3K3NA

Crystal structure of the catalytic core domain of human phf8
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
354
structure length
349
Chain Sequence
RSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PHD finger protein 8
total genus 93
structure length 349
sequence length 354
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3nA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3nA01
5FXXA 5F5IA 5FUPA 4AI9A 3PUQA 5FZOA 5FYYA 5FZCA 5FBJA 2OQ7A 5A7WA 3KV9A 4GD4A 5FXZA 5IVJA 2YPDA 5F39A 5FY4A 5A7OA 4CUGA 2WWUA 2GP5A 3PDQA 5FPVA 5FJHA 5LY2A 4E4HA 5FZFA 4GAZA 5FJKA 3PU3A 5FV3A 5FYBA 5FY8A 5A7SA 5FYZA 5FPUA 5FYCA 5FZDA 3N9PA 5A3WA 4BU2A 5FZIA 5LY1A 4XDPA 3DXUA 3AVSA 4QX8A 2YBSA 3PTRB 4GJYA 3KV5A 5FXVA 2OT7A 5FZ9A 4IGOA 5F3IA 4D6RA 2XDVA 4ASKA 5FUNA 4UF0A 4CCMA 5FPAA 5FP8A 5A3NA 2GP3A 3PUSA 2OX0A 3DXTA 4Y3OA 5FY9A 5FYTA 3KV6A 4V2VA 2YBPA 5FPLA 5FZ4A 2XXZA 4BXFA 4CSWA 5FYIA 4C8DA 5F3CA 2P5BA 5K4LA 4HOOA 4CCJA 3AVRA 5F2SA 5FY7A 5FZAA 5ISLA 5IVVA 5IVYA 5A7NA 4QXHA 5IVEA 5KR7A 4LXLA 3AL5A 5FZGA 5ANQA 2XMLA 5A7PA 5FWJA 4QWNA 1VRBA 5FZEA 5FY0A 5FZ8A 2YU1A 3OPWA 5F2WA 5FPBA 4V2WA 5FP7A 5IWFA 5A7WB 5IVFA 5A1LA 2W2IA 5F5AA 4CCNA 5FZ6A 3PU8A 3PURA 2OQ6A 3K2OA 5FP9A 5FYSA 3UYJA 5LW9A 4HONA 4DIQA 5F37A 5F32A 4QX7A 5LWBA 3U78A 5FXWA 2YU2A 4LIVA 5IW0A 5A1FA 3U4SA 5F3GA 3ZLIA 3NJYA 2Q8CA 2OS2A 5FYHA 3AL6A 3KVBA 3OPTA 4NUBA 5FYUA 3ZPOA 3N9QA 5FZ3A 3KV4A 5E6HA 5A80A 4QU1A 5FP3A 5FY5A 5FZ0A 3K3NA 3LDBA 2PXJA 4D6SA 3RVHA 4TN7A 4BISA 3N9LA 5F5CA 3PUAA 3KVAA 4Y4RA 5CEHA 2WWJA 3N9OA 4UF0B 4CCKA 4EZHA 4URAA 4LIUA 5FZ1A 5FZHA 5A3TA 3LD8A 5FWEA 4EZ4A 5FZKA 2XUEA 2YBKA 5FY1A 4QXBA 5FZOB 5IVCA 5FZLA 4AAPA 3N9MA 5F3EA 4QXCA 2Q8DA 3N9NA 4IGPA 4Y33A 4EYUA 5A7QA 5FP4A 5FZMA 4DO0A 5FYMA 4D6QA 4IGQA 5FZBA 4CCLA 5IVBA 2Q8EA 5FZ7A 4LITA 4XDOA 5FYVA 4GJZA 5A3PA 3K3OA 4CCOA 2VD7A
chains in the Genus database with same CATH superfamily
2NTYA 2ZLYA 5L7OB 2AZ5A 4FTEA 3CJIA 1FEWA 4P0BA 5DAWA 3ZFEA 2QUOA 3VZMA 4YW3A 3POYA 1FX5A 1X33A 2VNVA 4UW6A 3NNLA 3B5MA 1YQCA 4X8NA 5A32B 4CUGA 4DR3T 2X9HA 3FN9A 1EPWA 2D7FA 3PLQA 2XAFB 3A5XA 5APAA 4GH4A 1KEYA 3HWJA 5SV8A 3RHWA 2WA3A 3NBXX 2ID4A 2PHUA 3WF3A 4PT6A 3K46A 3N9PA 4WNKA 2ACZA 4OUSA 4QB2A 1ASJ2 5CISA 1DLLA 2W66A 4YM3A 1RYYA 2HWE2 5FYBA 1NG0A 4F8AA 1G9AA 4XPVA 4FAHA 5AQFB 1POV0 2ZBJA 1ULGA 4CVUA 1RJ8A 1VR3A 1W6NB 2OUHA 3ZSTA 2NW7A 1JS9A 3NRYA 1O8PA 1VBC3 3JBG3 1D0HA 3VRAA 2V72A 4G9SB 4IV3C 1NAEA 2A3WA 4XF0A 2R49A 1N3PA 2HN2A 1TMF2 3U11A 3MLJA 4BLJA 5A3NA 1XYOA 4R9DA 1VBD2 3T1HT 3ZOIA 2YBPA 5CFDA 1U4QA 1X9PA 1OH3A 1YFYA 4CA9A 3RI9A 4LLOA 2LKHA 4LLFA 4AKIA 1W8HA 2Z4FA 4WM8A 4HOOA 3ILFA 2ARCA 3AYEA 4LULA 3TRSB 4AKLA 4HFIA 3BALA 1W0PA 2X67A 1NEKA 3IDEA 4HKAA 5GONE 4QPIA 4Y5Z0 5JDBA 3AX4A 2VTFA 3LGRA 1JZ8A 2Q9QC 1LKNA 5FZGA 1W8FA 4COVA 1WA6X 2WT1A 5JRCA 4XF1A 4QWNA 4AQTA 3H3ZA 1GYKA 1IZNB 4YG6A 2HWD1 2D6NA 4M00A 2K0GA 2YU1A 2G9GA 2IW5B 4WVMA 1XPWA 2BP6A 4YJ3E 3ASIA 4ILAA 3PU8A 5L4EA 2FJDA 2IMLA 2BNNA 3TLUA 2GDFA 3VKHA 4JI5T 3NKGA 1OA3A 4JDOA 4DUVA 4OQ9A 5T52A 3HEIA 5F37A 2DCJA 4GIQA 1OLQA 1RUI3 2DVGA 4YM2A 1MR5A 3QK6A 1XE0A 5AQRB 5AQTB 2BU9A 1CR7A 3LDQB 1CAUB 4CDQB 5J3UA 5JDGA 2FUPA 2CNAA 1SFPA 4PK4A 3SS1A 3AP7A 3GJAA 4N8MA 5AQMB 1E5HA 2OS2A 4CEWA 2VZSA 3VBOC 1U5IA 1PMIA 2OV9A 2WFF3 2X5IC 5DZEA 4QXBB 3DV8A 3C7GA 2DCFA 2FCUA 5FZ3A 1OEDC 1V9U1 1T6BX 2XHNA 3OGJA 1NZIA 3R4SA 5GZDA 1E7PA 1SLLA 3ELNA 1JZ7A 3H1WA 2VB6A 1G6NA 2BVBA 3VDDB 2Y8DA 4D7TA 3AYAA 3LOBA 2E9QA 3KSCA 1T8BA 3AZZA 2OPKA 3O4XE 4MXWA 4D3WA 2MOZA 1ULCA 1YQ4A 4OFGA 4ZI2D 4AXOA 2KWIB 2VZTA 2KINB 1AL21 4TUYE 1Q5OA 2BFUS 2VPVA 2EVXA 3JCIA 4JUYA 1JYNA 1R1A1 3O1UA 3FBYA 4C90A 2I45A 1MIYA 4IV3B 3DYPA 3C8XA 4LE3A 3VHNA 3BQLA 2VM9A 1C8M3 4FI5A 3ACLA 3CKDA 2UWCA 5DQWA 2WZR3 4WM7C 3Q8CA 5J37A 3I1AA 3EUHA 2LALA 3N2GE 1JHJA 3ENRA 3ZFGA 2YXSA 2WDBA 3VD5A 3NJZA 5FYMA 4S2DA 3I9YA 4QH4A 1ND3B 1UNBA 4RQPB 4COYA 5AFEA 3JBG2 4LKEA 2YEVC 1D1CA 2R1DA 4HXCA 4N7UA 4P1NA 2C9KA 2IXHA 5G05L 2QZ2A 3MK7C 5LHHB 5LMNT 2MPFA 3DGTA 2QYWA 3I8TA 4X1IE 5A33B 2D5FA 3K3OA 4X65T 2JQQA 2ZMAA 4ZS2A 2DFBA 2LS6A 2PHFA 2VBBA 2WUHA 2WM9A 3D0JA 1IQAA 1UW8A 2CYFA 3OSDA 4YT0A 3MUY1 4MLOA 4BQ2A 3V0BB 1RHI1 5I93A 2OQ7A 4UFHA 5B4NA 1CAXA 5AVAA 3O1TA 2LE8A 4MHUA 4X20E 2A6WA 2ZAAA 3MW3A 3PNAA 1VBA1 1X82A 4MOAA 2DVAA 3VHPA 1W03A 3CQOA 4Y1UA 4C0BA 5FZFA 3LB9A 4UV9B 3WW2A 1SBEA 5FIXA 3O1MA 4XBFB 3IIIA 2P3KA 1XE7A 5FYZA 1XRUA 4GZ9A 4XDPA 2VUJA 2IDOB 4QX8A 1HRV3 3HBKA 3ZYJB 5JMCA 2F6BA 3UL2A 2VVSA 4HTEA 3LBXA 5CG9A 4OI2A 4QPGC 1RB8G 4CN4A 2PHDA 1WWYA 2JG9A 5F3IA 3AP9A 1JYIA 3SLIA 4U3CA 2BRTA 2WU5A 4W65A 1GR3A 1PO22 3BGAA 5BR8T 4GA9A 1KNRA 4XTMA 1ULOA 2RA1A 4I55E 4NRMA 1DQ2A 1UURA 4GULA 2R041 4YW2A 4YW1A 5HEGA 1RXGA 3T09A 2WMNA 3GZUC 4QKNA 2J1UA 3J7HA 2A3DA 3U07A 3O7OA 3AZXA 4E2QA 1GANA 1YI9A 3SFEA 3BCWA 4PLMA 2B39A 1DP0A 1OLMA 2EHOB 2WFF2 4HK9A 2V5DA 1R1A2 2WYSA 4I30A 3KGLA 4QXHA 1SEFA 2K24A 1S2BA 4Z82A 5KR7A 4HKWA 4AEJA 1YJLA 2YZ4A 2J1VA 1PHMA 5DUVA 3KHCA 5LK7B 2MBGA 1FNZA 3FB2A 1AR71 2QQLA 5GZFA 5I0RA 1QDOA 3LDKA 4X66T 3E22E 4YFWA 4YG3A 4R9AA 4AQGA 3DCQA 3ZIXA 3H3LA 5A6ZA 2UY9A 3WY6A 3ACHA 3AEEA 1DU2A 5CAZA 3WQBA 3CMLA 4NWWA 1HCIA 1JOBA 3K2OA 4RR3B 1UZVA 1XDOA 1BK0A 3ZYLA 5BNOB 2JB4A 2BVMA 2CBJA 4LMJA 3IM0A 3NMBA 2WSSV 3T1YT 5J96B 4RR3A 4HN1A 1I6ZA 4MXWB 4U7YA 1SBFA 4GALA 3I2OA 4IEVA 5L9BA 2ZGSA 2LROA 3RWNA 3B13A 2VL4A 4CU7A 1GP4A 3H3MA 4L0PA 3ZKUA 3AXJA 5KHKA 4Z8XA 3U37A 2DL1A 4D8MA 3VZLA 1UYYA 4B3RT 2XL7A 2V09A 2JG9B 4MLKA 2D3SA 4OMCA 3U1XA 2FDGA 2ZGNA 4L8QA 4DV5T 3SKJE 1LB2A 2DI4A 3ABZA 4TSVA 1LOFC 2WU2A 1FMD3 3UESA 4QD2A 4CEWB 2Y8KA 4X6QB 4NUUA 3NKTA 3CLPA 5FZ0A 3BPSA 3K77A 3RGLA 2XQ9A 1I94T 1RMU2 2CMRA 1CAUA 3P4WA 2D93A 2CM0A 5HXCA 3OTOT 2WO2A 3IT8A 1MZ6A 2UYBA 4QM9A 4AFAA 1NAFA 1KNPA 2A5ZA 4BMEA 4YYOA 4HVQA 1RVF1 5FZHA 3VD9A 1Q8QA 2ZPXA 3RQWA 3LPGA 3L3PA 2ZGOA 3AEGA 5IAXA 1VBE1 3D3AA 1ULFA 2VKHA 3SC7X 4KWUA 1T7SA 3FZLB 4IDPA 4UT5A 4COZA 3OY8B 4ZU4A 4XUOA 5T5PA 1O3RA 4ATEA 4FJOA 4NHKA 4BQ1A 4TZ4C 5ABFA 1CJPA 3A21A 5FAXA 4DO0A 5FOBB 3LEMA 1ZOYA 4KGQA 2CXDA 3VBUA 2ZM8A 3OBVE 2C1FA 2Q8EA 2XQ8A 1LHNA 2LEHA 3VHLA 3ZPYA 4TWDA 2Q30A 4JHZA 4ZS3A 3GWHA 4JEUB 4CDUC 4BJMA 4QHOA 1CWPA 4GH4C 4UFLA 3WX5A 3PE0A 2MEV3 3NWIA 5F5IA 1WLTA 2FDJA 3EMRA 3PUQA 4LFCT 1W8TA 2GC0A 2M67A 2ZTNA 4ASMB 2WP9A 4NMIA 3WUCA 1LCLA 4NPPA 3AMMA 4GD4A 4LO4B 4QGNA 2O14A 4YRDA 5C7GA 1SG3A 3RYPA 3HNMA 5J0ZA 3M7AA 4GK0E 5CKQA 4E4HA 4A42A 3KBTA 4I0WB 3RQUA 3SCGA 4QPGB 4CDQC 4AI3A 1NXMA 3HJRA 2KR2A 2QQKA 3BPZA 4ISRA 3RSJA 2Y6JA 1AR72 3M3CA 4E8CA 3DXUA 1JYXA 2E31A 1RIRA 4LEJA 4X6RB 4U2AA 2P9BA 1LULA 2SLIA 2DUPA 1RGSA 1D0YA 5FXVA 1V6NA 3HN3A 3NQHA 5IT6A 4M1PA 2W1SA 2W63A 4UBHA 4D6RA 3EVYA 5DABA 3ZJ2A 2VU9A 3GDBA 3ZC1A 1PX3A 1IOAA 1T6GC 1VAVA 2RS13 3HNYM 4I0AA 1V9U2 1MEC3 3WP3A 4DV7T 4FAGA 5C3RA 2XASB 1D0GA 4AEDC 4M4RA 3AEDA 4XAAA 4B8EA 5M0TA 4AE2A 4GWMA 4FO9A 1GQEA 2XXZA 3ZN6B 1W9SA 5L19A 3VBRC 4IEPA 4KQ7A 3B93A 1LAJA 1W3XA 2Y64A 1XU1A 1GWKA 1PVC3 3RLFF 3P7IA 1QOSA 1QJX2 4QKFA 4BK4A 4M4PA 5JCTA 5JSOA 3MF6A 4HWHA 4ILBA 3TNQA 1LOAA 1OPMA 4CP1A 4DR7T 2I07B 1ASJ1 3I3QA 4JX0A 3P8CD 3O0WA 2JQ9A 3V65A 2XJUA 4N78D 4QPWA 1OEDA 3UKVA 3Q5DA 2KLQA 4TWFA 1DG6A 2WNEA 2IHR1 4EEDA 1R093 4WVZA 3ZFFA 4E4DX 4YZ5A 2G9ZA 4CRQA 4HFEA 2W2IA 2ADDA 2BOJA 4PBOA 1WCRA 1LEDA 2J1TA 3AA6B 2WWSA 4NIAA 2WNUC 1NLRA 3CX6B 4OUEA 2B1EA 4K3UA 2C0ZA 4TWTA 4W6WA 2JB8A 1UYZA 2WBKA 3HVDA 4FQZA 4FPHA 3O1OA 1JNRA 1ODNA 3PUVF 2KNDA 5AQHB 2Q1FA 2IC6A 4YPJA 1S0DA 3UTKA 1ZRIA 2O8QA 2JE8A 5HCFA 3FZ3A 1W28A 3DPRB 3KCCA 5FVLA 1YQ3A 2ZXQA 2W39A 1CZTA 2E7AA 5CVRA 3V56A 2VR4A 3KVBA 4QXKA 1AYM1 2VVNA 3C7EA 4YJ2E 3HMYA 4FPJA 4JI0T 1YQ2A 5AQIB 3OVUA 1LOFA 1W8UA 3T08A 2HWC3 4HFDA 5AQQB 4JI2T 3I3DA 4TLGA 4BQYA 1KFXL 2B45X 3KB5A 5KC5A 1OLRA 2BERA 1S0GA 1FATA 1RUF3 1VPHA 1HX6A 4MYEA 2J4GA 2EXHA 3KLSA 4A3ZA 1OF4A 3FZMB 2DDUA 3T8OA 1D4M1 5CA6A 4HFBA 2UY8A 2VMHA 4IEYA 4K20A 4SBVA 4DINB 1ZKEA 4Q4V1 4DRVA 5A3TA 3H7JA 4OLLA 1UY3A 3RI5A 3ZFEB 4QHBA 1WMDA 3B69A 1OXCA 3M3IA 4QB6A 2LLYA 1OKQA 2BUKA 1YQ5A 5FFOC 5AVPA 3WINE 4NUVA 3WR0A 1WLDA 2CAVA 4YSXA 5JDQA 1C4RA 1FXZA 4OUMA 2BGCA 4XUPA 3ES1A 4PDWA 3ZYBA 3M3EA 3EABA 2Q5TA 4OULA 3RJRA 3SEEA 1RUG1 4GH4B 5FZ7A 2W95A 3NRXA 4PW8A 4AW7A 4QX5A 4O9EA 3SH5A 5AFBA 1QJU3 1FAYA 3SQOA 5FMNA 3GHMA 3MDPA 2I74A 1GBGA 2KWHA 4IREA 1OSGA 2VGDA 1C5HA 3HQXA 3OJBA 4QMAA 2A71A 3CX8B 5T5LA 1HN0A 5BV6A 1OOPC 1QJX3 3QNUA 2J42A 1RUE2 3H0OA 3PUWF 1PIV1 3JXSA 1E1HB 1RUG2 1ND2B 2WWUA 5J1XA 3L8RA 5AQSB 3ZCIA 1BKZA 2IUBA 3AXEA 4XIOA 3RFRA 1AXZA 3W21A 2VQET 3AMNA 5I0TA 5CFCC 4WBBA 2XUMA 1K5MA 1UZ0A 3UUMA 3HD8B 4Q5OA 5FZIA 3MPPG 4DBRA 1D1BA 1OLME 2EIDA 4TV8E 4QH1A 4JQRA 1UCXA 2NM1A 2YC0A 2W00A 2X68A 2XJTA 4PK5A 4PBPA 5E88A 4EROA 4NIDA 4CI3B 1FNYA 3AZVA 3ZYFA 1WD4A 1RMU3 1J5WA 2ZZQA 4HT1T 3EXUA 2PFWA 4O7XA 5CKMA 1SLIA 5EZYE 1UGOA 4O4LE 1QH6A 1XMQT 1O3SA 1ZBA3 3RGBA 5C3SA 4AGGA 4LO7A 3SKVA 1H8TA 1FMVA 2VOVA 1AUYA 1LHUA 4KGGA 4V2VA 4BK5A 5FZ4A 4EIWA 2ZM6T 4ISSA 1WCKA 3K51A 4LBQA 4MH0E 3ZSEA 5DG2A 4KUMB 3AFGA 5FZAA 3BU0A 1IGOA 3Q5XA 3TN92 2W3JA 2WA4A 2UXDT 2FJAA 4RFT0 1YCIA 2AEZA 1OFSA 2DVBA 2XJPA 3ILNA 4LXLA 2HWB3 2ZGUA 4U2ZA 2X09A 2WZPP 5F3JA 4QAWA 5KBFA 4K21A 4E7SA 4YFSA 2V7MA 1ZHCA 2V26A 1VBE2 3IWZA 4HN0A 4BAYB 4AFMA 3ZEFB 5F2WA 4UIGA 5DUUA 5H9SA 4OHFA 4A44A 4AYUA 4HVRA 1BR0A 3IBMA 4PIYA 3C64A 3GBWA 3MJXA 4JDMA 1AX2A 2IXJA 4BCUA 4BWOA 4DMIA 3ZO0B 4GWNA 4PAGA 1ZZBA 2V6XA 4UXNB 5AQNB 2E63A 4QDQA 2XTLA 4DIQA 3F57A 1N1YA 2GNTA 2RMU2 5FR3A 5KX5E 3AMHA 1GWLA 3O1HA 2YU2A 4JI1T 3MUZ1 1CESA 1G86A 2YFZA 2NW8A 3VKGA 2XL9A 2XY8B 4LBQD 4XJAA 5F3GA 1IHMA 3OBAA 4QB1A 2LHRA 3ZFFB 3O1VA 4PQQA 3FXDB 1PVC2 3A22A 4MGZE 4YW6A 4RS5B 2X9XA 4NUBA 4H2AA 3NNGA 3ZSMA 2IC9A 2DUQA 4XFCA 1PVXA 3J26N 3GA8A 4HWFA 4CP9A 1J1JA 3KV4A 5LHIB 4H7MA 3VBOB 5JZGC 3AE2A 1MNEA 1QF3A 2FD8A 3ZFGC 2XVGA 3E97A 3AKTA 4M3CB 2CWOA 1EV11 5B4XA 4U33A 3EYPA 3VBSC 3ZMSB 1V0AA 2J1SA 1H9WA 4IEOA 3VD3A 4BISA 4AQSA 1H2KA 4P5HA 1RUD2 3MI8A 1RUJ3 2RHPA 4EXTA 1VE0A 3SFDA 4GKKT 1YYNA 2BKOA 2AC1A 4QQ2A 1UKGA 1BEV2 1FV2A 1SLCA 1EUUA 2KA3A 2JRKA 4FPGA 3MIGA 5FY1A 3MZKB 3UQ7A 1NLSA 5ACA1 4KHPT 2BG9E 4MUVA 2Q8DA 1N33T 5LGUB 1IBLT 1GZWB 1X9TA 2JDAA 4CDWC 1LU1A 5FL1A 4UVBB 1R092 1MS9A 2HWF3 3MGUA 3NKZA 2NMOA 1AR92 4RR3C 1S0BA 4Q1RA 1JW6A 4B3MT 5DZGA 3OG2A 1ZBA2 4YGCA 4UV8B 4J2CA 5IAVA 5JPMB 3U0ZA 4CEYC 4IE7A 1Q3EA 3I2JA 1W0BA 4WYVA 3IKWA 3IBPA 1UCUA 3MICA 4XXAA 1W39A 3AEAA 1MS4A 1ZVFA 2A75A 2ZABA 3D0TA 4IXLA 2X8KA 3OGRA 1BXHA 1VBB1 3VLBB 3VD7A 2VZ1A 2DU1A 5FPVA 1QXJA 4LKDA 1MMAA 1VBB2 2BBAA 4NAOA 1QQP3 4XABA 1CAVB 3I2DA 2CHHA 1LOBA 4P9JA 2YGMA 1LVKA 5FPZA 3OBZA 3HNBM 5FY8A 4B1LA 4WW0A 2A7AA 1MVEA 4I50E 4Z90A 4O2AE 3ZN1B 1OQEA 2DV9A 2N7GA 4X8PA 2NTXA 1IPSA 5GLTA 4ZXKA 2HN1A 2D6KA 3OY8A 5LA9A 2VQ0A 4EE2A 3HOBA 3GZAA 5L3GB 5HEJA 3WAJA 1STMA 1W8WA 1X8MA 3JQXA 4EV0A 5C8CA 5DMYA 1GOHA 5C5UA 4YVSB 2D3RA 1W8ZA 1YKEB 4B3ST 1DGLA 1SLAA 2KXPB 1VB4A 1YHFA 1SLTA 3DUIA 3G6JB 3I2GA 3LSDA 4JI3T 2V7LA 4ET7A 1P8JA 3H9AA 3T2OA 5FNVE 1CZSA 3KCXA 2RE9A 4MSVA 3QD6A 5FY9A 3VBSB 3ZT6A 3OCPA 1G73A 2JQHA 4EN6B 4CSWA 3TBDA 2VAUA 4JTNA 4IE5A 1RL3A 4M3CE 5FY7A 3AE6A 2ZM2A 1WLWA 3IIAA 2V5CA 5EYXA 1WMEA 1IBKT 1COV1 1BBT1 3HIFA 2L9QA 1OUXA 1AL22 2GAUA 3A8YC 5ANQA 3C98B 5FWJA 3ZMOA 1PO11 3AAIA 4W6YA 1JYVA 1HJFA 4XFBA 2LHNA 5LJNA 2JIWA 3S4UA 1W9WA 1R8IA 3KHBA 3PL0A 3ZCJA 1SFNA 4J25A 4AVVA 1UY0A 4P9GA 4CCNA 3BKZA 3A7MA 5EQUA 3E08A 2LT3A 3C7HA 1QOOA 1L3JA 3AP4A 1LRHA 3OEBA 3AP5A 4XIKA 2IUWA 4IE6A 2B5HA 2DURA 3QUJA 4TWHA 3IDCB 1ZP0A 4K6BA 2LTNA 4Q4W1 1OMIA 5LBCA 3ZXFA 3M8LA 5K0UC 4IHJE 5A33A 4WVWA 4KI0F 4I01A 4AF9A 2ZX3A 1Q8PA 4XMIA 1MZEA 1YW0A 3CJIC 4XYXA 2Y6KA 3AJZA 4G3YC 3O1IA 2VG9A 2MYSA 2HEYF 4LBJA 3ZFGB 3SHRA 2UYAA 2VOTA 3VL9A 3VBHC 1RUOA 1EAH1 4DBQA 3CHXA 1W9RA 2FMYA 3JD71 4PLNA 3WDWA 4P9IA 5FDBA 1AR93 3RYKA 1QJY3 3WW4A 3ZYGA 5KXDA 4IW3A 1QKQA 5L3BB 1I5PA 2QBXA 1R082 4IEWA 2ZCWA 2ZM0A 1JUHA 4PDWC 2HWB2 4XJZA 1S0IA 1YQ6A 2RS52 3WAKA 2RVAA 2XWJB 4FP3A 1S0FA 3WNMA 3H1YA 3TYJA 2VUDA 2HWE1 1O4ZA 5EK2A 2GMEA 4N53B 3K3NA 1GICA 1X7NA 2NPIA 5GALA 1NX9A 1JYWA 3U4XA 2QQJA 4YZ2A 3RVHA 1Z78A 2XONA 2XJRA 3T0AA 4NPLA 1OHFA 1N47A 3AKQA 2R071 4WM8C 4H9SE 4RD7A 1HRI1 3DTOA 3VDDA 1UY2A 1NUKA 4DUYT 2DTYA 3M3QA 1SLBA 1WBLA 3T4HB 2DCKA 3KT7A 3W5MA 5HEOA 3FHQA 3VBFB 1POQA 4H3WA 2RMU3 1IG0A 1MACA 3TN93 3THPA 1IAPA 5K8SA 1VBA2 2G1MA 1LOGA 4QXBA 4RHV1 1OPOA 3AMQA 1PX4A 5C8CB 4FTSA 3IEEA 3KFWX 2BQPA 1FOD3 1US2A 2ARAA 1DDLA 2CE7A 2D44A 1KITA 2ZHKA 1A34A 1VBC2 3KQRA 1J1TA 4Q25A 2HKXA 3I97A 3ZMZB 1DU3D 3WHTA 3TNPB 2YB7A 2DFCA 2H0VA 4QX0A 5JH7E 5AFUL 1MS3A 2C26A 2IIUA 2ZHNA 4HVOA 1IS4A 5E89A 1GV9A 3USUA 4C0HA 4LBNA 1BLZA 2WQ4A 3V0BA 3JAFA 2R6GF 2BZDA 2ZZJA 3MXZA 1MQTB 3P6BA 2RDQA 3KD4A 4Q4Y3 4WV8A 3SH3A 4AQFC 5IVJA 5LCWL 2Y26A 5FY4A 5KXEA 5ABGA 1X36A 4QT6A 2UXBT 1ENQA 1RUE1 5KHIA 3MA9A 3OUIA 3WW1A 3AJYA 3HL6A 4F6RC 2ZGQA 5FZDA 3RI8A 2VQUA 1NA1B 2YKSA 4I43B 5D8AC 5BNPB 2B8MA 3J4UH 3P4QA 5LA2A 3H8OA 4Q26A 5BPXA 3S57A 3ETQA 2H7VC 1Z0PA 1C8NA 4ZI3C 3UFEA 3MIFA 1R081 4TZDA 2D0TA 2DF7A 2HWF2 2WS91 2XDVA 1QEXA 4K0UA 5L47A 2VBDA 2VCCA 3B02A 3RH3A 3LZZA 1RUD3 3M70A 1UZYA 2RM23 4DB5A 5J36A 3U10A 5FP8A 4XJWA 3HKDE 1CN1A 1ZBE2 4UFKA 1XNCA 1V6IA 3AC0A 4Q0QA 5K7PA 2WLPA 2YG0A 2WJSA 1BEV3 3MIEA 4AQ2A 5LHGB 5J48A 4IEXA 5FYIA 4C8DA 5C3OA 3IMMA 2PJQA 3JCFA 5EHDA 2HYXA 4MGYE 5K0UA 2RR12 1FPN3 1W6QB 3C4WA 3NNFA 4UOJA 5A3WA 4DEVA 2JDZA 3HKEE 1VBD1 4D0QA 3O14A 1QHDA 1WCQA 3RZLA 2QQWA 2RR11 3WP5A 3KT4A 3LG7A 3KF5A 2FJEA 2DCTA 4K9SA 2UXNB 1HF8A 1VRBA 2KSRA 3FXEB 2BYVE 3EAMA 2KMFA 4B4QA 4LF7T 4YVWB 3I54A 1U0AA 4FFFA 1F4HA 4ZZ5A 3CJIB 4PJJA 3R6NA 1G9FA 2BV4A 2RJLA 4LFAT 1UN1A 5FMOL 1YUDA 1QIQA 2IAKA 2IVIB 2QGSA 4DV0T 1QJEA 2F4PA 2ZMLA 1YIFA 4FPEA 2EXKA 3BQKA 4K8FA 4KG8A 3ZYPA 4CDWA 2WNUB 4YG0A 4DPNA 4OQ8A 2NP9A 2FDIA 4YW5A 1HXS3 2B76A 4RHV2 3ZYMA 1NT0A 5L3DB 4FFGA 4PHZA 1OA4A 1KS5A 2QQOA 3H3AA 4A97A 3B94A 3MKDA 4KWJA 4BXSV 2D98A 5AC93 2E53A 5DAQA 3W5NA 1AVBA 1T2XA 1UOBA 4RGGA 2YOEA 4XURA 4YVSA 1MVQA 4AEDB 3PUHA 4CDXA 1MMDA 3H42B 4HFVA 4IL7A 4JCKA 4LQRA 4NHXA 2W87A 3O0VA 4BQ5A 2YINA 3RZKA 1BYHA 3FJSA 4UW4A 4F7ZA 5H6RB 3PIJA 1J58A 3I2KA 3VDDC 3NNJA 3TEWA 5FLHA 1S0JA 2P6HA 1IPKA 5LBEA 2XQ6A 2YDSA 3O9XA 5BNNC 1FV3A 1PO23 5BNOC 5CBLA 3N9OA 1LNSA 1LVFA 1MS5A 1N1SA 1ZA7A 3FLRA 4I02A 4URAA 4JGYA 4PCRA 1XC6A 4QKBA 2CL2A 1VRH1 4PI0A 2W62A 4EZ4A 2OPWA 4TX5A 4DUZT 5DQVA 5F8PA 4YTMA 1TVGA 1Z7S2 1OWAA 1DF0A 1WW7A 3MEPA 3MV11 4OZOA 4UXAA 5A6XA 2VOKA 4D94A 3FHNA 2R1BA 4Y1XA 2JMKA 1AJOA 4IUGA 3K4DA 4UWDA 1WW5A 1SCRA 3J7Yq 1YNAA 4O65A 1ENRA 1Y01A 2ODVA 4EEBA 2WZEA 4LHSA 2VNOA 1YEWA 2G9FA 2XG3A 4JGZA 5FZBA 2ZKNA 1D2SA 1VAKA 2BWAA 2CGOA 2QVAA 1GZWA 2XQAA 2QQMA 5DZFA 3IB3A 1C3HA 1W2UA 2R0FA 4QQOA 4GWJA 1W6MB 2PMWB 2F4VT 5JVDE 2XSBA 2ACXA 4GOUA 5ABHA 5JIAA 4E4ZA 1WKYA 2LSJA 1ULEA 2CHNA 5JDHA 3T2PA 2GNMA 4CTEA 2VKOA 3AEFA 1YXRA 1Q8VA 5F39A 2LRKA 3K1SA 4YSZA 2WFF1 1WR0A 3NZQA 2JG8A 1PK6B 3OGVA 4MHCA 3RZZA 3ZSKA 3L9JT 5AQPB 2ARBA 3WG3A 1JZ4A 4WM7A 5D8AB 5BNPC 3H1MA 4RQPC 1OQ1A 3K4AA 1LODA 1JOJA 4FI9A 4M3CA 4N43B 1W6QA 5E1RA 4NHYA 2RS53 4PI2A 1J1LA 4JI7T 4QXCB 3NV2A 3ZSJA 4A7ZA 1YLLA 1JBCA 1RUC3 2D6OX 3UU5A 2W0GA 4DXTA 4H63V 1H6YA 1XOYA 3APBA 5FKCA 4BLIA 3KCYA 4COFA 3DJBA 1OXZA 3RJ2X 5JTGA 1XNQT 4NO4A 1BZWA 5GJ6A 2KXLA 4NIGA 1UX5A 3KV6A 1ZZCA 5JSPA 1UK5A 4AVBA 2PBIA 4H63H 3ZT7A 2NN8A 2XH6A 3MF9A 4XZUG 4BXFA 1EY2A 3CL1A 2YDRA 4CCJA 3NV3A 1NA1A 2NYYA 5L3EB 2WZR2 4KU7A 2JJ6A 3WI3A 4Z07A 4A2UA 4YARA 3DP7A 2Z69A 4LJHA 4NN0A 5J2UE 2A73B 2TBVA 4DR5T 1LR5A 2VXRA 3ACIA 4QPGA 2ERFA 3NNMA 4XAEA 3OYXA 2MHFA 2LM3A 2YV8A 3ALQA 4EJRA 3Q8BA 3SMHA 3RIUA 3HR0A 3ZX7A 2JX9A 5JOXA 5T5JA 1YQ8A 2EIBA 4LOTA 4LUMA 3UULA 5KHGA 1QWRA 5FZ6A 3VDBA 2IXIA 5LP6E 1LEMA 1EYBA 1O6UA 1FI2A 2EHOD 2J1EA 1N1TA 1OURA 1ZEEA 2E7QA 1U5PA 1KS4A 2EALA 3E5XA 3UYJA 1OUSA 4P9YA 1N32T 5DJQC 3KF3A 5F32A 4Q4Y2 2YFUA 2TEPA 3DN7A 3GM8A 4LKSA 1I1EA 2AREA 2AUYA 2WMOA 3WZ1A 2C24A 2DCZA 4UFIA 2MTQA 4LA2A 1H8TB 5JXIA 1YFXA 3UK9A 2AYHA 2JDYA 4IQPA 1ZX5A 4R4XA 4E8DA 1KGYA 3OPTA 2G0UA 4MFRA 5FYUA 4GMP3 1LRZA 3DL3A 1XJAA 2QRXA 2VVFA 1RXFA 3DEMA 3JB8A 3UUXB 5AQVB 4L2NA 5T55A 4LF4T 1GZ9A 4O9GA 2M6IA 2VW1A 4BA6A 3GF6A 4M0NA 5J7MA 3R84B 3R4DB 1LKXA 2C5IT 3JC6D 4N43A 3O1RA 4EN7B 2R16A 1VCTA 2XBO1 2HLEA 2UU8A 5DG1A 1XMOT 2XAGB 4XTPA 4P9WA 4AI8A 2RS32 4GYSA 3P3PA 3I3MA 2RS12 3H8UA 3FMGA 5EYYA 1GMMA 1WCDJ 4G2AA 1O5LA 4N53A 3SISA 4UF0B 3WNOA 4COUA 4Z92B 2BS3A 2R072 1DZQA 4LIUA 1E5IA 4GKYA 2VZUA 2YBKA 2BKNA 2W2UA 1AR81 4A56A 1AR73 5IVCA 1UKRA 4IETA 2XLFA 3DKQA 3S0MA 4ARYA 4HMZA 4Y33A 2XOMA 3LCPA 4JI6T 2NOXA 2JG8C 2RG4A 3ZKYA 1KEXA 3NL1A 5AC92 3THDA 3N36A 4JGZC 4CU8A 2MAWA 1OFNA 4CE8A 1GP5A 4XVHA 5JLVA 1H8VA 5FTTC 4AISA 2WDRA 4CEWC 5JMOA 5A3MA 4CCOA 5JWPA 2CBIA 5JXJA 3HQUA 4MGTA 5FUPA 5FZOA 4EYYR 1OQDA 1ZREA 3TB0A 3CF6E 4Y20B 3Q8EA 4M3CF 2CLYB 2DWGA 4CI1B 3THTA 1DGRA 5FPXA 2BTVC 1CIYA 3URFA 3ANWB 1VB2A 2VW2A 5HI0A 1CPNA 1QGLA 4YHHT 1F2NA 4RA0A 3S6PA 1Z8UA 4LO6B 1WW6A 3PUYF 2ORXA 5A7SA 2DWKA 5FPUA 5JR9B 1Z7S3 5LY1A 1FYUA 2BGOA 1K45A 2OZJA 3JBG1 3PUIA 1QMJA 2YBSA 3PTRB 2AH2A 1MS1A 2EA7A 2JDPA 3MIHA 3OBRA 2CU5A 4DXZA 3EB7A 4HKLA 1H1IA 5T50A 1XNDA 2F17A 3MLLA 2XQ4A 4NXMT 1QUUA 4OI1A 1RVF3 4S2HA 5GLZA 1GNZA 2VJXA 3N2OA 4FPYA 5TAOA 4Y3OA 4U36A 1VALA 1WRDA 1S2EA 3WG1A 2E33A 2DYCA 3ZXAC 5JR2A 5SV5A 2Z2SB 1UL9A 3Q5WA 4KWKA 4NXNT 3EDVA 5GKAC 3GBFA 4Q4V2 5CZKA 3H37A 2HWD3 4J1WA 5CADA 5F9TA 3VR8A 2BDEA 2VZVA 2Q9QA 1YC61 2VNRA 4P09A 2VQAA 3IPVB 3JUUA 5A7PA 2IXLA 1NENA 1CIWA 1ST8A 1NCQA 2IXCA 5D2AA 3D8CA 2A6XA 2DCYA 3F31A 3I0OA 3K3QC 1DZRA 3LK42 5IVFA 1RUH2 4AR2A 5CFDC 2VMEA 1H8TC 5EXOA 1DHKB 2YC2A 5HYAA 2W52A 4HPKB 2AXDS 2PLV2 3VBFA 5A80A 5BNNA 1X8EA 4XUNA 4CP2A 1J83A 3MIBA 1HB1A 2WFPA 5JDLA 4A4AA 4J1XA 5F6LB 1TNRA 3VUOA 1SDWA 4TN7B 4LIVA 4P00B 4E2GA 4B6XA 3I9WA 2W4XA 3PVEA 5L9RA 4UEMA 2WBLA 5IUXA 5A3LA 2GH8A 4A45A 3CK6A 4HEAA 3POBA 4X62T 3ROUA 3Q8AA 3VKMA 3PUZF 3F2EA 3QH6A 2IFWA 3AAEB 4ORFA 5JOZA 5FRAA 2JWPA 3NRUA 3N9QA 5FLJA 3FBMA 1HB3A 1YFWA 2VNGA 1UF2C 1B35B 1MMNA 3IAPA 3VBRA 3IA3A 4TNWA 1MEC1 2EIGA 1UU5A 2ZGLA 4FPLA 4HBNA 3UV9A 3CQGB 5HXRA 1XNRT 1VLNA 2P37A 4A6SA 1XBFA 4Y1VA 5I8TA 5LOVE 1MEC2 2E6VA 3BTAA 3N7JA 4HSLA 4LMLA 4TN7A 1GQPA 3ECQA 4TXWA 5DQ0A 2E5VA 1MS8A 2VY0A 3AP6A 1C8M1 3F2ZA 4A5XA 5HCMA 1MZ5A 5FBZA 1US7B 1DFQA 2YPJA 3ZMTB 2ZOEB 5CB7A 3IDBB 1TMF1 1TME1 4Y4YA 1UPSA 2PN5A 2O0OA 2BS2A 2KT9A 2JDKA 3KWVA 3I7DA 1F35A 2WDVA 5L4HA 4M0HA 1AJ3A 1LGNA 3PUXF 1A78A 4IDZA 1NCQB 2K2SA 2XKPA 2MNGA 3GCXA 3FFZA 5FP4A 1PGL2 3SOLA 1W0OA 2D6LX 3WCSA 5KXCA 1HX1B 3AYCA 1GUIA 4GXLA 3MFAA 1YRZA 3VBUC 1UPIA 3PMSA 4XDOA 3ZN4A 3QB5K 3ZXDA 3ZXGA 1UZZA 5ABFB 4XCBA 1RHI3 5C71A 5JXHA 2CEAA 1F8VA 1AX1A 3AA1B 3JB4C 5T54A 4EQVA 3QB5A 5JXGA 5LASA 2CLYC 1GP6A 4PLOA 4XBNA 2CRBA 3ZSLA 2JD4A 5I0UA 4CXYA 4QGLA 4QX1A 4L99A 2DWRA 2EICA 3PVBB 2XQ7A 3KV9A 3CX7B 1BR1A 4DEQA 3I0QA 3N5LA 2Y34A 4CN1A 2R063 5FMOS 5A7OA 1AYM3 1OKOA 3PDQA 2LRPA 1RJ7A 3DPRC 3LFMA 1HS7A 2VECA 1BHGA 4WVVA 2OYZA 4GAZA 3FZHB 3PU3A 1QOTA 4B4PA 3VKFC 4XFHA 3ZXKA 1X9BA 3NVOA 3NO8A 1MPXA 5ETWA 1UQXA 3AVSA 5FO7B 1POV3 1RUH3 5JR9A 2HWC2 5GZCA 5CG8A 3RYIE 3FHAA 1HR0T 3Q9OA 4O4IE 5JDMA 3GJBA 2O8OA 3UKTA 4IGOA 1PZ8A 1SA0E 2L3LA 1UMHA 1UOFA 4KX6A 4PFPA 2GU9A 3J7LA 3ZYKA 1J3PA 4FPKA 1JOPA 2RS33 4P02B 1AJKA 2PHLA 3NSTA 2H89A 4B29A 4BJNA 1DYKA 5LRSA 3G7DA 2XKOA 3B01A 4LHNA 2PG8A 3PUSA 3ITQA 1I9RA 1HW5A 4MGQA 4NPMA 1K42A 4AKHA 3DECA 3WQ0A 3E6BA 1SPPA 4PF5A 4QDRA 4CEYB 2GC3A 3LK2B 3IAQA 5F3CA 3HPNA 1KRIA 2ARXA 4OVEA 3TWIA 3H8XA 4Q0VA 3WLUA 5LBQB 3D5OA 3BIWE 3ILRA 4URTA 4YZ3A 4QGMA 1TEIA 3F95A 3KMHA 4AVAA 2WNOA 1OD3A 1RUG3 2OZ6A 5CFCA 4PQ9A 4DFSA 5BNOA 1RINA 3NAPA 1KK7A 1QNWA 1F5JA 1L7RA 1O4TA 4FOQA 3P1IA 4S2GA 2V1DB 4NJ4A 1DQ4A 3AE3A 4FOWA 3VHOA 5DDJ1 1RUJ2 2XJSA 3PURA 5IWAT 1QJX1 5L7OA 3W58A 1AR82 1Q8SA 1UXZA 3LEKA 4ANJA 4CXWA 3WF0A 3CZJA 2EHOA 2WZHA 1UU4A 1W04A 1COV2 1S0CA 4RYDA 4AQFA 5JVVA 5JUVA 5BNNB 1J59A 4FXKB 1B7TA 4JGYC 4CP0A 1ENSA 4YW4A 4Q2FA 4FBFA 3O1JA 2K48A 4L92A 4DNYA 4NHMA 3ZDVA 4DOUA 4XHBA 2E8IA 4YXDA 4OCTA 4Q4X3 3RPQA 3ETUA 3W59A 2CXFA 2ZGRA 3GN5B 1W2NA 1CAWA 3DF0A 4JEHB 1FMD1 3WT3A 4E27A 4AAXA 5LEJA 4BQ4A 1QQP2 1LHOA 3C51A 4NIQA 2IZWA 3OD0A 1C5IA 3MPBA 3RYFE 1I6XA 1V6JA 3A7QA 4ZI7E 2RJ2A 1W8OA 4DV2T 4EWDA 4LF8T 2EF6A 1HB2A 1AR63 2BNMA 2Y6LA 3L2HA 4CDUB 1RVF2 4DY3A 4LFBT 3NJXA 2EAAA 3LFIA 1J5ET 1W3VA 2YMZA 4DQAA 3OUHA 1MMGA 3UU8A 2ZX0A 5CEHA 4AHZA 2X0YA 2R30A 4GKXA 4AWDA 5A6YA 5FCCA 4Y26A 3SCHA 5C5TA 4EWEA 4R52A 2W9XA 4LPLA 3SNMA 1NY71 1QJFA 3OYWA 3AYDA 3K75B 2VCMA 3KT1A 4YM0A 1EP0A 3DYOA 4YGEA 5FQ0B 3LKJA 2D9DA 2NP0A 1SE7A 1EPZA 3RZJA 4XXPA 2QTWB 5KMGP 2B46X 1E5SA 2IWGB 2QQIA 3DPRA 3J7MA 4CZZB 2X0LB 4D6QA 3X1DA 4RGKA 2Y48B 4O8SA 1IS5A 4LF5T 1R64A 2MEV1 2UWAA 1IKPA 2Z42A 4RQPA 3LA2A 1W6OB 5HAXA 2AE9A 2ET7A 1GQHA 2PLV3 2XLGA 2GALA 1NXD1 1MQTC 2KD7A 4IEQA 2W47A 2XM1A 1QJZA 3AXDA 2BBHA 3N35A 4MVTA 2ZS6B 4BPZA 1WMFA 1ZRFA 1CVNA 1RUI2 2WNVC 3FL7A 1W2OA 5J1GA 1Q56A 2EHOC 5HCBA 4HFHA 5EK3A 4XILA 1YXWA 1SQ4A 2C4XA 4OI4A 1CGPA 5FV3A 1HQNA 2BG9B 2KZ7B 5KHHA 3D0SA 1F5FA 4KH9A 4LOSA 2HEWF 5C3QA 5BYNA 2CA5A 5LG4A 3M65A 2W61A 4X64T 1O7FA 1NA1C 2P4EA 2CV6A 2ZGTA 3C3VA 3M3ZB 3H3UA 1FMD2 1NCQC 4GWIA 3WF2A 4O4JE 1RUNA 5HXHA 1AYN3 4WM7B 4F3JA 1KNZA 2CPTA 1W9FA 2OT7A 1H2MA 1NYWA 3GNEA 4KBBA 1GKBA 1NE6A 1SDDB 2X5IA 4YSFA 4EOZB 2XR4A 5IFTA 2NQYA 1GU3A 3RX6A 2K9ZA 1UAIA 3SRZA 1SFYA 1UX7A 1XB9A 2OA2A 2Z79A 5FUNA 1PVC1 4OYJA 1IPJA 4QQLA 4R8HA 2X5IB 4Q0PA 4AL9A 4N9IA 4LO8A 4YM1A 3WQ1A 4Q4X2 4XAXB 5DUWA 2D5HA 1REFA 5M4YA 2VVEA 2A3XA 2N1GA 1XXNA 2P5BA 3Q8FA 4JKLA 4EWAA 5L36A 5HEUA 4L9IA 4YHJA 4IIJE 1PGW1 4ILCA 4LE4A 4A3XA 2L8KA 2XLAA 4YY3T 2AR6A 3MW2A 3A0NA 4PIXA 4ZHNA 2GSYA 4KBMB 3RC3A 2XQ5A 3UUNA 4JGZB 4L97A 4UBGA 3AKSA 3NJVA 4G63A 3FLTA 3KZ4C 2ZHMA 4XE9A 1HG5A 1MIVA 1Y4WA 5FZEA 5FY0A 3N7MA 3X29B 4NIIA 2WT0A 2E26A 4AHXA 4V2WA 5HV0A 4JI8T 1A3KA 4LNVA 2CDPA 2WZ8A 1NZCA 3B5LB 1PGW2 4NVPA 1OF3A 3CQXC 4SLIA 1DIWA 2BKPA 1EZ3A 4ISTA 4N9HA 2OUJA 5FP9A 3S7IA 4HONA 1UO9A 4BDVB 4DY5A 5C3PA 5DN2A 4AGVA 3RKOA 1W6OA 3PV0F 4LT5A 4DV3T 4YW7A 2D40A 4Q29A 4QU2A 1PZ9A 3BOWA 1ZRCA 2WSUA 1V6OA 5LG3A 4KMQA 3MZHA 1RUI1 3TLVA 1V70A 2IXKA 4LK6A 5ABJC 5IK7A 3RMXA 2HWC1 5IFPA 2XGXA 1DGWA 2P34A 2R042 2UWBA 4XFIA 5CNAA 3LOIA 2VKJA 3W15B 1RUF1 3K48A 4I0UA 4FP2A 3GN5A 4HETA 4PIZA 5FY5A 4C1WA 1JZ5A 1YIPA 5JDFA 5GM0A 1BR4A 2M6BA 4GK5E 4CU9A 5CKNA 1V9U3 3V5SA 3I59A 1DYPA 3OPZA 3C50A 4AI0A 4Z8BA 1EUTA 2W94A 3R6SA 3ZMVB 4HGAA 5C2TA 1NCRB 3HR9A 4CDWB 1IG3A 4LORA 5K9YA 5LW9A 3V0AA 2DTWA 2WWJA 3ZYHA 5FKYA 4CCKA 1B09A 4EZHA 4EGWA 1BBT3 1C28A 1COV3 1PM4A 1HFAA 1QXPA 4AI1A 2WZIA 5JAXA 3BI3A 2VL8A 2CGPA 4IDNA 1VIWB 3BU7A 5C8WA 1HNXT 1XYPA 2W5FA 4H14A 4CDXC 3AE1A 1AL23 5FZLA 1MNDA 2DHRA 2E7TA 4AAPA 4CUBA 1AF9A 1R1A3 4HSJA 2A3YA 3Q2MA 5HXSA 1L7QA 1W2AX 2VTXJ 4MHRA 4AZZA 4CCEA 1D1AA 3ZIWA 5JR9C 4AFDA 2WZR1 5CYYA 3J8F3 4CCLA 4A6OA 4KG0A 1UOJA 4BZ4A 5AQUB 2XQYA 2RDSA 5C9AC 4JLEA 1C1FA 4UAPA 3U14A 2VULA 3PUGA 2NMNA 1ZNPA 3HQRA 2ZEZA 1JZ2A 3J7NA 5HCJA 2K5BB 4RL7A 3RWKX 5B2GB 2XAHB 4IDQA 2G4IA 2JDNA 4CEYA 1PIV3 2GNDA 3ZJ1A 4Z1VA 4P9LA 3S5AA 3WW3A 3D4KA 4LBMA 3AMPA 5ADXL 5FMBA 4ERRA 1OT5A 3M1HA 4O4HE 3N7KA 4D69A 4OHXA 3IMNA 2I2SA 3JD73 2YHJA 2H0BA 5J2TE 2YPDA 1AR91 3IN9A 2GP5A 2VZOA 4P9XA 3WEZA 5FOJB 4OHYA 4PF1A 5FLIA 1E5RA 1V00A 1DQ5A 1F4AA 2OW4A 4V1Av 3LF7A 1VBA3 2HBUA 2OVUA 4GB33 3M2MA 4AG4A 2CXLA 2OKXA 3RS6A 1HJGA 1PNFA 5KC6A 2E9XD 4U74A 2Y6XA 1FOD2 1JZ6A 1I5ZA 1D0ZA 2BJSA 5FZ9A 4PJYA 5HBAA 3P3NA 2D2SA 3GZTB 4AEDA 2LW8A 3CNAA 1OOPA 3N7LA 4ZXEA 4ASKA 2LSGA 3AE5A 3AA0B 3E0ZA 2OIIA 3AZWA 3WCRA 5F1RA 2BNOA 3B9CA 5FPAA 2FDFA 5I91A 1AZDA 1KFYA 1HXS2 4PJLA 2EIEA 2ZGMA 4U7IA 1X50A 4RHV3 4XQWA 1HIXA 2D43A 5FVKA 3PMEA 3RYCE 4WBNE 1HDKA 2KM2A 4JZRA 2UUCT 1O59A 1S4CA 5JIUA 4B7KA 4BE3A 2DBNA 2A6YA 4LHLA 5ISLA 1KDKA 2R043 4XJ9A 3LJCA 3B00A 3WDXA 1ULDA 5H9QA 1FJGT 1MZFA 3CIHA 1VOMA 3LA7A 1D4M2 3FZKB 3RIFA 1JYCA 2WN2A 3T1LA 5L3FB 5JOYA 1ALYA 3ZXJA 4YVWA 2PYTA 2ZGPA 4UVAB 4XDQA 4R9CA 2X66A 4XJUA 3VDAA 5CB4E 3VBHB 4NRPA 2JPFA 5LBBA 2XM2A 1LOEA 1HKDA 4H9OC 4A41A 2LSIA 5LNKA 4D7SA 4Q4Y1 3GMIA 1GNYA 2HJIA 3BIEA 1WLXA 4CPBA 5FYSA 4ILUA 1GZCA 1LGCA 4LBQB 3SWHA 3OUJA 4NE9A 4XEZA 5EJ3A 3ZVXA 4AHYA 2FDKA 2YGLA 2H6CA 3GZEA 3FUOA 2FZ2A 3CMGA 4AI2A 1RUE3 5ANNA 2V6YB 3JU9A 1ZBE3 2XAQB 3SEPA 2CTVA 4LKFA 5C4WA 3ACGA 4N53C 5A1FA 4CCCA 1O3QA 4NIHA 5EIYB 4DR6T 2X29A 3AL6A 4MBQA 1FPN2 1VAMA 2QFEA 3KDSE 3UGFA 2QCSB 5HPOA 4OMDA 4CYDA 3ORJA 4QX2A 3HA4A 1ZRRA 3E1F1 1J3QA 2VMGA 3FWEA 2JIJA 3BTXA 2XWBB 1SHZC 2X51A 2B9UA 3AXJB 2RJKA 3TN91 1RUJ1 4XFAA 4IE4A 4HANA 4IV1C 1ZA4A 2HPLA 4IV1B 5EWSA 1CQ9A 4IDOA 2RM22 1Y43B 3LEGA 2CWYA 1SPPB 1SMVA 2PAEA 5CGMA 2W68A 3POSA 3ON7A 3QACA 3VL8A 3PUAA 2WN3A 2XSAA 1OC1A 3UETA 4BM8A 4IV1A 1HNZT 4BMBA 3JQWA 1VBC1 1W0AA 1CONA 1VBD3 1YFUA 2A1XA 1Z0HA 2QZ3A 2YDEA 1XE8A 3MV01 3EHKA 4BOWA 3AE7A 2PAMA 2RR13 5JSRA 5EV7A 3ZT5A 2B42B 3LSEA 2PHTA 2UUAT 2VMIA 4C1XA 5DAPA 4GB32 4XQDA 4KMCA 4FSJA 2HWF1 2W92A 1VMJA 2PELA 2WS92 4C91A 4XJ8A 4YSYA 2LSYA 4EYUA 1SZBA 3QCWA 3VBHA 4BA9A 5AQGB 1K5JA 1O5UA 3AE9A 4XACA 1G9BA 1CX1A 1VBE3 4NAMA 2VL0A 4B7EA 5AQKB 2GC2A 4IGQA 1G9DA 4NWVA 4G4FA 5KHJA 4ITCA 3WDTA 3POFA 4P08A 1M06G 4DV1T 2BEOA 3E6CC 1H2LA 2VCBA 1WFDA 4HL0A 3RMYA 3WD5A 1FT9A 2HYKA 4FFHA 1C1LA 1MQTA 2V7IA 4UI9L 5FXXA 1VP6A 5FYYA 3TLWA 5H9PA 5KWRA 3CU7A 5FMCA 2AGSA 2I59A 5GLVA 2ZKLA 4WVMB 3VZNA 3RC8A 4PNIA 1MS0A 5L73A 2JICA 5LGNB 2Z6EA 1KJRA 1O4YA 4LHKA 3ZXEA 5JZGA 2JE7A 4MO3M 1DYOA 4IERA 3RYRA 3LBXB 3NV4A 4QM8A 1JYTA 3OEAA 3EHZA 5FYCA 4BU2A 2PTFA 2WINB 2LOSA 4I0BA 1WYCA 3QOFA 4I3GA 2CCQA 4U31A 2PAKA 3A23A 5J98B 4CZSA 1JI6A 4FOYA 4AEMA 4CUAA 4EN9B 5JOWA 5CFDB 3TEYA 2XVKA 4Q27A 2ZEWA 5I0DA 2ENRA 1HB4A 2J7MA 1TQ5A 1TZOA 5EZWA 2GC1A 3GYDA 2ZJCA 4L11A 2GH2A 1PMJX 1VRH3 4OFZA 1CAXB 3MYXA 4FPOB 2Q1ZB 4ZZBA 3DXTA 4K8RB 5DPNA 1E2AA 5EPAA 3BK9A 2PTMA 3WP6A 3CVRA 4XF9A 2N9DA 2P2KA 5F6KA 4LF6T 2JXAA 3J9SA 2C5KT 3GCWA 2DBIA 2VMFA 2J1AA 5JI7A 3RZHA 3C4XA 3MBWA 4X1KE 5TSWA 3B9IA 4NOTA 4WZCA 5IVEA 2BVVA 2YY1A 3USSA 2WAUA 2YDQA 1HN1A 4OHZA 1W06A 1G8WA 2WB5A 2BOIA 3ANWA 1LENA 2E2AA 1TNFA 4YFZA 1UOGA 5LGTB 1CUNA 1IJ6A 2R0HA 3WV6A 1ASJ3 1HNWT 4EAHA 5FPBA 2XPJA 2R7EB 1M62A 2JEMA 3ZFEC 1RUC2 3IPVA 1OEDE 5LMUT 4AVCA 1O3TA 1PIV2 3TLSA 5JR7B 1QJU2 1X79A 4E2SA 1R091 2ZHLA 3DKWA 3I3BA 3SXWA 2PHWA 4XF4A 1GLHA 5GZEA 1W99A 4Z2WA 4HPKA 1NCRA 1UMIA 1YJKA 3JD72 3LAGA 3W20A 2W67A 5FXWA 3V0AB 2D5UA 1SBDA 3DYMA 5E16A 3T2TA 1W2TA 4L9BA 5CA0E 3O12A 1PK6C 2E9XC 1BQPA 2VO5A 2Y6FA 2JE9A 3UUBA 4Q0SA 4JDNA 1W9TA 1Q8OA 2VOWA 1YWKA 1E57A 5JPNB 5EFUA 1B35C 1PMHX 4QHZA 2P6CA 3FBLA 2FBWA 1IS6A 2ZMKA 2HWE3 2VBPA 2VOXA 4B3NA 4Y22A 2J47A 4ZPIA 2JKBA 4DXSA 1FIOA 2VE1A 4GQ7A 5E6HA 2LKGA 4LA3A 4RN5A 2LM9A 2NR4A 3AZYA 3I4IA 2QQUA 4CCDA 4IGUA 2P17A 4QX8B 5FP3A 3PJAA 3IF8B 1S0EA 2EXJA 2HEVF 5HCHA 4CXXA 1HRV1 2JDUA 2TUNA 1O91A 3AK0A 3BOPA 5FK8A 4D6SA 4OZXA 1UIKA 4UYBA 5HCAA 3POIA 3O1SA 4W50A 4ZOLE 1UD1A 4Q1PA 4Y4RA 3B57A 4UFMA 4V1PA 4Y5TA 3ZDSA 1K3IA 1XSRA 3POGA 4Z91A 4MZUA 4QH5A 3OGSA 5HWYA 2BFUL 4I09A 4META 1FOD1 1QXRA 1V6MA 1DCSA 4Y20A 3UU4A 1IS3A 1WA4A 1WZXA 3M4FA 3SCFA 4UW5A 1SACA 3ZN5A 1D4M3 1Y7BA 3MO4A 3N9MA 3KM5A 2CSGA 4Q4V3 1WLCA 2ZA9A 3AKRA 4LBLA 2V8SV 4B1MA 5FK7A 4MGIE 3N4MA 1WD3A 3H50A 5FZOB 2PA7A 1IQDC 3RRDA 1DLCA 1CAVA 2VZRA 3WNXA 5C9AA 3OF1A 1PM7A 4XBLA 2R6QA 4QPIB 4GJZA 5F7UA 5HWXA 1WYBA 4QX7B 1S55A 1VRH2 2YC4A 3MHZA 5CU1A 3IZOA 4YGBA 1KD7A 4BH9A 3BTYA 4HFSA 3CDZB 5LB6A 5G04L 4AI9A 4MGSA 3ZR5A 5A70A 2ET1A 3FBZA 1DQ0A 4AIUA 4IV3A 3SITA 1BR2A 1QJU1 4OHWA 1H4GA 1JODA 2D0UA 2QDNA 5LATA 4CU6A 4R9BA 3WVJA 3OKQA 3ZN0B 2X53S 3KS7A 4FVVA 3OYZA 1XNBA 2NLRA 4NHLA 1SHWB 4GMP1 3ES4A 5LJMA 5JDNA 5LY2A 3WDUA 2N2NA 2ILMA 1W05A 4AI6A 4O61A 1IKQA 3LEIA 2WYFA 4YTPA 1K5MC 4JV5T 1D4VB 5IK5A 1R083 5I0SA 3AECA 4IE0A 2AENA 2WS93 5IHRA 2FDHA 2E9XA 4ASLA 5A1AA 3KV5A 3AB3B 2XB6C 3OJAA 3H7YA 5JQGE 3NAPC 1N36T 4OHVA 4K40A 2WAOA 4UFJA 5FMDA 4LO5B 2Q8OA 4IESA 3FHIB 3L39A 5FO9B 3TAYA 3LE0A 3UJQA 3UJOA 3P4SA 4GIWA 3LK3B 4H9PC 2YUEA 4XF3A 4ZKTB 4CCMA 5FO8B 3WF1A 2QQPA 2RPAA 2GP3A 1HV0A 3WDVA 4YLHA 1GFF2 1RMU1 2V7KA 1Y9QA 5L7OC 1G8XA 2LJLA 4LBKA 1UX4A 1U5ZA 2WABA 3VKLA 3W9AA 2XJQA 3WSOA 1LGBA 1OD5A 3UFGA 3UU3A 1RTVA 2WLQA 3ATGA 2C5JA 4W6XA 4H9NC 5C6CA 5F2SA 5IVVA 2B4KA 4AVTA 2BS4A 4H9RC 4AFBA 2WO7A 4BJ0A 1EAH2 4ZEYA 2VMDA 1XDPA 1PK6A 4YLZA 4OI0A 4OYKA 1JTZX 1XNKA 1NWMX 2CY6A 2FZ1A 2GZWA 2W1WA 3ZMUB 1NQJA 4UVCB 4GMP0 3RIUC 5A3OA 1GSLA 1KFUL 3LQCA 4A7YA 4QWNB 2OXBA 4ISQA 1HRV2 5A7WB 5JRCB 2SBAA 5A1LA 1Y3TA 3KQ4B 3T30A 4E4SA 1ZV4X 5I8SA 3T0BA 2L9LA 3QOPA 4JGYB 5C3JA 1HXS1 1OI6A 4IEUA 3PIGA 1W09A 1U5XA 2CGNA 2XPKA 1PZ7A 4NRQA 4AK3A 3ZM8A 1NCRC 3T1MA 2QNKA 2FJBA 3ZC0A 5AC91 4BHPA 1CHUA 1ZZ8A 3HI2A 4Z2AA 2K3WA 1REEA 2BW8A 3G06A 1Z7S1 2ZGKA 4FPCA 3U4SA 1CJDA 1DGWX 2JDMA 3WOGA 2A9UA 5BXXA 5CIRA 5DDJ2 5C33A 4ZI3D 4YNIA 3USUB 2WO1A 1UIJA 1VCSA 4CN6A 2I0MA 2CHOA 4H9QC 1DGRN 1KJLA 1W6NA 1F31A 2DUOA 4XUTA 3RYHE 5HXEA 2HWD2 2K46A 2Y0IA 3OYWB 4JQTA 4KWLA 4NR1A 2E5LT 5DXDA 3BVCA 4TYSA 3ZYRA 2GK9A 2WS3A 2DNXA 3NWKA 4TLFA 4U72A 1YI7A 2MEV2 1H9PA 3MIDA 3R05A 5J09A 3CPZA 3LDBA 4FQ4A 5IYZE 1U5YA 4E7ZA 2ETEA 4XFFA 3VRBA 3ONXA 1BJQA 3GHNA 4AFCA 2HH7A 4DV6T 5HV4A 4PFOA 1H4HA 4I4TE 2JG8B 3OOXA 1ZRDA 1ND2A 1EV13 4JBWF 4QPYA 1AYM2 3RZMA 1AX0A 4DNDA 1NY72 4ZZ8A 1QY4A 4YWAA 2RS11 5T3NA 2ADEA 5L9VA 1UX6A 5ACA3 1XYNA 3ZFFC 5FZKA 3M3OA 4IL9A 3WHUA 1JUIA 2IVJA 4HFCA 2PQSA 3UT0A 3VBFC 4KBZA 1N1VA 4XQ4A 3HAGA 2XHEB 5A7QA 3C4ZA 1K12A 4FXGB 2RV9A 1SCSA 2ZX4A 4JKKA 5LA0A 2P1BA 3ME2A 2DU0A 4DUWA 5CFCB 2BG9A 1CX4A 1H6XA 3B7MA 3THCA 5IVBA 4NPRA 2TNFA 4Y5SA 5C70A 3PVNA 2ODUA 2UU9T 5A3PA 2PHRA 4F83A 4DVDA 2ZACA 1WCSA 5F5QA 1NOVA 1Y9GA 2Y0OA 3PJQA 2C5DA 3L09A 4ZI2C 4ZHQE 5FUIA 3CIRA 3Q5EA 2WNVB 5GLWA 4BYYA 4P5YA 3ETVA 3VZOA 3POWA 5A6QA 1APNA 2JD9A 4HZFA 1D0XA 1L0VA 1D2QA 3BODA 3WQ7A 4HLTA 3D6EA 2IC1A 3CQCB 4LTAA 3P4RA 2QVSB 4WZFA 1ZZ7A 3TKLB 2RS51 3RIAA 3LIHA 3NAPB 5FJKA 3OGGA 3RNSA 4JRAA 4CDUA 2X05A 3VR9A 2VZQA 2JQKA 4IEZA 1UMZA 5BNPA 2V5YA 4LR4A 1VMHA 1QSDA 4UELA 1GOGA 5K0UB 4W8JA 1RITA 3OB8A 1PGSA 1QQP1 2FQPA 4LK7A 1Y9MA 1U12A 4LMFA 4UW3A 4AOCA 4K0KT 1GWMA 1JXNA 3P5BA 5C4WC 2JIGA 1W6PB 4JTOA 1HV1A 4CDXB 3P4PA 1T72A 2W1QA 3ONLC 1AR62 3KBUA 2Y6HA 4MADA 1S2KA 1IBMT 2JDHA 3B3QE 3RF1A 4TTGA 2OX0A 5AQJB 1TME3 5ERLA 4K1ZA 1UXXX 4BIOA 1W8NA 2WQYA 2GN7A 4DXRA 3Q9DA 1VMFA 4Y1YA 1XQNA 4PJNA 5KXJA 3RRCA 2J1DG 3R4UA 1BK1A 3POJA 5K4LA 4XW3A 3VGIA 4N7IA 4GKJT 5LBMA 2YK0A 4WZXA 2P3JA 2A70A 2VCAA 1XWMA 2ES3A 5HXVA 4LF9T 2Q9QD 5LA6E 4ZZCA 3AEBA 5ABJA 1FMWA 3HBZA 5IJRA 1US3A 1VJ2A 2XQXA 2VQFT 1CAWB 1N3OA 2JECA 2Q0AA 1ULPA 2P3IA 2RP4A 5IHYA 5IWFA 2WWVA 3LDRA 4YVSC 2I6HA 3V5UA 1GQGA 4MG2A 3ZKRA 2H88A 2XAJB 5AQOB 1A8MA 1GZTA 1PO13 2XHKA 2MPKA 1DBNA 2FCVA 3ETPA 3HN1A 4XOGA 3SH4A 4ES8A 3OPCA 1ACCA 1CD3G 1URXA 2CAUA 2UXCT 1LHVA 3RDIA 2XJ7A 3WP4A 4JV4A 4QDSA 1M4WA 3PHMA 3U78A 5L3CB 2JKXA 4Q4W3 3S7EA 5IW0A 2ZX2A 2XQ3A 1ND2C 1H0BA 3ZLIA 2Q8CA 4DMWA 4FT8A 4B4RA 4XZCA 2LOPA 5HEHA 1OEDB 1OH4A 2VXJA 4FFIA 2QKDA 2BDRA 3TLTA 2H6BA 3ZPOA 2JG9C 4MGKE 1NE4A 4QU1A 2HPJA 1EAH3 3EO6A 4DV4T 1WMXA 4ZU5A 1PGL1 1JN2P 3ZXLA 5FREA 3UT5E 1F15A 2B7YA 3ZR6A 3UGHA 4BQWA 1UY1A 4EN8B 3QC9A 1SUMB 1UYXA 2EAKA 3ZN6A 3PJAJ 5F5CA 5EJ1B 2H3RA 4ADZA 2OLTA 3KVAA 3S30A 1AR83 1Q43A 1S35A 2VMCA 4OX9T 1WR6A 4I2OA 5FZ1A 2HH9A 2BVLA 2JENA 5FWEA 1NLQA 1ZBA1 2X9YA 3ZMNA 3I49A 4L0RA 3RRWA 1BVP1 4TNVA 1QH7A 2GN3A 2Y33A 4LBOA 3AE8A 1HRI2 5F3EA 4FTBA 1QNYA 1JNZA 4AQ6A 4AHWA 1T98A 3EBRA 5DDJ3 2NW9A 1LESA 3BN6A 3FUQA 2Z5WA 3MW4A 4KI5M 5IUQA 2Q9QB 4N90A 2PQQA 5CJ5A 4EV6A 1BCXA 3TEXA 5BNQA 5T5OA 2HWB1 5FYVA 3JAEA 5LRRA 3E5QA 4DR2T 3P50A 1TME2 3IDAA 4B3TT 4P14A 2VD7A 2WC2A 3U3IA 4HN9A 4X1YE 1J3RA 2QJVA 2Y6GA 4DR1T 3R0RA 2WO3A 2VUAA 2WQ8A 1HQLA 4XETA 5FBJA 3NVCA 4Q4X1 5FZCA 3WNPA 1AXKA 1RUF2 2HBTA 2LRLA 2A6ZA 1WW4A 2WT2A 3GBGA 3N2KE 4GYRA 5FXZA 2UUBT 1DQ1A 1JZ3A 2C0SA 1J84A 5H6QB 2WCAA 5E0OA 1EV12 2CDOA 5C8CC 2VURA 1S94A 2J1RA 5LA1A 3CJXA 3FC0A 5LBFA 4KHZF 2GMMA 2VC9A 4W4ZA 2HHHT 4KL1A 1ZZ6A 3C7FA 3VBUB 2VQTA 2VZ3A 1ND3C 1H30A 2VH9A 2LSKA 2X0HA 1KXGA 5DAXA 3T3YA 3BTZA 3EDUA 1TE1B 2E32A 4JHTA 2K9AA 3VV1A 3K8PC 3RZGA 4F8HA 3CO2A 2YROA 3CEWA 4JVAA 4Y22B 2WR9A 3CBNA 4XC9A 1XSQA 5CFBA 4LUKA 5LZ6A 3NW4A 3VDCA 4DIDB 1MIWA 3FX3A 3OTFA 3O0XA 3MACA 1JHNA 3WG4A 3NZPA 1H1AA 2XVLA 5FYTA 4E9KA 3IHRA 5I8YA 5AQLB 3JC6C 4K7JA 1OBNA 3WG2A 1JU3A 3VHRA 3AA7B 3E5UA 5IATA 1RC6A 3VN4A 1O8SA 3AVRA 1WUVA 1LECA 1N34T 3ONJA 1XNTA 5IVYA 1BEV1 3VBRB 3VBSA 1B35A 3J9X1 3QH7A 2Q1MA 3C2UA 3LWCA 2VTXA 2XMLA 4ZXLA 1TG7A 4XFGA 3RQ0A 3QLQA 3ZSSA 3RKGA 1A8DA 2IFRA 2D3PA 5FZ8A 3OBTA 3J8F2 1JH5A 4Y24A 4HK8A 4ARXA 3AAAB 1DZTA 1AYN2 3N3HA 2Q4SA 5C4WB 2OQ6A 2V6YA 2YYOA 2WY2A 3AE4A 2OA5A 1UU6A 1HG2A 1UZWA 3NV1A 4JI4T 3QBQA 4INDA 1ONAA 4IL4A 3H8RA 1H1MA 3I2HA 5CA1E 2FHRA 2XQRA 3I2IA 3VZKA 2ZX1A 2CWMA 1G7YA 2O1QA 3EJKA 2D6MA 3MLKA 2C6SA 4JYAT 4PK6A 3INAA 1HX8A 4AKGA 3ABVA 1R1ZA 4EN0A 3PTYA 1AYN1 5FYHA 2UXXB 1KQRA 4DR4T 1VBB3 2Y38A 4DZGA 1REDA 4JKMA 3VBOA 1L7LA 1AL0G 2WDQA 4PJMA 4U2YA 4ZONA 4XUQA 5A3UA 1LU2A 4H55A 1W90A 2ORZA 5D1IA 4RS5A 4QXHB 3S5QA 2JJ9A 5FL0A 4DUXA 3T0DA 4CI2B 3LSVA 4J6GA 4ONUA 4BQXA 1IZ3A 4HWIB 4ZY9A 3A4UA 4QPIC 4I3PA 3POEA 3VB9A 4CUCA 2WSVA 2UURA 3N9LA 4P0AA 4AGRA 5JZGB 1G9CA 1PO12 1OVSA 1TMF3 2V73A 5BUVA 4N43C 4XCAA 1NQDA 3BB6A 3VKNA 2QE3A 1ENXA 1GNHA 1WBFA 4HE8A 4XZPA 1XZYA 2G19A 3OD4A 3WDYA 4AVSA 3V64A 1PO21 4OYUA 2XUEA 4YTNA 3K4ZA 5GLUA 3WNNA 5L2LA 1JU4A 3TEZA 3I3EA 5BY5A 4AQYT 2P3YA 4A7KA 1QU0A 3AB0A 2D6PA 4XMAA 5FZMA 4DRRA 5FKBA 5KDMC 5JI9A 3ESLA 4HG6B 1LOCA 2PHXA 5KXBA 1KF6A 4LITA 2V7JA 4X5TA 3BUCA 4KP3C 3UNPA 1CPMA 4CPBD 4DS0A 1GOFA 2W91A 3VD4A 3PJYA 1DQ6A 1V6LA 2ZEXA 4IT4A 5F5WA 2R061 2VUCA 3AM2A 2GNBA 2XJVA 3HT2A 1YO8A 3PDYA 4R4ZA 3LPFA 2FBEA 5A7WA 4OK0A 2W46A 4Q4W2 4HWCA 3UQ4A 1UUSA 4AXPA 2WRAA 3I2FA 3JZVA 2J22A 2BWCA 2XBO2 1V9DA 2VW0A 5FJHA 4FPFA 4QKDA 2A2FX 1BBT2 1POV1 1RUH1 2ES0A 3AFKA 3WXPA 2X9WA 5IYYA 2QA7A 3BQIA 2FMDA 2W0XA 1ND3A 2QDRA 2A72A 2VASA 1XNAA 1WCUA 3GALA 1V6KA 4M01A 4GJYA 2LUWA 2RS31 1K5MB 4WBOA 3UKNA 5H9RA 1Y64B 3WNLA 1LTEA 4CP9B 2BZBA 4ES9A 4K1YA 3EI0A 1QJY1 2DVFA 4D7YA 3ACFA 2PFVA 2X10A 1C57A 5A32A 3BYWA 2W1UA 5EP9A 2BBVA 3EQEA 2LM2A 1RUC1 3U75A 2WAAA 4UF0A 4XBQA 1BMV1 1UY4A 2FCTA 2SPCA 2VWAA 2WL1A 2ZAHA 4RFRB 2QQNA 2Y60A 1LHWA 3E6DA 2BGPA 5FPLA 3RG0A 3I59B 2JMHA 2WNVA 1BMV2 4KNCA 1W6MA 1AXYA 5ACA2 4XHXA 2R073 2E9XB 3D82A 4QQPA 4TV9E 1HRI3 4MX3A 3O5SA 4MALA 3AKPA 3LA3A 2GMPA 4RGAA 1QJY2 2WKKA 1H7CA 4YZ4A 5DAVA 5A7NA 3J8F1 1AHSA 1S1AA 2VVDA 3WUDA 3AL5A 3GXUA 3FFQA 3HT1A 2RMU1 4MXVA 2WQZC 1XU2A 4PDWB 1HQWA 4JRLA 2ZEYA 2ZMNA 4NROA 2XZEA 5E8AA 3WF4A 1RHI2 3OPWA 4EB6E 5BMVE 2RDNA 5FP7A 5ABJB 1CZVA 2D97A 5F5AA 4CDQA 1H2NA 1LJ7A 2CWSA 2J62A 1ZYBA 2F4LA 2AEYA 1KDMA 3GGLA 5LK5A 2NWBA 4COWA 5IK4A 2DLRA 1QDCA 1IJ5A 3HKBE 1YD8G 3VU7H 4MV2A 4JC1A 1ZZ9A 4QX7A 4WM8B 3LIGA 3T4VA 5LWBA 4AEKA 3RPUA 1C8M2 2R062 5JREA 2BG9C 5EK4A 5DUXA 4A98A 4BB3A 4GB31 4ZU7A 4UR9A 3KGZA 4YVWC 5LEKA 3NJYA 4KU8A 2BBJA 2VKDA 1OA2A 3TOJA 3HKCE 2DVDA 2R32A 2V4VA 4BIFA 1OOPB 4Q8KA 1N3QA 3UU6A 4L5GA 1AR61 5C8YE 1W6PA 5ABEA 1JMUB 3FE5A 4Q0UA 4Q8LA 1W0NA 1QLBA 1BVVA 5LXTE 4RSUA 3WNKA 4RS5C 5IK8A 2V4AA 4JAAA 1NKGA 1UWWA 3UGGA 1ODMA 4ATFA 3MFCA 5EJZB 1I3HA 2B9VA 3CZUA 1D7PM 5C9AB 2PXJA 4FCAA 4CQIA 1M7KA 4QQHA 5LB7B 1W9YA 2VZPA 2W08A 2WNUA 4HWDA 1WGPA 2XBO3 3VZJA 5GZGA 4Y1ZA 1RUD1 2RM21 1HTJF 1HLCA 3L2YA 3LD8A 2QQVA 4S2FA 1OVPA 2YN6A 3CWZB 4AKRB 1ZM1A 4FOVA 3ST7A 3VKOA 3KINB 1A6CA 4LMKA 5HXMA 2AACA 5FQ0A 5D21A 2BPA2 2VK9A 4QXCA 3N9NA 2ATFA 3FLPA 4IGPA 3ZYIB 3FZFB 4O2BE 3PVOA 1PNGA 3C7OA 3CKHA 1FPN1 1YKHB 2C9AA 5D8AA 2E51A 3T2QA 3O1PA 4YZ1A 2PLV1 3A0KA 3JADA 5LCYA 4QX3A 2EXIA 2RDRA 1UYPA 1F9KA 1O3XA 2WIIB 4BQ3A 4YGDA 4H7LA 4HKOA 2NZ9A 2H7OA 2A6VA 5LYJE 4DMVA 1ZBE1
chains in the Genus database with same CATH topology
2NTYA 4AI9A 2ZLYA 2CLYC 3IBPA 1UCUA 1FEWA 4P0BA 4CXYA 3FBZA 1BR2A 3D0TA 2D0UA 3CX7B 1BR1A 3KV9A 3I0QA 3N5LA 3OKQA 3ZN0B 3OYZA 5A7OA 4CUGA 2X9HA 3PDQA 5FPVA 5LJMA 3LFMA 5JDNA 1HS7A 2XAFB 3A5XA 2N2NA 4GAZA 5LY2A 1MMAA 3PU3A 4AI6A 5FYBA 3NBXX 5FY8A 1LVKA 3N9PA 4WNKA 4WW0A 5A3WA 4I50E 5ETWA 4O2AE 4IE0A 3AVSA 3ZN1B 2NTXA 5JR9A 2E9XA 3KV5A 3AB3B 3RYIE 3OJAA 5JQGE 4O4IE 5JDMA 5L3GB 3WAJA 4IGOA 1SA0E 2L3LA 2NW7A 4PFPA 3NRYA 3ZYKA 1YKEB 2KXPB 4H9PC 4GIWA 3LK3B 4BJNA 2V7LA 4CCMA 5A3NA 2GP3A 2PG8A 3PUSA 5FNVE 5FY9A 4YLHA 2V7KA 4AKHA 2YBPA 1G8XA 1G73A 1U4QA 1UX4A 2LJLA 4CSWA 3LK2B 5F3CA 4IE5A 4AKIA 2C5JA 4HOOA 4H9NC 5FY7A 4AKLA 5LBQB 2ZM2A 5F2SA 2X67A 5IVVA 4HKAA 5GONE 2L9QA 4H9RC 2Q9QC 5FZGA 5ANQA 3C98B 1KK7A 5JRCA 5FWJA 4QWNA 4OYKA 3AAIA 1IZNB 1NWMX 2LHNA 3ZMUB 4UVCB 3S4UA 5LJNA 2V1DB 2YU1A 4QWNB 2IW5B 3ZCJA 5A7WB 5JRCB 5A1LA 4CCNA 4YJ3E 1ZV4X 3PU8A 3E08A 2LT3A 3PURA 3VKHA 4ANJA 4CXWA 2EHOA 4IE6A 3QUJA 4AQFA 5F37A 3QK6A 4IHJE 1B7TA 3ZC0A 1YW0A 3HI2A 3O1JA 2K48A 5JDGA 3O1IA 5FPBA 3U4SA 2MYSA 4PK4A 2E8IA 3SS1A 3ETUA 2OS2A 2CXFA 3GN5B 4ZI3D 4JEHB 4DBQA 4H9QC 3C51A 4QXBB 3RYHE 2DCFA 3RYFE 5HXEA 5L3BB 5FZ3A 4ZI7E 2ZM0A 2GK9A 2DNXA 3WAKA 4U72A 2VB6A 5EK2A 2Y8DA 3K3NA 3CPZA 3LDBA 5IYZE 4E7ZA 3ONXA 3RVHA 2HH7A 3O4XE 4PFOA 2MOZA 4I4TE 4H9SE 1MMGA 3DTOA 5CEHA 4ZI2D 2KWIB 4DNDA 2KINB 4TUYE 4JUYA 4C90A 1MIYA 5FZKA 3BQLA 1IAPA 4FI5A 4QXBA 3CKDA 5DQWA 3I1AA 3EUHA 3N2GE 3IEEA 3KFWX 2XHEB 5KMGP 5A7QA 3C4ZA 5FYMA 4CZZB 2X0LB 3I9YA 4D6QA 2Y48B 2CE7A 4O8SA 5IVBA 2YEVC 1D1CA 2ODUA 3MK7C 5LHHB 3ZMZB 5A3PA 5HAXA 4X1IE 4DVDA 3K3OA 2JQQA 2ZMAA 4ZS2A 5JH7E 5AFUL 3L09A 2WM9A 4ZI2C 4ZHQE 3ETVA 5LGTB 2OQ7A 1D0XA 3MXZA 2LE8A 4X20E 4AQFC 5IVJA 5J1GA 5FY4A 3CQCB 2EHOC 5EK3A 3TKLB 5FZFA 5FJKA 5FV3A 2KZ7B 4UV9B 3MA9A 4XBFB 3HL6A 4F6RC 5FYZA 2CA5A 5LG4A 3M65A 2W61A 5FZDA 1QSDA 4XDPA 4UELA 4QX8A 4I43B 4O4JE 5HXHA 4HTEA 3LBXA 1KNZA 2OT7A 2H7VC 1Z0PA 4ZI3C 3UFEA 5F3IA 2D0TA 2XDVA 4EOZB 4K0UA 3RX6A 3RH3A 3KBUA 3SRZA 5FUNA 5FP8A 4OYJA 3HKDE 2RA1A 4I55E 2OX0A 3Q9DA 2WMNA 5LHGB 4QKNA 4XAXB 2A3DA 4PJNA 5M4YA 5FYIA 4C8DA 2N1GA 2P5BA 2PJQA 2J1DG 3RRCA 5K4LA 4L9IA 4YHJA 4IIJE 3C4WA 2L8KA 2EHOB 3HKEE 2YK0A 5LBMA 4QXHA 4KBMB 2K24A 3RC3A 3UUNA 5KR7A 4G63A 2Q9QD 5LA6E 2MBGA 3LG7A 1FMWA 1HG5A 3FB2A 1MIVA 2UXNB 1HF8A 3FXEB 1VRBA 5FY0A 5FZEA 3E22E 2RP4A 5IHYA 4AQGA 2KMFA 5IWFA 4V2WA 3V5UA 2XAJB 3CMLA 4PJJA 3R6NA 3CQXC 1HCIA 4ISTA 1EZ3A 3K2OA 5FP9A 2IAKA 4HONA 2QGSA 3ZYLA 2BVMA 3BQKA 3RKOA 2WSSV 2NP9A 3U78A 5L3CB 5IW0A 3ZYMA 5L3DB 3ZLIA 3B13A 2Q8CA 3H3AA 4DMWA 3MKDA 4XZCA 4Z8XA 2LOPA 4MLKA 1MMDA 3ZPOA 4HFVA 2VKJA 2DI4A 2YINA 3W15B 4QU1A 2HPJA 3GN5A 5FY5A 4NUUA 5H6RB 5JDFA 3UT5E 5FZ0A 1BR4A 4GK5E 3QC9A 3V5SA 2CMRA 3C50A 3O9XA 2CM0A 2H3RA 5HXCA 4HGAA 3ZMVB 3KVAA 4ADZA 5F5CA 1NAFA 2WWJA 3N9OA 4CCKA 1S35A 1LVFA 4EZHA 1WR6A 4URAA 5FZ1A 5FZHA 1HFAA 2BVLA 5FWEA 2X9YA 2W62A 2VL8A 3L3PA 4L0RA 3RRWA 4TX5A 5DQVA 5F8PA 4EZ4A 5FZOB 2VKHA 1OWAA 5FZLA 1MNDA 2DHRA 5F3EA 4AAPA 3FHNA 2JMKA 3Q2MA 4FJOA 5HXSA 4TZ4C 1T98A 4DO0A 1D1AA 2NW9A 3J7Yq 5JR9C 2ODVA 2CXDA 2Q9QB 5FZBA 2ZM8A 3OBVE 4CCLA 2Q8EA 2XQYA 2LEHA 4JLEA 3VHLA 5FYVA 4ZS3A 3GWHA 3PUGA 4JEUB 4BJMA 4QHOA 2K5BB 2VD7A 3PE0A 3U3IA 4HN9A 2XAHB 4X1YE 5F5IA 3PUQA 3ZJ1A 5JVDE 5FZCA 2M67A 2ACXA 4GOUA 5FBJA 5ADXL 2LSJA 4ERRA 4GD4A 3N2KE 4GYRA 4O4HE 5FXZA 5JDHA 2C0SA 2VKOA 5E0OA 5H6QB 2YPDA 5J2TE 5F39A 1S94A 4GK0E 3NZQA 2GP5A 4E4HA 3KBTA 4MHCA 4V1Av 2LSKA 3DXUA 2CXLA 3EDUA 2P9BA 4QXCB 2K9AA 1D0YA 2E9XD 3K8PC 2Y6XA 4U74A 5FXVA 2W0GA 1D0ZA 4M1PA 5FZ9A 4H63V 2D2SA 2W63A 4D6RA 3EVYA 5DABA 3ZJ2A 3ZC1A 3DJBA 4ASKA 2LSGA 1OXZA 3AA0B 3E0ZA 1MIWA 5FPAA 2XASB 3MACA 4PJLA 1UX5A 3NZPA 3KV6A 5FYTA 3IHRA 3RYCE 4WBNE 2PBIA 4H63H 2XXZA 3JC6C 4BXFA 3AA7B 3P7IA 4CCJA 3AVRA 5ISLA 5L3EB 3LJCA 3WI3A 5IVYA 3DP7A 1VOMA 3J9X1 5J2UE 5L3FB 2XMLA 3P8CD 3OYXA 4N78D 4UVAB 2X66A 3HR0A 5FZ8A 2KLQA 5CB4E 2JPFA 3AAAB 3UULA 2W2IA 4H9OC 5FZ6A 2LSIA 5LNKA 5LP6E 2OQ6A 3GMIA 2EHOD 3AA6B 1WLXA 1ZEEA 2OA5A 3CX6B 1HG2A 1U5PA 2B1EA 4ILUA 3SWHA 5FYSA 3UYJA 5LW9A 5DJQC 5F32A 2KNDA 5CA1E 2IC6A 2WMOA 2XAQB 2MTQA 3UTKA 5A1FA 4PK6A 1HX8A 4AKGA 5FYHA 2UXXB 3AL6A 3KVBA 4MBQA 2G0UA 4MFRA 3KDSE 3OPTA 5FYUA 1LRZA 3HA4A 4PJMA 4YJ2E 3UUXB 4QXHB 1SHZC 2X51A 2JJ9A 4CI2B 4IE4A 3R84B 1LKXA 2C5IT 2HPLA 3JC6D 2CWYA 2XAGB 3N9LA 4P0AA 4GYSA 3PUAA 4G2AA 3T8OA 4UF0B 4HE8A 4LIUA 5A3TA 1ZKEA 2XUEA 2YBKA 4A56A 5IVCA 4KMCA 5L2LA 4C91A 2LSYA 4EYUA 4Y33A 4NUVA 4BA9A 5FZMA 5JDQA 2NOXA 5KDMC 3ESLA<