3K39A

Crystal structure of b/perth neuraminidase d197e mutant in complex with peramivir
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
389
structure length
389
Chain Sequence
PEWTYPRLSCPGSTFQKALLISPHRFGETKGNSAPLIIREPFIACGPKECKHFALTHYAAQPGGYYNGTRGDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGKEWTYIGVDGPENNALLKIKYGEAYTDTYHSYANNILRTQESACNCIGGNCYLMITDGSASGISECRFLKIREGRIIKEIFPTGRVKHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTETYLDTPRPDDGSITGPCESNGDKGSGGIKGGFVHQRMASKIGRWYSRTMSKTKRMGMGLYVKYDGDPWTDSDALALSGVMVSMEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKETWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Basis of Resistance to Neuraminidase Inhibitors of Influenza B Viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Hydrolase
molecule keywords Neuraminidase
total genus 106
structure length 389
sequence length 389
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 3k39A00
4XJRA 3D12A 4B7MA 4Q6KA 2ZB5A 3GVLA 3A71A 1IVGA 4FPHA 1B9TA 1B9SA 2YA8A 2QWBA 4XIOA 1MZ6A 2HU4A 2XZJA 5HUGA 2QWHA 4WA5A 4K1KA 4YW1A 4X47A 1NSCA 2VSKA 1MS0A 4M4UA 4FOQA 2VWDA 2HTRA 4FPGA 3TI8A 1SNTA 4DGRA 4GZXA 4QN6A 4WEFA 1NCAN 1NNBA 4CPMA 1Z4ZA 2W5NA 4FVKA 1MS8A 4XJQA 1EUTA 2VK6A 2QWIA 3T1EA 1INWA 1INGA 4GJTA 4H52A 4FJ6A 1A4QA 1F8BA 4SLIA 4B7RA 2F0ZA 1IVDA 4KS1A 4QN3A 2VW1A 1NMCA 4GEZA 1XOEA 4MZAA 4X49A 3O9KA 2SILA 2B8HA 4B7QA 5HX0A 1V3BA 2F24A 4XJ9A 4MC7A 1MWEA 4QN5A 4CPLA 4K1HA 2XCYA 1MS1A 1USXA 4MWRA 2YA7A 4FOYA 2BATA 1NSDA 3PJQA 2VK5A 1EURA 2X9MA 1EUSA 5B2DA 1W8NA 1L7HA 3SANA 1IVEA 4KS3A 3TICA 4MWWA 2FHRA 3OPZA 2XZIA 3TI4A 4XMAA 3NSSA 4QN7A 4XIKA 3O9JA 2F13A 1E8VA 3CYEA 4FOWA 5HUNA 1IVFA 1DIMA 4GZSA 2QWKA 2YA5A 4FP2A 4XJWA 4GDJA 3TIBA 3GVKA 2VSMA 2YDTA 1IVBA 4YZ5A 2W38A 2CMLA 1E8TA 5HUMA 4CPNA 4MZEA 4XOGA 3B7EA 4M3MA 1MS4A 1A4GA 1EUUA 1Z4WA 1NCDN 4J9TA 5M1ZA 3SILA 2QWCA 4XYXA 4WA4A 3H71A 1N1TA 3ALXA 1BJIA 1S0JA 1MR5A 4MWUA 3H72A 2HTUA 5HUKA 3K38A 4MJUA 4YW3A 1VCUA 3B69A 4KS4A 2QWEA 3SLIA 5F9TA 1USRA 4GZOA 1V0FA 4KS5A 4MWYA 1NNAA 1V3CA 1VCJA 2A75A 2QWJA 2SLIA 1F8DA 4YW2A 1Z4VA 1W0OA 4D8SA 3JU4A 1MS9A 1NN2A 1L7GA 4H53A 4FPCA 1NNCA 1V3EA 1MS3A 2F25A 1E8UA 4XJAA 1N1SA 1W20A 1WCQA 2JKBA 4FZHA 2C4AA 4MWQA 1NCBN 4FPYA 1V0EA 1A14N 1W8OA 2YA4A 4YZ2A 1SLIA 1KITA 2YA6A 1B9VA 4M4NA 4YZ4A 4XHXA 4X6KA 4GZWA 2QWFA 4HZVA 2VW2A 2QWGA 1NCCN 4MWXA 4FP3A 4NN9A 4QNPA 1NMAN 2YDPA 6NN9A 3BEQA 1INHA 2F29A 2F11A 3A72A 4FQ4A 4XJUA 3H6JA 4MWLA 3INBA 2HTVA 5JYYA 2F28A 2QWAA 4FPJA 4YW5A 3CL0A 3K39A 4MWVA 1V2IA 2F12A 2AGSA 4FOVA 4CPOA 4MJVA 4FPKA 2HT5A 1Z50A 4GB1A 5NN9A 2QWDA 4YW4A 4XMIA 1V0ZA 2HT8A 4HIZA 4JF7A 4GZTA 3K37A 3ALWA 1L7FA 2VW0A 4XHBA 2F26A 2XZKA 2F27A 4GDIA 1S0IA 3TIAA 1DILA 4FPOB 4QN4A 3CL2A 2HU0A 2SIMA 4FPLA 1NMBN 3H73A 1W0PA 4B7JA 2BERA 2AEPA 4GZPA 4KS2A 1INVA 4B7NA 4GZQA 4BBWA 4XE9A 4K1IA 2AH2A 1MS5A 4YZ3A 1Z4XA 1F8CA 2HT7A 1INXA 1W21A 1Z4YA 4UF7A 2W20A 4XJ8A 7NN9A 1F8EA 2RKCA 4HZYA 2BZDA 4M4VA 4FPFA 4MX0A 4CPZA 4I00A 3CKZA 1N1YA 2BF6A 2C4LA 1MZ5A 3TI6A 3NN9A 1NSBA 3GVJA 2F10A 5B2CA 1SLLA 3K36A 3TI5A 4NC5A 4CPYA 4WEGA 4FPEA 4HZWA 4XILA 2HTWA 2W5OA 2VVZA 4HZZA 4X4AA 4HZXA 2AEQA 2ZB6A 2HTYA 4XJZA 3W09A 2HTQA 2VK7A 4NCSA 1V3DA 1W1XA 1INYA 1IVCA 3TI3A 4K3YA 4MWJA 1N1VA 3SALA 1INFA 3D11A 3K3AA 1XOGA 4YZ1A 4K1JA 4WA3A 1SO7A 1WCSA
chains in the Genus database with same CATH superfamily
4XJRA 3D12A 3HLHA 4Q6KA 4B7MA 4ZY3A 2ZB5A 3GVLA 3II7A 2GVUA 3A71A 1IVGA 4FPHA 1B9TA 3BYCA 1B9SA 3VNGA 2YA8A 2QWBA 3Q6KA 4XIOA 1MZ6A 2HU4A 2XZJA 5HUGA 4XMBA 2QWHA 4WA5A 4K1KA 4YW1A 4X47A 3HLIA 1NSCA 2IAOA 4JMLA 2VSKA 3SOQA 1MS0A 4GN7A 4M4UA 4FOQA 2VWDA 2IAVA 2HTRA 5EX7A 1IJQA 2IAXA 3S8ZA 4FPGA 5FNRA 3TI8A 1SNTA 4DGRA 4GZXA 4QN6A 4WEFA 5H47A 1NCAN 2FP8A 1NNBA 4CPMA 1Z4ZA 1C9UA 4D52C 4D52B 2W5NA 4FVKA 4PWZA 4A0PA 1MS8A 4IFLX 4XJQA 1EUTA 2VK6A 2QWIA 5D9DA 3T1EA 1INWA 1INGA 1CRZA 4GJTA 4H52A 4FJ6A 1A4QA 2IAPA 3G4HA 1IUBA 3G4EA 1F8BA 2IASA 4SLIA 4B7RA 3S8VA 2F0ZA 1IVDA 1CVMA 4KS1A 4QN3A 2VW1A 1NMCA 4GEZA 1XOEA 4MZAA 4X49A 3O9KA 2SILA 2DG1A 1K32A 2B8HA 4B7QA 3Q6TA 1ZGKA 1V3BA 2F24A 4XJ9A 5HX0A 4MC7A 4AHAA 1MWEA 4QN5A 5FNUA 4CPLA 4K1HA 2XCYA 3I1CA 4GNCA 1MS1A 2DYHA 1USXA 4MWRA 2YA7A 4FOYA 2BATA 3AMRA 1NSDA 5FZNA 3PJQA 2VK5A 1N7DA 1EURA 2X9MA 1EUSA 2IVZA 5B2DA 1W8NA 1L7HA 3SANA 3Q6PA 1IVEA 4KS3A 3DR2A 2FPBA 3TICA 4MWWA 2FHRA 3OPZA 2XZIA 3TI4A 3SOVA 4XMAA 3NSSA 4GN9A 2FLUX 4QN7A 4XIKA 4IFJA 2IATA 2XN4A 2GHSA 3O9JA 2F13A 1E8VA 3CYEA 3O4PA 4FOWA 5HUNA 1N6EA 2G8SA 1IVFA 1DIMA 4GZSA 4D52A 2QWKA 2YA5A 4FP2A 5EO7A 4XJWA 4GDJA 1N6FA 3TIBA 2OJHA 3GVKA 5GX2A 3KGGA 3V1SA 2VSMA 3V64C 2YDTA 4HHQA 1IVBA 4DG6A 3UC1A 4YZ5A 2W38A 2CMLA 2FP9A 1E8TA 5HUMA 3E5ZA 4CPNA 1V04A 5FNSA 3U0SA 4MZEA 2VPJA 3B7EA 4XOGA 4M3MA 1MS4A 4C1YA 1A4GA 2IAWA 1EUUA 1Z4WA 3KYAA 1NCDN 4J9TA 5M1ZA 4CHBA 3SILA 2QWCA 4XYXA 4WA4A 5FZJA 1PJXA 3P5BL 3H71A 1N1TA 4GNAA 3ALXA 4L7DA 1BJIA 1S0JA 1MR5A 4MWUA 3H72A 2HTUA 5HUKA 3K38A 4MJUA 3WN7A 4YW3A 1VCUA 1QLGA 3B69A 4KS4A 5EO8A 2QWEA 4AGIA 3SLIA 5F9TA 1USRA 4GZOA 1V0FA 1NNAA 1V3CA 1VCJA 4KS5A 4MWYA 2A75A 2QWJA 4R40A 2P4OA 2SLIA 1F8DA 4YW2A 2POOA 1Z4VA 1W0OA 4D8SA 5FWWA 1POOA 3JU4A 4IYGA 1IUCA 4IN4A 1MS9A 1NN2A 3DASA 1L7GA 4H53A 4FPCA 4L7CA 1NNCA 1V3EA 1MS3A 1OFZA 2F25A 1E8UA 4IQKA 4XJAA 2QE8A 1N1SA 1W20A 1WCQA 2ZZKA 4C1YB 2DG0A 2JKBA 4FZHA 2C4AA 4MWQA 1NCBN 4FPYA 1V0EA 1A14N 1W8OA 2V91A 2YA4A 4CH9A 3ZGDA 4YZ2A 4YY8A 1SLIA 3LI3A 3WDZA 5F72C 1KITA 2YA6A 1B9VA 4M4NA 4YZ4A 4XHXA 4X6KA 4GZWA 2QWFA 4HZVA 4ZLRA 2VW2A 2H2NA 2QWGA 5GX3A 4AGTA 5GX4A 1S1DA 1NCCN 4MWXA 1CQ1A 4FP3A 2GVWA 4GNBA 4NN9A 4QNPA 1NMAN 2YDPA 1NPEA 3L6VA 6NN9A 3BEQA 4Q1UA 1SUUA 1N6DA 1INHA 3ZGCA 5FNTA 1WP5A 2F29A 2F11A 3A72A 3NO0A 4FQ4A 4XJUA 2ZWAA 4N1BA 1X2JA 3H6JA 4MWLA 5GTQA 3TC9A 3INBA 3HRPA 2HTVA 5JYYA 2F28A 4FPJA 2QWAA 4YW5A 2GVXA 3LI5A 4UOUA 3CL0A 3K39A 4MWVA 1V2IA 3IAXA 2F12A 3FW0A 2AGSA 4FOVA 4CPOA 1U6DX 4MJVA 3SRGA 2H2UA 4FPKA 4D4UA 4O5SA 2HT5A 1Z50A 4GB1A 3S94A 5NN9A 2QWDA 4YW4A 4XMIA 3WW9A 1V0ZA 2HT8A 4HIZA 4JF7A 4GZTA 3K37A 4ASCA 3ALWA 3S2KA 3FVZA 1L7FA 5D9BA 1RWIA 3SOBB 2GVVA 3AMSA 2VW0A 4XHBA 1QBIA 4AH4A 2F26A 2XZKA 3LI4A 2F27A 4IMBA 4GDIA 1S0IA 3TIAA 1DILA 3V65B 3VNHA 4FPOB 4QN4A 4ZGCA 3CL2A 2HU0A 4O5TA 3WWAA 2SIMA 4FPLA 1NMBN 3H73A 1W0PA 4B7JA 2BERA 1CRUA 2AEPA 4GZPA 4KS2A 1INVA 3A9HA 4CSDA 4B7NA 4GZQA 2IARA 4BBWA 4XE9A 4K1IA 1C5KA 2AH2A 1MS5A 4YZ3A 1Z4XA 4HHOA 1F8CA 2HT7A 2IAUA 1INXA 1W21A 1Z4YA 4UF7A 2W20A 2WOZA 1Q7FA 4XJ8A 7NN9A 1F8EA 2RKCA 2W8BA 4HZYA 5CGJA 2BZDA 1RWLA 2ISMA 4M4VA 4FPFA 4MX0A 4CPZA 4I00A 3CKZA 1N1YA 2VAQA 2BF6A 2C4LA 1MZ5A 4HW6A 1ZI0A 3TI6A 3NN9A 1E1AA 1NSBA 3GVJA 1H6LA 2F10A 5B2CA 1SLLA 3K36A 4G3NA 3TI5A 1S18A 2HQSA 4NC5A 5D9CA 4CPYA 2FPCA 2Z32A 4WEGA 5FNQA 2DSOA 4FPEA 4HZWA 4XILA 2IAQA 2ZW9A 2HTWA 2W5OA 2VVZA 4HZZA 4L7BA 4X4AA 4HZXA 2AEQA 2ZB6A 4GN8A 2HTYA 4XJZA 3A9GA 3ADEA 3W09A 2HTQA 2VK7A 4NCSA 5GX5A 5GX1A 1V3DA 1W1XA 1INYA 1IVCA 4IFNX 3SREA 3TI3A 4K3YA 4MWJA 1N1VA 3SALA 1INFA 2W8BB 3D11A 1X2RA 3K3AA 1XOGA 4YZ1A 4K1JA 4WA3A 1SO7A 1WCSA
chains in the Genus database with same CATH topology
4XJRA 3D12A 4B7MA 4Q6KA 2ZB5A 3GVLA 3A71A 1IVGA 4FPHA 1B9TA 1B9SA 2YA8A 2QWBA 4XIOA 1MZ6A 2HU4A 2XZJA 5HUGA 2QWHA 4WA5A 4K1KA 4YW1A 4X47A 1NSCA 2VSKA 1MS0A 4M4UA 4FOQA 2VWDA 2HTRA 4FPGA 3TI8A 1SNTA 4DGRA 4GZXA 4QN6A 4WEFA 1NCAN 1NNBA 4CPMA 1Z4ZA 2W5NA 4FVKA 1MS8A 4XJQA 1EUTA 2VK6A 2QWIA 3T1EA 1INWA 1INGA 4GJTA 4H52A 4FJ6A 1A4QA 1F8BA 4SLIA 4B7RA 2F0ZA 1IVDA 4KS1A 4QN3A 2VW1A 1NMCA 4GEZA 1XOEA 4MZAA 4X49A 3O9KA 2SILA 2B8HA 4B7QA 5HX0A 1V3BA 2F24A 4XJ9A 4MC7A 1MWEA 4QN5A 4CPLA 4K1HA 2XCYA 1MS1A 1USXA 4MWRA 2YA7A 4FOYA 2BATA 1NSDA 3PJQA 2VK5A 1EURA 2X9MA 1EUSA 5B2DA 1W8NA 1L7HA 3SANA 1IVEA 4KS3A 3TICA 4MWWA 2FHRA 3OPZA 2XZIA 3TI4A 4XMAA 3NSSA 4QN7A 4XIKA 3O9JA 2F13A 1E8VA 3CYEA 4FOWA 5HUNA 1IVFA 1DIMA 4GZSA 2QWKA 2YA5A 4FP2A 4XJWA 4GDJA 3TIBA 3GVKA 2VSMA 2YDTA 1IVBA 4YZ5A 2W38A 2CMLA 1E8TA 5HUMA 4CPNA 4MZEA 4XOGA 3B7EA 4M3MA 1MS4A 1A4GA 1EUUA 1Z4WA 1NCDN 4J9TA 5M1ZA 3SILA 2QWCA 4XYXA 4WA4A 3H71A 1N1TA 3ALXA 1BJIA 1S0JA 1MR5A 4MWUA 3H72A 2HTUA 5HUKA 3K38A 4MJUA 4YW3A 1VCUA 3B69A 4KS4A 2QWEA 3SLIA 5F9TA 1USRA 4GZOA 1V0FA 4KS5A 4MWYA 1NNAA 1V3CA 1VCJA 2A75A 2QWJA 2SLIA 1F8DA 4YW2A 1Z4VA 1W0OA 4D8SA 3JU4A 1MS9A 1NN2A 1L7GA 4H53A 4FPCA 1NNCA 1V3EA 1MS3A 2F25A 1E8UA 4XJAA 1N1SA 1W20A 1WCQA 2JKBA 4FZHA 2C4AA 4MWQA 1NCBN 4FPYA 1V0EA 1A14N 1W8OA 2YA4A 4YZ2A 1SLIA 1KITA 2YA6A 1B9VA 4M4NA 4YZ4A 4XHXA 4X6KA 4GZWA 2QWFA 4HZVA 2VW2A 2H2NA 2QWGA 1S1DA 1NCCN 4MWXA 4FP3A 4NN9A 4QNPA 1NMAN 2YDPA 6NN9A 3BEQA 1INHA 2F29A 2F11A 3A72A 4FQ4A 4XJUA 3H6JA 4MWLA 3INBA 2HTVA 5JYYA 2F28A 2QWAA 4FPJA 4YW5A 3CL0A 3K39A 4MWVA 1V2IA 2F12A 2AGSA 4FOVA 4CPOA 4MJVA 2H2UA 4FPKA 2HT5A 1Z50A 4GB1A 5NN9A 2QWDA 4YW4A 4XMIA 1V0ZA 2HT8A 4HIZA 4JF7A 4GZTA 3K37A 3ALWA 1L7FA 2VW0A 4XHBA 2F26A 2XZKA 2F27A 4GDIA 1S0IA 3TIAA 1DILA 4FPOB 4QN4A 3CL2A 2HU0A 2SIMA 4FPLA 1NMBN 3H73A 1W0PA 4B7JA 2BERA 2AEPA 4GZPA 4KS2A 1INVA 4B7NA 4GZQA 4BBWA 4XE9A 4K1IA 2AH2A 1MS5A 4YZ3A 1Z4XA 1F8CA 2HT7A 1INXA 1W21A 1Z4YA 4UF7A 2W20A 4XJ8A 7NN9A 1F8EA 2RKCA 4HZYA 2BZDA 4M4VA 4FPFA 4MX0A 4CPZA 4I00A 3CKZA 1N1YA 2BF6A 2C4LA 1MZ5A 3TI6A 3NN9A 1NSBA 3GVJA 2F10A 5B2CA 1SLLA 3K36A 3TI5A 1S18A 4NC5A 4CPYA 4WEGA 4FPEA 4HZWA 4XILA 2HTWA 2W5OA 2VVZA 4HZZA 4X4AA 4HZXA 2AEQA 2ZB6A 2HTYA 4XJZA 3W09A 2HTQA 2VK7A 4NCSA 1V3DA 1W1XA 1INYA 1IVCA 3TI3A 4K3YA 4MWJA 1N1VA 3SALA 1INFA 3D11A 3K3AA 1XOGA 4YZ1A 4K1JA 4WA3A 1SO7A 1WCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJR A;  3D12 A;  4B7M A;  4Q6K A;  2ZB5 A;  3GVL A;  3A71 A;  1IVG A;  4FPH A;  1B9T A;  1B9S A;  2YA8 A;  2QWB A;  4XIO A;  1MZ6 A;  2HU4 A;  2XZJ A;  5HUG A;  2QWH A;  4WA5 A;  4K1K A;  4YW1 A;  4X47 A;  1NSC A;  2VSK A;  1MS0 A;  4M4U A;  4FOQ A;  2VWD A;  2HTR A;  4FPG A;  3TI8 A;  1SNT A;  4DGR A;  4GZX A;  4QN6 A;  4WEF A;  1NCA N;  1NNB A;  4CPM A;  1Z4Z A;  2W5N A;  4FVK A;  1MS8 A;  4XJQ A;  1EUT A;  2VK6 A;  2QWI A;  3T1E A;  1INW A;  1ING A;  4GJT A;  4H52 A;  4FJ6 A;  1A4Q A;  1F8B A;  4SLI A;  4B7R A;  2F0Z A;  1IVD A;  4KS1 A;  4QN3 A;  2VW1 A;  1NMC A;  4GEZ A;  1XOE A;  4MZA A;  4X49 A;  3O9K A;  2SIL A;  2B8H A;  4B7Q A;  5HX0 A;  1V3B A;  2F24 A;  4XJ9 A;  4MC7 A;  1MWE A;  4QN5 A;  4CPL A;  4K1H A;  2XCY A;  1MS1 A;  1USX A;  4MWR A;  2YA7 A;  4FOY A;  2BAT A;  1NSD A;  3PJQ A;  2VK5 A;  1EUR A;  2X9M A;  1EUS A;  5B2D A;  1W8N A;  1L7H A;  3SAN A;  1IVE A;  4KS3 A;  3TIC A;  4MWW A;  2FHR A;  3OPZ A;  2XZI A;  3TI4 A;  4XMA A;  3NSS A;  4QN7 A;  4XIK A;  3O9J A;  2F13 A;  1E8V A;  3CYE A;  4FOW A;  5HUN A;  1IVF A;  1DIM A;  4GZS A;  2QWK A;  2YA5 A;  4FP2 A;  4XJW A;  4GDJ A;  3TIB A;  3GVK A;  2VSM A;  2YDT A;  1IVB A;  4YZ5 A;  2W38 A;  2CML A;  1E8T A;  5HUM A;  4CPN A;  4MZE A;  4XOG A;  3B7E A;  4M3M A;  1MS4 A;  1A4G A;  1EUU A;  1Z4W A;  1NCD N;  4J9T A;  5M1Z A;  3SIL A;  2QWC A;  4XYX A;  4WA4 A;  3H71 A;  1N1T A;  3ALX A;  1BJI A;  1S0J A;  1MR5 A;  4MWU A;  3H72 A;  2HTU A;  5HUK A;  3K38 A;  4MJU A;  4YW3 A;  1VCU A;  3B69 A;  4KS4 A;  2QWE A;  3SLI A;  5F9T A;  1USR A;  4GZO A;  1V0F A;  4KS5 A;  4MWY A;  1NNA A;  1V3C A;  1VCJ A;  2A75 A;  2QWJ A;  2SLI A;  1F8D A;  4YW2 A;  1Z4V A;  1W0O A;  4D8S A;  3JU4 A;  1MS9 A;  1NN2 A;  1L7G A;  4H53 A;  4FPC A;  1NNC A;  1V3E A;  1MS3 A;  2F25 A;  1E8U A;  4XJA A;  1N1S A;  1W20 A;  1WCQ A;  2JKB A;  4FZH A;  2C4A A;  4MWQ A;  1NCB N;  4FPY A;  1V0E A;  1A14 N;  1W8O A;  2YA4 A;  4YZ2 A;  1SLI A;  1KIT A;  2YA6 A;  1B9V A;  4M4N A;  4YZ4 A;  4XHX A;  4X6K A;  4GZW A;  2QWF A;  4HZV A;  2VW2 A;  2QWG A;  1NCC N;  4MWX A;  4FP3 A;  4NN9 A;  4QNP A;  1NMA N;  2YDP A;  6NN9 A;  3BEQ A;  1INH A;  2F29 A;  2F11 A;  3A72 A;  4FQ4 A;  4XJU A;  3H6J A;  4MWL A;  3INB A;  2HTV A;  5JYY A;  2F28 A;  2QWA A;  4FPJ A;  4YW5 A;  3CL0 A;  3K39 A;  4MWV A;  1V2I A;  2F12 A;  2AGS A;  4FOV A;  4CPO A;  4MJV A;  4FPK A;  2HT5 A;  1Z50 A;  4GB1 A;  5NN9 A;  2QWD A;  4YW4 A;  4XMI A;  1V0Z A;  2HT8 A;  4HIZ A;  4JF7 A;  4GZT A;  3K37 A;  3ALW A;  1L7F A;  2VW0 A;  4XHB A;  2F26 A;  2XZK A;  2F27 A;  4GDI A;  1S0I A;  3TIA A;  1DIL A;  4FPO B;  4QN4 A;  3CL2 A;  2HU0 A;  2SIM A;  4FPL A;  1NMB N;  3H73 A;  1W0P A;  4B7J A;  2BER A;  2AEP A;  4GZP A;  4KS2 A;  1INV A;  4B7N A;  4GZQ A;  4BBW A;  4XE9 A;  4K1I A;  2AH2 A;  1MS5 A;  4YZ3 A;  1Z4X A;  1F8C A;  2HT7 A;  1INX A;  1W21 A;  1Z4Y A;  4UF7 A;  2W20 A;  4XJ8 A;  7NN9 A;  1F8E A;  2RKC A;  4HZY A;  2BZD A;  4M4V A;  4FPF A;  4MX0 A;  4CPZ A;  4I00 A;  3CKZ A;  1N1Y A;  2BF6 A;  2C4L A;  1MZ5 A;  3TI6 A;  3NN9 A;  1NSB A;  3GVJ A;  2F10 A;  5B2C A;  1SLL A;  3K36 A;  3TI5 A;  4NC5 A;  4CPY A;  4WEG A;  4FPE A;  4HZW A;  4XIL A;  2HTW A;  2W5O A;  2VVZ A;  4HZZ A;  4X4A A;  4HZX A;  2AEQ A;  2ZB6 A;  2HTY A;  4XJZ A;  3W09 A;  2HTQ A;  2VK7 A;  4NCS A;  1V3D A;  1W1X A;  1INY A;  1IVC A;  3TI3 A;  4K3Y A;  4MWJ A;  1N1V A;  3SAL A;  1INF A;  3D11 A;  3K3A A;  1XOG A;  4YZ1 A;  4K1J A;  4WA3 A;  1SO7 A;  1WCS A; 
#chains in the Genus database with same CATH topology
 4XJR A;  3D12 A;  3HLH A;  4Q6K A;  4B7M A;  4ZY3 A;  2ZB5 A;  3GVL A;  3II7 A;  2GVU A;  3A71 A;  1IVG A;  4FPH A;  1B9T A;  3BYC A;  1B9S A;  3VNG A;  2YA8 A;  2QWB A;  3Q6K A;  4XIO A;  1MZ6 A;  2HU4 A;  2XZJ A;  5HUG A;  4XMB A;  2QWH A;  4WA5 A;  4K1K A;  4YW1 A;  4X47 A;  3HLI A;  1NSC A;  2IAO A;  4JML A;  2VSK A;  3SOQ A;  1MS0 A;  4GN7 A;  4M4U A;  4FOQ A;  2VWD A;  2IAV A;  2HTR A;  5EX7 A;  1IJQ A;  2IAX A;  3S8Z A;  4FPG A;  5FNR A;  3TI8 A;  1SNT A;  4DGR A;  4GZX A;  4QN6 A;  4WEF A;  5H47 A;  1NCA N;  2FP8 A;  1NNB A;  4CPM A;  1Z4Z A;  1C9U A;  4D52 C;  4D52 B;  2W5N A;  4FVK A;  4PWZ A;  4A0P A;  1MS8 A;  4IFL X;  4XJQ A;  1EUT A;  2VK6 A;  2QWI A;  5D9D A;  3T1E A;  1INW A;  1ING A;  1CRZ A;  4GJT A;  4H52 A;  4FJ6 A;  1A4Q A;  2IAP A;  3G4H A;  1IUB A;  3G4E A;  1F8B A;  2IAS A;  4SLI A;  4B7R A;  3S8V A;  2F0Z A;  1IVD A;  1CVM A;  4KS1 A;  4QN3 A;  2VW1 A;  1NMC A;  4GEZ A;  1XOE A;  4MZA A;  4X49 A;  3O9K A;  2SIL A;  2DG1 A;  1K32 A;  2B8H A;  4B7Q A;  3Q6T A;  1ZGK A;  1V3B A;  2F24 A;  4XJ9 A;  5HX0 A;  4MC7 A;  4AHA A;  1MWE A;  4QN5 A;  5FNU A;  4CPL A;  4K1H A;  2XCY A;  3I1C A;  4GNC A;  1MS1 A;  2DYH A;  1USX A;  4MWR A;  2YA7 A;  4FOY A;  2BAT A;  3AMR A;  1NSD A;  5FZN A;  3PJQ A;  2VK5 A;  1N7D A;  1EUR A;  2X9M A;  1EUS A;  2IVZ A;  5B2D A;  1W8N A;  1L7H A;  3SAN A;  3Q6P A;  1IVE A;  4KS3 A;  3DR2 A;  2FPB A;  3TIC A;  4MWW A;  2FHR A;  3OPZ A;  2XZI A;  3TI4 A;  3SOV A;  4XMA A;  3NSS A;  4GN9 A;  2FLU X;  4QN7 A;  4XIK A;  4IFJ A;  2IAT A;  2XN4 A;  2GHS A;  3O9J A;  2F13 A;  1E8V A;  3CYE A;  3O4P A;  4FOW A;  5HUN A;  1N6E A;  2G8S A;  1IVF A;  1DIM A;  4GZS A;  4D52 A;  2QWK A;  2YA5 A;  4FP2 A;  5EO7 A;  4XJW A;  4GDJ A;  1N6F A;  3TIB A;  2OJH A;  3GVK A;  5GX2 A;  3KGG A;  3V1S A;  2VSM A;  3V64 C;  2YDT A;  4HHQ A;  1IVB A;  4DG6 A;  3UC1 A;  4YZ5 A;  2W38 A;  2CML A;  2FP9 A;  1E8T A;  5HUM A;  3E5Z A;  4CPN A;  1V04 A;  5FNS A;  3U0S A;  4MZE A;  2VPJ A;  3B7E A;  4XOG A;  4M3M A;  1MS4 A;  4C1Y A;  1A4G A;  2IAW A;  1EUU A;  1Z4W A;  3KYA A;  1NCD N;  4J9T A;  5M1Z A;  4CHB A;  3SIL A;  2QWC A;  4XYX A;  4WA4 A;  5FZJ A;  1PJX A;  3P5B L;  3H71 A;  1N1T A;  4GNA A;  3ALX A;  4L7D A;  1BJI A;  1S0J A;  1MR5 A;  4MWU A;  3H72 A;  2HTU A;  5HUK A;  3K38 A;  4MJU A;  3WN7 A;  4YW3 A;  1VCU A;  1QLG A;  3B69 A;  4KS4 A;  5EO8 A;  2QWE A;  4AGI A;  3SLI A;  5F9T A;  1USR A;  4GZO A;  1V0F A;  1NNA A;  1V3C A;  1VCJ A;  4KS5 A;  4MWY A;  2A75 A;  2QWJ A;  4R40 A;  2P4O A;  2SLI A;  1F8D A;  4YW2 A;  2POO A;  1Z4V A;  1W0O A;  4D8S A;  5FWW A;  1POO A;  3JU4 A;  4IYG A;  1IUC A;  4IN4 A;  1MS9 A;  1NN2 A;  3DAS A;  1L7G A;  4H53 A;  4FPC A;  4L7C A;  1NNC A;  1V3E A;  1MS3 A;  1OFZ A;  2F25 A;  1E8U A;  4IQK A;  4XJA A;  2QE8 A;  1N1S A;  1W20 A;  1WCQ A;  2ZZK A;  4C1Y B;  2DG0 A;  2JKB A;  4FZH A;  2C4A A;  4MWQ A;  1NCB N;  4FPY A;  1V0E A;  1A14 N;  1W8O A;  2V91 A;  2YA4 A;  4CH9 A;  3ZGD A;  4YZ2 A;  4YY8 A;  1SLI A;  3LI3 A;  3WDZ A;  5F72 C;  1KIT A;  2YA6 A;  1B9V A;  4M4N A;  4YZ4 A;  4XHX A;  4X6K A;  4GZW A;  2QWF A;  4HZV A;  4ZLR A;  2VW2 A;  2H2N A;  2QWG A;  5GX3 A;  4AGT A;  5GX4 A;  1S1D A;  1NCC N;  4MWX A;  1CQ1 A;  4FP3 A;  2GVW A;  4GNB A;  4NN9 A;  4QNP A;  1NMA N;  2YDP A;  1NPE A;  3L6V A;  6NN9 A;  3BEQ A;  4Q1U A;  1SUU A;  1N6D A;  1INH A;  3ZGC A;  5FNT A;  1WP5 A;  2F29 A;  2F11 A;  3A72 A;  3NO0 A;  4FQ4 A;  4XJU A;  2ZWA A;  4N1B A;  1X2J A;  3H6J A;  4MWL A;  5GTQ A;  3TC9 A;  3INB A;  3HRP A;  2HTV A;  5JYY A;  2F28 A;  4FPJ A;  2QWA A;  4YW5 A;  2GVX A;  3LI5 A;  4UOU A;  3CL0 A;  3K39 A;  4MWV A;  1V2I A;  3IAX A;  2F12 A;  3FW0 A;  2AGS A;  4FOV A;  4CPO A;  1U6D X;  4MJV A;  3SRG A;  2H2U A;  4FPK A;  4D4U A;  4O5S A;  2HT5 A;  1Z50 A;  4GB1 A;  3S94 A;  5NN9 A;  2QWD A;  4YW4 A;  4XMI A;  3WW9 A;  1V0Z A;  2HT8 A;  4HIZ A;  4JF7 A;  4GZT A;  3K37 A;  4ASC A;  3ALW A;  3S2K A;  3FVZ A;  1L7F A;  5D9B A;  1RWI A;  3SOB B;  2GVV A;  3AMS A;  2VW0 A;  4XHB A;  1QBI A;  4AH4 A;  2F26 A;  2XZK A;  3LI4 A;  2F27 A;  4IMB A;  4GDI A;  1S0I A;  3TIA A;  1DIL A;  3V65 B;  3VNH A;  4FPO B;  4QN4 A;  4ZGC A;  3CL2 A;  2HU0 A;  4O5T A;  3WWA A;  2SIM A;  4FPL A;  1NMB N;  3H73 A;  1W0P A;  4B7J A;  2BER A;  1CRU A;  2AEP A;  4GZP A;  4KS2 A;  1INV A;  3A9H A;  4CSD A;  4B7N A;  4GZQ A;  2IAR A;  4BBW A;  4XE9 A;  4K1I A;  1C5K A;  2AH2 A;  1MS5 A;  4YZ3 A;  1Z4X A;  4HHO A;  1F8C A;  2HT7 A;  2IAU A;  1INX A;  1W21 A;  1Z4Y A;  4UF7 A;  2W20 A;  2WOZ A;  1Q7F A;  4XJ8 A;  7NN9 A;  1F8E A;  2RKC A;  2W8B A;  4HZY A;  5CGJ A;  2BZD A;  1RWL A;  2ISM A;  4M4V A;  4FPF A;  4MX0 A;  4CPZ A;  4I00 A;  3CKZ A;  1N1Y A;  2VAQ A;  2BF6 A;  2C4L A;  1MZ5 A;  4HW6 A;  1ZI0 A;  3TI6 A;  3NN9 A;  1E1A A;  1NSB A;  3GVJ A;  1H6L A;  2F10 A;  5B2C A;  1SLL A;  3K36 A;  4G3N A;  3TI5 A;  1S18 A;  2HQS A;  4NC5 A;  5D9C A;  4CPY A;  2FPC A;  2Z32 A;  4WEG A;  5FNQ A;  2DSO A;  4FPE A;  4HZW A;  4XIL A;  2IAQ A;  2ZW9 A;  2HTW A;  2W5O A;  2VVZ A;  4HZZ A;  4L7B A;  4X4A A;  4HZX A;  2AEQ A;  2ZB6 A;  4GN8 A;  2HTY A;  4XJZ A;  3A9G A;  3ADE A;  3W09 A;  2HTQ A;  2VK7 A;  4NCS A;  5GX5 A;  5GX1 A;  1V3D A;  1W1X A;  1INY A;  1IVC A;  4IFN X;  3SRE A;  3TI3 A;  4K3Y A;  4MWJ A;  1N1V A;  3SAL A;  1INF A;  2W8B B;  3D11 A;  1X2R A;  3K3A A;  1XOG A;  4YZ1 A;  4K1J A;  4WA3 A;  1SO7 A;  1WCS A; 
#chains in the Genus database with same CATH homology
 4XJR A;  3D12 A;  4B7M A;  4Q6K A;  2ZB5 A;  3GVL A;  3A71 A;  1IVG A;  4FPH A;  1B9T A;  1B9S A;  2YA8 A;  2QWB A;  4XIO A;  1MZ6 A;  2HU4 A;  2XZJ A;  5HUG A;  2QWH A;  4WA5 A;  4K1K A;  4YW1 A;  4X47 A;  1NSC A;  2VSK A;  1MS0 A;  4M4U A;  4FOQ A;  2VWD A;  2HTR A;  4FPG A;  3TI8 A;  1SNT A;  4DGR A;  4GZX A;  4QN6 A;  4WEF A;  1NCA N;  1NNB A;  4CPM A;  1Z4Z A;  2W5N A;  4FVK A;  1MS8 A;  4XJQ A;  1EUT A;  2VK6 A;  2QWI A;  3T1E A;  1INW A;  1ING A;  4GJT A;  4H52 A;  4FJ6 A;  1A4Q A;  1F8B A;  4SLI A;  4B7R A;  2F0Z A;  1IVD A;  4KS1 A;  4QN3 A;  2VW1 A;  1NMC A;  4GEZ A;  1XOE A;  4MZA A;  4X49 A;  3O9K A;  2SIL A;  2B8H A;  4B7Q A;  5HX0 A;  1V3B A;  2F24 A;  4XJ9 A;  4MC7 A;  1MWE A;  4QN5 A;  4CPL A;  4K1H A;  2XCY A;  1MS1 A;  1USX A;  4MWR A;  2YA7 A;  4FOY A;  2BAT A;  1NSD A;  3PJQ A;  2VK5 A;  1EUR A;  2X9M A;  1EUS A;  5B2D A;  1W8N A;  1L7H A;  3SAN A;  1IVE A;  4KS3 A;  3TIC A;  4MWW A;  2FHR A;  3OPZ A;  2XZI A;  3TI4 A;  4XMA A;  3NSS A;  4QN7 A;  4XIK A;  3O9J A;  2F13 A;  1E8V A;  3CYE A;  4FOW A;  5HUN A;  1IVF A;  1DIM A;  4GZS A;  2QWK A;  2YA5 A;  4FP2 A;  4XJW A;  4GDJ A;  3TIB A;  3GVK A;  2VSM A;  2YDT A;  1IVB A;  4YZ5 A;  2W38 A;  2CML A;  1E8T A;  5HUM A;  4CPN A;  4MZE A;  4XOG A;  3B7E A;  4M3M A;  1MS4 A;  1A4G A;  1EUU A;  1Z4W A;  1NCD N;  4J9T A;  5M1Z A;  3SIL A;  2QWC A;  4XYX A;  4WA4 A;  3H71 A;  1N1T A;  3ALX A;  1BJI A;  1S0J A;  1MR5 A;  4MWU A;  3H72 A;  2HTU A;  5HUK A;  3K38 A;  4MJU A;  4YW3 A;  1VCU A;  3B69 A;  4KS4 A;  2QWE A;  3SLI A;  5F9T A;  1USR A;  4GZO A;  1V0F A;  4KS5 A;  4MWY A;  1NNA A;  1V3C A;  1VCJ A;  2A75 A;  2QWJ A;  2SLI A;  1F8D A;  4YW2 A;  1Z4V A;  1W0O A;  4D8S A;  3JU4 A;  1MS9 A;  1NN2 A;  1L7G A;  4H53 A;  4FPC A;  1NNC A;  1V3E A;  1MS3 A;  2F25 A;  1E8U A;  4XJA A;  1N1S A;  1W20 A;  1WCQ A;  2JKB A;  4FZH A;  2C4A A;  4MWQ A;  1NCB N;  4FPY A;  1V0E A;  1A14 N;  1W8O A;  2YA4 A;  4YZ2 A;  1SLI A;  1KIT A;  2YA6 A;  1B9V A;  4M4N A;  4YZ4 A;  4XHX A;  4X6K A;  4GZW A;  2QWF A;  4HZV A;  2VW2 A;  2H2N A;  2QWG A;  1S1D A;  1NCC N;  4MWX A;  4FP3 A;  4NN9 A;  4QNP A;  1NMA N;  2YDP A;  6NN9 A;  3BEQ A;  1INH A;  2F29 A;  2F11 A;  3A72 A;  4FQ4 A;  4XJU A;  3H6J A;  4MWL A;  3INB A;  2HTV A;  5JYY A;  2F28 A;  2QWA A;  4FPJ A;  4YW5 A;  3CL0 A;  3K39 A;  4MWV A;  1V2I A;  2F12 A;  2AGS A;  4FOV A;  4CPO A;  4MJV A;  2H2U A;  4FPK A;  2HT5 A;  1Z50 A;  4GB1 A;  5NN9 A;  2QWD A;  4YW4 A;  4XMI A;  1V0Z A;  2HT8 A;  4HIZ A;  4JF7 A;  4GZT A;  3K37 A;  3ALW A;  1L7F A;  2VW0 A;  4XHB A;  2F26 A;  2XZK A;  2F27 A;  4GDI A;  1S0I A;  3TIA A;  1DIL A;  4FPO B;  4QN4 A;  3CL2 A;  2HU0 A;  2SIM A;  4FPL A;  1NMB N;  3H73 A;  1W0P A;  4B7J A;  2BER A;  2AEP A;  4GZP A;  4KS2 A;  1INV A;  4B7N A;  4GZQ A;  4BBW A;  4XE9 A;  4K1I A;  2AH2 A;  1MS5 A;  4YZ3 A;  1Z4X A;  1F8C A;  2HT7 A;  1INX A;  1W21 A;  1Z4Y A;  4UF7 A;  2W20 A;  4XJ8 A;  7NN9 A;  1F8E A;  2RKC A;  4HZY A;  2BZD A;  4M4V A;  4FPF A;  4MX0 A;  4CPZ A;  4I00 A;  3CKZ A;  1N1Y A;  2BF6 A;  2C4L A;  1MZ5 A;  3TI6 A;  3NN9 A;  1NSB A;  3GVJ A;  2F10 A;  5B2C A;  1SLL A;  3K36 A;  3TI5 A;  1S18 A;  4NC5 A;  4CPY A;  4WEG A;  4FPE A;  4HZW A;  4XIL A;  2HTW A;  2W5O A;  2VVZ A;  4HZZ A;  4X4A A;  4HZX A;  2AEQ A;  2ZB6 A;  2HTY A;  4XJZ A;  3W09 A;  2HTQ A;  2VK7 A;  4NCS A;  1V3D A;  1W1X A;  1INY A;  1IVC A;  3TI3 A;  4K3Y A;  4MWJ A;  1N1V A;  3SAL A;  1INF A;  3D11 A;  3K3A A;  1XOG A;  4YZ1 A;  4K1J A;  4WA3 A;  1SO7 A;  1WCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...