3K3NA

Crystal structure of the catalytic core domain of human phf8
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
354
structure length
349
Chain Sequence
b'RSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 8
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
total genus 93
structure length 349
sequence length 354
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3nA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3nA01
4Y3OA 4BXFA 5F3CA 2GP5A 4ASKA 2Q8EA 5LWBA 4DO0A 4QX8A 4QWNA 4AAPA 2WWUA 5FP7A 5K4LA 2OQ7A 5FZIA 5FZ1A 3PU3A 5A1FA 5FJKA 5FUPA 5A7NA 5A7SA 3OPTA 2WWJA 4V2WA 5IWFA 2XXZA 2P5BA 2YBKA 4HOOA 4QXHA 5FP4A 4CCKA 5F39A 3AVRA 5ANQA 3RVHA 5FYCA 4EYUA 2Q8CA 2GP3A 5FP3A 5F5AA 4BISA 4LIVA 5FYBA 4CCJA 3AL5A 5FZHA 2OX0A 5A7QA 4UF0A 5F5CA 5FUNA 3LD8A 5FPLA 4XDPA 5FZCA 5FY5A 5FYIA 5F3EA 4LXLA 4XDOA 5FZFA 5FP9A 3K3NA 5A80A 3UYJA 4GD4A 5FZ9A 4D6QA 5FPUA 3KV6A 5A7PA 4IGPA 5A7WA 3U4SA 2YPDA 5FBJA 4CUGA 4EZ4A 5KR7A 3N9NA 5FJHA 2XDVA 4QXCA 2OT7A 2YBPA 5IW0A 5FY7A 2VD7A 4HONA 4GJYA 4URAA 3AVSA 5A7WB 3OPWA 4D6SA 5FZEA 2XUEA 5FZMA 5FYZA 2PXJA 5FZKA 4Y4RA 5FXWA 5FZ3A 3KV9A 3PURA 1VRBA 5FY4A 3KV4A 3ZLIA 3AL6A 5FXVA 5IVJA 3NJYA 4QXBA 3U78A 5LY2A 5FZAA 3PUAA 5F2SA 2OS2A 5E6HA 4NUBA 5FZDA 4LIUA 4V2VA 5FWJA 5FXZA 5F32A 2XMLA 5IVFA 5FYUA 5FZ7A 5FZ0A 5A7OA 5A1LA 4CSWA 4IGQA 5FXXA 5FZBA 5FV3A 5FYHA 5FY9A 4DIQA 5FYSA 5FYYA 5FZ4A 3KV5A 3PDQA 5FZ6A 4E4HA 3KVBA 5FPBA 3LDBA 2YU2A 2OQ6A 3N9LA 5FY1A 3ZPOA 4CCOA 4UF0B 5A3PA 5F3GA 4GAZA 5FYTA 5FZ8A 3N9QA 5FZGA 5CEHA 5F5IA 3N9OA 4CCLA 2YBSA 3DXTA 4AI9A 5IVCA 4TN7A 3KVAA 4CCNA 3K3OA 4D6RA 5IVBA 5FZOA 4C8DA 5A3TA 5LY1A 5FP8A 5FYVA 5FYMA 5LW9A 3DXUA 3PUSA 5F3IA 3PTRB 5FY0A 4EZHA 4GJZA 2W2IA 3K2OA 5IVYA 5A3WA 5FY8A 5IVEA 3N9PA 5F37A 5FPVA 5FZOB 5FPAA 4QX7A 4IGOA 5FZLA 5F2WA 3PU8A 4BU2A 2Q8DA 5FWEA 4Y33A 3N9MA 2YU1A 4LITA 4QU1A 5IVVA 4CCMA 5ISLA 3PUQA 5A3NA
chains in the Genus database with same CATH superfamily
4Y3OA 5CA6A 2A1XA 1UZWA 1IOAA 2VASA 4HFVA 1DHKB 1U5YA 4IEQA 3KT7A 5JPNB 1RUE3 4B7EA 2JG8C 2RV9A 1KDKA 4GH4C 4O61A 2WNUA 1D4M1 3LWCA 4JGZC 1J1TA 2RPAA 5ABGA 3BQIA 2BJSA 2RDQA 2UUCT 2RS12 2WNVA 2XKPA 2Y8KA 3H0OA 3MV01 5A1FA 5L9RA 4JEHB 4LO6B 1DQ1A 2X9WA 1NXD1 1LVFA 3FC0A 3PMSA 4FOQA 1UKGA 2P5BA 4XBNA 3RLFF 4MUVA 3WNNA 4CEYC 2IVJA 2LS6A 2NMOA 3BU7A 3R4UA 3VZLA 4YTMA 4IXLA 4INDA 3RZZA 2ZBJA 1A8MA 1G8XA 4ASMB 1JBCA 2E26A 4CE8A 1SE7A 2J1EA 3C4ZA 3TEXA 1HXS3 3MIGA 2XVKA 2WZIA 3RWNA 4ES9A 1CAUB 4IV3A 3BTAA 3GGLA 2WM9A 4CU7A 4CTEA 2TUNA 3WDTA 3RIAA 2XAHB 3QH7A 5FOJB 3GMIA 1UKRA 4UF0A 5HAXA 3WAKA 1ZA4A 1ZREA 3VBSC 1NE4A 3I59A 4ZZ5A 3K4ZA 2YC2A 4HSLA 2CXDA 3LFMA 1MACA 4XZUG 2WYFA 2HLEA 2JG8B 1V9U2 1D0GA 5FZCA 2HEVF 4TLFA 1SCSA 3D0SA 2GU9A 5JCTA 5C70A 1N1SA 2QQIA 1US7B 4E4DX 2CM0A 3I49A 3POBA 4JKKA 4PIYA 1OOPB 3VRAA 5A32A 2RS32 3U4SA 4YVSB 3ZYRA 2ZGPA 2VNOA 5KWRA 4R52A 3WQBA 1ASJ3 4XTPA 4N8MA 5DUUA 4PBOA 4CP2A 5AQNB 2HN2A 1W03A 1XDOA 3FJSA 4K9SA 5LBFA 1URXA 2E9XB 1E7PA 2KWIB 4UV9B 3AVSA 5ABHA 4LF4T 1HJGA 1Y9GA 4Q4X2 3ZO0B 4ZS3A 1BHGA 4PDWB 4XHXA 4U2YA 4YG0A 1QJU3 5EZWA 5BNNC 4Y22A 5LA0A 3ZSKA 4YHHT 3MO4A 4QM9A 4EN8B 2QBXA 2D3PA 1HB3A 5FREA 3SNMA 4QXBA 2YG0A 2ZGKA 3TNPB 1Q8SA 4QH4A 4AEDC 5LY2A 2VULA 1H4GA 5HCAA 2RS52 4Q0QA 2V5DA 1PM7A 1AR82 3VR8A 4DV5T 3L8RA 1LVKA 4Z1VA 4ZXLA 1U5ZA 2UY9A 3EBRA 2XMLA 1NUKA 4KL1A 4AGGA 4IT4A 1VBA2 3SCFA 4BHPA 1AL23 4TX5A 4CDQB 5C71A 3U3IA 3AMNA 4LBMA 3WNXA 3NVCA 4QXHB 1GICA 2BGPA 1BR0A 3K77A 4N53A 4A42A 5FTTC 2YFUA 1NLQA 1VBB3 2Q1MA 1YQ2A 3CQOA 1FPN1 3FLTA 3LEMA 3NNMA 3NV3A 2PFVA 1XNAA 1WKYA 5LHHB 1XE0A 1YEWA 1Q8OA 1JUHA 1SACA 2EXJA 3AEGA 2HJIA 2P3JA 3SISA 4CCOA 5A3PA 5JPMB 3OPCA 4GAZA 5FZ8A 4YJ3E 3VBSA 1D2SA 4MSVA 3U11A 2IW5B 2K3WA 2YBSA 4B8EA 1ND3B 3Q5WA 1FYUA 2F4PA 2GSYA 1HN0A 5FIXA 5J48A 4U72A 4IE0A 3AXJA 3CLPA 5CFDC 1OXZA 1EAH1 1OXCA 4UFKA 5HEGA 1JU4A 4NPLA 4YNIA 3ZKRA 2HWE3 4L97A 2HKXA 3ZYJB 4ARYA 4BIOA 2UWCA 3KQRA 4A97A 3JD73 3PNAA 4LLOA 1WW4A 2QQVA 1BBT1 3NNJA 4E4ZA 1Z7S3 3P5BA 2EHOA 4Y20A 1QIQA 1WYBA 4L9BA 1QJU2 2IXJA 3GF6A 1UWWA 4IEOA 4Q4Y3 1O3QA 5JDNA 5KHKA 4AVVA 2ZEXA 4XJ9A 2CV6A 4TNVA 3TLUA 1CPNA 1UU4A 2JDKA 3AKPA 3DJBA 2WKKA 3HN3A 1PGW1 4HTEA 2NM1A 3E5UA 5B2GB 5H9RA 2BVVA 4GH4B 3N36A 5IAXA 4YGEA 4WBBA 1W8FA 3RI5A 1LESA 5H9SA 4QWNA 3LDRA 4BQ3A 3CMGA 3JQXA 4YG6A 4CA9A 1O4TA 3ZT5A 2WO7A 2GNTA 1LOGA 4F7ZA 4GA9A 2NW8A 1SHZC 5L19A 5EXOA 2IXHA 2RR11 2V7MA 1DQ5A 3FWEA 3P1IA 2Q9QC 4HK9A 3WQ0A 4PK5A 4DEQA 2GC2A 1WGPA 5BNPB 1QY4A 3O9XA 3FBYA 5AQKB 4N9IA 4ILCA 3IT8A 3WLUA 3ZSJA 3MIDA 3QB5K 5J0ZA 2ADEA 1MQTB 2WA4A 3AVRA 3KQ4B 4FCAA 2A71A 3D3AA 3U75A 3VDDA 3RVHA 2PN5A 3VKOA 3WW4A 4CEWA 5FP3A 5F5AA 4XW3A 4DRRA 4YTNA 1XNTA 3DPRA 5HXVA 4BISA 1RUOA 4UW6A 4WZFA 4YARA 2EIDA 3FBMA 1YQ8A 3WW2A 5KC6A 3RYPA 4TLGA 5A3LA 5AFBA 5I0SA 2C26A 2KD7A 2ZGNA 4IEYA 1H8TC 2JIJA 2O8QA 3M3ZB 2P3YA 5H6QB 1RXFA 3CZJA 5DAVA 3H3UA 4MOAA 3NKGA 1Z7S2 1YI9A 5GLUA 5I93A 3CJXA 2WYSA 1JOPA 2ZX3A 2VCBA 1YKHB 2I45A 5LGUB 3B00A 3KV6A 4IQPA 3NNLA 3MW3A 5FVKA 1KS5A 1ZNPA 3O1SA 2ZA9A 3NL1A 4XFAA 3S5QA 4L8QA 4AVSA 1ZRFA 3EVYA 4CYDA 3I2GA 1PO23 4MHUA 4JKLA 4QXCA 4Q5OA 3P8CD 1S2EA 3FHIB 3LKJA 5LA6E 4I02A 1G86A 3OG2A 3ZXGA 3ALQA 4R4ZA 4ZI2C 3F2ZA 1YXWA 1WCKA 4FPLA 4X1KE 1NCQB 3GBWA 2IIUA 1R1A3 2ZAAA 2X5IA 2ORZA 2WU2A 4MBQA 1XSQA 5CVRA 1ZZ9A 4M0HA 3MPPG 4YVWB 2GC1A 3EXUA 2B8MA 1S0IA 1LEMA 1Y7BA 2D9DA 3DYPA 3H50A 2ZGTA 2WIIB 3ZMNA 3OGRA 4JRAA 3T4HB 3CK6A 2VO5A 3AE7A 3C8XA 5FUIA 2CGOA 4AFDA 2A9UA 3C64A 2RHPA 3AYEA 1KNZA 4QQHA 4IL4A 5AQOB 2EXIA 1YQ4A 3L09A 5LMUT 1VB4A 4QPYA 3P50A 4Q4V2 4UVAB 3DECA 1OEDE 4IGQA 1KS4A 3FZHB 1W06A 2D98A 3EO6A 3ZXLA 2PHWA 4CDXA 2FBWA 3UK9A 5FMCA 1JHJA 2XLAA 4DR1T 1NCRA 1P8JA 2H0VA 3MICA 4YJ2E 3SITA 2OQ6A 4PJJA 1AX2A 3JBG2 4GMP1 5H9PA 1WCDJ 3IPVB 2VW1A 1HCIA 3O1IA 3MZKB 4PFPA 2V1DB 4KBBA 4H63V 1GQPA 1KDMA 3IKWA 4NWWA 2Z5WA 4WVWA 1H0BA 4EWAA 1OF3A 3M3QA 2XQ6A 1COV3 1YNAA 2XJ7A 2DU1A 4CI1B 4QXKA 4YGBA 2DFCA 2JDPA 3W9AA 4CCLA 5IVCA 3T0AA 2XQ7A 5GLVA 3EDVA 3FZLB 5CZKA 1UMHA 3LSVA 5C4WA 1S0FA 4QX7B 1KITA 1X50A 2WFF2 4U3CA 4MXVA 4QB1A 1SFYA 3CJIB 3UUBA 2ZZJA 4JDMA 3ZOIA 2F4LA 4BQ1A 3B5LB 1HRI3 3J4UH 4G4FA 5FK7A 2FDGA 1WLXA 1V70A 5I8YA 4DUVA 1OPMA 1WA6X 4TV8E 4GMP0 4RR3A 4XVHA 4CU9A 4YVSC 1WLTA 1Y9MA 4JCKA 4CVUA 3ZM8A 4UIGA 3GXUA 3VHRA 1DZQA 1CZVA 1OH3A 1PX3A 1VBC2 2WLQA 4UOJA 1PK6B 2VCMA 3AYAA 3J26N 3VV1A 4CCMA 5JZGC 3P4PA 5LWBA 1G9CA 1AUYA 1POQA 2ARBA 1PGL1 4E7ZA 1W9TA 2OXBA 5AQSB 1HB1A 5CJ5A 1VAKA 3MXZA 5ABFA 3VKFC 5KXBA 2P6HA 2CWOA 2UYBA 2YKSA 2FUPA 4AGVA 4COVA 1VBE3 4HG6B 1AL22 4P9GA 2DURA 2PHTA 3P3NA 2UU9T 1ZM1A 4LULA 2QJVA 3ZKYA 4P14A 4GXLA 1LAJA 4OZOA 4YSZA 3P4RA 4ISSA 2R072 3ZMSB 2W1UA 2YV8A 4CXWA 2G1MA 4LHSA 4N43B 5L36A 5JLVA 2WSVA 4Y1ZA 2YC0A 5E88A 5KHIA 1YYNA 4JTNA 5CA1E 5JIAA 1W0OA 1QQP1 2NWBA 3RYIE 1FIOA 3WG3A 5FYCA 1GYKA 1JZ8A 4DXTA 2AXDS 3P6BA 5I8SA 2A70A 2FD8A 2ID4A 4K21A 4IE4A 5FYBA 4IREA 1RHI1 1BEV2 3CZUA 3J7MA 4NHYA 5IYYA 1IS3A 3WVJA 5LB7B 2D5HA 3T08A 3V64A 2M6BA 5BMVE 1EUTA 1V6NA 3HKBE 4HPKA 3H8OA 4P1NA 4X1IE 2D6LX 2RE9A 4JBWF 5F3EA 2OPWA 1MS8A 3E6BA 1YQ3A 5FKYA 1EV12 4K0KT 1UYXA 2G9FA 2V09A 2VBBA 3VBFA 4DS0A 5BNOA 3VD5A 4ZONA 3PJYA 3Q9DA 3JUUA 1T8BA 4JI1T 3BN6A 4KBMB 4AQFA 5AQLB 2KXLA 2FDFA 1ND2C 1DQ6A 1FOD3 1J58A 4P9XA 4ZHQE 3FX3A 3UULA 2OT7A 3B94A 1GZ9A 3CEWA 1GWMA 3H3LA 3MIBA 4GJYA 4L9IA 2JECA 2OVUA 4HONA 4UFJA 5KMGP 2VMHA 2Y6XA 4TYSA 1W6QB 4ZU5A 4I0UA 5HEHA 4OHXA 4H14A 2PXJA 2QTWB 4LQRA 1RUE1 5FZ3A 3PURA 1O5LA 1UYPA 1WD3A 2C0ZA 2VVFA 3ASIA 3RZHA 3VBFC 3N4MA 2OW4A 2W92A 3J8F3 3O1UA 4OI2A 4QPGC 1WLCA 3U37A 3O12A 3FXEB 2AGSA 4DV1T 4OULA 1ASJ1 1B7TA 1C8M2 1UY1A 3UETA 3ANWA 4C91A 3HEIA 3KB5A 5CBLA 3HMYA 1QOOA 4LBJA 4XAEA 3V56A 2MBGA 3EJKA 4XHBA 5DUVA 3KWVA 1X33A 4M3CB 2LE8A 1MZEA 1RIRA 4HFDA 2J7MA 3KZ4C 2WAOA 4AKIA 4DV3T 2WDRA 2BWCA 2VTFA 4XFFA 3R6SA 3WR0A 2VOWA 3K75B 4ZXKA 3UGGA 5FO8B 3HKDE 1HG2A 3S4UA 3OCPA 4IV1B 2RJLA 3D0TA 1UAIA 4MLKA 1OEDA 2HWF2 3WP5A 4ZY9A 5IAVA 2GMPA 3RNSA 4ANJA 3Q5DA 3WT3A 2JX9A 1VRH2 3OTFA 3ETUA 4YZ1A 5H9QA 3FLRA 5DZEA 1BR4A 1W9SA 2DWGA 2MPKA 2BOJA 2VMCA 3BALA 3N9QA 3I3QA 3OBAA 3TYJA 4I50E 3UJQA 3POJA 1NEKA 3RYFE 2BPA2 4YW2A 1IKPA 4KWUA 5IK8A 1CN1A 2ZZQA 3O1VA 1OEDC 3B5MA 1SFNA 3D6EA 4XQDA 3I2JA 3RIUA 2P17A 4BB3A 3ZYPA 3ZFEC 3R4DB 2IUBA 1SLAA 3ZFGA 5A33B 4Y5TA 3R84B 3E08A 1ZRCA 2KMFA 1XJAA 2CNAA 1YUDA 1UY2A 4HEAA 2B9VA 1UX4A 3EI0A 5FZOB 5LEJA 4LF5T 1RVF1 5LK7B 5CFCC 4RD7A 1UU5A 4K40A 4U74A 3I9WA 1VBD2 1BZWA 2RS33 2NQYA 4QDQA 2ZM6T 2O0OA 1CR7A 2ZJCA 5FQ0A 4Q27A 5L3GB 3L2HA 5JOYA 2W4XA 1UOFA 1D0ZA 3Q2MA 4QX8A 2VQTA 2WSUA 1KK7A 5LMNT 1C5HA 4OQ9A 1RITA 2OYZA 3RI9A 3LIHA 4QX5A 4Z8BA 3MI8A 3LEGA 3N7KA 4IEWA 4OUMA 2IXKA 4AKLA 4K1ZA 1FJGT 4R9CA 5BNOB 3GN5A 3UT0A 3AAEB 1UIJA 3L3PA 3GNEA 4GWMA 3OUJA 1YO8A 4LBKA 4EAHA 4K8RB 2LRKA 4LBQD 3POFA 3JADA 5IFTA 4HKAA 3D5OA 4JGYB 3IIIA 3HT1A 4WBOA 2DVDA 4BQXA 2HWE2 5C5TA 1HB4A 1S0JA 2VNVA 3OBZA 4XBLA 1W90A 2ZX0A 4DINB 1SA0E 2JG9C 3OJBA 3CKHA 2W62A 5JTGA 2W63A 2WP9A 3PUGA 1DGWA 1KXGA 1U0AA 2QQKA 4KU7A 4PDWC 3BYWA 4XFIA 5CKNA 5HXMA 1UX5A 1C3HA 1GWKA 5A7QA 1B35B 4Q4Y2 4WM7B 1WMFA 4YFZA 3WG4A 3RQUA 4Z2WA 1WCUA 1BR2A 1VAVA 3ZN6A 4DBRA 2VQAA 3KDSE 3KINB 1Q5OA 3UU5A 3NRXA 2R32A 2VPVA 4XDPA 2Q5TA 3VD7A 3ZFGC 1W8TA 4QX2A 3OVUA 2DCZA 4H2AA 4NO4A 3FUQA 4BYYA 2AREA 2PLV3 4R4XA 3AP5A 4P00B 1S35A 1OLME 3I3DA 2CMRA 1QXJA 1R083 4BQ5A 3CJIC 3FN9A 2BG9C 4LKFA 5D2AA 1C4RA 1X36A 3POEA 3GJBA 1QXPA 2VXJA 2YBPA 1JYVA 2LSGA 3JCFA 3K3QC 3NKZA 4JUYA 2B46X 1ZV4X 2BVLA 5JXIA 1F4HA 4CUCA 4LE4A 5JQGE 3AXDA 3C7HA 1W2AX 4OHYA 2W67A 1GOHA 4WVVA 1ZZ7A 4R9BA 2ZLYA 3AL6A 1W2TA 3QUJA 5DG1A 4F83A 1YKEB 1RB8G 2BYVE 1O3SA 3QBQA 4R9AA 4D69A 2ZPXA 2KT9A 2KZ7B 3KCYA 1MS1A 4Q4W2 4CUAA 1HKDA 5LJMA 5HWXA 2XQ4A 2OS2A 2YK0A 2WQ4A 5KHGA 1H8TA 2ZHKA 4ARXA 2OZ6A 2W1WA 3VBUA 3NV2A 4WVMA 3UNPA 1W9FA 1WLDA 2FCUA 4QKNA 2FJBA 5CA0E 1GQEA 2H89A 2A75A 1H2NA 3BOPA 5IYZE 4HL0A 4A3ZA 4YXDA 4MGTA 2OPKA 4OYUA 1AYM2 4AR2A 3B7MA 1BK1A 1JTZX 3TOJA 2IXIA 1F31A 1ULOA 4DZGA 2BUKA 2N7GA 5C5UA 1UGOA 5JUVA 2W3JA 1PZ7A 4NHXA 4Q0VA 3RC3A 2ZGRA 1MEC1 2X51A 3K4AA 4OFGA 3IEEA 1OH4A 3I8TA 2C6SA 3SCGA 2Q9QA 1UOJA 1ULCA 3AA0B 3N9OA 4B4PA 2RM23 2HHHT 1XE7A 3DXTA 3Q8FA 4AI9A 1OMIA 3V0BA 4YW5A 1QJY2 5ABJC 1JYTA 2G4IA 2WAUA 5JDHA 1WLWA 1T6BX 1R082 1YFXA 2JB8A 3ACGA 5EV7A 5FYVA 4YPJA 5A3TA 3AEEA 1LGNA 3E1F1 4X1YE 1AJKA 5CFDB 1UX7A 4X20E 1W6OB 2RR13 3MYXA 4UI9L 4AFMA 2R041 4QX3A 5L3BB 4Z90A 2V5CA 2XAQB 3SFEA 5FL1A 1LOEA 1OT5A 1VBE1 1LGCA 1G6NA 2C1FA 3OY8B 3U1XA 5JRCA 3L39A 4HXCA 3AXEA 4COFA 2LKGA 4L5GA 4UBHA 3ABZA 5EYYA 4AFCA 3BODA 4B3MT 3NV4A 4LITA 5L3CB 2B7YA 2WS91 2RVAA 3KF3A 4RQPA 2OKXA 4DMWA 1HQNA 1EPWA 4BXFA 5F3CA 1WZXA 5L7OB 1E57A 3CMLA 4DV0T 4OI1A 3M70A 4PI2A 1W3VA 3MGUA 4FPOB 4QMAA 4AHWA 5BNOC 5FL0A 3C7EA 2X66A 4LF8T 3T1MA 2E7AA 2VG9A 1US3A 4JLEA 4GK5E 3V5SA 2QRXA 2ZHLA 1UCUA 4HKOA 3BQKA 4UWDA 5ABJB 2LSKA 3AEBA 2WWJA 3C3VA 3GCWA 2UXDT 5DDJ1 3SRZA 1U5IA 2DCJA 4FT8A 5FFOC 1W9RA 1CX4A 1KFYA 1RUJ2 3RH3A 2GC3A 2L9QA 2BDEA 2C9KA 4HKLA 4AQ6A 5J7MA 5DQ0A 2BBVA 4MGKE 3HVDA 2XSBA 1WCSA 4LF6T 2WNUC 5D8AB 3E5QA 2Q8CA 4K3UA 5APAA 3D8CA 1JZ4A 3PMEA 3P4WA 3ZJ2A 2DI4A 3HIFA 4RR3C 4LORA 3CKDA 2QUOA 3VDBA 1E5SA 2VXRA 3ZCJA 2VURA 2RS11 5JDBA 4NIQA 1JI6A 1N1VA 4GQ7A 4UR9A 1YC61 2LROA 1E2AA 2QQNA 2YHJA 5T5PA 2P9BA 5LA9A 2HWD2 3I7DA 4P9WA 2Y0OA 4U7YA 4LXLA 1AL0G 1GV9A 1W0PA 2IC1A 4FQZA 4PNIA 4ORFA 1L7LA 1GNHA 4O7XA 1FEWA 2K9AA 3N5LA 3MJXA 1IQDC 1WMEA 2VGDA 2ZOEB 4HETA 1DBNA 1W3XA 1ND2A 2CU5A 3J8F1 1D0YA 3OGGA 3IMNA 4AQFC 2YPDA 5CU1A 5EQUA 2W00A 5HWYA 1XQNA 1NX9A 2YPJA 4CP9B 4CUGA 1GKBA 4IL9A 4J6GA 3GZEA 4AQYT 4PJYA 4AKHA 4JI7T 1UX6A 5IW0A 1HRI2 3CBNA 2WWVA 5JIUA 5HCMA 2ET1A 4YGCA 3WHTA 4AGRA 3DL3A 5FZEA 2CXLA 4NAMA 5FZMA 5FZKA 2GMEA 4U7IA 1NKGA 3J7NA 3KS7A 4O4JE 2WA3A 3VR9A 1J5ET 2LSIA 5EJ3A 1UQXA 3GZTB 2XAGB 4XFHA 2WDVA 2VL8A 2BVMA 1HIXA 3VU7H 3DV8A 3BUCA 3A5XA 1HW5A 1R091 2RDNA 4LO5B 1S94A 3BIEA 1JZ5A 3HL6A 2W91A 3PIJA 3F31A 3ZMOA 4UAPA 5CB7A 1OQ1A 2QYWA 3NQHA 3EDUA 2EXKA 1J83A 3B3QE 1W8HA 4CCCA 1ODMA 3FHAA 1UUSA 3KVBA 1AR92 3VKLA 1LRHA 3WDYA 4CCDA 3D4KA 3JCIA 4U31A 3WF1A 3UQ7A 3NZQA 3HBZA 4EN6B 4UF0B 4QB2A 1GSLA 1LTEA 3GBFA 3PDYA 1QEXA 2VZUA 5FMOL 4A41A 5K0UA 1SDDB 5AQQB 3ZSLA 2I0MA 3JQWA 4UVCB 2F4VT 4EIWA 1LHOA 4CCNA 4JQTA 1OLRA 3KGLA 1Q3EA 1D0XA 1VBA1 3ZC0A 2RDRA 2LALA 3CPZA 5AFUL 1CIYA 4JGZA 1XNRT 3ZXFA 1HN1A 4WNKA 3HT2A 3I4IA 2BW8A 3OSDA 4QPIC 4YVSA 3LPGA 2W87A 5F3IA 1QH6A 5IVYA 1J1LA 5A3WA 3WXPA 1OWAA 3WP4A 4P0BA 4WM8C 2Q9QD 3M2MA 2O14A 4TTGA 1MS0A 5A6ZA 5LHGB 2HWB1 3O1TA 2E8IA 2NTYA 3B02A 5JH7E 2PJQA 1RUH3 2EIGA 2HYKA 3POYA 3UGFA 2YDSA 2QCSB 2BFUL 2QQWA 4R9DA 4KUMB 4ZI3C 2W9XA 5HPOA 1FOD2 4MZUA 1V6KA 3OEAA 2VZOA 1RUC2 5JOWA 4ASKA 2X0YA 1FMD2 2A3DA 1JMUB 3ILRA 4QXBB 3ZXAC 1W6NB 3MW2A 3U10A 4ES8A 4FPEA 2AC1A 3DP7A 2LOPA 4QT6A 5HEOA 1CPMA 1GP5A 3ZR5A 5FOBB 5AQTB 1SPPA 1XOYA 3G6JB 2A72A 1BBT2 3RYKA 3EYPA 1W6MB 4A5XA 2UWAA 3ZIXA 3LIGA 5EK4A 2F17A 4MH0E 4XF9A 3ZC1A 1CQ9A 4Q26A 1YQCA 2FZ2A 5DABA 3ONJA 4QXHA 5D21A 4CCKA 1IG0A 3KT1A 1JYXA 5FQ0B 3FUOA 5AQRB 2WZHA 4FSJA 2GMMA 4QH1A 1PGW2 4F8AA 1JYNA 1DDLA 4RFT0 4UT5A 3SH5A 1F8VA 2GP3A 2R6QA 2W68A 1NCQC 1LU1A 2GH2A 3AMMA 5ERLA 3VBSB 1RMU2 2BS3A 1ACCA 3H3ZA 1RUF3 3B69A 1WCRA 2WC2A 4RFRB 4W6YA 3T2TA 2EALA 2FDIA 1SCRA 4U36A 3AXJB 1VBD3 1MMNA 1OA3A 1OPOA 3MW4A 4CN4A 2QDRA 4WVZA 3A22A 2WZR2 4OUEA 1J3RA 4BOWA 3AEDA 4GD4A 2TBVA 4KWKA 2CE7A 4ZZCA 2WN2A 4IEXA 3ONXA 4FI5A 4CXXA 4J1XA 4X66T 4CPBD 2EHOB 4LK6A 4PQ9A 3CIRA 4Y20B 3RGBA 4X8NA 5CISA 5G04L 1K3IA 3OPZA 5IUXA 2IXCA 1BK0A 3S5AA 4RS5A 2H0BA 5A3MA 3SH4A 4LTAA 3L2YA 4H9NC 3VKNA 5BNNB 2YOEA 5GJ6A 1IG3A 4GH4A 2OA5A 4WBNE 4DY5A 4PJLA 2RJ2A 3H1MA 5FXWA 3RWKX 2XLGA 3CDZB 1HDKA 4QWNB 1QGLA 2IC9A 2K48A 5LBQB 3HBKA 2FQPA 1UNBA 1Z7S1 3M7AA 2C4XA 3T4VA 4BPZA 4DMIA 3UUXB 5IVJA 5JSRA 2CAUA 2GN7A 1PIV1 5LATA 2DL1A 5JOZA 2DWRA 4O2BE 2PTMA 1RUI1 4KMCA 3K48A 3MDPA 4EV0A 5DQWA 1KRIA 2W94A 3MZHA 3WP6A 5KXJA 1RINA 4ILBA 4UYBA 1BJQA 4BLIA 3N2KE 4X62T 3LQCA 4NIGA 4NXNT 4L0RA 1S2BA 2V4VA 3RF1A 4G63A 2PHXA 2W47A 2X9HA 3CL1A 3EMRA 3T1LA 4A6SA 2MAWA 2VC9A 4H63H 4JEUB 5AQUB 1V6LA 2D0TA 1QXRA 3BQLA 2XLFA 4OUSA 4AI1A 5FYYA 3QC9A 2ZGMA 4BA9A 2ZX1A 1ZEEA 2PBIA 2V6YA 5FZ4A 2JE8A 5KHJA 4BQWA 5IK7A 4FP2A 4AVAA 3J7Yq 4DR2T 1OHFA 2JDAA 2PTFA 2RP4A 3ZYKA 3ZPOA 3AZVA 5JZGB 4FPYA 3LBXA 2WAAA 3NRUA 4ZXEA 4S2DA 3URFA 3C4WA 1F9KA 1N33T 1UPIA 5F5IA 5CEHA 2ZMLA 4OHFA 2WDQA 4B3NA 1RUNA 4O2AE 1SHWB 4YWAA 5ADXL 3AE8A 4XCBA 4QPIB 3MIFA 4JI4T 4HWHA 1GQHA 4Q4V1 1G7YA 5KX5E 2GK9A 1WD4A 4G3YC 4OVEA 4QDSA 1UOBA 1W39A 2XZEA 3PTRB 1XYOA 4EZHA 1VIWB 2VMFA 3T2PA 4GJZA 4AYUA 2AEYA 1GP4A 3LA7A 1H7CA 3UQ4A 1PVC2 3SEPA 1W0NA 4LKSA 3N9PA 4COZA 1GMMA 1H2MA 4QXCB 4AL9A 2BTVC 3JBG1 4GYRA 4PLOA 2RM21 2ERFA 2PLV2 4YLZA 1XC6A 4JI2T 5DAPA 1XNQT 3AE1A 3ZXEA 3IF8B 2IAKA 3LK42 3AE5A 1RL3A 3Q5EA 2V7LA 1RYYA 5HI0A 3S30A 4M0NA 1JYWA 4HWDA 4YSFA 1UO9A 5A3NA 3U4XA 5E89A 4E27A 1AHSA 2JQHA 2R16A 1POV1 4QPWA 4OQ8A 4ZU4A 3MF6A 3SXWA 4I09A 4TZDA 4GB33 1H6YA 2MEV1 4P9IA 2BBHA 3RYHE 4H7MA 4LR4A 4CI2B 4JI8T 4N7IA 3K8PC 4H9OC 2GNBA 2WNVC 1NENA 2ARCA 3MLKA 4OZXA 4V2WA 3ZSEA 2ES3A 4ONUA 3H3MA 3E0ZA 2Z6EA 1TEIA 2JXAA 1XDPA 2CSGA 4XUPA 1OFSA 2QGSA 1NCRB 4RL7A 3PUZF 1HRV2 2BQPA 3CF6E 3MFAA 4IW3A 2DF7A 5EFUA 3VBUC 2QQPA 1BR1A 1DQ0A 2JMKA 3LA2A 1T98A 1E5HA 1TNRA 1XE8A 1YFUA 3UU3A 1IBMT 2DYCA 2PAKA 3I3EA 5TAOA 4L99A 4KMQA 2JWPA 3IA3A 3LK2B 5HXHA 4XAXB 1PK6C 2VJXA 3AL5A 4I01A 1AR73 2RDSA 5IVBA 4X6RB 2LRLA 4QPGB 3NRYA 4ISQA 5F5CA 2WQYA 1STMA 2AEZA 4CDWA 3O5SA 4MV2A 2A3XA 1B35C 1W6PB 4LHKA 5FYIA 4BK4A 4A6OA 4OI4A 4X64T 3RIUC 3TBDA 3F2EA 2VVNA 4AQTA 2LT3A 3ZN0B 2ZX2A 3ZXKA 5FZIA 1LNSA 1FXZA 1NOVA 2W61A 1UY3A 2WWSA 4AEJA 5JI9A 1YQ5A 3KHBA 1OD3A 1BVP1 3NO8A 5FJHA 2ZXQA 3HJRA 4WM8B 1BEV1 1NAEA 2A7AA 2QQOA 5FKBA 2X8KA 2G0UA 3WDUA 3UUNA 1Q8QA 4HMZA 1OQDA 2PELA 3LOIA 3VB9A 3KSCA 3HR9A 1VAMA 4HFIA 3DUIA 4Q29A 4SLIA 2FDKA 1D4M3 5FXVA 4EB6E 1WMDA 2CBIA 3OEBA 3ACFA 1FNZA 3FMGA 4P02B 3WP3A 2X9XA 3OYXA 1D1BA 2Y38A 3VD4A 3OBVE 1ZBA1 4Q8LA 2ZKLA 4B3RT 3JC6C 5FZAA 2UXCT 4A7ZA 3I3MA 3VZOA 2FBEA 5FXZA 2CTVA 3AE6A 1US2A 2DVGA 2CWMA 4Y4YA 5K9YA 2MYSA 4CSWA 3DKWA 1J84A 3HQUA 2CHHA 2JQKA 1PHMA 2R30A 4LKEA 3WG1A 2QFEA 4KI5M 4NR1A 4XJ8A 1RMU3 2BP6A 4XC9A 5FYSA 5IUQA 3IIAA 4CDUB 5FZ6A 1AR72 1N1TA 1LOCA 3S7IA 1BQPA 5LG4A 4JI0T 2VVEA 3WV6A 2XG3A 4A7YA 1YI7A 4NRMA 1H2KA 4DV7T 2NZ9A 5EJZB 4Z8XA 5JR9B 1MZFA 3O0WA 2E7TA 1K5MA 2ADDA 1KFXL 3SHRA 2GAUA 1IPSA 1HJFA 2FCVA 2ILMA 4FFFA 4TN7A 3I97A 3ETQA 3JXSA 2HH9A 4D6RA 2VVDA 1AXKA 3HPNA 4PK4A 4JYAT 3AE2A 3I0OA 1NZIA 1O7FA 3B9IA 4JV5T 4NJ4A 3ZYBA 1N47A 2VMGA 3AFKA 4MXWB 3MACA 3LA3A 1R1A2 5LRRA 1RXGA 4NN0A 1CAWB 1MS3A 4AEKA 4DXRA 1WBLA 2ZCWA 4NMIA 4JGYC 2VE1A 1D4VB 3NSTA 3VBOA 4RQPC 4LO4B 5EK3A 2RS53 4MGIE 4D7YA 1UOGA 5L3DB 4YFSA 5FZLA 3UTKA 4FOWA 1LGBA 5LP6E 5DAXA 3S6PA 1XXNA 1HV1A 1VE0A 3PVBB 3EB7A 3J9SA 2WNUB 4XUQA 3OOXA 2YXSA 2WSSV 3MIHA 1WR6A 4N9HA 4PF5A 1VBB2 2B76A 2HBTA 3O4XE 3TN91 3THPA 3ANWB 1F35A 1S0DA 1ZBE3 3QACA 4HK8A 4AAPA 2K24A 3MKDA 1LB2A 1D7PM 1ENSA 3M1HA 2VU9A 3NWKA 3PU3A 1RJ7A 3ZSTA 4M3CA 4NHKA 1RUH1 2KM2A 2VOKA 4Q8KA 2KNDA 3OPTA 4LHLA 1RUF1 4AEDA 3CVRA 1IGOA 1RVF2 3HNYM 4GKYA 4O9GA 1PM4A 4IDOA 3A7QA 4BQ4A 2JIWA 2ZGOA 3OYZA 1HQWA 4H55A 2ZEZA 2CGPA 1TME2 2HPJA 4LFCT 2YGLA 3FZ3A 4J1WA 4H9RC 4W6XA 2YFZA 4X8PA 4B4QA 3HKEE 1KGYA 5C8CB 3I9YA 5L7OA 1SQ4A 1QJX3 5I0RA 3BB6A 1LOFA 3TB0A 4YZ5A 2JG8A 4IDQA 4BIFA 3OJAA 5JVDE 1GANA 4MGZE 3WDXA 4CCJA 3OD0A 4QGNA 3PIGA 5C3SA 5C3PA 3ZR6A 2ZMAA 2YDRA 3UT5E 1GZWB 2E51A 4PHZA 5BNQA 4URAA 3TNQA 2QA7A 4HT1T 4CU8A 2NP9A 1GQGA 3ZFFC 2PYTA 4FPGA 4DPNA 5L7OC 1C1LA 5FZ9A 1RC6A 1GWLA 2WMOA 4J2CA 4UW5A 4DV4T 1R093 5GLWA 5A7PA 3MPBA 2O8OA 2XBO2 3MLLA 4OHZA 3RSJA 5C33A 2C5JA 1LR5A 4B7KA 2XPJA 1GNYA 5I8TA 4RSUA 1S0CA 2VL4A 3NMBA 3FZMB 2W66A 4B1MA 2WS3A 2VUJA 2E5VA 3ITQA 3QD6A 2VD7A 3WD5A 3H7YA 5A7WB 3ZT6A 2BBAA 1CAVB 5E1RA 3WZ1A 1OKOA 1UMZA 4D8MA 1ULFA 3HAGA 5EPAA 5FYZA 3ZLIA 2GN3A 1VRBA 1V9U1 5LG3A 2BZDA 5C8YE 1U5PA 2N9DA 3JD72 3UU6A 3ACHA 4IESA 4M00A 1RVF3 2Y60A 4IHJE 2VCCA 4P08A 1GOFA 3FBZA 4LEJA 3RFRA 1IAPA 2YYOA 4RHV3 3GWHA 4CDQA 5JDQA 2BGOA 1HXS1 2RS31 5C9AB 3I2OA 1SLLA 3M8LA 4DFSA 1JU3A 2LOSA 2WT0A 1LULA 1PMHX 4JGYA 4JQRA 5JWPA 5L9VA 3TLTA 2VBPA 2HEWF 4W50A 1UXXX 3H9AA 1DQ2A 3PVOA 4Q4X1 2VWAA 1DLLA 4GULA 5T50A 3INAA 4AQ2A 3ZYGA 4Z91A 2LSJA 2HWB3 1D1CA 1G9FA 3LG7A 1F15A 4HFSA 1VMJA 4DNYA 1K45A 1T2XA 3IAQA 5JDLA 3SOLA 1YQ6A 4ILUA 3C98B 1B35A 2DUPA 4NUVA 2WBKA 5FMDA 1MPXA 1N36T 2YDQA 1R8IA 3UFEA 1VCTA 5C2TA 2UU8A 1IBKT 2IHR1 1G9DA 2J62A 2LHRA 3I2FA 3POWA 5FMOS 4N90A 3ZFFA 1BMV2 4LFBT 2A2FX 1WRDA 1EY2A 2Z42A 3UKTA 4FTSA 4D94A 5JDGA 2ZEYA 1RUD1 3TRSB 4DY3A 3UV9A 4Q0PA 1LHNA 1I9RA 5ANNA 1QKQA 3VBRA 2IC6A 4AI3A 1FPN2 5F37A 1BXHA 1M7KA 1XU1A 1LHWA 3F57A 2HWC1 3A23A 2VZPA 4LBOA 4MGSA 3PU8A 3DYMA 3KFWX 2X9YA 4MFRA 2D6MA 4FPJA 3H37A 2XQAA 4DQAA 5SV8A 1YXRA 3ETVA 3I3BA 2PAMA 2D3RA 4GIQA 3IMMA 4EROA 4IIJE 3PUQA 2Q1FA 4V1Av 1NYWA 3WQ7A 4DEVA 5FPXA 2BFUS 4O4HE 1OSGA 4LBQA 4S2HA 2Q8EA 3J7LA 3V5UA 1WCQA 4DUYT 4DO0A 1R081 2NYYA 1KQRA 4K20A 4QHOA 5TSWA 2R061 4KWJA 4JI5T 2VOVA 1OF4A 2Z69A 3WX5A 4UVBB 2VQUA 2Y64A 1NA1C 3SEEA 1WWYA 1V6OA 4WVMB 1TMF3 3AZXA 1AYM3 4ADZA 3FB2A 3FL7A 5EP9A 1HX1B 4O4IE 3I0QA 3M3IA 4JV4A 4MHRA 4PBPA 3RJ2X 3VBHB 4A3XA 2V26A 3ZYLA 1LODA 4CEWB 3CQXC 1ENRA 3ROUA 4PW8A 5LASA 2HH7A 1LKNA 1GLHA 2EF6A 5GM0A 3HA4A 5AQVB 3APBA 1CX1A 4AW7A 2BG9E 1A6CA 2WNEA 1WA4A 3ZSMA 2P3KA 4AHYA 4EQVA 4XDQA 4Y1YA 1X9BA 3V0BB 2DFBA 1POV0 3T3YA 3VD9A 2HPLA 3JAFA 4YY3T 3EUHA 1A78A 1W28A 1W04A 3SFDA 1WUVA 1WBFA 4YZ2A 2JG9A 5FAXA 5LYJE 2RR12 1A3KA 4HANA 4YW6A 3A8YC 4DR6T 1TZOA 5CFDA 4XFGA 3K3NA 3ZX7A 3Q8CA 5BXXA 5L4HA 1KF6A 4C90A 5HXRA 1RUJ1 3M4FA 4EEDA 4H9QC 3LB9A 1CAXA 2XKOA 4OCTA 3O0VA 3JBG3 4PQQA 1R1ZA 4EGWA 4KGGA 4QDRA 1MIWA 2VTXJ 3ACIA 5C8CC 1NY71 3N9NA 1YFWA 4Z82A 3MV11 4A4AA 2ZEWA 1COV2 1UZVA 1VJ2A 3BCWA 1PVC3 2P6CA 4RQPB 1MZ5A 3QH6A 1VMFA 2E2AA 1LKXA 2QQMA 5C6CA 2VUDA 3Q8BA 1ZBE2 3B57A 1YCIA 4META 5KC5A 1DU2A 2NW7A 1OD5A 2Y6HA 5C8WA 3QLQA 3AP4A 3CQCB 1VP6A 2JB4A 4DV2T 2HEYF 3U78A 4DR3T 4IGUA 1Y64B 2WRAA 4JC1A 5AQMB 1ENQA 1TME3 1ZOYA 1MS5A 1NT0A 3PUAA 2FJEA 3RYCE 1X82A 2Q4SA 4FOVA 3WSOA 4DXSA 2XM2A 1DYKA 1H1IA 2MHFA 4V2VA 2XQ3A 3K4DA 4H7LA 4MHCA 4RGKA 4GOUA 5A7OA 1QJX2 3HKCE 4LA2A 1J5WA 4DR4T 3AECA 1HRI1 4KGQA 5K0UC 2WO2A 5AQPB 4WV8A 3N7JA 2LJLA 2X05A 5F1RA 4CZSA 1DG6A 4TV9E 4E4HA 1MVEA 5ABEA 3ZJ1A 1BYHA 3JAEA 2GDFA 4RGAA 3QK6A 1AJOA 3JC6D 4NWVA 1VALA 1W2NA 1C1FA 5FLHA 4N7UA 1QJEA 4IEVA 4XFCA 1D1AA 1NQJA 3OKQA 2W39A 4A7KA 5L3FB 2BG9A 2D6KA 3N2GE 4XCAA 5LBCA 1CVNA 5IK4A 1UYYA 2JD4A 2ZMNA 3CJIA 3FLPA 4LOSA 2OZJA 3I2DA 2R073 5T55A 1R092 2P34A 3CX6B 2BKPA 2X67A 1ZVFA 1UURA 2WLPA 3DF0A 1NAFA 3LPFA 1W8UA 5B4NA 1X9TA 1M06G 1REFA 3ZXJA 5ACA2 3W5NA 2H88A 4BJNA 5FO7B 2JDUA 4UXAA 5BNPC 4DR5T 2R49A 1HS7A 2IFWA 3PLQA 5AVAA 4CP9A 1JZ7A 3RZMA 1ULPA 5IVEA 1JOBA 2C5DA 1PK6A 1NWMX 4WYVA 1RGSA 1BEV3 1JODA 2VZ3A 2XJVA 3PUVF 3I2KA 3ZT7A 5ABFB 3W15B 1DU3D 2ACXA 4ISTA 1VOMA 5HXSA 1FT9A 2DCKA 4MX3A 1N3OA 4AISA 3PUIA 1GFF2 3IAPA 2XVGA 4K7JA 2JENA 3DKQA 3T0BA 2XONA 2BRTA 3C51A 2E9QA 4PI0A 3O1OA 1O8SA 4YHJA 1VR3A 4XZPA 1VRH3 3X1DA 3PJAJ 4GALA 5AC92 2CHNA 2WZEA 3VZNA 1UZZA 2R0FA 5LRSA 2HWB2 1G9BA 2J4GA 5I0TA 5L4EA 5F8PA 1AR93 2OLTA 2LHNA 1LU2A 1UIKA 1QJY3 2D97A 2WNVB 2YZ4A 3RQ0A 1YRZA 2OUJA 4A44A 3OYWA 4HE8A 2XAJB 3IN9A 2AH2A 5ANQA 1KEYA 1UCXA 4IE6A 1NQDA 2MNGA 3GBGA 1NCRC 1NLSA 2VB6A 1PGL2 4AI6A 1BCXA 4XZCA 2CHOA 1LOFC 2A3YA 3PUYF 3LAGA 3H3AA 4L92A 3Q8EA 1IS4A 2VZQA 4LIVA 1C8NA 4AFBA 2A6XA 3R6NA 2RG4A 5CAZA 3V0AA 3OF1A 2V7IA 1AL21 5FLIA 4IETA 4FI9A 1JZ3A 3HD8B 3MHZA 2JE9A 3SC7X 3VBFB 4AHZA 1W9WA 1JNZA 4JGZB 1CAUA 1UXZA 2IFRA 3P7IA 4I0AA 4IV3B 1L7RA 4KQ7A 4XF1A 4Z07A 4IEZA 1FPN3 5F7UA 2BBJA 3E5XA 2N2NA 3EHKA 4QAWA 3UYJA 2V7JA 3PE0A 4KHPT 1CJPA 2EIEA 3I54A 4BE3A 4D6QA 1V6IA 4UW3A 3ST7A 4JDOA 4EWEA 2RS51 1QQP2 4DVDA 1AR81 1OVSA 2XL7A 2JJ6A 1JZ2A 4ZPIA 2UXBT 2VZVA 1DQ4A 1KD7A 1RMU1 2XDVA 1RHI2 4UEMA 2B5HA 4BDVB 4ILAA 1JUIA 3BIWE 4OHVA 1OOPA 4FXGB 4C0HA 4IDZA 2VNRA 2LUWA 2C5KT 1ZA7A 5J36A 1HV0A 2ENRA 1DGWX 3IZOA 5LHIB 1SPPB 4Q2FA 3FBLA 4I55E 2JDYA 3RMXA 4MGYE 3PJQA 1W6MA 5KXCA 4PDWA 5HV0A 1XYNA 3ELNA 4IV3C 2DTYA 1W8NA 4B29A 3SLIA 2XJRA 1YWKA 4BJMA 1U5XA 4PIZA 1S1AA 1EAH2 3BPZA 1Y3TA 5DXDA 5FPLA 2QVAA 1D0HA 2O1QA 3USSA 3Q5XA 1F2NA 1MMDA 1QOSA 2WABA 2SPCA 2JDMA 2VKDA 5HEUA 2QDNA 3H1YA 4PIXA 4UBGA 5LA2A 5T52A 5C7GA 5FDBA 4CEWC 2VY0A 1RUE2 3QCWA 4NXMT 2Z4FA 3LDQB 4UW4A 2BKNA 2YINA 2KLQA 1H1MA 1O4YA 3MUY1 4G9SB 4RHV1 3UESA 1QJU1 2VZTA 1PIV2 5BPXA 4N53C 4YTPA 1H9PA 1ASJ2 1C8M1 5FYTA 3RMYA 5BY5A 4ITCA 1UMIA 1I94T 2VH9A 1CD3G 2CA5A 4I43B 2QE3A 3AKRA 2E63A 3C7FA 3ZFGB 4AEDB 4CPBA 2H3RA 3TN93 4PLNA 2JDHA 2ACZA 3G06A 3TWIA 5FZOA 2LRPA 2XQXA 1GZCA 4LOTA 4SBVA 1AR62 3RZGA 5FYMA 4XBFB 1BKZA 1Y4WA 2K46A 3Q9OA 4CZZB 4XUTA 2SLIA 4AI2A 1AX1A 2XJQA 2AE9A 1IPJA 5GLTA 3LGRA 4U2ZA 1MZ6A 1OUXA 3POSA 4RS5B 1HB2A 4B4RA 4OYKA 3WF2A 1B09A 2OIIA 3T2QA 3TEWA 4ZI7E 3USUA 2ZM0A 5BNNA 2BU9A 5FK8A 2BKOA 1LHUA 1Y01A 3O1JA 4QX8B 2VVSA 2AENA 4CI3B 2PHUA 3AK0A 2RMU1 4Y1VA 1PO11 2XHNA 5CKMA 3P4QA 1GUIA 1UL9A 5L2LA 3VKGA 1V9U3 4XMIA 5BV6A 4AI0A 1AYN1 2V6XA 2R1BA 3PUWF 2D93A 2GP5A 2BV4A 2JD9A 2X5IC 2D2SA 3EQEA 1DZTA 4FO9A 1FX5A 3IBPA 1IKQA 2IVIB 2JDNA 2TNFA 4G2AA 4QU2A 1K12A 4LF7T 4BLJA 1HNXT 1WW5A 3TLWA 3ON7A 3SWHA 1FI2A 5FP7A 3M3EA 5IJRA 3NKTA 5K4LA 5I0DA 4XAAA 2YB7A 3AJYA 1XB9A 1O3XA 2OUHA 3RRWA 4CXYA 4AEMA 3S0MA 1XNCA 3AZZA 2RM22 1N3PA 5AFEA 4GYSA 1VPHA 2B4KA 5LZ6A 3VBOC 1QDCA 2YROA 4JRLA 1XYPA 2XUMA 2Y6LA 1HQLA 5JZGA 4I4TE 2J1DG 4PJMA 4EEBA 2E53A 2WQ8A 3T09A 5KXDA 1DGRA 2UUAT 1I6ZA 3AMPA 4YW1A 2NN8A 4LMKA 4ISRA 3T30A 3ZN6B 3KBUA 2EHOD 4KWLA 1MQTA 1TMF1 2MEV2 5GALA 1QH7A 2P2KA 1HFAA 5FZHA 2X0HA 3QNUA 4TWDA 1HR0T 1BLZA 5FUNA 1AZDA 3VDDB 1K5MC 3W58A 2IWGB 3ZEFB 2DUQA 4QPIA 2J1SA 2Y6JA 4AKRB 2YEVC 4ZEYA 1ZZBA 2FMYA 2XWJB 3G7DA 5D1IA 5J09A 2Y48B 1S4CA 2W1SA 2P3IA 1YIFA 2IUWA 3SH3A 1UZYA 4L11A 2DVAA 4PAGA 4QX1A 4XACA 2HWE1 4BJ0A 4NPRA 4NIAA 1XWMA 3R0RA 3U07A 5FBJA 3AE3A 1BBT3 4IV1C 3NW4A 2CEAA 3THTA 1FATA 4XQ4A 5EJ1B 2VUCA 2J1UA 5IWAT 2BGCA 4EN9B 2V8SV 4Q4Y1 1QWRA 2FJAA 3OTOT 2ODVA 1JW6A 3AKQA 4QHBA 4CDXC 3DYOA 4UELA 1ODNA 2VKJA 4Y4RA 3RHWA 1RUJ3 2B1EA 2XJUA 1ENXA 2R0HA 5FBZA 3MK7C 1H30A 1NZCA 1H8TB 2CPTA 2DUOA 1V6JA 4E9KA 4DBQA 2IXLA 4NUUA 2A3WA 3H7JA 4M3CF 4LUKA 1SZBA 4DNDA 3HWJA 3ABVA 4YT0A 5J1GA 1NCQA 3AM2A 3NBXX 2CYFA 4UFIA 3ZFEB 2NW9A 4NUBA 3RRDA 2E7QA 2EHOC 2NTXA 1WMXA 2CLYC 1NLRA 4QGLA 4ZZBA 5A1LA 1APNA 2VM9A 2WFF1 5IVVA 3A0NA 5FZBA 3WW3A 3KM5A 2MEV3 4NIHA 3A21A 1H2LA 2VTXA 4FP3A 4KBZA 5FPBA 1NXMA 3AKTA 3LDBA 4JDNA 4YYOA 4XTMA 4XXPA 1S0BA 2ZAHA 3N7MA 2JIGA 1XBFA 4LBLA 4A56A 2WS93 2Y6FA 5LGTB 4CDXB 4CDWC 4X5TA 5KDMC 1OFNA 2J1AA 1ZBA2 2UWBA 2PQQA 2XHEB 2H7VC 1PO22 1W6PA 1MIYA 1W6OA 3E97A 3KVAA 1OBNA 3HR0A 1QNYA 2QKDA 3IPVA 1E5IA 1N34T 1CESA 3N7LA 1O4ZA 3AEFA 2XR4A 4MGQA 3ZDVA 5L3EB 3JB4C 1T6GC 1RTVA 4K0UA 3SS1A 2A6ZA 4FAHA 3BOWA 1LOAA 1H6XA 2I59A 2X68A 5FY8A 1AR71 2PFWA 2CLYB 2WUHA 5FPVA 4WM8A 5C4WB 2H6BA 3AE4A 2WT2A 3M3CA 3MF9A 4FPCA 2MTQA 1SFPA 3FE5A 4QX7A 5JXGA 5CYYA 2R071 1JZ6A 3M65A 4HFHA 2V4AA 2Y6GA 2BVBA 2Q8DA 4M01A 3MUZ1 5J98B 5JOXA 3TAYA 3E22E 5E8AA 1UPSA 4B1LA 5ISLA 3H8RA 3U0ZA 3FHQA 4GKJT 1FV3A 1QJY1 3AP6A 3I2HA 4BAYB 4E8DA 3ZMZB 3D82A 4RR3B 5L9BA 5CADA 5FO9B 1GR3A 5JREA 3B13A 3NWIA 3VD3A 5IHRA 1MIVA 2K0GA 3C2UA 3IDEA 4BA6A 1A34A 4ZS2A 2ETEA 2NR4A 2R042 2Z79A 4I3GA 5FJKA 1DYPA 3NAPA 4Y5Z0 2ES0A 2D43A 2VOXA 2EVXA 4QB6A 4AQGA 2ZGLA 5LK5A 4PCRA 4XJWA 4KP3C 5K8SA 5F3JA 5D8AA 2VMEA 2ZM8A 3ES4A 4HOOA 5FP4A 3WOGA 1ALYA 3IDCB 3AA6B 4CDUA 4XJZA 2YUEA 1UF2C 2GH8A 2WS92 5F39A 2R6GF 2GNMA 5GZFA 1IJ6A 5ACA3 5LJNA 4CEYB 1H4HA 2HN1A 2DHRA 4YW7A 1EUUA 4N43A 3VL9A 1YLLA 3KT4A 1PZ8A 4W8JA 3KD4A 4Q25A 3TN92 3WI3A 2IDOB 1K5MB 2GNDA 1IBLT 1LECA 2CAVA 3LDKA 1AR63 2FCTA 4HWFA 4TWTA 4DOUA 4GK0E 4YM2A 3PUHA 2CL2A 3THCA 5LBEA 4Y1UA 1VBA3 2AUYA 2UY8A 2XB6C 4S2FA 2LEHA 3PV0F 5C9AC 5FY5A 3O1RA 4E2SA 3KLSA 2B42B 1CAWA 3PHMA 1UZ0A 3KBTA 3NJXA 1NA1A 3OGJA 5A6YA 1FMD3 4XFBA 1F5JA 2ZS6B 4HN1A 4IUGA 4YRDA 1O8PA 2VZSA 4HPKB 2D6NA 3MA9A 3VBOB 3H42B 2AACA 2XQ5A 2XJTA 5F5WA 2FMDA 5DMYA 4HVRA 2VZ1A 4EZ4A 4AK3A 5KR7A 4NHLA 1OOPC 1UU6A 2JKXA 3LZZA 2QZ2A 2Z2SB 1EPZA 2W1QA 2X09A 3AC0A 4IL7A 1D2QA 3RX6A 2ZGUA 3O0XA 3C4XA 2XL9A 4I0BA 2X53S 4LKDA 5GKAC 4GZ9A 4ET7A 3RPUA 4IE5A 5DDJ3 2EICA 2XTLA 2HWD1 4QHZA 4X6QB 2LW8A 5F5QA 5KBFA 1L0VA 1M62A 1LJ7A 3PTYA 1VRH1 3TLSA 2PMWB 4KNCA 4DR7T 2WZ8A 5G05L 4OLLA 1W6QA 4QQOA 1ND3C 2XBO1 3E6CC 1RJ8A 1RUG2 2EAKA 4JAAA 4LMFA 4XF0A 4S2GA 2RA1A 4H9PC 4J25A 5FWJA 2B9UA 3C50A 5JSPA 1ULGA 1VBC3 1W8WA 3FFQA 3L9JT 2VKOA 5FZ0A 3WQ1A 5C8CA 4CDUC 4YSXA 2BS4A 4IE7A 1RUC3 3T1HT 2WZR3 2WN3A 3CIHA 2BNMA 4CN1A 2JEMA 3OGSA 5K0UB 1IPKA 1KJLA 2E32A 4FPFA 4I3PA 5BYNA 2YU2A 4IEPA 2FHRA 2Y33A 4YFWA 4B3ST 3VZMA 1CHUA 1GZWA 1VBD1 3T2OA 4BMEA 4C1XA 4IV1A 4Q0UA 4CUBA 4KG8A 1OEDB 3FZKB 2ZGSA 2G9GA 3O7OA 4E7SA 3EHZA 1PO13 1NE6A 1J3PA 3I59B 5GZDA 4C8DA 5A1AA 5FP8A 2H7OA 4MYEA 2WQZC 3DGTA 3GM8A 5HXEA 3VBHC 3AB3B 3R05A 2H6CA 1HNZT 1D4M2 1DLCA 3CX7B 1E1HB 4TUYE 1OQEA 1AR91 4LT5A 3QOPA 5HCFA 4UFLA 4GWJA 1OUSA 4XABA 4Q1PA 1O6UA 2NOXA 1JS9A 4IGOA 1JXNA 1QOTA 1X8EA 5A32B 1MQTC 5F2WA 5A33A 4IDNA 1CAVA 3H8UA 3W21A 5FWEA 3AFGA 1PGSA 5BR8T 2VZRA 3PVNA 4DV6T 4XXAA 4AG4A 3W5MA 4W6WA 2E9XA 1XSRA 3HQXA 2CGNA 2DBIA 1QJZA 3CU7A 3UKVA 1EV13 4I0WB 1N3QA 3B93A 2VQ0A 3JZVA 5T5OA 2PHDA 1YJKA 1G8WA 4RGGA 4Y22B 2HWF3 3UL2A 4GB32 3ZYHA 3ZPYA 5DQVA 1RUD2 4O9EA 2NMNA 3CWZB 5HXCA 1CZTA 2ARXA 2OQ7A 1W8OA 5FZ1A 2ZGQA 5FUPA 5BUVA 1OA4A 4EYYR 5EK2A 3IB3A 4Q1RA 2HWC2 5L73A 2XXZA 1XNDA 2FDHA 2I6HA 2XVLA 1JYIA 1S2KA 1AR83 1SUMB 4RA0A 1WFDA 3A7MA 4D7SA 4KU8A 2DLRA 1YJLA 2ZHMA 5A3UA 1Q8VA 5JR2A 1EAH3 1O91A 4N53B 2NP0A 3OUIA 1C8M3 1Z0PA 3WNKA 4ATFA 2A73B 2R062 4Y5SA 2WO1A 3ETPA 3W59A 4PJNA 1G73A 4YLHA 5JDFA 1FV2A 1QJFA 2OX0A 5KXEA 4HN9A 4P5YA 2L3LA 4FQ4A 1AF9A 4QGMA 3J9X1 2J1VA 3ZFFB 3WAJA 2WO3A 3VHNA 2L9LA 5JR9C 2WFPA 3MIEA 2XY8B 2CY6A 3K1SA 3GHNA 1HNWT 2P1BA 5FZFA 1ND3A 5FP9A 4Z92B 2ZKNA 3S57A 4FPHA 3VBRB 3T0DA 4DMVA 4WM7A 3R4SA 3ZSSA 4P0AA 4FBFA 2LM3A 5AQHB 3KCXA 2A5ZA 4DXZA 4EV6A 4XE9A 1QUUA 3EABA 2F6BA 4PK6A 2K2SA 4LJHA 3ZYIB 1CZSA 3NVOA 4XILA 3B01A 3CHXA 5C4WC 3VDCA 1DZRA 3AKSA 5F6LB 4HFCA 1SBDA 3B9CA 4LBQB 3SCHA 4D6SA 4ZHNA 1RUD3 1LRZA 4XIKA 4CN6A 4GB31 3F95A 2XASB 1A8DA 2R043 4HSJA 3HQRA 4EE2A 1ZZ6A 4AI8A 4M3CE 3ZN1B 4O65A 4QX0A 5A3OA 1VCSA 2C0SA 1OA2A 1OI6A 2HWC3 4KH9A 1MEC2 5KHHA 4NIIA 1QMJA 4QQ2A 1WW7A 1XMQT 4LMJA 1V0AA 4FXKB 2K5BB 4PFOA 3I2IA 5J3UA 4AXOA 5IK5A 1DCSA 5E6HA 4AHXA 4NPPA 4NE9A 5DN2A 1NY72 2V6YB 5E0OA 3VRBA 4QD2A 3RYRA 1N1YA 1V6MA 4NIDA 2EA7A 3CQGB 4AKGA 2ARAA 1VMHA 5IFPA 5I0UA 5BNPA 2Q0AA 5FVLA 4NHMA 3AE9A 5FY9A 3RDIA 4TZ4C 1QNWA 3ACLA 1PX4A 1VLNA 2A6YA 3PDQA 4MADA 1QDOA 3LOBA 1OLMA 3ENRA 4MG2A 1VBE2 3ECQA 3VL8A 1X9PA 3D0JA 3ZVXA 2A6VA 4Z2AA 5FKCA 4ASLA 1AYN3 2AR6A 4KI0F 4DUWA 1U12A 3WW1A 2CDPA 2ZM2A 1RUI2 4PT6A 2JG9B 3DPRB 1POV3 1W2OA 3AEAA 3GALA 4JHTA 2DVBA 2UXXB 3PJAA 3DCQA 1W2UA 2DCTA 3NAPC 1Z78A 2V5YA 5T54A 3FXDB 1U4QA 2R1DA 4W4ZA 4WM7C 3BTYA 2WINB 1YHFA 2DVFA 4JX0A 3LK3B 2C24A 1ZP0A 2LM9A 2J42A 4HKWA 4AVTA 3DXUA 5C3OA 2Q9QB 1DP0A 3ATGA 3AAAB 3NZPA 1KFUL 2PQSA 3LCPA 4XJUA 1WYCA 2W2IA 4WW0A 2W52A 3K2OA 4HZFA 4P5HA 4XOGA 4AIUA 4Y24A 5FR3A 4EN7B 5HCBA 3UU8A 3WNOA 4Q4W3 5J1XA 4TXWA 5DDJ2 3WNLA 2DWKA 3IBMA 1W09A 4LLFA 5CFCB 2AYHA 4ZKTB 4BU2A 5T5LA 3RRCA 3SQOA 4Y33A 3N9MA 3P4SA 2YU1A 1Z8UA 2WR9A 2UUBT 1UW8A 3O1HA 4E8CA 1ZHCA 4OX9T 1MEC3 1SLIA 2OV9A 1YD8G 3OY8A 2KA3A 5JRCB 1RUG3 3ESLA 3WUDA 1SEFA 1XMOT 4B3TT 4QKBA 4XJAA 4R8HA 5ACA1 3DPRC 1TE1B 1SLBA 1MMAA 1ZZ8A 2X5IB 2WWUA 2YDEA 2EXHA 1SG3A 3K46A 4JZRA 1W0AA 3PVEA 4W65A 5E16A 4ZI3D 1LEDA 1PVC1 2WL1A 4YVWA 3W20A 4D7TA 3EAMA 2BDRA 5A7SA 5LEKA 1CUNA 2KSRA 3RQWA 4L2NA 5IWFA 4DUZT 2LLYA 4BZ4A 1UN1A 3JB8A 5SV5A 4CRQA 2WCAA 3SKJE 1C28A 4M4RA 1SLCA 2ORXA 3C7OA 2XPKA 3AP7A 3VDAA 4EN0A 5DJQC 2JMHA 5GZGA 2JE7A 3ZKUA 4ZI2D 3J8F2 4UXNB 4WZCA 3V65A 3IDBB 2UYAA 4AOCA 4CDWB 2M6IA 3ZN4A 4AF9A 3T8OA 3AZYA 1PZ9A 3H1WA 2VQET 4DB5A 2ZACA 2IMLA 4K8FA 1GU3A 3WF0A 5AC91 3O1MA 4MALA 4XUOA 3ORJA 4U33A 4EJRA 2FDJA 2DU0A 3LE0A 2Y8DA 2QQUA 1SLTA 3HOBA 3WUCA 5HYAA 3VDDC 1ZRDA 4C0BA 5HEJA 5A80A 1IZ3A 2DCFA 2EIBA 1HTJF 4TWFA 2W46A 4AWDA 4ERRA 3GYDA 1HRV1 1JHNA 5CFBA 1FAYA 1KEXA 2QVSB 4NVPA 4ATEA 2XQ8A 5CB4E 2ATFA 4C1WA 3GCXA 2XQYA 1T7SA 3BKZA 1ZKEA 3RKOA 3MEPA 5J37A 3LJCA 1ST8A 3BK9A 1MMGA 3ZMUB 4Y26A 3N35A 1SBFA 1CJDA 4CU6A 1S0GA 1ND2B 2VOTA 4LO7A 2XQRA 3OPWA 4XQWA 4CP1A 2G19A 3J7HA 1OVPA 4XETA 3KV9A 5CFCA 3GHMA 1PNGA 4FAGA 1I3HA 3RZJA 1EYBA 5AQFB 4P9LA 4L0PA 1MS9A 4KG0A 3P3PA 3RIFA 1OKQA 4BK5A 2CDOA 1I5PA 1WW6A 2WT1A 4XYXA 2C5IT 4E2QA 5IT6A 2PG8A 1O3TA 2X0LB 5C3RA 2WMNA 1BVVA 5LNKA 4LIUA 2VK9A 1SDWA 4K6BA 5FYUA 4LHNA 5DZGA 5ETWA 1E5RA 1UD1A 5GZEA 3OYWB 3OD4A 5L47A 2I07B 4U2AA 4X65T 2ZHNA 3VZKA 4OYJA 1YW0A 5CIRA 2FZ1A 1REDA 5FV3A 5FYHA 2TEPA 3CNAA 4OFZA 1DYOA 3DN7A 5JXJA 4FVVA 1PMIA 2DDUA 5FY4A 4DUXA 5JMOA 3V0AB 3N9LA 5CG9A 2I2SA 4OK0A 1HX8A 3THDA 2J47A 3QB5A 3NJVA 4V1PA 4A2UA 2PHRA 3TKLB 2V72A 5FLJA 4HVQA 2VR4A 1VBC1 5CKQA 4QH5A 1TG7A 2ET7A 1FOD1 1AXZA 4QKDA 4EOZB 2EAAA 3KGZA 1RUC1 4QQLA 1IJ5A 4IEUA 1KNRA 3AA7B 3UU4A 1FMD1 4NOTA 5LY1A 1O3RA 1C57A 4K1YA 1IQAA 3FHNA 5LW9A 4MVTA 2D6PA 4KX6A 5FY0A 1ZZCA 4HWCA 2B39A 3RZLA 1DF0A 4FPKA 1MVQA 2XJPA 4ZU7A 4HWIB 4NRPA 4BH9A 5LCWL 4MO3M 5EZYE 1W99A 1JOJA 2Y26A 5M0TA 4RHV2 4DIDB 5EYXA 1H9WA 1UY0A 3KCCA 4LE3A 4LNVA 3IHRA 1Z0HA 2K9ZA 2QQLA 4OHWA 5HV4A 4XF4A 3AP9A 3POIA 5FNVE 4COWA 2HWD3 1QU0A 2CWYA 4A45A 3ZMTB 5C3JA 1LCLA 2GZWA 4FJOA 1R64A 2XH6A 2X10A 1XPWA 2IZWA 2VCAA 1AR61 2YY1A 2DBNA 1AVBA 2XBO3 5EWSA 5LBBA 2DNXA 3JU9A 2KXPB 5C3QA 4YM0A 1LOBA 1OC1A 3SMHA 4BCUA 2XJSA 2JRKA 2JJ9A 5A6XA 2BNNA 1XU2A 3O1PA 5FMBA 3ZIWA 4JI6T 1H1AA 2WZPP 4O8SA 3LSEA 2KINB 3AMHA 5DG2A 5A7NA 1W6NA 1SMVA 3NJZA 4LBNA 3RPQA 4HGAA 3T1YT 2XQ9A 1W0BA 4CP0A 4Q4X3 1I5ZA 2ZTNA 3KF5A 2WZR1 4JVAA 2YBKA 2DCYA 4YZ3A 2WBLA 1EV11 2RMU2 1PO12 1XNBA 1PIV3 4FFHA 1AYN2 2BERA 3O14A 2VW0A 1QSDA 1PMJX 2P37A 3TEYA 4LA3A 5IHYA 3BI3A 5F6KA 2LKHA 4EXTA 3IM0A 1PVXA 1W05A 1VBB1 2BOIA 5FPZA 4P09A 3BU0A 4Y1XA 3WDWA 2JDZA 3N3HA 1M4WA 3ZYFA 4RN5A 1WR0A 3WCSA 4LO8A 1GP6A 1RUH2 4WZXA 3M3OA 3MBWA 4LK7A 3GA8A 1AJ3A 1FNYA 3DEMA 3LD8A 1ONAA 4ZOLE 2Y6KA 3AYDA 1QF3A 4JKMA 4TSVA 4YM3A 2J22A 1YFYA 3QOFA 3NV1A 2MPFA 4OMDA 4OMCA 1VB2A 3AZWA 3CO2A 4IGPA 1GNZA 5FCCA 3WINE 4FTEA 5A7WA 1CWPA 5T5JA 3USUB 4AFAA 4PF1A 1DGRN 4M4PA 2VUAA 5JR7B 1T72A 1XNKA 5AVPA 1TVGA 2RJKA 1IHMA 4LMLA 3AB0A 1TMF2 3A4UA 3LEKA 2WB5A 3Q8AA 5FPAA 5FY7A 4URTA 4UFHA 4BQYA 5IATA 5JDMA 2UXNB 1IZNB 3ZDSA 5AQGB 2ZX4A 2XUEA 1K5JA 1LENA 3DTOA 2J1TA 2PHFA 4FFIA 5J2UE 4F3JA 5B4XA 5C9AA 2HWF1 4YW4A 3KV4A 1HLCA 3WG2A 3RZKA 3HN1A 3U14A 4MLOA 4PLMA 3WEZA 1X8MA 3NJYA 3CX8B 1N32T 2G9ZA 4I2OA 4XEZA 5JSOA 1OLQA 4HLTA 5JMCA 1L7QA 2KWHA 3AAIA 4NROA 2RMU3 2SBAA 1QHDA 1O5UA 5F2SA 3WNPA 5FZDA 4BMBA 1J3QA 4XUNA 5F32A 5IVFA 3GN5B 4BXSV 1DIWA 3HNBM 1J59A 4HFEA 5FRAA 3WHUA 3I1AA 1REEA 3WY6A 1F4AA 2LTNA 5D8AC 3ME2A 4P9JA 1L3JA 2E9XD 2ODUA 2XM1A 3KV5A 2E5LT 2A6WA 2DV9A 3BVCA 3VLBB 3TEZA 1Q43A 2Y0IA 2PHLA 2YC4A 2LSYA 5JI7A 3WNMA 3JD71 3MLJA 4F8HA 4HBNA 1EP0A 1JYCA 4E4SA 4YGDA 2VMIA 2PLV1 4XBQA 2VW2A 4P9YA 3UKNA 2KR2A 5H6RB 1QLBA 3PUXF 4GIWA 3RS6A 4JI3T 3OBRA 3K51A 4GWIA 2R7EB 1HXS2 2M67A 5FZGA 1DFQA 3MFCA 4HVOA 1K42A 4LF9T 3OBTA 2BEOA 2R063 1Y9QA 5DUWA 3K3OA 4UFMA 2Q8OA 1W8ZA 2W2UA 3C7GA 4UV8B 4YM1A 3LBXB 3BPSA 4RS5C 3GZUC 3WF3A 2CBJA 4H9SE 4TWHA 1SBEA 3OUHA 1I1EA 5LOVE 1MNDA 3SKVA 1TQ5A 2J1RA 4QQPA 4XIOA 2Q30A 2E9XC 2LM2A 5LBMA 3ILFA 5FMNA 1LHVA 3BTXA 2PA7A 3GZAA 2C9AA 3VZJA 4IDPA 4XURA 1PO21 1HF8A 5GONE 2JQQA 2L8KA 1CONA 5HBAA 3VUOA 3VKMA 3KHCA 4HFBA 5HCHA 4BWOA 4FTBA 1ULDA 2D5FA 2Q1ZB 1BMV1 4B6XA 4GKXA 1CIWA 1KNPA 2WDBA 1CGPA 2XGXA 3A0KA 5K7PA 3ES1A 3OGVA 2JQ9A 2NPIA 4QM8A 1UY4A 2JPFA 2W0XA 3IDAA 3VBHA 1V00A 3ZFEA 2CXFA 4AAXA 4COYA 4EWDA 2VL0A 4Q4V3 4BM8A 1W9YA 4YVWC 1IS6A 2Y34A 1KJRA 1AXYA 2D40A 4XF3A 2N1GA 1J1JA 1RUI3 3NNFA 5DAWA 3N2OA 3VHPA 2CCQA 1UK5A 5CNAA 5F9TA 2ZABA 3ZCIA 3GDBA 4CCEA 3UUMA 2E6VA 2CRBA 3AA1B 4CQIA 3VBUB 2D6OX 1F5FA 1ZYBA 4I30A 4F6RC 2QZ3A 4LFAT 3OB8A 4N78D 1ZBA3 3RGLA 4EYUA 5GLZA 2VECA 3RI8A 2JKBA 1FMVA 1JN2P 2BWAA 4FFGA 1I6XA 4H3WA 4AVBA 3IWZA 4M1PA 5J96B 2W5FA 5EHDA 1GZTA 4LUMA 2D7FA 4XPVA 3H8XA 2WFF3 1MS4A 3GJAA 1PNFA 5AQIB 2BZBA 3FZFB 4FOYA 4LPLA 4YZ4A 1CAXB 3HI2A 3VN4A 2W95A 2GC0A 1Q56A 4YG3A 3UGHA 1JH5A 2YMZA 4XDOA 3WF4A 3BTZA 4NRQA 2X29A 2D5UA 2AZ5A 3LFIA 2VAUA 3ZN5A 3AJZA 4QPGA 5FPUA 4OI0A 3X29B 1HX6A 1OURA 1H8VA 5M4YA 1G9AA 4Q4W1 4A98A 2BS2A 5J2TE 2ZMKA 3FFZA 2VMDA 3VBRC 4TNWA 5DAQA 3ILNA 4NPMA 5I91A 2D44A 5AC93 2I74A 3E6DA 2WU5A 4COUA 5A6QA 2W08A 1X79A 2V73A 4AXPA 3VKHA 5JAXA 1ZX5A 3RKGA 1DGLA 3TLVA 1AYM1 1S0EA 3NNGA 4YW3A 2PAEA 4AVCA 2P4EA 3BGAA 5CGMA 2OA2A 3LF7A 3KMHA 3RJRA 1JNRA 1TNFA 2W0GA 2NLRA 4D0QA 4O4LE 5LCYA 3PL0A 3NAPB 3RC8A 4RYDA 3AYCA 5DZFA 3LEIA 3RG0A 2XAFB 5LGNB 2XSAA 2E33A 3VGIA 3ZMVB 5ABJA 1NG0A 5FZ7A 1COV1 2GALA 2V7KA 2BNOA 2RS13 1EZ3A 3ZYMA 3LSDA 5FXXA 2MOZA 1R1A1 4AZZA 4CEYA 3VHLA 4BQ2A 1Q8PA 4DIQA 4ZZ8A 2D0UA 2FJDA 2BG9B 1ZBE1 4N43C 1V9DA 4D3WA 4GWNA 4CDQC 2YGMA 2UURA 2VQFT 4GKKT 1UYZA 4AQSA 5LB6A 1ZRIA 1QQP3 5FY1A 3AX4A 3UFGA 1GOGA 4QKFA 2JICA 3POGA 5F3GA 4Q0SA 1S55A 1RUG1 3ZXDA 1MR5A 5JVVA 3UJOA 2VKHA 1C5IA 1RHI3 2CWSA 2WNOA 1AX0A 5A70A 2WY2A 1O59A 1GBGA 2DTWA 2D3SA 2YN6A 4YSYA 2QQJA 1NA1B 4JHZA 3WCRA 2E31A 5HCJA 1XZYA 1X7NA 3S7EA 1QJX1 4AE2A 5GZCA 1MNEA 2XWBB 5JR9A 1HRV3 2B45X 4NAOA 2XHKA 3PUSA 1ULEA 4JTOA 1HG5A 1ZRRA 1XRUA 4TN7B 4GMP3 4KHZF 2HBUA 5LXTE 2WJSA 1FMWA 4IERA 5DPNA 1RUF2 2QNKA 3AMQA 4MXWA 5T3NA 3ONLC 3WDVA 3HNMA 2VNGA 1Y43B 2VBDA 1IS5A 4HN0A 1YIPA 5JXHA 5EIYB 1TME1 5CG8A 5AQJB 2XOMA 4E2GA 2HYXA 4XMAA 5DUXA 4QU1A 4DRVA 5LA1A 3VHOA
chains in the Genus database with same CATH topology
4Y3OA 4BXFA 5F3CA 4O4HE 2Q8EA 2VASA 4HFVA 3CMLA 3V5UA 4DO0A 4QHOA 5DQVA 2X66A 3CWZB 5HXCA 2OQ7A 4UVBB 3BQIA 5FZ1A 5FZIA 4JLEA 4GK5E 3V5SA 5A1FA 1UCUA 5FUPA 3BQKA 4EYYR 2LSKA 5EK2A 2WWJA 4ADZA 4JEHB 3FB2A 3SRZA 2X9WA 4O4IE 1LVFA 3I0QA 2XXZA 2P5BA 2V26A 3ZYLA 3CQXC 4PW8A 3RH3A 2L9QA 2BDEA 2HH7A 1G8XA 2DLRA 3HA4A 3C4ZA 2Q8CA 1Z0PA 2WM9A 3ZJ2A 2DI4A 4PJNA 1G73A 4YLHA 5JDFA 3CKDA 2XAHB 2OX0A 2HPLA 3GMIA 4HN9A 3EUHA 2L3LA 4UF0A 5HAXA 3WAKA 3ZCJA 3J9X1 2CXDA 3LFMA 3WAJA 5LYJE 5JR9C 2P9BA 5FZCA 4LXLA 5FZFA 5FP9A 4PNIA 3K3NA 4DMVA 1FEWA 1US7B 2CM0A 2K9AA 3MJXA 3N5LA 5HXRA 4C90A 4H9QC 4P0AA 1D0YA 1MIWA 4AQFC 2YPDA 3U4SA 1QUUA 2W00A 4PK6A 5HWYA 4CUGA 3N9NA 4AKHA 5IW0A 2E9XB 2KWIB 4UV9B 4URAA 3AVSA 1LKXA 4D6SA 5FZEA 4ZS3A 2CXLA 3B57A 5FZMA 5FZKA 1LRZA 2NW7A 2XASB 4O4JE 3ZN1B 3CQCB 2C0SA 2LSIA 4QXBA 3U78A 5LY2A 2XAGB 1Y64B 4IGUA 2K5BB 2VL8A 4PFOA 2BVMA 3PUAA 3RYCE 3VU7H 5E6HA 1LVKA 3A5XA 4V2VA 1S94A 2XMLA 3HL6A 5E0OA 4MHCA 4GOUA 3F31A 5A7OA 3CQGB 3HKCE 4AKGA 4TX5A 3EDUA 3U3IA 5FY9A 4QXHB 2LJLA 1BR0A 4TZ4C 4TV9E 3PDQA 4E4HA 3KVBA 3ZJ1A 2PFVA 3QK6A 3JC6D 5LHHB 3NZQA 4CCOA 4UF0B 5A3PA 1D1AA 3OKQA 4GAZA 2ZM2A 3PDYA 5L3FB 3N2GE 5FZ8A 4YJ3E 2UXXB 2IW5B 2YBSA 3Q5WA 4UVCB 4CCNA 3CX6B 4EIWA 2X67A 1U4QA 3FXDB 4IE0A 4U72A 5IVBA 1D0XA 1NAFA 1OXZA 3ZC0A 3CPZA 3LK3B 5AFUL 2LM9A 3DXUA 2Q9QB 4WNKA 4BJNA 3AAAB 3NZPA 5F3IA 1WYCA 1HS7A 4WW0A 2W2IA 3K2OA 5IVYA 1OWAA 5A3WA 5IVEA 4P0BA 1NWMX 2Q9QD 2EHOA 1WYBA 2DWKA 5LHGB 2E8IA 2NTYA 5JH7E 2PJQA 5JDNA 4BU2A 3RRCA 3W15B 2ACXA 4Y33A 3N9MA 4ISTA 1VOMA 2YU1A 5HXSA 3O1HA 4KUMB 1ZHCA 4ZI3C 3DJBA 4HTEA 1YD8G 4ASKA 5JRCB 2A3DA 3ESLA 4QXBB 4QWNA 3C51A 3DP7A 2LOPA 4YHJA 1MMAA 2WWUA 2A72A 4ZI3D 2NW8A 5A7SA 1SHZC 5EK4A 2V7MA 1CUNA 3ZC1A 2Q9QC 5IWFA 4PK5A 5F8PA 5DABA 3O9XA 2LHNA 4QXHA 4CCKA 4HE8A 2JMHA 2XAJB 3AVRA 5DJQC 5ANQA 4ZI2D 4IE6A 4UXNB 3PUQA 2VB6A 3RVHA 4AI6A 4XZCA 5FP3A 2GP3A 5F5AA 3H3AA 4BISA 4LIVA 3T8OA 3R6NA 2V7IA 4MALA 1MMNA 2Y8DA 5H6QB 3P7IA 5HYAA 2N2NA 5A80A 3UYJA 1YKHB 2DCFA 2V7JA 3PE0A 5LGUB 1HTJF 2CE7A 3KV6A 4GD4A 4D6QA 3ONXA 4FI5A 4CXXA 4ERRA 2EHOB 4DVDA 5CB4E 2XQYA 1ZKEA 3EVYA 3RKOA 2XDVA 4QXCA 3LJCA 4UEMA 3BK9A 1MMGA 3P8CD 4H9NC 3ZMUB 5LA6E 3OPWA 4ZI2C 2OA5A 4IDZA 4WBNE 4PJLA 2C5KT 5FXWA 4X1KE 4QWNB 3KV9A 2IC9A 2K48A 5LBQB 5FY4A 5LHIB 4MBQA 3UUXB 5IVJA 3FBLA 4I55E 4O2BE 4KMCA 2C5IT 5DQWA 2PG8A 2X0LB 2WMNA 5LNKA 4LIUA 2VK9A 3C64A 3N2KE 1KNZA 5FYUA 4BJMA 4L0RA 3L09A 5ETWA 4G63A 2X9HA 4UVAB 4IGQA 3Q5XA 4H63H 4JEUB 1MMDA 2D0TA 2SPCA 1YW0A 2VKDA 3BQLA 4OYJA 5FV3A 5FYHA 5FYYA 3QC9A 5FZ4A 4OFZA 4BA9A 1ZEEA 2PBIA 4YJ2E 2YINA 2KLQA 2OQ6A 4PJJA 3N9LA 3J7Yq 4OK0A 2RP4A 3ZYKA 1HCIA 3O1IA 1HX8A 3MZKB 2V1DB 4PFPA 3LBXA 4H63V 3ZPOA 3C4WA 3TKLB 5FYTA 5CEHA 2CA5A 4I43B 5F5IA 4OHFA 4CI1B 4CCLA 5IVCA 4O2AE 2H3RA 4EOZB 5ADXL 1IJ5A 3AA7B 3EDVA 5FZOA 5LY1A 4QX7B 5FYMA 3FHNA 2GK9A 5KX5E 4XBFB 5LW9A 3PTRB 4CZZB 5FY0A 4EZHA 4GJZA 1H7CA 3N9PA 1WLXA 5EZYE 4OYKA 4QXCB 4GYRA 4ZI7E 2ZM0A 4TV8E 3IHRA 3O1JA 4QX8B 4CI3B 3IF8B 2IAKA 3LK42 4UIGA 2V7LA 5FNVE 5L2LA 3VKGA 2CWYA 4CCMA 5LWBA 3ZMTB 5A3NA 4FJOA 2GP5A 4E7ZA 2D2SA 3IBPA 3MXZA 4G2AA 2CWOA 2DNXA 2KXPB 3SWHA 5FP7A 3RYHE 2JRKA 2JJ9A 5K4LA 4CI2B 3K8PC 1O3XA 4O8SA 5A7NA 2KINB 4H9OC 3RRWA 4CXYA 4HGAA 4V2WA 3E0ZA 2Z6EA 4GYSA 4ISSA 3ZMSB 2YBKA 4CXWA 2WBLA 2QGSA 5CA1E 1QSDA 4I4TE 2J1DG 2NWBA 1BR1A 4PJMA 1FIOA 2JMKA 5IHYA 3RYIE 1T98A 5FYCA 4EXTA 5TAOA 3KBUA 4IE4A 2EHOD 4P09A 5FYBA 3LK2B 5HXHA 4XAXB 3AL5A 1HFAA 5FZHA 5FUNA 5F5CA 3NRYA 3ZEFB 5BMVE 3GA8A 3HKBE 1AJ3A 3LD8A 4AKRB 2YEVC 4ZOLE 4X1IE 5FYIA 5F3EA 2Y48B 3F2EA 2LT3A 3ZN0B 4PAGA 4IGPA 5A7WA 3Q9DA 2W61A 4KBMB 4AQFA 5FBJA 2CEAA 5FJHA 4ZHQE 3UULA 2OT7A 5FY7A 4HONA 4GJYA 4L9IA 5JDMA 2UXNB 1IZNB 2G0UA 2Y6XA 2ODVA 3UUNA 5KMGP 2XUEA 3DTOA 4UELA 2PXJA 2VKJA 5J2UE 4Y4RA 3PURA 2B1EA 5FZ3A 3KV4A 3MK7C 5FXVA 4DBQA 4NUUA 4EB6E 3NJYA 3CX8B 3FXEB 2X9XA 3OYXA 4DNDA 1D1BA 1B7TA 3OBVE 5J1GA 2KWHA 3AAIA 3ANWA 3JC6C 3NBXX 4C91A 5F2SA 5FZAA 2NW9A 5FZDA 4NUBA 2MBGA 2EHOC 5FXZA 2NTXA 5F32A 5IVFA 2LE8A 2CLYC 3GN5B 5A1LA 4AKIA 2MYSA 4CSWA 3I1AA 5FZBA 3HKDE 1HG2A 3S4UA 5FYSA 2E9XD 2ODUA 3D0TA 3KV5A 4MLKA 5FZ6A 5FPBA 3LDBA 4ANJA 5LG4A 2LSYA 3ETUA 4A56A 1BR4A 5LGTB 5H6RB 4GIWA 2DWGA 4Z8XA 5JR9B 5KDMC 3N9QA 5FZGA 2XHEB 2H7VC 2M67A 4I50E 1MIYA 3RYFE 4TN7A 3KVAA 3HR0A 3K3OA 4D6RA 4PK4A 3I0OA 4UV8B 3LBXB 5L3EB 3MACA 4K0UA 3SS1A 4H9SE 5LOVE 3R84B 3E08A 1MNDA 2I59A 2X68A 2KMFA 5FY8A 2CLYB 4HEAA 5FPVA 1UX4A 5FZOB 2E9XC 5EK3A 4QX7A