3K3NA

Crystal structure of the catalytic core domain of human phf8
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
354
structure length
349
Chain Sequence
RSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PHD finger protein 8
total genus 93
structure length 349
sequence length 354
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3nA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3nA01
5LWBA 5A7OA 4TN7A 4D6QA 3KV6A 3N9MA 2WWJA 3KV5A 5IVFA 5FPAA 5FZLA 2YPDA 4CCKA 5A1FA 5FZOB 4QXCA 4CCOA 2XUEA 5FYCA 5FZGA 3U78A 4V2WA 3AVRA 4XDOA 4BISA 4D6RA 5FYMA 2XMLA 2OQ7A 5FP4A 4LXLA 5A7WB 4CCLA 5ANQA 4GJZA 3N9PA 5FWEA 5IW0A 4QXHA 5FPVA 5FPBA 5FZCA 5IVCA 3N9QA 4CSWA 5F37A 2OX0A 5FXXA 4HONA 3N9OA 3N9NA 4LITA 5FJHA 3KVBA 2XXZA 5E6HA 2GP3A 4Y33A 5F2WA 4CCMA 4E4HA 1VRBA 2YBPA 5A3WA 5FYIA 3PURA 5FZFA 4C8DA 5FYBA 4CCJA 5A7SA 4V2VA 5F3GA 5FZMA 3K2OA 2YU1A 3PU3A 5IVBA 3KV9A 2XDVA 4DO0A 5FY8A 4LIUA 3K3NA 2YU2A 2Q8EA 3RVHA 3PUSA 4Y4RA 3AL6A 5FZ9A 3KV4A 4Y3OA 3PUAA 5A7NA 3KVAA 3DXTA 5FY4A 4AI9A 5FY9A 5FBJA 5FZ8A 4QU1A 5F32A 5FZEA 2YBKA 5FWJA 5CEHA 5KR7A 5IWFA 2WWUA 3PTRB 5FZ0A 5FZ7A 4BXFA 5F5AA 5FXWA 5FUNA 5FYTA 5A3NA 4IGQA 5FPLA 2GP5A 5FYSA 3K3OA 4XDPA 5FZAA 3UYJA 5IVJA 5FY7A 5F3EA 2Q8DA 5A7PA 5FZIA 4EZHA 4CUGA 4ASKA 4URAA 3DXUA 4GD4A 5A80A 5IVVA 5FPUA 3AL5A 3U4SA 4HOOA 5FV3A 5FY5A 3OPTA 5FZ4A 5FYVA 5IVYA 5FUPA 2Q8CA 5FZHA 2P5BA 4UF0B 5F3IA 3AVSA 5F5CA 5FZ1A 2YBSA 5FP3A 4LIVA 4EZ4A 5FYZA 4GJYA 4QX7A 5FZDA 4BU2A 4CCNA 5F2SA 5FP7A 5FY0A 4IGPA 2PXJA 4QX8A 4NUBA 4IGOA 5A7QA 2VD7A 5FYUA 5FXVA 2OQ6A 3OPWA 4AAPA 5A1LA 5LY1A 5A7WA 5A3TA 3PUQA 3LD8A 5FYYA 5LW9A 3PDQA 5F3CA 5FYHA 5FZBA 5ISLA 5FZOA 4EYUA 5FP8A 5FZ3A 3NJYA 5K4LA 4UF0A 5IVEA 3ZPOA 5FP9A 5FZKA 3ZLIA 2OS2A 5FZ6A 5A3PA 2OT7A 4DIQA 3PU8A 3LDBA 5FJKA 5FXZA 4D6SA 2W2IA 5F5IA 3N9LA 5F39A 5FY1A 4GAZA 5LY2A 4QWNA 4QXBA
chains in the Genus database with same CATH superfamily
2UWAA 1OFNA 1LRHA 3PVNA 3VBSC 4UXAA 3M3QA 1U5XA 4XJ9A 1ZHCA 2RJ2A 2A3XA 2ZGLA 4XFAA 2V6XA 1SDDB 2R071 1JNZA 4JV4A 3VB9A 2VQAA 1LOBA 2HWC1 2ZGOA 1GFF2 4COWA 1ZBE2 2OPWA 4HPKB 2WMNA 4HWIB 1QDCA 2VZ1A 5LYJE 4ZOLE 3JBG3 1W0AA 3B7MA 5LATA 2EALA 1NXD1 2FCUA 5DQVA 3BK9A 5IW0A 5T50A 2WY2A 5IK4A 1IPKA 2ENRA 3C2UA 1D0XA 1TE1B 1W0OA 2XLFA 1HRV2 5C9AB 5C3PA 1Q56A 5BYNA 5M4YA 2P34A 2NW7A 4NHMA 4YZ5A 1E5SA 4DV5T 3ZT6A 3C50A 4L5GA 2JX9A 1G9AA 2XQXA 1F8VA 4RL7A 2YC0A 5JXIA 4PF5A 2CPTA 3N36A 1QQP3 2D6KA 2E7AA 2VPVA 3O5SA 3P1IA 4JHTA 4YJ2E 1U12A 4I3PA 4JGZB 2H3RA 1XMOT 3PU3A 4ES8A 3ZMTB 1EUUA 3I2HA 1BR4A 4YTMA 2VGDA 4YZ3A 1R082 2X53S 3F95A 2AEYA 1S0EA 1N47A 1PZ7A 5G05L 5AQPB 1UQXA 2NOXA 2V09A 1OXZA 1R083 2XHNA 5A3OA 1G9DA 3ZYMA 2XQ3A 2XBO2 5A7NA 2VKOA 3E0ZA 4DOUA 3PHMA 2BP6A 2D6NA 2XBO3 2Y6KA 2ZX0A 4IQPA 4XFFA 4U7YA 5FMNA 1T6GC 1XNTA 3GBFA 4XFCA 2V7LA 2XKPA 4CP0A 1CONA 3BTXA 4QHZA 3MLLA 4OHYA 1JYVA 1OOPB 4K1YA 1PO23 1BZWA 3RNSA 4CA9A 3JC6D 1O3XA 5C8CB 1NE4A 3GF6A 2GP5A 1W6PB 3K1SA 4QGNA 2ZLYA 2QVSB 2WZPP 2HWC3 3WNXA 4QQLA 4C1XA 3JQXA 5AQVB 2R49A 2R16A 5LHHB 1QJU3 1MS4A 1Q8SA 3I9YA 4NWWA 3H8XA 3ZXEA 1DQ0A 3WSOA 4IV3C 3IA3A 2OLTA 1TMF1 5F5WA 1X9BA 2JG8B 2FDHA 3ONJA 1GP5A 1VBD1 1UYXA 2WLPA 2E31A 4GMP0 1SHZC 1WCDJ 1N1TA 3IKWA 1NCRA 3J9SA 4MGYE 4Q0VA 4AWDA 1MQTC 4S2DA 5L9RA 5JCTA 3ZFEA 1O4YA 4AQ6A 2PA7A 2RP4A 1GNYA 1T8BA 1QJZA 3RKGA 3M4FA 2RMU2 3ZYIB 4A42A 1W6PA 4PFPA 3ZFGB 1AYN1 2ZEZA 5KX5E 1UYPA 1HV0A 1UZVA 1W6OA 2CAUA 2CU5A 4K8RB 4QD2A 5FTTC 3WQ7A 1UD1A 1OEDA 4XCAA 4BU2A 2VOTA 2EHOD 4TSVA 3RYIE 1RUD2 1JZ7A 2FDKA 2HWB1 5K0UB 2WQZC 2ZA9A 3H3AA 2E7TA 1KS5A 2K24A 1VBB3 2LSKA 2JQQA 1XNKA 1KK7A 1DYPA 1OC1A 1LENA 1VBE2 4U33A 1W9TA 2YDSA 1XE8A 5L3EB 3LEGA 3PL0A 2ILMA 5CIRA 3WZ1A 3FBYA 3ASIA 1VBC1 2W95A 4AHXA 3PVEA 4AAPA 5FXVA 2WZR1 4ZZCA 3R6SA 1CUNA 4S2HA 5AC92 2EAAA 1TEIA 4CDQA 3EI0A 5L19A 1BEV3 2P17A 4CVUA 4B6XA 4CN6A 1UURA 1FMD2 1AR63 2VU9A 1LKXA 2AREA 4XACA 3ZMNA 2BG9C 5K0UA 2E26A 4QKDA 3VBFC 5IVEA 2H0BA 1AR91 2WFF2 2L8KA 3VZLA 4J2CA 5FXZA 1WZXA 1UO9A 1UY0A 3IIAA 3HMYA 4IETA 4XUOA 2MNGA 2CNAA 2B1EA 3N9LA 4WBNE 5EP9A 2V26A 4XQDA 5B4XA 3FLTA 3ZEFB 1UY2A 4ITCA 4Q4W1 4AVTA 2KNDA 2UYBA 2XONA 4RS5B 4MBQA 3KV6A 2ZAHA 4L0RA 1QDOA 4HVRA 3POGA 4IEVA 2Z4FA 3WP6A 3I49A 4PQQA 5GLUA 1ASJ3 3RFRA 4Z07A 2VVFA 4AXOA 4CCKA 4Z91A 4FOWA 5CNAA 4DMVA 1WBLA 3NJXA 1GR3A 4V2WA 1PO13 4ZI7E 3L2YA 2XMLA 5GKAC 2Y6XA 5LGUB 3I2IA 2B46X 2VUDA 3MPPG 5BNOC 3ZN4A 2LSYA 2GNBA 3PTYA 4WM8A 5ERLA 1GICA 3WDXA 2UWBA 3LSDA 5FPBA 5AQKB 2I45A 2E5VA 3VL8A 2W63A 2L9QA 2WYFA 4CSWA 4F8AA 1X79A 2DL1A 3QB5A 1AJKA 1BQPA 2V72A 1GSLA 4JGYA 1OOPA 3UKNA 3T09A 1LEMA 2WNUA 4OQ8A 1J3RA 4QAWA 2MPKA 2EA7A 5LA9A 3RG0A 2AACA 5DUUA 1US2A 1OOPC 4FPGA 1DYKA 1M7KA 3UJOA 5IK5A 2VZSA 5AQQB 3R6NA 1RXGA 1FATA 1HF8A 5HXEA 2E63A 3AFKA 5LCWL 5BNQA 1GZ9A 4EJRA 4LF8T 4INDA 4XJWA 4ASLA 5BNPB 3J7LA 3INAA 3BU7A 3IBPA 4UOJA 4XE9A 1UMZA 2XQ5A 2FJBA 1UU5A 4CDUA 4DUZT 1LOGA 3SXWA 1W2AX 4KBBA 1UMHA 2I59A 4P5YA 3SMHA 4WZFA 5IYZE 3PJAJ 1H1AA 1FMWA 1S0FA 2ZM6T 1W8HA 3HAGA 3ZR5A 1HXS1 1TMF2 5HXMA 2WBLA 3JBG2 3T8OA 4XF9A 3DP7A 1BJQA 1HN1A 3DXTA 4YW6A 4AVAA 4H63H 2G19A 5LRSA 4TWFA 4YW5A 5FMCA 1MMGA 3U3IA 4L92A 4OUSA 5DUXA 4PW8A 3T4VA 2WWUA 4OX9T 4BXFA 3ZXLA 5T54A 5LBFA 2Y0IA 4LFBT 2P3KA 4ATEA 1RB8G 3MACA 3LA7A 2XL7A 5EYYA 5FUNA 3ZSEA 1QJY3 5IVJA 5JPMB 3SCFA 3LWCA 2VVSA 2XQRA 3DCQA 5C71A 3Q2MA 3RKOA 4IV1B 5ACA2 4MGTA 4N53A 5SV5A 1DF0A 2FHRA 5T52A 4GYRA 1V6KA 3PUYF 4BQ2A 2MEV3 2VTFA 5A3UA 2JDAA 4E2GA 4MYEA 1YD8G 2MEV2 5IVVA 2J42A 1OA4A 2OUHA 4MFRA 2G9GA 3ATGA 3H3ZA 2E9XA 3AE6A 4GWNA 1IPJA 1GP6A 5HXCA 3JD73 2YK0A 1NG0A 3MGUA 4LBQD 2DFBA 2A2FX 5T5OA 1FOD1 2D6OX 1D2QA 4PNIA 4AHZA 4UF0B 2QRXA 3UU6A 2XQAA 5B2GB 5F3IA 5JZGA 3KZ4C 2IXHA 3IPVB 4B8EA 1T72A 1LU1A 1SPPB 2XQ7A 3P4QA 1CAVA 1OUSA 4NRMA 3FZLB 1KS4A 3GMIA 5FQ0B 1QXJA 2CGOA 2VH9A 4EWAA 3H37A 5JI7A 5CA6A 2PHDA 2YFUA 5LASA 2ZGUA 1NQDA 2JG9A 3WI3A 2XTLA 3CLPA 3CZJA 2C5KT 2JDKA 3AKQA 4XABA 3OUJA 4TWTA 3ZMOA 3EB7A 4H9OC 1AL23 4IERA 2YOEA 1FV3A 1S0IA 3KINB 4N43A 4HBNA 5CU1A 4O61A 3Q8AA 2JJ6A 5A7QA 3SH3A 4WNKA 2W4XA 3ZSLA 5CJ5A 4FOQA 5LY1A 1I9RA 3I2OA 2K5BB 3W9AA 3SWHA 3KBTA 3HBKA 5HV0A 3UNPA 3T2TA 4FPJA 4X62T 2Y33A 5I8SA 3HA4A 3NVCA 4AVSA 4IW3A 1JYIA 4B4QA 2NZ9A 3RI9A 3RF1A 2ZX3A 2C5DA 5EJZB 3WG2A 4A45A 3EAMA 2RE9A 5K4LA 4D0QA 1CAWA 2A7AA 4BYYA 5ABJB 5J7MA 3OY8A 2Y26A 2RS11 1XPWA 5LMUT 2XVLA 5A33A 1QUUA 3CPZA 5HCMA 2JJ9A 3ZT5A 4Y1ZA 4ZPIA 4GZ9A 5JOXA 5KHJA 1HX6A 3FMGA 3O1OA 1QGLA 3MIFA 4CUCA 1UZWA 3AEGA 1ZP0A 3FHAA 1RUH1 5FK7A 3APBA 1JYTA 1ULCA 4XIKA 3BN6A 1TME1 3B94A 4XYXA 1OH3A 4DR2T 3HBZA 1RUC1 3ONLC 5L73A 4AI0A 2E33A 4UVBB 1AJ3A 1AX1A 2BERA 2XLGA 1W2UA 4ISQA 4Q27A 4W8JA 3B13A 1SLLA 2CYFA 3NNGA 3OY8B 4NAOA 5DPNA 3AEBA 1QXRA 4JI4T 3I3BA 4AF9A 4WBOA 3JADA 1MNEA 4YTPA 2WL1A 5IHYA 2JD4A 1JU4A 1W06A 3J9X1 1F2NA 1ZM1A 3AYCA 3KF3A 5HEJA 1POV3 4IEZA 1YNAA 5FJHA 4AL9A 5LNKA 1UX5A 5DAVA 2XJVA 4R9BA 1LESA 5CFBA 4NIIA 4WVVA 3ZMZB 4KI0F 1W8TA 4JQRA 5F2WA 4CCMA 2A6ZA 3NAPB 5LK7B 4QPGA 2R061 2J1RA 1UWWA 1S2KA 2PQSA 4DUXA 2QQPA 3Q8EA 4YFSA 1VRH3 1D4VB 3AYEA 4V2VA 1E5HA 1A8DA 1PGW1 2FMYA 4XBFB 1E57A 3RYCE 1DP0A 2VE1A 1UAIA 5IUQA 4A4AA 2VOKA 4E8DA 1VAKA 1W0NA 5FREA 4DIDB 2W66A 1Q5OA 2RDSA 3NWIA 1PO12 3BQIA 1GNZA 1MZFA 2Q5TA 4AQTA 3ZFEB 4HZFA 1CD3G 4Y22B 1HJGA 1I6ZA 1IQAA 1NLQA 2JB8A 2QE3A 2BKOA 4Q8KA 3PUAA 1HRI1 3ES1A 4TWDA 4HKLA 4XFGA 4YFZA 5LGNB 1YIPA 3AEFA 2VY0A 4QPYA 3AE1A 3VD5A 4YHHT 1COV1 1UZ0A 4IV1C 3H7JA 1W8WA 4K8FA 5FMDA 3TLTA 2HWF1 2O0OA 3R4DB 2XSBA 2JG9B 1NY72 5C9AA 3TKLB 1OPMA 2OPKA 2D3PA 4Q29A 4Y5Z0 4NJ4A 3KCCA 2RM23 3K3OA 2HH7A 1POV1 5FYSA 4N43B 2N1GA 3SRZA 3R0RA 5F3EA 5ABEA 5IWAT 2KT9A 5T5PA 4EROA 1QXPA 4ILBA 3E1F1 4JAAA 4L99A 1ENRA 2JQKA 3TLVA 2WA3A 2WFPA 2BWCA 1UPSA 4BQ1A 4QB1A 5HCHA 2V4VA 3KGZA 3HR0A 2JG9C 2HWD3 3NJZA 3I0OA 5BV6A 3E97A 3C7FA 4XUNA 4GKJT 1SLBA 2Q1FA 5FUPA 1GV9A 3S7EA 3BU0A 5AQRB 1H9PA 1WCQA 3EO6A 3AVSA 5C8WA 3GGLA 1OF4A 3VHNA 1SQ4A 1HJFA 2V6YA 2CWOA 2YXSA 1WD4A 3CQOA 4OHXA 2ZKNA 4A44A 3GJBA 5B4NA 1J83A 4HETA 5T5LA 2TEPA 5LBBA 5KXEA 4AQSA 2WO1A 4QX3A 4BXSV 4HN9A 3IDCB 2E9XD 4HWHA 1UX7A 4FTEA 3N7JA 4IEUA 3C3VA 1WLWA 4A98A 1ENSA 4GWJA 3I3EA 1FT9A 4W4ZA 2BRTA 3Q5DA 4LO8A 4QU2A 3BI3A 1OT5A 4URTA 3I0QA 5JDNA 2YPJA 3DV8A 3JUUA 4LPLA 1V70A 1HR0T 3B69A 5TSWA 4BQ5A 1PGL2 4N78D 1XRUA 4ARYA 4ZEYA 1N34T 5CISA 2XASB 1CHUA 2R1DA 5IT6A 3LB9A 1LHWA 4FCAA 1DGWA 4OCTA 1WRDA 5FLIA 1W2TA 3TLUA 4OUMA 4CEWC 3WQ0A 2EAKA 1IJ6A 2H0VA 1A78A 1DQ2A 1YKEB 2ZMNA 3MIBA 4KGGA 1ND3C 5DQWA 3LAGA 1HIXA 3KT4A 4OFGA 4WVMA 5A70A 5DJQC 1JBCA 1W3VA 2BYVE 3LPFA 3FZMB 1ZVFA 3ZFGA 1C8M2 3OYZA 2W2IA 2WT0A 5JMOA 1JHJA 4JI7T 1XMQT 2KSRA 4EN6B 4U3CA 4DVDA 5FMOS 1LVFA 2JXAA 5HXHA 5FPAA 4NIGA 3WP4A 1BK0A 4NHXA 1WLDA 3CIHA 3FZ3A 2V7MA 3MUY1 2ET1A 5GM0A 4YM0A 3M1HA 4QXCA 4CCOA 1HX8A 4X64T 3PUZF 1OQ1A 3H9AA 4ADZA 4YT0A 1DGRN 3ETQA 3ON7A 4WVMB 4DR7T 1D0HA 3H1YA 2XAHB 1ZZ8A 2PFWA 2VW0A 3BIWE 3POFA 1CAUA 2MEV1 3SEEA 3N9PA 2HEWF 4MUVA 4L9BA 3DF0A 4QXHA 1P8JA 1H2MA 1R081 3IZOA 2CXDA 2E8IA 4XZCA 2BKNA 2VB6A 3N9OA 1GZCA 1WKYA 3LIHA 4LITA 4NWVA 4CTEA 4E27A 1RUJ2 1CIWA 2W94A 1SMVA 2C0ZA 4XBNA 1COV2 4DQAA 1XYPA 2CDPA 3NQHA 5J36A 3RZLA 3PURA 1LOEA 1X82A 3UT5E 4X1IE 2PN5A 4CI2B 4GK0E 3JCIA 1VP6A 5JXHA 4JYAT 2WDRA 4LKDA 3M70A 4AEDC 5K8SA 5K9YA 3NNLA 3ZN0B 4IV3B 1LJ7A 4Q4W3 2VOVA 3KV9A 3C4WA 2LOSA 1YFWA 1S0CA 2XDVA 5GLTA 4E4DX 1VRH1 3WAJA 2V8SV 4LF4T 1JW6A 3MKDA 4DZGA 1NLRA 4AYUA 4DB5A 4DFSA 2LJLA 2QZ3A 4PI2A 4AI9A 1BXHA 3E5XA 4CEWB 5DMYA 2QQIA 3JU9A 3O4XE 4QH1A 5F32A 2YBKA 4LMLA 2RS33 2BV4A 3JD71 5FKCA 1MIYA 1RUE1 3ME2A 4RR3A 1K12A 1DZRA 3PTRB 3A4UA 3LEKA 3RIUA 4LLFA 5AVAA 5FZ0A 2JDNA 3ZYHA 4XMAA 3M3OA 1GYKA 1CN1A 1O4TA 2LRPA 2VZRA 2Y0OA 2VKJA 2IDOB 2J22A 4FPCA 1XE0A 2DURA 2Y34A 1R091 2EIGA 3JQWA 2JDHA 2VQ0A 4U31A 2KINB 2ZM2A 4X1KE 4XETA 1XB9A 3KSCA 4MO3M 2QQUA 4W6WA 1RUH3 4EOZB 4UFJA 2QFEA 1YFYA 4FFGA 4E8CA 3CX8B 3RMXA 3N2GE 4O4IE 4YXDA 5GLWA 2HWC2 1OA2A 2WQYA 4DUVA 4ZU4A 5A32A 3SFEA 1TVGA 1PK6A 4D7SA 3P8CD 1NZIA 4Y20A 4YVSA 2CMRA 1RJ7A 2GNDA 2BS3A 2ACXA 4B4PA 1FPN2 1MQTA 3ECQA 3VZJA 4AKGA 5C8YE 1Y4WA 2RR13 2RS12 2ZABA 2ZX2A 5FUIA 3AMHA 5F1RA 2ORZA 4Y5SA 2GSYA 2CHHA 4OI2A 3ZYFA 1LGBA 1HLCA 4PK4A 1VCTA 4W6YA 4FPYA 3WP3A 2PHLA 3T4HB 1FYUA 2V5CA 3AMNA 1Z0PA 5LBMA 2RS51 5A1LA 4BCUA 3UU3A 5I0SA 1HCIA 1RUC2 3JCFA 3RQUA 1H8TC 1PK6B 2HWD2 5C6CA 4BJNA 2E5LT 5AQLB 2QYWA 3ES4A 3J7HA 4MH0E 2DWGA 4Z90A 2IIUA 1VBC3 2F6BA 4SBVA 5GZGA 1WWYA 1AF9A 2WS93 2VC9A 1O6UA 1FAYA 2WA4A 3K51A 4LUMA 5DN2A 1JOJA 5HWXA 1WD3A 3ZFFC 4P9GA 5EZWA 4NHLA 4B3ST 2DCKA 1ZBA3 2PMWB 1YXRA 1UL9A 2D0UA 2W67A 2FDIA 1RVF1 1ZZ6A 3HT1A 4QPGB 5AC93 3TEWA 4N90A 3S57A 3TRSB 1AR92 4LUKA 1E5IA 2J1SA 5CKQA 4QWNA 1JYXA 3OEAA 2NTYA 2VZUA 2ETEA 2X9HA 1H4HA 3ZN1B 2DU1A 4CQIA 1YWKA 2VQTA 4JI0T 2WWJA 4XF3A 5J0ZA 3H3UA 1DZQA 4D7YA 5KWRA 2FDFA 3EABA 2D43A 2LKGA 2WP9A 3B5LB 4HWFA 2Y6HA 5A1FA 4C90A 1F15A 3GNEA 2VOXA 1GUIA 3RIFA 2KWIB 1GWKA 2PAEA 4IE0A 3VBOC 1IKQA 5A3LA 4HFBA 4LHNA 1V6MA 1JHNA 4HK8A 4PAGA 1UGOA 1EZ3A 1PO11 2OZJA 1EUTA 1WLXA 4RHV2 5FPVA 5AQNB 4RN5A 2RHPA 3RX6A 1AR72 5IK8A 4X66T 4FOVA 1V9DA 5I0UA 3WOGA 3ZXJA 3MIHA 3GALA 2Y6GA 1A3KA 1W0BA 5FPZA 5ABJC 5EK4A 5AQOB 4YW7A 3GYDA 4LO6B 4O8SA 1WW4A 2VKHA 5C4WA 3VBRA 1QMJA 4BLJA 4IE6A 1RGSA 1W39A 4QQ2A 4HPKA 4BQ3A 3X29B 4UAPA 2BVBA 1SUMB 2IUBA 3WD5A 4DBQA 1F5JA 5FJKA 1GOHA 4DV3T 1VB4A 2ORXA 2IVIB 1BKZA 4WW0A 2LW8A 5I0TA 5F9TA 5HWYA 5I93A 3VRAA 3H8RA 3VU7H 1LECA 3OGSA 4XTPA 4WBBA 4G9SB 1C4RA 3KV4A 1CX4A 4H2AA 5BUVA 1RUD3 2PAKA 3ETUA 1U4QA 1MS8A 4Q4X2 4Y20B 3NBXX 4BWOA 5C4WB 2M67A 1I94T 4P08A 3TBDA 2XQYA 3RYHE 1ALYA 2QDNA 3Q5EA 4I3GA 5DDJ1 4OQ9A 3EHKA 1RYYA 3IMMA 2QKDA 3MW2A 3VD7A 2VZ3A 2XR4A 5AQHB 1UW8A 2D97A 1HNWT 5FXWA 2Q9QB 3HL6A 1DIWA 5FZAA 3EMRA 2BZBA 3O9XA 3UULA 2VVDA 4RQPB 2GC3A 1EV11 4XFHA 3UUBA 4Z2AA 3MZHA 2Y6JA 3IM0A 1RXFA 4OULA 3GN5B 4IE5A 2R32A 2R6GF 2YB7A 4FI9A 4JI1T 5AQJB 3ZFGC 4XW3A 3AE2A 1AX2A 1YHFA 1CZSA 3C64A 1ULEA 2RMU1 3O14A 2ARXA 4P9LA 3I2JA 5GJ6A 4KH9A 5J98B 3OPTA 1U5ZA 2V73A 2CDOA 5FZ4A 5L7OC 1LAJA 1SBFA 4KBZA 5IVYA 2XJRA 3D4KA 4YG0A 3VD3A 3CQCB 2VBBA 2QJVA 3USUB 1RUOA 3NL1A 1CPNA 4GMP3 3NO8A 4YLZA 1ULOA 4E2SA 4I01A 1DZTA 1BR0A 3BTAA 4Z2WA 3B93A 4DV1T 5FYZA 4B7EA 3RWKX 2A6WA 4IEPA 2D5FA 4AI2A 5FOJB 3G7DA 2BG9E 4LNVA 2CRBA 5JRCB 4BK4A 4C0HA 3R05A 5HXSA 2WWVA 4OUEA 4OHZA 2ZOEB 3WX5A 1YEWA 3D0SA 4QQOA 4EEDA 1XYNA 3LSEA 1RTVA 4QXCB 4JUYA 2EXJA 5DG2A 4AGRA 3LKJA 2BBHA 1X8EA 4AI6A 2QA7A 3E6CC 3OYXA 1IG0A 1HN0A 3ZDSA 2VL4A 5CKNA 1W05A 3LE0A 4Q4Y1 5IJRA 4JI5T 3AM2A 1VCSA 3ESLA 5C3SA 5C7GA 2BOIA 3FN9A 4G2AA 4G63A 3HJRA 4K1ZA 4JVAA 4CU6A 3WCSA 3I3QA 4XMIA 3AX4A 4AFCA 2FUPA 1UY3A 2X51A 1PIV3 1V6NA 1S0DA 2WAAA 4D6SA 5JZGB 1WW5A 2PLV3 3BOWA 3VBUB 4DR3T 3ENRA 1SZBA 5HBAA 3C98B 2DVBA 3M3EA 2BS2A 1ZBA1 5A7OA 2IC1A 2ZMAA 1US7B 3FBZA 3VBSB 3ZIXA 4ZI3D 2I2SA 4YVWC 1ZREA 2Y48B 2P2KA 3LEMA 1R8IA 3T1HT 4LHKA 5FYMA 5JR9B 5DZEA 4D6RA 5HCJA 1SFPA 1EPZA 3POBA 2O14A 1XU2A 5CBLA 4WZXA 1VBC2 1D0YA 2X0HA 3U10A 4Q8LA 4YZ2A 2WAUA 1BBT2 4KI5M 3FZFB 2BTVC 4R4XA 4FQ4A 4CE8A 3LZZA 1J58A 1AHSA 1WR0A 4FFFA 3SOLA 4N9HA 3WUCA 3P3NA 1UCUA 3HKBE 2CBIA 1UX6A 3MDPA 5EZYE 1R1A2 5C8CA 2JICA 1HQWA 4OI0A 1VRBA 2EIEA 3GXUA 2KZ7B 5FVLA 2XQ6A 3O1PA 2JE9A 1UOGA 4JDNA 3TEZA 2B39A 2XVKA 2WINB 4L9IA 3JD72 5FCCA 5CKMA 3WF4A 1RUG1 2ADEA 2GZWA 1S2EA 2RM21 5J3UA 2WFF3 5AVPA 3OBRA 1IG3A 3NSTA 1G8XA 4HWCA 3V64A 4I50E 3RI5A 4JTNA 4EN8B 1PO22 1T6BX 3UESA 4IEOA 1NCQA 4WM7C 3VBOA 5JXGA 5J48A 4S2FA 2WNUB 5L3BB 3POEA 4BK5A 4IDNA 3VLBB 1Y7BA 5FBJA 5J37A 3JXSA 4QU1A 3I9WA 1R1ZA 3ZM8A 3U4XA 2CSGA 5JUVA 1F9KA 2IC9A 5HCBA 5KR7A 1O5LA 1X9PA 4K20A 3USSA 4EV0A 3MHZA 5FPLA 4QX8B 1FNYA 3Q8BA 1NENA 3S6PA 3W20A 1OEDC 2Q8DA 3RSJA 3VR9A 2VCAA 4KWJA 3GHMA 2QVAA 2OV9A 5AQMB 1MS1A 1X8MA 5KHGA 4AEMA 4DY3A 1AR83 3A21A 3PUWF 1PGSA 3DECA 4GD4A 4QX2A 1G73A 4IXLA 1BCXA 1QF3A 3UGGA 4AVVA 3Q9OA 4BM8A 5C8CC 5L9VA 3WCRA 5HEGA 3EJKA 2QQVA 1VBE3 4F3JA 3AA1B 3AEDA 5LA0A 3FBLA 1RUI3 3AMPA 1WFDA 5JR7B 5I0DA 3V0AB 3AJYA 3QH6A 3KMHA 1PHMA 4QX7A 4DBRA 4RR3B 2W1SA 2ZHNA 3MZKB 1BBT1 2A3WA 2C6SA 4FOYA 1YQ4A 4NRPA 5JVVA 4CU9A 2YY1A 1JZ6A 3TWIA 4M0HA 3UJQA 2CBJA 2VR4A 1QJX1 2RJLA 3RPUA 4DPNA 3VZKA 4NIHA 5FL1A 4LLOA 4K0UA 4P9YA 3UK9A 1GQEA 2EICA 2IMLA 3AZVA 3I59B 4LE3A 4QXBB 1XBFA 3FX3A 3LA2A 2H89A 3NJVA 3PMEA 1PGW2 2W3JA 4QDSA 4XTMA 5CVRA 5L3CB 2GU9A 4O4LE 3IPVA 1H7CA 4H9PC 2EHOB 3I8TA 3K46A 3G06A 3TLSA 3AMMA 2WQ4A 2GMPA 4AGVA 1MR5A 1VAVA 1WLCA 2G1MA 2JDPA 2CAVA 2DUOA 3CF6E 3D8CA 3LOIA 3OOXA 1POQA 2C1FA 3FFZA 4YW2A 3AKRA 3W58A 5L7OA 3U1XA 4LF5T 2UU8A 5HXRA 1ASJ2 2YEVC 5FP9A 2WJSA 3WW1A 5C3OA 1ZA4A 4HFSA 3D82A 2ZZQA 5HAXA 5JTGA 2ZMLA 1BK1A 3A7QA 3PJQA 4HSLA 4JHZA 2V7KA 5DAQA 4XF1A 4YVSB 2YFZA 2VECA 4P02B 5F39A 4RA0A 3B5MA 1I5PA 2WNVC 4QGLA 1ZEEA 2A73B 1D0ZA 1LODA 4TN7A 1ND2A 4HLTA 5FO9B 4HKAA 5AFEA 3VRBA 4ZU7A 1KDMA 4QM9A 3AE5A 3HNBM 5E89A 1G9FA 2OZ6A 4YFWA 3WVJA 4D69A 3K4AA 4BISA 3M3CA 1OLMA 4LR4A 1MIWA 4X20E 1XSQA 1CR7A 2GC1A 2PHWA 2XBO1 3USUA 2H7OA 4BA9A 4KL1A 4UXNB 3RIAA 1YQ2A 3ELNA 5ANQA 5A7WB 1D7PM 3ZPYA 2OA2A 4I0BA 4IHJE 5L9BA 2RS53 4DXZA 1QWRA 4AEKA 4YNIA 4NIDA 2QGSA 3VKNA 3AFGA 1WCUA 3VDDB 4K7JA 5FK8A 3CK6A 4BHPA 1RUF1 1OVSA 4TN7B 4YLHA 4NRQA 2OA5A 4UVAB 2DFCA 2WB5A 1MPXA 2DCZA 3O0WA 4L8QA 4QKFA 4AG4A 3EXUA 5JXJA 5FZFA 3PUGA 2LALA 4N53B 5BY5A 2IXLA 4JDOA 3KQRA 2NWBA 2ZAAA 3GN5A 3VBRC 3WW2A 5AC91 3DJBA 1PMJX 1WLTA 1U5IA 4GH4A 3CMGA 2YU1A 3DPRC 3LDKA 5KXCA 3AE7A 1JYCA 5DQ0A 1YO8A 3TNQA 1ZRRA 2BQPA 4IUGA 2LKHA 3Q9DA 2GC2A 1MMAA 4HN0A 4BQWA 5ABFA 1PZ8A 3ZCIA 1GZWB 1B35C 1R092 1YQ5A 3H7YA 4KWUA 3RVHA 1SBDA 2H6CA 2HBUA 3LQCA 3FUQA 3SC7X 3A0KA 5CFCA 3C7HA 3T1YT 1SPPA 2Z42A 1YRZA 5FQ0A 4GALA 3BCWA 3WNMA 4Q4W2 5FZEA 3OVUA 4LFAT 4CEYC 1ODNA 4J1XA 2IAKA 2DVGA 5J1XA 3ZXDA 4GH4B 4OI4A 5JWPA 1UXXX 2EXKA 1SLCA 1NE6A 3N3HA 2XB6C 4JTOA 4XJ8A 4EEBA 2MYSA 1ZRFA 5LHGB 4XFIA 2W47A 5HXVA 1LVKA 5FY7A 4LTAA 2DCYA 2YKSA 5JDFA 5IFTA 1EP0A 3ST7A 4C1WA 4Y22A 3LCPA 2LSIA 3I59A 4KG0A 4YGBA 2RS32 1Y43B 2JENA 2VZOA 3M7AA 3T30A 4BOWA 5CFCB 3O1MA 3I3MA 4TV8E 3LJCA 3RLFF 1NCQC 2BVLA 2EHOA 2D6MA 2BUKA 2QDRA 3AL5A 3QUJA 1EV12 4XEZA 3AEAA 5FVKA 3S4UA 1AR61 1UKGA 1UY4A 3V65A 5FNVE 1J3QA 5L7OB 1XNAA 3AA7B 3CKDA 3RWNA 4AOCA 3CZUA 2QQJA 4OYKA 2KMFA 1C1LA 1CAWB 5ABJA 3PUHA 4Y1YA 3BKZA 2D40A 5A33B 2QQOA 1H8TA 2YDEA 3WUDA 5JIUA 4KUMB 3I1AA 1I5ZA 4U36A 1VMFA 4YSZA 4AW7A 3ZFEC 5FLHA 4B3TT 1GOFA 5M0TA 3POWA 4CUBA 1ASJ1 2XAGB 2L9LA 4HSJA 1ND2B 4GKXA 1M62A 1OBNA 3SS1A 4GOUA 4LBQB 5GLVA 2Q9QC 4WM7B 3ZO0B 4AK3A 4BPZA 3ZSJA 1YKHB 3KD4A 3VBFB 3VGIA 1IHMA 4CRQA 1YQ6A 2GC0A 4AQ2A 2HYKA 1DQ6A 3QACA 4IESA 3IF8B 4EN9B 2V1DB 2NQYA 1RHI2 1W90A 1FPN3 1EPWA 3IN9A 5A7WA 3PUQA 3MK7C 1YQ8A 4A7YA 5A3TA 2WM9A 1W8NA 4EAHA 3AKPA 5JVDE 4HANA 3N7MA 5EHDA 5TAOA 2WR9A 1KJRA 3O0VA 4Q1PA 3T2OA 1ACCA 5EIYB 2AE9A 3KHCA 1F35A 1DU3D 4GK5E 3U75A 3NJYA 3V5SA 5EV7A 2RVAA 2G9ZA 4FFHA 2H88A 2VJXA 1J1JA 1NWMX 2DI4A 2TBVA 2MAWA 1LRZA 1NYWA 2D93A 3CBNA 3D5OA 2A72A 4H14A 3BIEA 1A6CA 1GKBA 3ZYLA 2FMDA 5FY1A 3ZC1A 4H7MA 4W50A 3ACGA 4YGEA 4NHYA 5ETWA 3TB0A 2WT2A 1H8VA 3ZKYA 1VBA3 1BMV2 1N36T 3N9MA 1AUYA 2J4GA 3MJXA 2C9KA 3BALA 2J1UA 1HXS3 5FZLA 1OA3A 3CDZB 3QOPA 3ACIA 4HL0A 3IMNA 1HXS2 3AZYA 5DAXA 5GLZA 4Y24A 2VTXA 4U2AA 2W62A 1NCQB 3RRDA 3VBOB 1CGPA 1URXA 3RRCA 2W00A 3A7MA 2DUPA 2YGMA 3OF1A 3RGBA 5CFDC 3N2OA 2QTWB 4GA9A 2KLQA 4XQWA 4YZ4A 3CJIC 4FFIA 4CI3B 5JDMA 1RMU2 1KFXL 3FHIB 3PUIA 4MVTA 1DQ4A 4LO5B 3N9QA 2WZ8A 2VUCA 4QWNB 2GNMA 4XBQA 2AGSA 1Y64B 1JUHA 3CJIA 3HEIA 2ZBJA 2L3LA 4OHFA 2DNXA 3ILRA 3RJRA 1YW0A 1JUIA 2DYCA 2UXNB 3QB5K 4COZA 2O8QA 3H50A 4NMIA 1ZA7A 1LULA 3OUHA 5FR3A 4A41A 3NKTA 4U74A 3B00A 3OD4A 5F8PA 1CAUB 1HV1A 2PHTA 3LIGA 3VBSA 2W1QA 4DV7T 4QXHB 4WV8A 4S2GA 4CU8A 2ZGSA 2W2UA 4BIOA 5GZCA 1Q43A 3FB2A 3ACLA 3AKSA 4IEYA 4XHBA 3UGHA 3PUSA 4LO7A 4Y4RA 5DUWA 3FZKB 2RM22 3EBRA 4B29A 1I6XA 2F4LA 2KM2A 3AP7A 3BQLA 1W9SA 4HFVA 2JDYA 3BYWA 4CDXA 3NV1A 1DG6A 2LHRA 3WF2A 3V0AA 3RQ0A 1OQDA 1ENQA 3UGFA 4B3NA 2ZGKA 1XU1A 2IXJA 2R063 4IDZA 2HEVF 5BNNC 2WC2A 4RFT0 2CE7A 1HX1B 1OH4A 4QX1A 2B42B 2VUAA 3CL1A 3PVBB 2WCAA 4RSUA 2HWF3 1WGPA 1KITA 1DDLA 1V00A 3WR0A 4G4FA 1UU6A 5A6ZA 2X5IC 1IBMT 1ULFA 3IDEA 3RZZA 3SH4A 2VWAA 3PVOA 5K7PA 1QH7A 3J7MA 4URAA 4FTBA 4NPMA 4I55E 4K0KT 4BJMA 2P37A 3OJBA 3WDTA 3R4UA 1STMA 1GBGA 4N53C 1JZ5A 4JI6T 5L3GB 1WMFA 3HNMA 3KQ4B 2E9XC 1S94A 4DR1T 1XNQT 1VIWB 1YFUA 2XGXA 2Q8CA 1OHFA 2HKXA 5L3FB 2D3RA 3WQBA 2W68A 2A9UA 3VDAA 2HWB3 1KNRA 1IJ5A 2UUBT 2BBJA 4OI1A 3KDSE 2IWGB 2HWB2 3E6BA 3JB4C 2UUAT 2ZHMA 1W9WA 3TN91 1JYWA 2XKOA 4WZCA 4CCNA 5FY0A 3SKJE 4HE8A 4HGAA 3EVYA 2CXLA 1KQRA 1E2AA 5BNPC 3LGRA 2XQ4A 2LLYA 1NCRB 2ZEYA 1PMHX 4Q25A 4IGOA 1Y3TA 3HR9A 3RMYA 1UMIA 4NR1A 5LXTE 1H30A 1GZTA 2OQ6A 2YROA 2J1DG 1LCLA 5A32B 3UL2A 2XWBB 5CA0E 1YJLA 2D9DA 2IFWA 1W2OA 5LW9A 1OPOA 4DXSA 2VM9A 1KNPA 4IIJE 5HEHA 4EYUA 1NLSA 1YI7A 4DV0T 2UU9T 2F17A 2NN8A 3FFQA 3FHQA 5G04L 3AB3B 5JRCA 4XJZA 4ILAA 5LCYA 3QCWA 3CJIB 4NAMA 1GLHA 4WVZA 3VKOA 1DHKB 4B3MT 1VLNA 4LBKA 4B7KA 4ZS2A 3HKDE 1NQJA 4P09A 2WRAA 3AE4A 2DCJA 1QLBA 4FAGA 5F6LB 1XC6A 4LULA 4XAEA 5GZDA 1JZ3A 4QGMA 4RYDA 4HG6B 1IBKT 2DUQA 5FP7A 2VNOA 4GULA 2HLEA 5C5UA 5LWBA 2BG9A 2I6HA 4KWLA 2RDQA 1ZBE1 1XWMA 2LEHA 3A8YC 3MI8A 5FPXA 4LMJA 1PMIA 2P3YA 4GWMA 2YPDA 4ZY9A 2UY8A 2XWJB 4MHRA 5FO7B 5EK3A 3AZWA 5FYCA 3ZXGA 3ZYGA 2NP0A 1DYOA 1WBFA 1Z8UA 2OQ7A 1EYBA 3WT3A 1GMMA 1LU2A 2QQWA 2VMGA 4UV9B 3H3LA 1VBD2 2FJDA 1KEYA 3M8LA 4GJZA 4M3CE 3NZQA 4H9RC 4FPKA 2XOMA 4MOAA 4R9DA 1O3TA 1JTZX 2AXDS 4NXMT 3DYPA 3HPNA 1DCSA 4F7ZA 3N9NA 2ZGPA 3U14A 1OXCA 2SLIA 2J1AA 4A5XA 4MXWB 2DU0A 3T1LA 2XQ9A 3GA8A 1N33T 1E5RA 1QJY2 2AUYA 1HRV1 2ES3A 5JDLA 2H6BA 1PNGA 1VOMA 3AZXA 3O1RA 4I4TE 5IATA 2B76A 1VBA2 2HWD1 5AFBA 2P6CA 2WMOA 5FZMA 1RITA 1OUXA 5BNOA 2CWYA 1D2SA 2ES0A 1R1A3 5EFUA 2N2NA 4AVCA 5C5TA 4QHOA 4O4HE 2E6VA 3AYAA 2QCSB 4GQ7A 2VVEA 4I2OA 3E08A 3R84B 4QT6A 3QD6A 4BQ4A 2B4KA 2A70A 4PK5A 2WZR3 1H1MA 2X66A 1LR5A 1SEFA 4AI1A 1MZEA 1WW6A 2JD9A 4K6BA 5FZ8A 4AI8A 2IHR1 5CEHA 4CCEA 3VDDA 1XDOA 2H7VC 3ZXFA 3BVCA 3C7GA 5IWFA 1RUH2 3IAPA 1PK6C 4N9IA 4X6QB 3ZXAC 1U5YA 1O7FA 4RHV3 5A3NA 2A6YA 3RZKA 2ZGNA 4XDPA 3VBFA 5JDQA 1Q8VA 5K0UC 3OUIA 2ZM8A 2FJAA 2ZEXA 4JDMA 3E6DA 3VBHC 1OLME 4RGGA 1N1SA 1QJU2 3JBG1 4CDQC 4CUGA 5HCFA 4UVCB 5IAXA 3K75B 4EN7B 5LK5A 4H9QC 5JR9C 5LJMA 4WM7A 4BLIA 3U11A 4DS0A 4HXCA 3CX6B 2OKXA 1JU3A 4O2AE 4DR5T 3C51A 2P3JA 4MLOA 2BGPA 2WLQA 2VMEA 4KBMB 2YBSA 4JZRA 4CUAA 5IFPA 2JG8C 1NT0A 2RR11 4LIVA 3KWVA 4UWDA 3O12A 4BB3A 2F4PA 1J1LA 3WDYA 1YIFA 4MZUA 2BS4A 3FLPA 3AA6B 1VBB2 5A6XA 3KT1A 3RZGA 1Q8PA 1CESA 4FBFA 2PXJA 2CLYB 4X6RB 2VNRA 1U0AA 4NUBA 4LHLA 3OEBA 3GWHA 1RUI2 4AFBA 4EE2A 2IW5B 5DZGA 4DXTA 2N7GA 1ENXA 1JOPA 2JPFA 3UU4A 3L39A 3OPZA 4P9WA 2VASA 4A97A 4DRRA 4EN0A 1H4GA 1BEV2 1IAPA 2ZX4A 3KHBA 1D1BA 1RHI1 2JIGA 3WLUA 1REFA 3F57A 5HEUA 4KQ7A 1UIJA 4DXRA 1ODMA 4XDQA 4N7UA 2WBKA 3JAEA 4CN4A 1C3HA 4QPWA 4MXWA 5A3PA 5L2LA 2FZ2A 2M6IA 4LQRA 3U07A 2Q0AA 2WUHA 5CFDA 5LGTB 1V0AA 3EDVA 4FT8A 4M4RA 2WNEA 4FSJA 3MA9A 3DGTA 1XZYA 1AZDA 4AEDB 1S1AA 4D6QA 1NX9A 2VOWA 4UFIA 5IVFA 1H6YA 5JIAA 4AI3A 3DN7A 2UXXB 3WP5A 1HRI2 4CP2A 4QB6A 1SACA 2Y8KA 4YGDA 4CU7A 4Q4Y2 4KMQA 1LOCA 3OCPA 4A7KA 3ROUA 2R043 2G0UA 1BMV1 1IZNB 1FEWA 4LXLA 4P0BA 1ND2C 4GIQA 2P1BA 3DPRA 4DEQA 1FXZA 2LOPA 4IDQA 1OQEA 4NUVA 1HQLA 2PJQA 1REEA 4YRDA 1AJOA 4Z8BA 3AP5A 3LDRA 5CFDB 2ACZA 3M65A 3VN4A 4A6SA 2TUNA 2DBNA 3J8F3 4Z92B 2VTXJ 3UTKA 2LS6A 2E2AA 5LG4A 1RUF3 5EK2A 2YBPA 1OKQA 1MZ5A 2GH2A 3F2ZA 1RUF2 3ILNA 4XVHA 3ZYPA 4CCJA 3PE0A 3PUVF 1YJKA 2UURA 2LM3A 4ZS3A 1UOJA 1WCRA 3K2OA 2X05A 2V7IA 3KBUA 5AFUL 1KNZA 1BR2A 2HWE2 1GOGA 1LHUA 1V6LA 3VHLA 2WT1A 4GB32 2E7QA 1UOFA 3AAIA 2JECA 1MVEA 1KXGA 5EXOA 1QJX2 2BOJA 1AL21 2Q8OA 4JC1A 1JI6A 1FMD1 2Q8EA 3BUCA 5FO8B 1H9WA 4LBJA 2BVMA 4TWHA 4EV6A 1VBD3 2VKDA 3HNYM 2QUOA 2LRKA 4ZHQE 5FRAA 1S2BA 3VR8A 2PTMA 5I8YA 1KDKA 3UQ4A 1QH6A 4CEYB 2XG3A 5FKBA 3CU7A 3W21A 1X36A 2CWMA 2ZGTA 4AFMA 2LRLA 2JE8A 5FOBB 5FIXA 3NAPC 1HG2A 4XBLA 1PZ9A 4YGCA 1VE0A 1H2NA 4OVEA 2V4AA 4IGQA 2XY8B 4MADA 2XAJB 2R6QA 2VNGA 4JKMA 4R4ZA 4JCKA 4LORA 2PHUA 1UNBA 2AEZA 4H3WA 2WO7A 4I0AA 4DUWA 3ZYBA 2D0TA 5A7PA 2CLYC 1B09A 4P9IA 4GIWA 3VDCA 4D94A 1OLQA 4YJ3E 4AFAA 1H6XA 3DXUA 4OHVA 3MLJA 5EJ1B 3W15B 1CJPA 4FVVA 3ZSKA 1S4CA 1Q3EA 3KT7A 3PV0F 2KD7A 3WF1A 4C0BA 5FYVA 4LKEA 3WG3A 2W39A 4HN1A 1L7RA 4DR4T 1HDKA 1NY71 1KJLA 2ATFA 3N5LA 3P4PA 2VQFT 2WZR2 3WW4A 1XNCA 3E5UA 1HNZT 3ETVA 3UUNA 2TNFA 4Q4V3 4A56A 5F5QA 5C9AC 4FTSA 1OURA 5LEKA 1YFXA 4E7ZA 4XIOA 1K5MA 4BZ4A 4PT6A 3OBTA 1EV13 3TEYA 1JMUB 5ABGA 1NKGA 5DUVA 3ANWA 4H63V 4DV4T 1W6NB 2VK9A 4BJ0A 4LBLA 5I8TA 1LB2A 2NPIA 3KB5A 4JKKA 1WCSA 1HB4A 4MHCA 3KCXA 1L3JA 1R64A 3TYJA 3DKWA 3ZFFB 5FLJA 2ET7A 1POV0 1FOD2 2FJEA 3OG2A 4HWDA 3Q8FA 3MBWA 5EPAA 3VUOA 5JR9A 4IDPA 1H0BA 3WNOA 3ONXA 3MW4A 4HMZA 5FBZA 4XPVA 5CB7A 1YUDA 3P4RA 1WMXA 2K2SA 3PDQA 4NUUA 2WNVB 5LOVE 4LO4B 3TEXA 1RUE3 2Y6FA 4UW4A 5J96B 2D5HA 1SLAA 2RS31 4PJNA 3ZSTA 1H1IA 2A6VA 1KGYA 1UY1A 2DWRA 2WABA 3DL3A 2JQHA 1MS3A 1B7TA 3M3ZB 2XPKA 5LB7B 1LNSA 3GCXA 2XH6A 3IDBB 5F5IA 2R30A 2VURA 1V9U1 2VZTA 2JMHA 1GANA 2D44A 3K48A 1UX4A 4JGYB 1O4ZA 3CHXA 4IE4A 4ANJA 4XURA 5HCAA 2A3YA 3HKCE 1CAXB 1JN2P 3H8OA 2Y6LA 3KV5A 1BBT3 1PNFA 1X33A 3G6JB 4JEUB 4FXKB 2DBIA 4BA6A 1E1HB 3B9CA 1FNZA 4HFCA 3KLSA 4CZSA 3SQOA 1OF3A 1G9CA 4Q4X1 2WIIB 4PLOA 1TME2 1MACA 1W6MB 2WZIA 1JH5A 1F31A 3AE9A 4ZXLA 1UPIA 1VBE1 2CGNA 4XJAA 4LF6T 2AENA 4MV2A 5CYYA 3O7OA 4CDUB 1XDPA 1FMD3 2SBAA 3I2FA 5DDJ3 5FZCA 3VV1A 2XQ8A 3MW3A 1JOBA 4YVWB 3GBGA 4PLNA 3B57A 1X7NA 3HOBA 1CAXA 4IEQA 3UT0A 1QY4A 1ZV4X 3LBXA 2BZDA 3PLQA 5E6HA 1SFYA 2RA1A 2IXCA 3BB6A 1C5IA 3MIGA 4AEJA 4E4HA 4LKSA 1DLCA 4OFZA 5LJNA 1DGLA 1UCXA 1ZOYA 4TZDA 4Y1XA 1DFQA 2EHOC 2E51A 1W6MA 3ZMVB 1JNRA 5J09A 4DV6T 1PVC2 3HQXA 2IZWA 3AAEB 2HJIA 3O0XA 5C3JA 5IHRA 2ODUA 3GJAA 4OZXA 4Q2FA 4TTGA 1IS3A 1UYZA 2P6HA 2FCTA 2BU9A 1QJU1 2CTVA 2HEYF 2R042 2WS91 4YVWA 4YWAA 4IDOA 2CEAA 3UFEA 1XXNA 2XAFB 2XL9A 3SH5A 1HB3A 2HBTA 5LP6E 4Y3OA 4ZZ8A 3D6EA 3KVAA 3MUZ1 2YHJA 4M3CB 4AKLA 3WV6A 3RZJA 2CA5A 4TXWA 5H9RA 3WAKA 4UT5A 4UYBA 2PTFA 1MNDA 1Y01A 3A5XA 5LBQB 2DTYA 4AHYA 1MMDA 4QX7B 3P7IA 1PM7A 1UU4A 1XNDA 4O2BE 3QOFA 2UXCT 1MIVA 2WSUA 4P00B 3ANWB 1VR3A 1G8WA 1W6NA 3B02A 4XILA 3E22E 2AC1A 4B1MA 3WG4A 1RUG3 4IGUA 4RS5C 5CGMA 3OBZA 4E4SA 3FXDB 5BMVE 1J5ET 3FLRA 4ISRA 4HFHA 3GHNA 3HVDA 3MPBA 4DMIA 2VBPA 3MEPA 2X9XA 4ASKA 5C2TA 4IE7A 2AH2A 5A6QA 3RRWA 4FP3A 4MGQA 4OMCA 5BNOB 4YM2A 4QPIA 4ZXEA 4RR3C 1O3RA 3RS6A 5LA6E 2UXBT 4Z82A 5FY5A 3CKHA 1K5MC 1V6OA 3V0BA 3LSVA 4B4RA 2VXRA 4DNDA 1DLLA 1RUI1 3IEEA 4GKKT 2BEOA 1SLTA 4ZXKA 3WG1A 5E88A 3POIA 2BDRA 4XZPA 5FZ1A 5BNNA 2NYYA 3HI2A 1V9U2 2BFUL 4ONUA 4Q5OA 3VDBA 1ZBA2 1XE7A 2XJTA 4Y1UA 2X9YA 3E5QA 1Q8QA 1UZYA 2R7EB 2WNUC 2ZPXA 3HWJA 4NE9A 3T0BA 1ZRCA 3EHZA 1PO21 5JQGE 4J6GA 5ACA3 1WCKA 1D1CA 1T7SA 4NROA 1W8FA 2EXIA 1A34A 4ZI2D 3RPQA 3LFIA 1MMNA 4CYDA 2WDVA 1GQPA 1V6IA 2AYHA 4YTNA 3I2DA 2JEMA 2HYXA 1TG7A 2QQKA 2RG4A 2DVDA 1UKRA 5BNNB 2B5HA 2BWAA 4CN1A 5AQIB 1GQGA 5E1RA 4EXTA 5AQUB 1EAH3 1D0GA 5FYHA 5ISLA 2LM2A 4R9AA 2WS3A 4M3CF 4QQHA 3VBUC 5C3QA 1MQTB 1XSRA 1RVF3 1J5WA 3N2KE 3AP4A 3J4UH 1AR73 4CDUC 1RVF2 3FC0A 2MOZA 2PHRA 1IGOA 5SV8A 2W0GA 5A1AA 4X65T 1AYM2 2D6PA 4W65A 3LG7A 3UKTA 4XCBA 1W8UA 2IXIA 3NRYA 1AYM3 1AYN3 1S0BA 2WO3A 1YYNA 3DYOA 3SEPA 3WDWA 2NMOA 4PJYA 4DNYA 1AYN2 2HN2A 1KFYA 2EF6A 5H9SA 3VHPA 4TZ4C 3J26N 1VPHA 3AKTA 4H9NC 1W9FA 1ZZ7A 2VAUA 3OGGA 2IVJA 3NAPA 4M1PA 2HH9A 1PVXA 1DU2A 1Z7S1 5E16A 2WDQA 3TNPB 4AQFC 1G86A 4E2QA 4WM8C 3I2GA 4XF0A 4YSXA 1LGNA 2BDEA 2JDMA 4M3CA 3C7OA 3ZJ2A 5FWEA 1YXWA 1QNWA 4AQFA 2VCCA 3PIJA 3CWZB 4Q4X3 1SFNA 5E0OA 5D21A 4IREA 3A22A 1PM4A 4FPFA 1RHI3 4YPJA 5KBFA 1RUJ3 3HQUA 5AQFB 2BGCA 4BH9A 1XNBA 2ARAA 2BG9B 1VBA1 2XM2A 5LBEA 5D8AB 4X8NA 2GP3A 1QU0A 4Y33A 2V7JA 4KHPT 1UF2C 3PDYA 4LBNA 4LE4A 3T0AA 3DKQA 3VD9A 4C8DA 4JGYC 4NPPA 4OYJA 4UFLA 4HKWA 5FAXA 5FYBA 1HFAA 3LA3A 1RINA 3BTZA 4O4JE 2WDBA 3BPZA 3C8XA 4JRAA 4R8HA 2CM0A 4RGKA 3IT8A 1CZTA 2ZGQA 5FY8A 3WNLA 5C70A 3CNAA 2YU2A 4LMKA 2HWE1 3K77A 2VXJA 1IQDC 2A71A 2B9UA 5IYYA 5KC5A 2Z5WA 3MIEA 4GB31 3DPRB 4O9EA 5D8AA 2WKKA 3V5UA 2X29A 4X5TA 4JGZC 3AA0B 1LOAA 2YZ4A 5JI9A 5JH7E 4U7IA 5AQTB 2HHHT 1O8SA 4XUTA 4QX0A 3VBRB 1VAMA 4CCDA 3H1MA 2RJKA 4RQPA 3PJAA 2PYTA 2VG9A 3O1HA 2UWCA 4TYSA 2VUJA 2JKBA 4DRVA 3LOBA 1WMEA 5BXXA 3ZFFA 3ETPA 3ABVA 2BKPA 1XJAA 5L36A 2WN2A 2P9BA 1NZCA 4DUYT 3NVOA 1W09A 3TOJA 1BLZA 1W28A 1MEC3 3P3PA 2W52A 1BYHA 2HPJA 1UOBA 4ZZ5A 4CDXB 4XJUA 1WR6A 4ZI2C 1UK5A 2FZ1A 5FPUA 3U4SA 1HS7A 3KGLA 4PLMA 4MX3A 4JEHB 4L0PA 2R073 1ST8A 4Q0QA 2Q9QD 1L7QA 4GWIA 3T08A 3U37A 3L3PA 1MS9A 1QKQA 3PJYA 1AXZA 2R072 1GP4A 2YGLA 2KA3A 3I3DA 3LDQB 3BPSA 3OB8A 5FZHA 3S0MA 1PGL1 4KWKA 1QIQA 2Q9QA 2DF7A 1F4AA 4EB6E 4XZUG 2W9XA 3T1MA 4J25A 2W0XA 4EZ4A 1OD5A 3AE3A 3F2EA 1QOOA 4GJYA 4U2YA 1N1VA 2JE7A 4MSVA 4NHKA 5FZDA 2PLV2 4D3WA 3QLQA 1ZBE3 4YVSC 1APNA 2MHFA 1RUNA 1FX5A 2K46A 2RR12 2RS13 2WFF1 4PCRA 3W59A 1FPN1 4NIAA 2UYAA 4UFHA 1AXKA 5BR8T 1HB2A 1UXZA 1RIRA 4I0WB 4RGAA 1JZ4A 5JOWA 1SE7A 2ZCWA 3MFAA 3VKHA 4B1LA 1EY2A 3P4SA 5FYUA 3LEIA 2BNNA 2K9ZA 4Y26A 2JG8A 5DZFA 2BVVA 4GH4C 1GU3A 3GZEA 3ZJ1A 1S0GA 4QH4A 3I97A 5FYYA 3ZN6B 4AZZA 1HB1A 2PHXA 2XHKA 4N7IA 4Y1VA 3VKFC 2P3IA 5FZBA 4RQPC 1OMIA 2DWKA 5FP8A 2X8KA 4BQYA 3ZKUA 3SCHA 4XAAA 1I1EA 3O1VA 3MF9A 2JIWA 1QJEA 2J1EA 1NUKA 4QM8A 4FP2A 3WNPA 2J1VA 3ZX7A 3RZHA 4LF9T 1K5JA 3N7LA 3O1IA 2IUWA 3AK0A 5D1IA 3PU8A 3P6BA 5GZEA 1TNRA 3ZSSA 2RDNA 3A23A 4TNWA 1OEDB 4YW3A 2ZACA 4JQTA 2ZXQA 2J7MA 2BBVA 1AR93 4XC9A 3ZN6A 5AQGB 2E32A 4HTEA 3FL7A 3ZKRA 4Q26A 3RYKA 3MLKA 3VHRA 1IPSA 3WXPA 4UEMA 4K40A 4XUPA 4YG6A 3LPGA 5FMOL 4EWDA 3WHUA 2VZQA 1JZ8A 5FP4A 4JGZA 4AVBA 4Q1RA 3D0JA 4P0AA 3RYFE 3J7NA 3M3IA 3MV11 3TAYA 3VL9A 4A7ZA 2R041 4BIFA 5KXBA 3H3MA 1OWAA 5LG3A 2EXHA 1AL0G 3VBUA 4G3YC 4UBHA 1TNFA 2OX0A 1OKOA 1BVP1 1WW7A 2DLRA 3H1WA 1G9BA 2LT3A 4CP9A 2VMCA 4COVA 1ND3A 3K4DA 4QX5A 1MS5A 1C8M3 2CHOA 4OHWA 4DY5A 1SLIA 2LSJA 5CG8A 2KWHA 2CL2A 2WQ8A 4XXPA 5FYIA 2CCQA 4HFEA 4LFCT 1KD7A 5A3WA 4D7TA 3OJAA 2K48A 3RHWA 1N32T 2EVXA 3P5BA 1IS5A 1O59A 3GBWA 4FXGB 4JX0A 5EJ3A 1MS0A 1CX1A 2JRKA 2Y8DA 2IFRA 1VMHA 2DVAA 4PDWC 4RHV1 4TLGA 3SCGA 5LEJA 5GZFA 4DO0A 1W6QB 2A75A 2WO2A 3OSDA 2V5YA 4YG3A 1W03A 3IWZA 3BOPA 3VZMA 5FZ9A 3DUIA 3J7Yq 2YC4A 4PHZA 1LOFA 1ULDA 4CP9B 1RJ8A 4E4ZA 4OMDA 3ZMSB 5FY9A 2WU2A 4FJOA 1QHDA 2HWE3 3KS7A 1OI6A 3K3QC 4ZZBA 1K42A 3L8RA 1W3XA 3B3QE 2D5UA 5HEOA 4ASMB 1ZYBA 5H6RB 4AXPA 4HFDA 2FCVA 4HVOA 4YM1A 5GALA 2VBDA 3NV4A 3WW3A 4A3ZA 4COUA 4F8HA 1GWLA 2W46A 1SBEA 1O8PA 1AYM1 3ALQA 1HQNA 4I0UA 4MGKE 1HRV3 3N35A 3MV01 4IL7A 5LMNT 3N7KA 3WINE 4CDWC 5BNPA 2D2SA 1J1TA 5HI0A 5T3NA 3LFMA 4B3RT 4P9JA 2Y38A 2LTNA 1CWPA 4E7SA 1QEXA 4HOOA 1S55A 1BVVA 1TQ5A 1X9TA 3SHRA 1QQP2 4FPOB 4META 1Z7S2 5FFOC 4KGQA 3TN93 5JDGA 3O1JA 3JB8A 2YDQA 5CAZA 2ARCA 4BDVB 2CGPA 1W8OA 3SLIA 2MTQA 2PBIA 3OGVA 5KHHA 4CDWB 1DBNA 4FAHA 3EYPA 3C4ZA 2QQMA 3FZHB 2KXLA 2A5ZA 3GZTB 4UW6A 4OLLA 3RGLA 4XXAA 1W0PA 4JI3T 4FI5A 3AXJB 2X68A 4UV8B 5JDHA 1K45A 2W87A 5J2UE 2F4VT 3OYWB 4I43B 4PJJA 2PFVA 2ZTNA 1XYOA 4KX6A 3L9JT 4TX5A 5KDMC 3URFA 4A6OA 3D3AA 3PUXF 5FL0A 1NA1C 3TLWA 1D4M1 1LGCA 2LM9A 1MEC2 2VD7A 3AAAB 3PIGA 3SITA 1S35A 4PDWA 3NRXA 1XOYA 5LA1A 4RS5A 4XDOA 4QXKA 4LKFA 4YY3T 2VL0A 1JZ2A 2JMKA 5F3CA 2QZ2A 4FPEA 3FHNA 2XLAA 4Q0SA 1HNXT 2FDGA 3V0BB 1K5MB 1AL22 2NLRA 5FZ3A 1SG3A 4YM3A 4UF0A 1ZX5A 4CP1A 4F83A 1ND3B 3KM5A 4TUYE 1VBB1 3Q5XA 2GDFA 3SFDA 3IBMA 1UN1A 4BMBA 3ZDVA 4CPBA 2C24A 4IEXA 4ES9A 1YLLA 3RC8A 2RPAA 3ORJA 2R1BA 4Y4YA 4AQYT 1PIV2 4JI2T 1QJX3 4DEVA 2CV6A 1RUE2 3EQEA 4QXBA 1PX3A 3QH7A 5LRRA 4U72A 1Y9MA 4F6RC 2RMU3 1TMF3 4H55A 2I07B 2WSSV 2A6XA 4CCCA 2VZVA 1ZNPA 1BHGA 3VD4A 1FMVA 3K4ZA 1O5UA 2ADDA 1F4HA 1WA4A 4SLIA 5FZOB 3WDVA 1CIYA 3U78A 4L11A 2YINA 3AVRA 1CPMA 4OYUA 4GYSA 2VQET 1RUC3 4HVQA 3LK42 3VZNA 5BPXA 2JDZA 3AYDA 4H9SE 3WF3A 4PI0A 1VB2A 1UZZA 4FO9A 4O9GA 2AZ5A 4KP3C 2DV9A 4XQ4A 5ANNA 4ARXA 4R52A 5IVCA 4YZ1A 2Z6EA 4Q0PA 5FXXA 5FKYA 2XM1A 1FJGT 4WVWA 5JOYA 1NEKA 1O3QA 4PIXA 2XXZA 2WZHA 2DVFA 1L0VA 3H42B 1N1YA 5F7UA 5GONE 4QKNA 2VO5A 5LBCA 1LHOA 3NW4A 5I91A 4MG2A 4L97A 2V5DA 2EIDA 1R1A1 1SCSA 2QBXA 1PIV1 3ITQA 5JOZA 3AP9A 3QBQA 5F3GA 3UKVA 4P1NA 4AE2A 4PJMA 4BAYB 1QQP1 4IL4A 4ZI3C 1XNRT 1RC6A 4IL9A 1G6NA 3NWKA 1SDWA 2XJPA 4Q4V2 5IK7A 5L47A 3O1TA 4Z8XA 3K3NA 3B01A 3MXZA 3P4WA 2GH8A 2NMNA 2W1WA 3I7DA 4OK0A 4JRLA 4MHUA 4N43C 2B9VA 3AL6A 3NV2A 5KXJA 1DQ1A 3RIUC 1C5HA 1CZVA 5J2TE 2VMHA 4X8PA 5FY4A 4LBOA 1PVC3 1OD3A 4DINB 2GAUA 2VMDA 2BFUS 2YV8A 4NN0A 2R0HA 4LK7A 4AISA 2GMEA 2X9WA 4JV5T 3ACHA 4ERRA 2J1TA 4UBGA 4UI9L 3OPCA 3AXJA 3OTFA 4UFMA 5FZ7A 5H9QA 5DABA 4BQXA 5F5AA 4NO4A 1IS4A 2HN1A 1WUVA 2X0YA 5FYTA 3UYJA 1RUJ1 3RJ2X 3F31A 1W6OB 2ZKLA 3H0OA 2WWSA 2YN6A 1JYNA 3O1UA 2G4IA 5ABFB 4HT1T 2OUJA 3NMBA 1WYCA 4RD7A 4XOGA 2WNOA 3KCYA 1I3HA 4PDWB 5T55A 2XVGA 2ZMKA 3FJSA 4AR2A 3P50A 4CEYA 1DGRA 4ORFA 3UETA 3S7IA 3CIRA 2FD8A 2D7FA 3S5QA 4NPLA 5F3JA 1J3PA 1V6JA 2VZPA 5FDBA 2MPFA 2P5BA 2BNOA 2C5JA 1NAEA 3ZMUB 3ZYKA 5L4HA 5IUXA 1W04A 3HIFA 3UQ7A 2XSAA 2HPLA 3QK6A 3QC9A 1Y9GA 3THCA 4H7LA 4Y5TA 2IC6A 4TLFA 3AB0A 3T3YA 3WY6A 1TME3 2YYOA 2FDJA 4IGPA 3FBMA 4AEDA 2PHFA 1MZ6A 2WU5A 4HEAA 2P4EA 1MVQA 2WN3A 3VBHB 3CJXA 3MFCA 3ZOIA 1S0JA 2KXPB 5APAA 1V9U3 1HKDA 1NXMA 1GQHA 2YDRA 5JSPA 3OGRA 3W5MA 1PVC1 3WHTA 2JDUA 1Q8OA 3POJA 5D8AC 2QQNA 1H8TB 4MGZE 3AXEA 4ILCA 4LA3A 2W08A 2B7YA 3EUHA 4V1PA 1Z7S3 4XUQA 1LEDA 4HKOA 3VKLA 3JC6C 4A3XA 5C4WC 2VCMA 2ARBA 1W9YA 1EAH1 1VRH2 4MGSA 5T5JA 3UUMA 1ZRDA 2VCBA 1HRI3 3MO4A 2VW1A 2OS2A 5FZ6A 2CY6A 3CO2A 4DIQA 4WM8B 4TNVA 2XUMA 3ILFA 3LDBA 4I30A 2C0SA 3BQKA 2C26A 1ONAA 5LA2A 3RI8A 4CPBD 4EQVA 5KMGP 3VHOA 4DV2T 1J59A 4AAXA 3CQXC 4FQZA 2WSVA 5KXDA 1NAFA 3GZAA 3CVRA 2WNVA 2C5IT 5J1GA 2ZHLA 1JS9A 2ZS6B 1W6QA 5H9PA 2DCTA 3J8F2 2BW8A 2XJSA 2XUEA 3AZZA 1ULGA 1T2XA 1LHNA 3S5AA 4NIQA 3UU8A 4C91A 3MICA 4RFRB 4UR9A 2OYZA 2RS52 4CXXA 2NW9A 3OTOT 4L2NA 4Q4V1 3HT2A 4CCLA 1WA6X 4E9KA 4YSFA 3T2QA 4R9CA 1AXYA 1W99A 2YG0A 3NNMA 4CI1B 4DMWA 4GB33 4EIWA 3THTA 4LA2A 5JPNB 3BTYA 3KVBA 1Z0HA 2XAQB 3IAQA 2Q1MA 4YYOA 2XJUA 3A0NA 1YI9A 2VULA 3L2HA 2HWF2 4YARA 3JZVA 4BMEA 3ZC0A 4AKRB 4EGWA 1HW5A 3C7EA 3HN3A 4XAXB 2D6LX 5A7SA 4COFA 2LE8A 1LKNA 2RV9A 2W91A 5E8AA 3ZSMA 4AKHA 5JDBA 1TZOA 2BNMA 1FV2A 4FPLA 1VJ2A 3SKVA 2BJSA 4AFDA 4EWEA 3S30A 5IVBA 1WMDA 5JMCA 2RDRA 1R093 4LIUA 4IV1A 3WNKA 2B45X 4M4PA 1DQ5A 2C9AA 4ZU5A 2ZZJA 3KFWX 2PELA 2YMZA 5AQSB 2PQQA 3OD0A 3LBXB 4LT5A 1IBLT 3GDBA 3H8UA 4XFBA 5CA1E 2BPA2 1ULPA 4MLKA 3ZR6A 1RL3A 4MXVA 1BR1A 2XHEB 3RH3A 3X1DA 3HD8B 4IEWA 4Q0UA 4M00A 2N9DA 5LY2A 3CX7B 2ID4A 2Q30A 5H6QB 4I09A 2GN7A 3T2PA 1LHVA 5JREA 1C57A 1Z78A 3PMSA 4GMP1 2XPJA 2V6YB 1REDA 4PBPA 3VBHA 3FXEB 4UELA 2ODVA 5ADXL 1NCRC 4PBOA 1OFSA 4LHSA 2PLV1 1O91A 2VW2A 4QKBA 4QPIC 2OW4A 2X67A 2A1XA 3AP6A 5FZIA 4EZHA 3RYRA 4CDXC 3MF6A 4CZZB 2Q1ZB 3SISA 2X0LB 4IV3A 3W5NA 5FZOA 1YCIA 1N3PA 1ZZBA 2ERFA 4M0NA 5FV3A 3RQWA 2I74A 3ZN5A 3V56A 2FQPA 2LHNA 1M4WA 3DEMA 1X50A 2X10A 5JSOA 3IHRA 4UIGA 4PQ9A 3U0ZA 1YQ3A 2B8MA 3T0DA 1UIKA 5FP3A 1C8NA 2DCFA 2XJ7A 2K0GA 1M06G 1FOD3 4UFKA 4JBWF 5EWSA 3I2KA 2VVNA 3JAFA 1ZZCA 4QDQA 1XQNA 3NNJA 4QB2A 4WYVA 4ISSA 2Z79A 4W6XA 1VMJA 2CXFA 1QJFA 1N3OA 4QH5A 2JWPA 3LK3B 3WQ1A 3AECA 5A6YA 1YC61 1IS6A 2VMFA 4KHZF 2X5IB 2ZJCA 3R4SA 4LK6A 1SCRA 2DHRA 1US3A 3GCWA 4D8MA 2JB4A 2UY9A 2LROA 3FWEA 5KHIA 4HFIA 2UXDT 2WYSA 4LOSA 3ZVXA 1AR82 3RZMA 1ZKEA 4JI8T 1RUG2 3I4IA 5JSRA 3THDA 1A8MA 1QOSA 2NW8A 2ZGMA 3NNFA 3J8F1 1KF6A 5CZKA 3POYA 5DAPA 3UUXB 2W92A 3THPA 1COV3 3VDDC 2D98A 2G9FA 1NA1B 3UV9A 5C3RA 3WF0A 2MBGA 1AX0A 3AMQA 3FUOA 4AHWA 3ZPOA 5FZKA 2IXKA 4UW3A 3DTOA 3GZUC 4YSYA 4AQGA 4HK9A 1KFUL 2Q4SA 2OVUA 4LJHA 4QQPA 4ET7A 1FI2A 4GAZA 3CMLA 5HV4A 2J62A 4KNCA 4U2ZA 3OYWA 3RYPA 3NKZA 4PF1A 5DDJ2 4V1Av 1IOAA 1SHWB 5CG9A 3C4XA 4JKLA 4P5HA 4P9XA 2NP9A 1HTJF 4YHJA 3L09A 4EYYR 3EDUA 2C4XA 2AR6A 1C1FA 2Z69A 5FZGA 1UUSA 4MALA 3ZCJA 4MGIE 2W61A 1N3QA 2JQ9A 3ACFA 3OGJA 2FBWA 4QPGC 3VKMA 1O3SA 2GMMA 1AR81 4LEJA 2LUWA 4N8MA 4LOTA 1SA0E 3D0TA 4PFOA 2GALA 2XJQA 5D2AA 1Y9QA 4CDQB 5HYAA 4AKIA 1ZRIA 3BGAA 3HN1A 4KMCA 2GNTA 2M6BA 2ZHKA 4X1YE 5F37A 1WYBA 1GZWA 1RMU3 3OBVE 3QNUA 4HONA 1QJY1 5JZGC 1KEXA 3HQRA 2J47A 2XZEA 3WEZA 4ZHNA 4K9SA 4ZKTB 5L3DB 4CEWA 2GK9A 2ZEWA 5FMBA 3UU5A 1OLRA 5LZ6A 3UFGA 3NKGA 4LMFA 3CQGB 1W9RA 5JR2A 2CHNA 1JXNA 2W5FA 1D1AA 2BBAA 3AXDA 3BODA 4I02A 2JIJA 5C33A 1KRIA 3Q8CA 3M2MA 4Z1VA 1QSDA 3RDIA 3AE8A 4QPIB 1K3IA 4FPHA 3IB3A 2DDUA 1C28A 4XHXA 5F6KA 3VZOA 2I0MA 4OZOA 3B9IA 2QQLA 3N4MA 2R0FA 2VNVA 4ILUA 2FBEA 3RC3A 3IIIA 4NOTA 3ZYRA 2YC2A 5I0RA 4AIUA 3O1SA 1CAVB 4KU8A 3ZT7A 1U5PA 4COYA 2O8OA 3FE5A 2R062 1F5FA 2SPCA 1L7LA 3POSA 1OSGA 5FWJA 2O1QA 4LBMA 5DG1A 5CADA 4YW4A 5DXDA 3WNNA 2QNKA 5LHIB 3LK2B 2A3DA 2NR4A 4PIYA 4QDRA 3NZPA 2K3WA 2Y60A 1VALA 4PK6A 4QMAA 3IDAA 2X5IA 2Y64A 4QHBA 1CVNA 1DGWX 3ABZA 2CWSA 3OBAA 3CEWA 2Z2SB 5DAWA 1AVBA 4IT4A 2WAOA 2WS92 2JKXA 2WZEA 2LSGA 2GN3A 4NPRA 3SNMA 5CFCC 3OKQA 2NM1A 4O65A 4JLEA 4GXLA 3ZIWA 5ABHA 4LBQA 5A80A 1B35A 5IAVA 4KU7A 4A2UA 3LF7A 5L4EA 4BE3A 1NA1A 4J1WA 5A3MA 2KR2A 2NTXA 4UW5A 1AR62 3WDUA 2E53A 2PG8A 3HKEE 5F5CA 3ZYJB 1T98A 2OXBA 4TV9E 2PAMA 4KG8A 1OVPA 3AC0A 2VMIA 1GNHA 4NVPA 4NXNT 1G7YA 3AEEA 1E7PA 2VL8A 3KF5A 1NOVA 4O7XA 1JODA 5F2SA 2ZM0A 4YW1A 1PX4A 5ACA1 1W8ZA 3TN92 1EAH2 1J84A 4LF7T 1B35B 5LB6A 4PIZA 3ZXKA 2UUCT 1FIOA 3NRUA 1H2KA 1LTEA 3Q5WA 2ZX1A 1QOTA 1CJDA 2X09A 1BEV1 2D3SA 4GKYA 4Q4Y3 5EQUA 1W2NA 3OPWA 1CQ9A 3GM8A 5HPOA 4CXWA 3LD8A 4QX8A 2W1UA 5CB4E 4XF4A 1D4M2 1LOFC 1MEC1 4K21A 5JLVA 3NV3A 4CDWA 2DTWA 1H2LA 2E9XB 1D4M3 2EIBA 3I54A 4ZONA 3AJZA 5KC6A 5KHKA 2BGOA 1OEDE 3PNAA 1HG5A 1C8M1 4CXYA 1IKPA 1RUD1 2ZGRA 3DYMA 3K8PC 3VKGA 3MYXA 4K3UA 5EYXA 2OT7A 1YQCA 4DR6T 1GWMA 1AR71 2VQUA 5JAXA 3MIDA 1IZ3A 1QNYA 4PJLA 1RMU1 2OIIA 2YUEA 4P14A 2E9QA 4ATFA 4M01A 1ZZ9A 3ZLIA 1UYYA 2K9AA 4ISTA 4AGGA
chains in the Genus database with same CATH topology
2NTYA 5LWBA 2X9HA 3ZN1B 4CQIA 2WWJA 2LEHA 1ZHCA 4HTEA 2YPDA 5A1FA 5EK3A 5FYCA 4C90A 4UEMA 2KWIB 2WMNA 2OQ7A 4IE0A 5FP4A 5LYJE 4ZOLE 4UV9B 3RYFE 4P0AA 4PAGA 4GJZA 1EZ3A 1WLXA 3NZQA 5FPVA 5DQVA 3BK9A 1OWAA 4H9RC 5IW0A 3RX6A 2OX0A 1D0XA 1V9DA 2DLRA 3N9NA 2LT3A 5M4YA 2NW7A 5EK4A 3C50A 4L5GA 3GA8A 2LSJA 4O8SA 2KWHA 2VKHA 5A3WA 5FYIA 5JDLA 2CCQA 1VOMA 4IE6A 3OJAA 2K48A 4I4TE 4YJ2E 2WMOA 5FZMA 4DBQA 2JRKA 2H3RA 2Y8DA 3PU3A 3ZMTB 1BR4A 2CWYA 4DO0A 2ES0A 4WW0A 2N2NA 5HWYA 4QHOA 4O4HE 2NOXA 3VU7H 1OXZA 3E08A 3R84B 5FZ9A 3KV4A 3ZYMA 3J7Yq 5A7NA 2VKOA 3E0ZA 4PK5A 3ETUA 1U4QA 2X66A 3ZMSB 5FY9A 3NBXX 4FJOA 5FZ8A 2M67A 5FMNA 3K3QC 2XQYA 2V7LA 5CEHA 3RYHE 2H7VC 5IWFA 2D5UA 5H6RB 4AXPA 3JC6D 5FXWA 1O3XA 2Q9QB 3HL6A 5A3NA 2GP5A 5FZAA 4XDPA 2ZLYA 5JDQA 2BZBA 3O9XA 3UULA 2ZM8A 5LHHB 3I9YA 3GN5B 4IE5A 4CUGA 4UVCB 2D2SA 3LFMA 3C64A 4E7SA 1SHZC 4H9QC 4HOOA 5JR9C 5LJMA 3OPTA 5FZ4A 3CX6B 5IVYA 5JDGA 3O1JA 4O2AE 2RP4A 3C51A 3CQCB 4KBMB 2YBSA 2MTQA 2PBIA 4PFPA 1BR0A 4LIVA 3C4ZA 5KX5E 5FYZA 4BU2A 2EHOD 3AA6B 3RYIE 4FI5A 4UV8B 2X68A 5JRCB 5HXSA 5JDHA 5J2UE 3H3AA 4I43B 2K24A 2PFVA 4PJJA 2LSKA 2PXJA 2CLYB 2JQQA 1KK7A 4QX8A 4TX5A 5KDMC 4NUBA 5L3EB 4QXCB 4JUYA 3GWHA 4AI6A 2QA7A 2LM9A 2IW5B 3OYXA 3AAAB 5FXVA 2VD7A 4AAPA 1S35A 2JPFA 3NRXA 2VASA 1CUNA 1IAPA 2JMKA 5F3CA 1D1BA 3FHNA 3ESLA 3F57A 4B6XA 4G2AA 4G63A 1LKXA 5FZ3A 4UF0A 5IVEA 5A3PA 4TUYE 3Q5XA 5L2LA 2X51A 2L8KA 4J2CA 5FXZA 5FJKA 4D6SA 3RC8A 2B1EA 3N9LA 4WBNE 5LGTB 3EDVA 3C98B 2V26A 4QXBA 3MA9A 3ZEFB 4U72A 5A7OA 2KNDA 4F6RC 4D6QA 4MBQA 2ZMAA 2WSSV 1US7B 3KV6A 4L0RA 5IVFA 1FMVA 3FBZA 2UXXB 4CCKA 4ZI3D 5FZOB 4DMVA 3U78A 4V2WA 2Y48B 2YINA 3AVRA 4D6RA 4GYSA 5FYMA 2G0UA 4ZI7E 3LK42 1IZNB 1FEWA 2Y6XA 5JR9B 5LGUB 2XMLA 4P0BA 4LXLA 2LSYA 4H9SE 1D0YA 2LOPA 4KP3C 5FPBA 4NUVA 2PJQA 2WAUA 2W63A 5IVCA 2L9QA 2Z6EA 4CSWA 1X79A 3M65A 5FXXA 3SOLA 1UCUA 3HKBE 2XXZA 5EZYE 3UTKA 5LG4A 1VRBA 5EK2A 5GONE 4QKNA 2YBPA 2KZ7B 3R6NA 4CCJA 1HF8A 5HXEA 3PE0A 4L9IA 4ZS3A 5F3GA 3K2OA 2V7IA 3KBUA 4PJMA 5AFUL 1BR2A 3IBPA 4BAYB 1KNZA 3VHLA 4ZI3C 1G8XA 3AAIA 4I50E 2I59A 4Z8XA 3K3NA 5IYZE 3MXZA 1FMWA 2Q8EA 4OK0A 2BVMA 3AL6A 2WBLA 2VKDA 3T8OA 3DP7A 4ZHQE 5L3BB 5J2TE 3DXTA 5FY4A 5FBJA 4H63H 4QU1A 3I9WA 1MMGA 3U3IA 2IC9A 2X9WA 4PW8A 4ERRA 2WWUA 4BXFA 5FZ7A 5KR7A 1HG2A 5DABA 5F5AA 3MACA 5FUNA 5FYTA 4IGQA 5FPLA 4QX8B 2XAJB 3UYJA 5IVJA 3F31A 3Q2MA 3RKOA 2Q8DA 2D0TA 4GYRA 1WYCA 2CLYC 5A7PA 4GIWA 4YJ3E 1YD8G 3DXUA 4GD4A 5IVVA 3W15B 4MFRA 1G73A 2E9XA 5HXCA 2YK0A 5FYVA 5F3JA 2A2FX 4PNIA 2P5BA 4UF0B 3N5LA 5F3IA 2C5JA 3AA1B 3ETVA 3UUNA 3ZMUB 3ZYKA 4A56A 3FBLA 3GMIA 2HPLA 3QK6A 3QC9A 4E7ZA 3H37A 4DBRA 2IC6A 4QX7A 3MZKB 3ANWA 4H63V 4IGPA 2VK9A 2XTLA 3WI3A 2C5KT 4HEAA 4MHCA 4H9OC 3RPUA 2KXPB 3KINB 4K0UA 5A7QA 4WNKA 4QXBB 5JR9A 5LY1A 2K5BB 3ONXA 3SWHA 3KBTA 5L3CB 4O4LE 1H7CA 4H9PC 2EHOB 3HA4A 4NUUA 3PDQA 5LOVE 3EUHA 5FZOA 4PJNA 3JC6C 5K4LA 3UUMA 5HXRA 2YEVC 5FP9A 2OS2A 1B7TA 5FZ6A 1QUUA 3CPZA 4DIQA 5HAXA 2JJ9A 3LDBA 2C0SA 2V7KA 3BQKA 5F5IA 5F39A 2JMHA 1UX4A 5KMGP 1ZEEA 4IE4A 4ANJA 1D0ZA 3HKCE 3CQXC 4TN7A 4HKAA 3KV5A 1NAFA 3CVRA 4JEUB 2C5IT 1E1HB 5J1GA 2XUEA 4BISA 4UVBB 1AJ3A 1MIWA 4C91A 4X20E 2H7OA 3B13A 4BA9A 4UXNB 2NW9A 4CXXA 5A7WB 5ANQA 4CCLA 4IHJE 4WBOA 1MNEA 2QGSA 5IHYA 5FZCA 3J9X1 3B57A 4CI1B 5FJHA 4DMWA 4EIWA 5LNKA 4TN7B 1UX5A 3KVBA 4YLHA 2XAQB 2OA5A 4UVAB 1ZV4X 3LBXA 5E6HA 3ZMZB 2RA1A 5F2WA 4CCMA 4E4HA 4OFZA 5LJNA 5FZFA 3PUGA 2EHOC 4YFSA 4AKRB 3ZC0A 2NWBA 3ZMVB 3GN5A 4XAXB 4V2VA 5A7SA 3DJBA 2LE8A 4XBFB 2YU1A 3AAEB 3RYCE 4AKHA 5IVBA 2ODUA 4LIUA 3Q9DA 1MMAA 3BQIA 3UFEA 2CEAA 3ZCIA 3RVHA 2XAFB 3KFWX 5LP6E 4Y3OA 3PUAA 3KVAA 3LBXB 4AKLA 2CA5A 5LGNB 5CA1E 3WAKA 1MNDA 3A5XA 4MLKA 5LBQB 1BR1A 2XHEB 3RH3A 1MMDA 4QX7B 3P7IA 5FZEA 5LY2A 2N9DA 4O2BE 3CX7B 1MIVA 2IAKA 3ANWB 5H6QB 3TKLB 3E22E 5JREA 4IGUA 5FYSA 2MYSA 2HH7A 3K3OA 5LHGB 3FXDB 2N1GA 3SRZA 1LVKA 5FY7A 5BMVE 5F3EA 2KT9A 3FXEB 4UELA 2ODVA 5JDFA 5ADXL 2LSIA 2X67A 5FZIA 4EZHA 2X9XA 4ASKA 4IE7A 4CZZB 4TV8E 2X0LB 3RRWA 3LJCA 3HR0A 2BVLA 2EHOA 3AL5A 3QUJA 5LA6E 3I0OA 5FV3A 3S4UA 5FY5A 2LHNA 5FNVE 5FUPA 3AA7B 3CKDA 4DNDA 3IHRA 4UIGA 3IEEA 4OYKA 2KMFA 5FZ1A 3AVSA 5FP3A 2DCFA 3HI2A 2CWOA 4KUMB 3I1AA 2X9YA 4ISSA 2CXFA 4HN9A 2XAGB 2E9XD 3LK3B 3SS1A 4GOUA 2Q9QC 5JQGE 1YKHB 1D1CA 2DHRA 4ZI2D 1MMNA 3I0QA 5JDNA 3IF8B 2V1DB 1ZKEA 5A7WA 5A3TA 3PUQA 3MK7C 4N78D 2WM9A 2NW8A 2XASB 4EAHA 4EXTA 5JVDE 5FYHA 5ISLA 3UUXB 5TAOA 1WRDA 3N2KE 4GK5E 1IJ6A 3V5SA 3NJYA 1YKEB 2MBGA 2MOZA 5DQWA 3ZPOA<