBA 4JNCA 4XVHA 3THYA 2P62A 1KNQA 1PS9A 4GRAA 3TLXA 2HR1A 5EIXA 1GUFA 3EH2A 3M3YL 3ZV6A 1EFLA 4BXOB 1QFYA 2C92A 4LYFA 2ZUBA 1D1SA 4LXIA 1MB3A 3DCIA 3ONEA 4Y30A 4O6VA 4L8VA 3GTPL 3EUFA 3MOGA 3ADDA 4AROA 3IEKA 1KJIA 1NHWA 1N36B 1Y1RA 4PLHA 2C9BA 1JSZA 3VU9A 4L6IA 2WV9A 2O14A 2QE6A 4Q4HA 4PTLA 5JO9A 2NUTA 5KTTA 1JW9B 3W1EA 4YFVA 4MAAA 5KVQA 3UV3A 4YJ2B 2EEPA 3JYLA 1LSOA 3IOCA 2VYQA 1TQDA 1XU4A 3AUFA 3L0YA 5L7WA 2FPLA 1IDN1 3GJ6A 1I9CA 4AECA 4GM1A 2C7QA 5FO1A 3IPYA 3JSXA 1OXMA 5ALXA 4B31A 4Y9TA 3P9XA 1LUAA 4YDRA 4ZRNA 2D5CA 1SU7A 3H75A 2B98A 3NDRA 4W99A 3C1TA 4JT4A 5EJ4A 3V48A 3SR0A 2AB0A 4FFMA 2PWBA 3SQNA 1YJQA 4FMCB 4JT8A 5FXMA 3WP0A 4PNPA 1C7EA 1YIAA 4ROTA 2ZJAA 3FPHA 5KNBH 1IRIA 5BVHA 1S7GA 3KJQA 1IRNA 1AUQA 4OD0A 1ISPA 3OPYB 3W6ZA 2D1YA 3H4IA 3IQDB 5JXGA 4WFJA 2F55A 3FOEC 3O5AA 3FMFA 1J42A 1H1LA 1RYDA 3AFNA 2BY4A 2H17A 2QAJA 3IEUA 4KRYA 2Q5IA 3T5BA 2ZWAA 5K3OA 4R7ZA 1IXKA 1V5FA 5CH5A 4LUCA 3IUSA 5EJIA 5KQLA 2VHEA 4PCAA 3IQZA 2IH2A 3WP1B 2N9UA 4BLPA 2C88A 1BA2A 2OT3B 3OJOA 1WUTA 1JA9A 3TCXB 5HJ2A 4X54A 2Z6VA 4KYIB 5C81A 1TU3A 3Q3IA 5A06A 3ROMA 4OBWA 1H4SA 3BTSA 1PBNA 2WDPA 1OH8A 1OB2A 4P7BA 1WOMA 5BMVA 1L1RA 1HRDA 3A36A 3QH4A 4Q7KA 2VA9A 2Z2JA 3R41A 4I4TB 1R5NA 3E9QA 1Y8RB 3UJ6A 3UFXB 4YMUA 5A2GA 1RCTE 5C37A 4KK4A 1K6XA 1WM1A 1G5HA 4FGSA 2CVPA 2CDNA 4JLWA 3FWPA 4BMNA 1Z22A 4CKCB 3TFQA 3FJ1A 1SN7A 1AQUA 3DWGA 1RYQA 1GUAA 3H4MA 3UYKA 4LVCA 4ZYLA 1NW7A 2CEKA 4DYVA 4A2QA 4RNCA 4TZTA 3W79A 5L3SA 1ES9A 1KR2A 2CE7A 2OKCA 4UZFA 3TSYA 1H23A 3UJDA 4B3XA 5AKKA 3D7KA 2VXYA 1A2BA 1EFKA 3DO8A 2YUTA 1NSFA 1Y3AA 3ZZ1A 5B7PA 4QTTB 1LSJA 1CRZA 3BILA 4PIVA 3A2KA 1S2OA 3VDXA 3ADCA 1RHJA 3AQIA 2OMKA 5B7GA 1PTJC 2C8LA 2Q7XA 4Q48A 2Y2VA 2AR9A 4JLKA 1D8TA 4D9BA 4HDKB 2R11A 3E5NA 2IS4A 2VPQA 3BOSA 4QBKA 2C42A 1AO0A 4WLVA 2JK0A 2XI4A 3KUXA 4BZQA 5KYTA 1COWA 4C29A 2JFOA 3X2FA 4LZWA 1DZ3A 2BT4A 2XT0A 2VQFB 2UUCB 1TK2A 1UAGA 1L4MA 2JH3A 3E7PA 4DLLA 1T9OA 1SJ9A 3H4VA 4GHWA 1NX9A 1MQ9A 4F72A 2J87A 1PFVA 4PVDA 4IH9A 5T6BA 2X5NA 2X0KA 4EQZA 2P2LA 1Z0DA 3B8HA 3H5WA 3UHFA 3GLQA 4JP8A 2H4JA 5ALPA 1Z75A 4M0MA 1TC2A 3NAGA 3N70A 2Q9AA 4KO1S 4K03A 1CR2A 4N82A 1OOEA 3F5QA 1ZW6A 3OLYA 2Q3DA 1PL0A 1VJ1A 2IUSA 2PRIA 1T9PA 5BW4A 4Y8VA 3X1DA 5LZ5A 2R25B 3FRIA 1I6KA 2H52A 3VJMA 1QM5A 2X4LA 3H3XA 3M6MD 2JVKA 2HDNB 1YC2A 3X1XA 1Z2EA 4B32A 3DULA 4P9NA 4KMSA 3WRYA 4B44A 3MERA 1CY0A 4GC9A 3VUEA 5DK4A 5CCDA 1CNEA 1RZVA 3A4LA 3G2JA 4UBKA 5BV2P 4QXOA 2BEVA 3PQ8A 3BS4A 4MICA 4FMBB 2Z8XA 2R5NA 1EWKA 3HA7A 4GUDA 3P2MA 2FG7C 2V1XA 3D3WA 1T6ZA 4TSFD 5FT9A 3KL4A 5C1BA 1TD9A 3V7UA 5LQJA 4EDHA 1YRQA 5CA0F 2V59A 5IEJA 3NBQA 4HLNA 2LXNA 5JMOA 2H7XA 4FFBA 2PVCA 4P8RA 4MVJG 4P7GA 4XFKA 3VV3A 3U7HB 4RKWA 3K0FA 2XQJA 1DCKA 4C0BA 4RA9A 4HVTA 2AXPA 2HF7A 5B1IA 5JPIA 3EMVA 5I9IA 5MN5A 4N76A 4LJKA 1OIXA 4H35A 3I53A 3UGQA 5JY1A 2YVKA 1KEEB 3TYXA 1BJKA 2EG9A 5HEKA 3IQWA 4DIKA 1G5TA 4NEHB 1PL7A 2ZBDA 4IIVA 4C0AC 4OMCA 2H8GA 1TQ2A 3HK2A 3HI6A 4QIWP 1JEOA 1BE6A 3N0RA 1G20E 2R84A 2B4KA 2ZPTX 3NKFA 4LE1A 2AT1A 1Y1PA 5K6TA 2NVXL 3A4NA 2IF2A 1U0GA 1UMCA 2JEZA 1BFKA 3MIIA 3W0LB 2IYYA 3CPJB 5G3YA 1A72A 1PL6A 4RSGA 2WSYB 3AFGA 3UWMA 2X7XA 2FXIA 3DZFA 1FFGA 4POAA 1EX6A 3HB1A 3S1LA 1XTJA 3TTYA 5KREA 4J2OA 5LOVA 1HE3A 2ONKA 4CL8A 2C7GA 4KPEC 2H4YA 4D2IA 4MQLA 1DP4A 2EP7A 5GADl 4WMLA 1NXWA 3QM1A 3B36A 1PEYA 1K6EA 3QLEA 4LHLA 4LYGA 4KJXA 1O0CA 4IQ4A 1MO4A 3EPPA 4QULA 3RFCA 5AW9A 1ELOA 3F7TA 3NOVA 1YUXA 1PJRA 2O0MA 2OGUA 3EE6A 4H1HA 4I6EA 4W82A 1P7PA 4L76A 1U2DC 2BWJA 3LOUA 5ARCA 5F52A 2UYGA 2LVBA 3W06A 1YV9A 4FN4A 3BUSA 3FZYA 4PYIA 3IEPA 4J4TA 3D8BA 2W2XA 4HAWA 4HX2A 2IKQA 3BXPA 3E9EA 1AU9A 1BX3A 3WMWA 1KRHA 3DNMA 1Q0TA 2FK7A 1RCUA 3S68A 2A59A 1GZDA 3AKCA 4E2FA 4CV0A 4RX1A 2FZWA 3DEKA 2VHUA 3W3AA 4GXTA 2A5JA 4KN5A 2HLHA 4OQMA 1P5JA 1UODA 3R09A 2ZRHA 3E2IA 1M5UA 3L8EA 4AUKA 4EQ6A 4EW6A 1DJMA 6RXNA 4I9FA 2QZ9A 2P6OA 4FCTA 5K8JB 1LSUA 1RT9A 4J7CA 1YZGA 2HV9A 4UBJA 1R4ZA 3N07A 2OXEA 3L5KA 1AV7A 3A7DA 1FQOA 1YTUA 3B1XA 3JXEA 2QSZA 4LW8A 3QE9Y 1EZZA 5ECDA 4WFIA 3E48A 1E77A 1JH9A 2RHWA 1RAEA 1S8FA 3PI7A 4QXQA 4ZT3A 3REFA 3TQQA 4B4WA 1DMSA 4U671 2JAUA 2RK4A 3N75A 1UPCA 1UUFA 2YV1A 3OJEA 4C04A 1YRBA 4DWWA 3LT1A 4IZ6A 1QG2A 1X9GA 5FO0A 3KOYA 3VU8A 3ETNA 1KHHA 3N2YA 1OU0A 4BVAA 5KJEA 1AHIA 4CDRA 6YASA 3KHUA 1PJTA 3SDSA 5K09A 1GG9A 3DD5A 4HWPA 2W42A 3U26A 3QFFA 4KQ6A 4YJ3F 5CVJA 3EVBA 3DBRA 4JBLA 4FJ2A 4ZVLA 4ARVA 1KDZA 4D4GA 4RTKA 3MS2A 4FR5A 1YJBA 4S24A 3PRHA 3D8HA 4ZQEA 3CX4A 3UG7A 3BCRA 3O8DA 4JXJA 3CCBA 4LF4B 1CT9A 1VBFA 2AYZA 2GB4A 2J09A 4DV6B 2JHPA 4AR3A 2Q6VA 1YFKA 5FIUA 3U3MA 5AD1A 2JGDA 4QOFA 3LTNC 1RRCA 1KC1A 3G6KA 1U3DA 4OSEA 4KXFB 4YIKA 1P8JA 1QIIA 2HO5A 4E3ZA 4UXIA 2Y2UA 1DB3A 2QL7A 2ZU6A 1H1LB 5AW3A 2FPIB 2OECA 4JYPA 3ORRA 1LJUA 4V38A 1BMFA 1OPRA 3U49A 3OLWA 1UT5A 2HGZA 2P9CA 2GCOA 4F56A 1JAIA 2AG6A 2BI8A 2PYZA 2A0UA 3VC2A 2VK1A 3ISJA 4HWSA 1NU8A 3GP3A 3K09C 1CVLA 3OLZA 4G25A 1QH8B 2ZSDA 2Y1KA 2R4TA 4FYWA 4GSKA 3ZWAA 3BMCA 3QVUA 1V8OA 2Z83A 2CZGA 3CZ9A 1U3VA 3FRHA 1ZZGA 1P39A 2F43A 2JKYA 4H7FA 4NK4A 4OP1A 3HM9A 3LCUA 4DQXA 2BI4A 3OTWA 4GI5A 2MYNA 4P35A 3SHOA 2YXDA 4FCWA 1ZI6A 3T1NA 3QYJA 4CRWB 3KSAC 1Z88A 2QZSA 2IOQA 1YU9A 3PFNA 1HYGA 5JNTA 2V8OA 4XB2A 1TWGL 4LSGA 4JGGA 3TN7A 3K1TA 3HQ4O 3VSCA 3F67A 2HK7A 4X71A 3E61A 2FOIA 2H1CA 2W22A 3NHRA 1C8LA 3U4AA 1B42A 1C30A 3F2IA 4HR7A 4KOEC 2XTJA 4H3SA 4WY5A 3RBVA 3B9PA 4EG1A 4W5OA 1AGXA 2NAPA 3ABIA 3SICE 1AHNA 1L1EA 3RLFA 4MK4A 2SBTA 1AUPA 1I3LA 3OP1A 4QFMA 1Z6QA 3MTEA 3FMGA 4FE4A 2W2QA 2IIPA 3EW7A 2GILA 1EVEA 3GC6A 1OA0A 2OBNA 3H1BA 4KC0A 2CMGA 3ACBA 1B13A 4IF6A 3Q0EA 1BVHA 1XQ6A 1GPYA 2FNAA 3QMMA 4K9MA 4X97A 1FUUA 3RYFA 1GPKA 4DDMA 5C7OO 1L5YA 1QX3A 3GYBA 4KH0A 3H8SA 4PRLA 1QP8A 3W3AH 4BN0A 4AURA 4XD7D 1AQIA 1GTRA 2VRBA 3R5SA 5JCJA 3D54D 1P1KA 1SCJA 4O0LA 5ALVA 4IIBA 4LHYA 2VF4X 3GU3A 3L07A 4O1MA 3MFQA 3E82A 1UBSB 1G1MA 3OOWA 1JBQA 4YJFA 5E7JA 4DV5B 2OV6A 3ESRA 2FQXA 3GNLA 2H1FA 3EEFA 1RJ9A 4CL0A 3EGDB 1M2WA 1GZ5A 3MT8A 1TTPB 4RV5A 4Z99A 1CQXA 4OLBA 2QV7A 3PHJA 2XGSA 3PGKA 3FXAA 3LT4A 3CGWA 1WSAA 3KU4A 1MU0A 1DSSG 1G3MA 4GR5A 2SICE 1BRTA 1V1MB 3CISA 3LPNA 4KAAA 4MCJA 1UDRA 1BXZA 2VDMB 3C24A 4B48A 4AYBP 4XAQA 4B17A 1L7PA 3BHJA 2Q2OA 4IQGA 3G02A 3FIJA 3VNRA 8OHMA 3QEAZ 3S2SA 4ZIRB 4CMIA 2IX9A 4FZVA 3SSOA 5IXJA 2JJ8A 2AG1A 1V41E 1OSNA 4K0RA 1ZINA 4RIGA 4AMBA 3AVUA 3LP5A 2JCXA 3PR2B 3MINB 4KX3A 4P33A 5EMNA 5KINB 3U39A 1JLRA 5C44L 3V4OA 3CH4B 2VWHA 2ACKA 5FP0A 4DDHA 1VA5A 3FSEA 4NEQA 4MRAA 2W2LA 2J0UB 3VPFA 2P1ZA 4PN3A 1V3VA 1ZA2A 3HWRA 1VGRA 1X42A 2ZRPA 5LQUA 3OQNA 3UMYA 2PIAA 1EQUA 3EF1A 1F51E 4BXXL 2BGJA 4LQ4A 2YW2A 3QELA 4HDRA 4O8ZA 1H2AS 4G3XA 4S2EA 7MDHA 2VWPA 4JUAA 4GUAA 1E4VA 1XQ1A 1EP1B 1GZ4A 1ULBA 2X41A 2XKBA 1IZ0A 2P1DA 1NJ1A 1TKCA 2IQ5A 2R79A 1OF1A 3AFOA 5KS2A 1U0EA 4JU9A 1E63A 5TJ9A 1C8VB 1D09A 1OAKA 3RU9A 4NFHA 3ADPA 4XM1A 2K2DA 1RMYA 4RA9B 3UAWA 5AFSA 2C2WA 4FDVA 4EJFA 5CAEA 2IDKA 2Q3EA 3G82C 4HTAA 4CUJA 1VMKA 1NVWQ 4KNVA 4UMEA 4MUJA 1SUEA 1WDMA 3GLIB 1Z35A 3SC6A 2O8EB 4L57A 3NAZA 3Q88A 4RZ3A 2N1BA 2PGNA 2P3SA 3NAMA 1XYGA 2MSEB 5JI3E 3EPJA 1EHCA 2BAGA 2O7NA 1X3LA 2ZPAA 3EZ7A 3D3WB 1X80B 4PAOA 4R9SA 4AI3A 3BL8A 3CY6A 3FM9A 5EZYA 4JXXA 1KJ9A 3IV9A 3UV6A 4AHXA 4N7BA 5DNYB 4IHKA 1G8AA 3KSZO 3NI2A 3AKDA 4PRYA 3ND5A 5AI6A 3RUDA 1VL0A 1C2TA 1QO0D 5JDIC 4EHNA 4CPDA 2ERXA 2RBGA 5DNDA 1ZHFA 2AW5A 4FFVA 3HVHA 1T5OA 5T4FA 1CJMA 4AICA 2V58A 5ALSA 3ZY5A 1K2VN 1SPXA 2BP7A 4LI0A 1T5HX 5HILA 4PZUA 3GJ3A 4G4JA 2Y4OA 1OI7A 1TMKA 4N7MA 3QG5A 5LP6A 4PLGA 4ZXPA 4D4LA 1KQPA 3AO0B 3STTA 1TJNA 1KJQA 3DA8A 1UZMA 4JOBA 4U6QA 5HBRA 2YDXA 3T9AA 4GKKB 1HDGO 3DHVA 3I3OA 3F47A 4YQFA 1SUSA 2WNSA 2ZBEA 3PIIA 3QKRB 4WK2B 4M8IA 5EEHA 3S2HL 4RU1A 1IZ8A 2JATA 4HRAA 2Z6UA 4H0FA 3D4NA 4OMDA 4OF4A 3A6KA 3DL4A 1DBSA 1XD8A 4YMGA 2PKYX 3K4QA 3UIEA 2JA8L 2VTEA 2GK3A 3AUTA 1ZPDA 1E92A 3NAQA 2ODEA 1M1NA 4PZZA 3BMXA 4XX0A 3I01A 4URFA 3MAJA 2J4CA 3NVKI 2X14A 3O8LA 1Z5UA 1JKFA 3RAGA 3PJEA 2Y1LA 2QD4A 5JVDA 1UBMS 2JCYA 2A3RA 4DMGA 4ZYVA 3GRRA 3TOVA 3GLFE 2DE0X 3CN9A 2E4UA 1F2TA 2C00A 2P2CA 4I19A 4KQHA 1JEAA 4FFDA 3SM9A 3ICEA 3R6LA 3TL3A 1VJRA 1QZUA 1UKEA 4QQKA 5CX1B 4W8HA 2AXNA 3C6BA 1DAEA 3SEQA 4E6YA 2FV8A 5CD1A 1B1CA 4FQ8A 5EHGA 1IVYA 4GGPA 4Q6BA 3E3LA 1RD4A 1GUZA 4HN2A 2DPMA 5LXTA 1VPEA 2H2AA 3LUGA 4MKXA 4PM4A 3V33A 1C29B 4LE2A 4S1PA 1KSFX 2BYTA 1N33B 4JQCA 3ZLUA 2X5JO 2YHAA 4RF3A 3QV1A 3K4PA 4BO6A 2VPIA 4B85A 2X8AA 4UM8B 1W49A 2WZBA 3TPFA 3MCZA 5EIHA 5DLDA 3KQOA 4R98A 3DBVO 3HU1A 4KAFA 3R8XA 4JP5A 2WM8A 3QLTA 2BZGA 3R3YA 5JAHA 5KB3A 3SBOA 1HRKA 1K7FB 1RRMA 3AYZB 2LIPA 1Z9BA 2X19A 3C74A 3LUKA 2PUVA 4HRYA 4M9RA 4S3MA 3P0HA 5NULA 2GDZA 1EB9A 2Z08A 4XDHA 1Y7TA 3LVFO 4YAJA 2Q29A 4ZEWA 2E0IA 3E18A 2HMVA 1JDUA 1X14A 3L9WA 1QNFA 4PR3A 4AZ0B 4TV9F 3ZVNA 2XCQA 2R1ZA 3BD9A 4OU4A 4DBZA 2GSWA 3A1SA 3FPFA 1ZWKA 1GAWA 3GRUA 5HBGA 5F9MA 3O93A 3T6KA 3V80A 4D02A 4PQFA 1K5HA 3RVJA 3FPBA 3BH7A 4WBSA 3OA0A 5LB2A 2PSMC 4W5WA 1NDQA 3PXBA 4ACAA 4DVGA 4JXKA 5IF9A 1T0PA 4IWYA 5CD9A 1ICEA 3DL2A 3N6XA 3PHCA 3PGA1 4YRLA 4RETA 4JFAA 3VR4A 4AI6A 2QYSA 2QXYA 3UKDA 3L93A 4FMPA 3VOBA 1Z6TA 5BVGA 5HGXA 4UTPA 5I45A 4KG7A 1BS1A 5K3SA 3K2QA 2PGOA 3VX3A 2O2JA 1CJKC 3LWNA 1XZCA 2AYXA 4GAEA 3QEJA 1M2FA 1II9A 1RXSA 2H9IA 3MB8A 4L22A 3VM6A 5AW0A 1IIRA 3G5TA 4JVLA 5FBHA 2IXGA 3IELA 4YIHA 1AIPA 4BO4A 3L7CA 4MRMB 1VDMA 2AJBA 3H3JA 2QJRA 3GNSA 4G0PA 4FDMA 5ARBA 2BGIA 1OA1A 1R6BX 3COPA 4QO7A 4QYXA 2XUQA 1EFDN 3DFZA 1D6MA 5A5DA 2X0FA 5BR8B 4OKNA 3Q15C 4KODA 1VIVA 1NVVR 2Z4TA 4MS3B 3V1TC 3HDYA 4BNLA 1E2UA 4TKVA 2QT9A 4LHWA 3QE4A 4REQB 5JMPA 3HC7A 1F3OA 3SYTA 2M6PA 1U99A 1UF9A 1EMDA 3VNSA 2YQ4A 2AF4C 3UWOA 3ZNOA 1G8HA 2VRWA 4TTTS 5DP1A 1WG8A 2P6RA 1E4EB 2HBRA 3RPEA 3TPCA 4R54A 1J70A 4GBED 3HNOA 3KHKA 5TS3A 2IV7A 4O1HA 3THYB 3PNSA 4AQ7A 4HI0E 4WNAA 4QGFA 1XCPA 4MVJF 3S2YA 2V7BA 3RV4A 3B3GA 5D00A 3B38A 4BIMA 4CE6A 4Q1FA 5A2QA 3UQYS 4UPVA 3ZDCA 1XPRA 4JP2A 2BZ0A 5EXPA 5F78A 3HJWB 2WF6A 1B2JA 1EVQA 5JNLA 2F1RA 4HSEA 4UXHA 2GK6A 2QQ0A 3CS3A 5FF9A 3EG9B 4A0QA 1KWGA 3QK7A 4A3BL 2Z98A 2XE6A 1IBLB 1IWPB 3OUZA 2CB0A 5BSVA 1IU9A 2VSXA 4EVIA 1Q20A 1G8FA 1E3SA 1QF9A 1ZNQO 2A0KA 5TRTA 3BWEA 4KQXA 5IYZB 1QWOA 3ANXA 3HCBA 1ZIYA 3PPXA 5CIYA 3OJLA 2XEDA 3EVDA 4JI5B 2QI9C 5DNVA 5THKA 1I7SB 2HMUA 3PX3A 1HPLA 2BZ1A 3QELB 4PIPA 3K1JA 4RHUA 3IJPA 1ULHA 1IEXA 4C6TB 1EUDA 1H22A 2P3OA 3DTYA 3L7IA 1R4NA 3IGFA 1OASA 2BBWA 1DCMA 1XXHA 2REXB 2FEAA 5LL6P 4ME3A 2VYCA 2WJYA 4BIIA 4PYRA 1T1SA 1JEEA 1XYVA 2M9MA 1EEXB 3EF3A 3O03A 4FQ7A 5F2OA 3D2CA 1CUVA 3DC2A 1OFUX 8RXNA 2YZKA 5DM1A 1GQ2A 2IZ7A 3WL3A 5KCZA 1O6FA 2HSJA 2PQ0A 3NX4A 3Q10A 4LDJA 4B09A 3I9V1 3HFRA 4O4IF 4HNTA 4IIFA 2AVNA 5L3VA 1C3OB 4LXYA 4N0MA 1ZMBA 2JIBA 4G8DA 2OYRA 3PXGA 3TB6A 3VPSA 3R7BA 1IUNA 1C3XA 3ERCA 7RXNA 1J6UA 2NYDA 2BFEB 4N3NA 4A3ML 4DC9A 2O8BB 5B1HA 1JLSA 1RFGE 4FJ0A 3NM5A 3EEQA 1QLJA 2PDAA 1MX5A 2E5FA 3ZWOA 3M1YA 5BRAA 1X39A 4E2ZA 2VT7A 2LD4A 4YJDA 5EINC 5IT5A 1YR7A 2DCUA 2F2TA 1OFHA 3CPHA 3K8OE 4MO9A 5B5SA 3T5AA 1TJ5A 4YJFB 5KDLA 1P2SA 5H9WA 4JI7B 3EDQA 3SN6A 2QGNA 5C5IA 1NM5C 2Q5LA 5TEWA 1EB8A 2FQ1A 1IJKA 1WVMA 1C50A 1QYXA 3L1KA 5E8RA 2AZXA 3FHCB 3UJNA 2DLCX 5MLC3 1FRQA 1OWPA 1UKYA 3AZPA 1CF4A 2JG3A 1ZVKA 3QXJA 3Q6NA 1MRNA 3J7TA 2AR7A 3COSA 4KWIA 2R4QA 1LLUA 3QX3A 1BN7A 4UHBA 1FIUA 2JD0A 2XNHA 3COZA 4L28A 4Y2SA 3WDMA 5JSZB 1IBKB 4V1CB 3V32A 2NYAA 3QOWA 4DQDA 3WHLA 5CYOA 2B4QA 3GT3A 1JXQA 4EGFA 2NACA 3VNBA 3FFTA 1FFDA 2D5AA 2RAPA 3KT6A 4EX6A 4TLBA 5ICGA 1P2TA 2WM9B 3DDHA 2BTQB 1E4EA 4NCKA 4OA5A 5KHAA 3WRXC 3ETGA 4WCVA 2XA1A 1C1HA 5ADHA 3V7FA 4FFOA 3SAJA 4MA4A 4RH0A 3H86A 3PCTA 4M37A 4BDSA 3KJIA 4F04A 3TLMA 3JQBA 4ILKA 4Q7EA 3HJAA 1H94A 3WMRA 2DSXA 1II8A 2MMGA 3P9IA 4MDHA 4YV2A 4Z9YA 1P2GA 2OCXA 3EQ7A 2ODTX 3THXB 3SIXA 3VH3A 1Y1LA 1Z4LA 4DLVA 1LZKA 3PTLA 1JHDA 2XMQA 3PC7A 2IZ5A 2XOEA 1BQ4A 4ZOQI 1DJNA 2JIRA 1D2NA 5A02A 2WAYA 1L5MA 1IU6A 1LI7A 1MRZA 3KVRA 4GP7A 3L7BA 5BSFA 3ABOB 4RIFA 5KX5B 1WF6A 2AN1A 1LWNA 2XCSB 4F45A 1ZM4A 3AVVA 2G5TA 2VNKA 5JVDB 2GM5A 1GSOA 2GZ3A 4EGAA 1AZSC 4IEFB 4TKLA 2DOKA 2M1XA 3RUIA 1GLGA 4MUYA 1DIHA 5EWMA 3M33A 5FKJA 1NRXA 5AW1A 4CQMA 3S8YA 1IL0A 2VA8A 2NIPA 4HKTA 2RK6A 3C6ZA 4ZT4A 1K08A 1CUZA 1YA4A 2R86A 4XIGS 2QBYA 1GAXA 3CUYA 3BL5A 3WQSB 3RROA 1NKSA 1ZH6A 5J23A 1CULC 2NZJA 1M6NA 2VDKB 4N9WA 4BFLA 3RU7A 1T1GA 2C4NA 1N2BA 1WCV1 2H2IA 3DGFC 4RD1A 2Y1DA 4LXUA 3EIFA 4FP9A 4FR0A 3BFKA 1TVEA 2HWWA 1S3GA 2DUJA 1JMYA 2DR0A 3IKVA 3N2KA 3SIRA 4NCBA 2PA3A 2ZB7A 3OWXA 3HYNA 2ZI5A 4PX2A 1LBSA 1MHTA 3GUUA 3V4RA 3EF0A 3W7AA 4E30A 2XRYA 1QP0A 2AXQA 3L40A 1Q15A 4N6GA 1EXWA 3CSSA 4BNUA 2YJNA 4L6AA 5AVZA 3CNEA 4WZ6A 4ZJUA 1QFSA 3G79A 2W8BA 1MCZA 5IY0A 3JRWA 3PZAA 1N1EA 2HHLA 2QUJA 3NJ4A 2RDMA 4J07A 3MQKB 1P7ZA 1Z82A 2WLSA 3C3YA 4TRNA 1A8QA 5CCBA 2G6TA 2OM6A 1AK1A 1CNFA 1U0NA 1N3LA 2JGMA 1S2GA 2DBVO 3D6HA 4U6NA 1GAEO 2YL2A 4M8KA 2B5OA 1T3HA 4DOMA 1CQPA 2PYIA 1H3EA 3HEMA 4E5MA 2YDYA 2CMDA 2ECPA 4Y2JA 2X0JA 3UTDA 4KIFA 2QTTA 3JASA 4QRIA 3JATB 3ELDA 4GX5A 4QUDA 5TXGA 4AJKA 4YRAA 1G8GA 1L4EA 4YASA 1GRVA 3ND7A 1GRQA 3R9KA 2N75A 4LJAA 3IXMA 1QOZA 1YCGA 1BD4A 2GJ8A 3A1VA 1USKA 3FGNA 1O94D 5CIQA 2PGIA 2V7QD 4L5IA 2D2IA 2ONJA 4X92A 5GONF 3WLEA 1QHNA 3C70A 3C85A 1DAOA 1O89A 2DFNA 3L84A 4TOIA 1U2PA 5SY6A 5JALA 3K8ZA 1SXJD 5C4GB 3RHTA 4NPHA 3TEMA 1HFEL 3EFHA 1XZJA 5H0IA 4AZTA 5AOVA 3RFVA 4EUKA 1RYZA 4KIGA 4YRFA 1XZAA 4LMPA 4RW0A 3WDKA 1P3Y1 3TR5A 2CT8A 2AFRA 1SU4A 4IFBA 4ZAYA 1Q84A 2YJZA 2BFCB 4ABYA 4EY6A 3BWMA 1XE3A 1EFRA 1A5TA 3A8TA 4KYVA 4JQOA 1EWRA 4BFSA 2UVPA 5FJIA 3SHWA 1VYVA 1X7YB 3FWHA 3G2OA 3LNCA 3ZGNA 2CLMB 4MLPA 5L3QB 2X4IA 3H0EA 1ST3A 1WCXA 3EAGA 4HK4A 1HURA 4K3UA 4MIYA 5JRDS 1PCXA 2WT4A 2JLWA 4OUKX 4OTZA 2G5GX 3DAYA 1QC5B 3BM5A 4J0GA 4ZN6A 1UBJS 1KS2A 3IMFA 1ZD2P 1XBTA 3F8WA 4UHKA 2WWYA 2ZIXB 3AI2A 1JSLA 3B78A 5EPEA 3NNSA 1NVTA 1G8SA 2HSEA 3VBEA 7ABPA 1FMTA 3W5HA 2SKDA 1GNVA 5FB3A 3IP5A 1WQ1R 2HA6A 3AEQA 3AUUA 1W5BA 2NUPB 3DPSA 3OUTA 4LOJA 3RS3A 2VWGA 3UPDA 3M4YA 1SIWA 3MRTA 4X0EA 3B6KA 3BMQB 1TNDA 1KVRA 3T5MA 1RJ9B 4WZBB 3E35A 3H13A 5IMSA 3AJDA 3LUPA 1I3KA 1JG2A 1LVUA 2EXXA 3F4LA 3ZY3A 4AR6A 1BYUA 4XVCA 2FLVA 3K0AB 2XECA 4KAXA 4MVJH 4OLFA 2VJPA 3M70A 3AI7A 3OOYA 5KOHB 1IHOA 3IEVA 2VZLA 2YW9A 2HIMA 3L4EA 5TE9A 3SPXA 3T3HA 5EWJB 3CRZA 4MI3A 1TUEA 1A8UA 4ESEA 1LBHA 3GRAA 3O3OB 4OHPA 3AONB 3O2SB 3QE0A 5CNMA 3WB0A 3JARB 5AI5A 1ADFA 1J9GA 3ZWXA 2AX3A 2AFIB 3BZBA 3PA8A 3R5JA 1LPBB 3HNPA 5FI3A 2ES4A 2GZHA 5KUTA 3SS8A 2PL9A 3L82B 1T4MA 2RGGA 1EJ2A 3FGZA 3Q3GE 5IH3A 4DABA 2VYNA 2FN7A 4HDRB 1KI8A 3LG2A 3U4HA 5LYJF 4KXXA 2AD1A 1W1WA 1R0XA 2J3KA 2WUEA 3UJ9A 1KARA 3L2OB 4JSYA 5TMEA 3S7TA 3MEQA 3TGWA 2QA5A 2GD0A 3ILSA 1SQSA 3KYJB 2X22A 2OHFA 3W6UA 3L1HA 4XIYA 3LV8A 4KK3A 3R7DA 4TS9A 3TKLA 4CR7A 2ZYWX 2DKNA 3D1VA 3UMMA 4P32A 2AOWA 4I50A 2O5EA 2O8DB 2RHLA 1DV1A 1E8NA 1R0LA 2EZ9A 4R8SA 3PFIA 5K51A 1P7YA 2VDWB 4QSHA 2XJVA 4MHTA 4GS7D 3AR2A 2AMFA 3LNLA 4OL0A 2NU8B 4HF7A 2AUTA 2H2GA 4MW5A 3TNYA 2F4VB 1UJ5A 1XD2A 5IF3A 1MB4A 3TEFA 3TVDA 3AHIA 3KLMX 2JBAA 2ZRGA 5JBQA 1W19A 2QN2A 2WT8A 4JJ6A 1NV9A 5EIWA 3CLSD 1XKQA 2YS6A 4ZQGA 5CK4A 3DMTC 2Q1XA 4MDEA 3RUAA 4IQFA 4YACA 2O3TA 2HF9A 3D7LA 1EJ0A 4C7BA 3DTTA 3OJ0A 3PPIA 3WWPA 3PGXA 1YGPA 1Q19A 4X8LA 2VAMA 4B6JA 1BTOA 2DLNA 1I8TA 2JIOA 1D4FA 1U28A 2BGKA 1JPUA 2J07A 3NT5A 4TM7A 2QDXA 1Z6YA 4DNXA 1BWSA 1SVOA 2D7CA 3X2EA 4ZQFA 3T0GA 1L3CA 4D9IA 1IJBA 5H83A 4BNXA 3CRMA 3QBDA 1CJVC 1CJSA 4TLCA 3DCNA 5I47A 4D3DA 2C3PA 2OGTA 3TBKA 4OK5A 4EY3A 5JG7A 5BXQC 1J0EA 1CBUA 1RBYA 1JQBA 4L3WA 1M7HA 1B6TA 2ZRFA 1WCYA 4LRWA 4REMA 3R8CA 3SC4A 3T9BA 4B6EA 1FPQA 1H05A 1JYSA 3AWIA 1E7QA 2VTBB 4OGLA 1HORA 2G1AA 4GGOA 4Z8XA 5HF5A 3Q9SA 3QVJA 1BCSA 4HAIA 5KTYA 1VLZA 2F1KA 3U4QB 3TLBA 1M2OA 4NEGA 2ZYAA 1XZHA 2VSNA 3KLOA 1KK1A 2FQYA 3EYWA 4KN9S 5KKCA 3FPSA 4DR3B 2L17A 1G9TA 3UWDA 1ZESA 1LNQA 3LC1O 4O4LB 1PTKA 2N42A 2ZBFA 4YAUA 1V35A 4EMTA 3CIOA 1YA8A 2IXBA 4OBXA 4R9VA 2NVBA 4ND1A 3D6MA 3OOJA 3L7OA 4BMYA 4DYHA 1NVMB 3A3OA 3AG6A 4OB7A 5HDQA 1SMUA 3X1KA 5HIJA 4BMOB 1R15A 1YJCA 3I32A 3HACA 4QTZA 4X1YB 4HRVA 3UHPA 4WBNA 3SQMA 3H1FA 2X8JB 3UK0A 3FSGD 2WG2A 3GBSA 1ABEA 3QBVA 1E0JA 2B1GA 1F6DA 1M2KA 2W37A 2XITA 1XU7A 3KALA 1Z37A 1GTVA 1LI5A 1U5CA 1S9HA 3CGGA 3Q3VA 4MVJI 4TL8A 1F6BA 1JQKA 3R4CA 4H7HA 1OC4A 5CBKA 1V5WA 4GKJB 2OGWA 3BC1A 3BB3A 2BCGY 2NPIA 3IRUA 1M0EA 4L72A 4RZSA 3QEMB 1FVXA 2Q4TA 4NOJA 3ET5A 2IZ1A 1Z4IA 4DIFA 4NK5A 4BNMA 1A9XA 3HXOA 2HM7A 4KIWA 2HSGA 4FD2A 4DQUA 4D82A 4PGHA 3AXSA 5E1DA 2P91A 4LVNA 2DFLA 4G1VA 5GP1A 4FLFA 1QOPB 1W2WB 2CLOB 4NKRA 3VU9B 1Y8AA 4U0JA 3KX2A 2EW8A 4YVFA 2F3QA 1MIOA 1UJMA 1PFUA 1JKMA 2IVFA 2Q2WA 3V2IA 1VZ2A 2PAAA 2DWOA 4AZ0A 3KVYA 4TWBA 4UDXX 3JQPA 4QXRA 3PC2A 3FZNA 3B8EA 3NBAA 1IRXA 1Q3HA 4HYQA 2I4OA 4CL2A 5HQ3B 3CUKA 3UHJA 1KDVA 2CL7X 4EGCB 2A0FA 1BVUA 1L4GA 1PFYA 4BTEA 1G0OA 3RZTA 2JFNA 5C5CA 5L51A 4FFNA 1RWXA 3TBFA 1IM5A 3UK7A 3UT5A 1B8VA 5I9LA 2WIDA 3NC4A 4C4AA 2IY8A 4V3BA 5A5EA 4F84A 1PUIA 2CJYA 1EDDA 4F2GA 4GI3A 1TLFA 1WUIS 2C9OA 3QBJA 1CYDA 4HYEA 3TJRA 1NFRA 4ARAA 3U4MA 5JSFA 1Y3DE 3WR5A 5KMGB 2SNIE 3IR7A 4DRXB 3F73A 5M04A 3CSUA 1IWBB 1T26A 4DWVA 2IE8A 3EXG2 2EX4A 1MEEA 3WNVA 4Z53A 2QG9A 4XX1A 2I4MA 4YH1A 1PZFA 1KJJA 1S4QA 4RKFA 2ZZNA 1U2EA 3C7AA