3K3NA

Crystal structure of the catalytic core domain of human phf8
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
354
structure length
349
Chain Sequence
RSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 8
publication title Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 93
structure length 349
sequence length 354
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2009-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3nA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3k3nA01
5A7QA 4LXLA 5F2WA 5FPLA 5FY7A 2YBPA 5FZMA 3PUSA 4Y3OA 3U78A 3PU3A 5IVVA 5FXZA 5FZEA 5IVCA 2YU2A 3K3NA 3ZLIA 5IVBA 3DXTA 5LY1A 3LDBA 3N9QA 5F3IA 4BXFA 2YU1A 4DIQA 4V2VA 5KR7A 5A80A 4CCLA 3KV5A 4CCNA 5FZFA 3KV4A 2GP3A 4IGQA 5A3WA 4HONA 3PUAA 3RVHA 2YBSA 5FYMA 3AL6A 5F2SA 2XUEA 4DO0A 5FZGA 5A7WA 5A3TA 5FP8A 3UYJA 5FPAA 5F5AA 5F3CA 3PURA 5IW0A 5FYHA 5IVYA 3ZPOA 5A7PA 5FWJA 5F32A 5IVFA 4CCMA 4GAZA 5IWFA 4C8DA 5E6HA 3AL5A 4GJYA 4QXBA 5F3EA 4D6RA 2WWUA 4IGPA 4GD4A 2OX0A 5FJKA 5F39A 2XMLA 5FXVA 3PU8A 4UF0B 3KV9A 4QXHA 5FZ8A 3K3OA 4D6QA 3N9LA 2GP5A 3PUQA 3OPTA 5FZ9A 5A1FA 5FZOA 2OQ7A 5IVEA 4QX8A 3KVAA 5FYTA 4AAPA 3OPWA 4BISA 5A7SA 4V2WA 5FY8A 4QWNA 5FYIA 5FYBA 5FZ4A 5FXWA 5FYUA 4QX7A 2P5BA 4CCOA 5FUNA 5FY1A 4AI9A 5F3GA 5FZAA 5FZIA 5F5CA 5K4LA 5FZ3A 5FP7A 5FYCA 5FZ1A 5FJHA 2Q8CA 4Y33A 3PDQA 5FBJA 2PXJA 3N9MA 2WWJA 3KVBA 4CUGA 2OS2A 5FWEA 4CCJA 5A7WB 5FP3A 5F5IA 5FUPA 3K2OA 4NUBA 5FYZA 3N9NA 4CSWA 5FXXA 5A3NA 3DXUA 4EYUA 5FZDA 4QXCA 5FP9A 5ANQA 2OQ6A 3U4SA 5A3PA 5FY5A 4XDPA 4IGOA 5ISLA 2VD7A 3NJYA 5FP4A 5FY4A 5FZ0A 4Y4RA 5FZLA 5FZKA 5FZBA 4URAA 2OT7A 4E4HA 2YPDA 5IVJA 4XDOA 5FV3A 5FY0A 4LIVA 5FZCA 2W2IA 3N9OA 5FYSA 5FZOB 3AVRA 4HOOA 4CCKA 4TN7A 5FZ7A 2Q8DA 4EZ4A 5FPUA 5LW9A 2XDVA 1VRBA 5FY9A 4BU2A 4GJZA 4QU1A 5A7NA 2YBKA 5FYYA 5A7OA 4D6SA 4LIUA 5FPBA 5LY2A 4ASKA 4LITA 4UF0A 2Q8EA 4EZHA 5A1LA 3KV6A 5FPVA 3N9PA 3AVSA 5FZHA 5CEHA 2XXZA 5FYVA 5FZ6A 5LWBA 5F37A 3PTRB 3LD8A
chains in the Genus database with same CATH superfamily
1ZBE3 1PHMA 2BV4A 4JGZB 5JZGC 4LO4B 3JQXA 2XM1A 3K77A 4UVAB 5DDJ2 5HXRA 1KS4A 3NV3A 3WF3A 2HWC3 4Y1YA 5FO7B 5L7OB 2DCKA 2VMCA 4KHZF 1CAWB 5AQHB 1RVF1 5JZGA 2R6GF 4XPVA 4FFFA 1N3PA 2Y38A 2D6LX 1X7NA 1Z7S2 3ENRA 2ZZQA 5E0OA 2JICA 3U14A 3E5QA 4GMP3 1LGBA 1YIFA 3LBXB 2I2SA 4U72A 2VOXA 1V6KA 4FVVA 4Q0PA 1D1BA 1BK1A 1UQXA 3SLIA 1EY2A 5FWEA 2ZEWA 3OBVE 2UXCT 1RUH2 1Q8VA 4AHZA 4LKSA 5FZBA 4KWJA 5IVJA 2A71A 2XQ4A 2XL9A 2ZGOA 4PIXA 2D9DA 3PV0F 4LF6T 1X9PA 3ZXFA 1W0BA 3C8XA 2JIJA 2VO5A 5HCBA 1PX4A 3ONJA 5IVBA 3WZ1A 4DR3T 3ES1A 2JD9A 3CJIC 4EV0A 5L36A 4AFBA 3PVBB 2QDNA 1LTEA 3W59A 4Q4Y2 5CKNA 3K51A 5H9PA 4DMVA 1XE0A 4XE9A 1IJ5A 3WOGA 5EP9A 3IDCB 5CB4E 2WT0A 1GQGA 1HNXT 1WR0A 3GWHA 3CJIA 1UYXA 3RMXA 5FZ9A 1WLXA 5HV4A 2NPIA 4FXKB 4RR3B 3H50A 1SQ4A 1JN2P 3BKZA 1JYCA 1TME3 2ZGQA 4YZ4A 4RHV2 3ZSKA 3VRBA 4DXRA 1LESA 3HR9A 2HWF2 3SCFA 1RJ8A 4MLOA 4XABA 3R4SA 1SACA 4U2AA 2RM23 3AE3A 1QGLA 4WBOA 4U2YA 2QZ2A 3J9X1 4AEMA 4HFSA 2VY0A 5BNQA 1DFQA 2CDOA 3AVSA 4AIUA 5EYXA 4W6XA 4CP0A 5HEGA 4JRLA 3RI9A 2D5UA 2UY9A 3I2DA 2MBGA 3AB3B 3U07A 2A3WA 2XWBB 5LZ6A 4LOSA 5FZGA 1RGSA 3RGBA 2QRXA 1OLRA 1VRH3 5JSOA 4PDWB 4GIQA 4C91A 2NN8A 1IZNB 4FCAA 4B7KA 5AQSB 3VKMA 2YC4A 3ZMNA 2WNUA 5T5JA 3M2MA 2W1SA 1Q8QA 3WCRA 2D98A 1JTZX 1OPMA 2A3XA 1JW6A 1H8TB 1MS1A 1OOPC 1KK7A 1JU3A 2M6BA 2KM2A 1YO8A 2VD7A 4JCKA 5GLUA 4L9IA 3HKEE 1UOJA 4OLLA 2KR2A 5AQIB 4AG4A 3ZN4A 4JDNA 1OOPA 2FJAA 2WABA 1HV0A 5GM0A 2VGDA 1N36T 5J37A 3ZN6B 4MHUA 2UWAA 1PO11 3VKGA 3K3QC 1PO21 2V5YA 2RDSA 2VW2A 5J1GA 1W9RA 2YDEA 3BGAA 1Z78A 4NWWA 3RHWA 4NXMT 4OHXA 5FYMA 4CDUB 2WN3A 3MHZA 5L3GB 3DP7A 3LA7A 1RUC1 2ZM0A 5F32A 1PZ8A 1QIQA 1H1IA 3ZYPA 4W4ZA 1UIJA 5CFCC 3D4KA 5DXDA 4L0RA 2BUKA 2JECA 2WT1A 2RG4A 3ZJ1A 3QB5A 2I59A 2JB8A 5KXEA 2D43A 3K4DA 3A0NA 5F3JA 5GLZA 2WO2A 2WRAA 5CFCA 4ET7A 1RUF3 1DDLA 2QQPA 5CNAA 4XFGA 2EHOD 3ZMVB 3I3DA 3Q9DA 1X79A 2B5HA 2XAQB 2VUCA 3WQ7A 3KINB 5FPBA 3WUDA 1U5IA 1V9U3 2VMDA 5DUVA 2XXZA 5APAA 1ZBA2 4QKDA 1N1TA 2VH9A 4P9JA 2IUBA 3OTOT 1YYNA 3D3AA 3DKWA 3ZFFC 1ND2C 2RS32 1OLME 1P8JA 4Z2AA 4K7JA 2IXHA 4X8PA 5JLVA 3N4MA 1RUH3 5FWJA 2Z69A 4MGSA 1QLBA 3TLTA 3HKDE 4DV5T 1XRUA 2XASB 3ZFFA 1ND2A 4UYBA 4EN9B 4QDQA 4QX3A 1W6QA 4QD2A 5IT6A 3FZHB 3AAIA 3TEZA 5FZ3A 5FYCA 4RGGA 1UO9A 4JHTA 4GWNA 2WWJA 2V4AA 3FHIB 5FKCA 2PHTA 5EJ1B 1QNWA 2BFUL 4Q4Y3 1AR72 5KC6A 1S35A 1A3KA 1GYKA 2X05A 4A41A 1ND3B 5LB7B 5AQPB 2B9VA 3WG3A 4LA3A 2PHUA 5FYYA 4PK5A 2ZKLA 1OLMA 2HWD2 3GZTB 1HJFA 4NROA 5L3EB 5LASA 5CAZA 1WCDJ 3IEEA 1XXNA 3GBWA 2DVGA 1ONAA 4PT6A 3LCPA 1TE1B 3LGRA 4NHYA 4XFCA 5J96B 1OQDA 2XAGB 2R071 3R4UA 2HWF3 4DIDB 2PHDA 4IGPA 4COFA 4IGUA 2LALA 3VD5A 2XL7A 2D3SA 1AX0A 2Y8DA 2WMOA 1RXFA 1ULPA 1COV3 1D4M1 3VD3A 3JD73 3AYEA 2FMYA 1K5MC 2NW8A 1W2NA 2XQ3A 2X9HA 3V56A 2P3YA 3HN3A 3VHPA 1EV11 5B2GB 4MSVA 1PGL1 4WVMA 4DEVA 1BXHA 5BV6A 4MGQA 2JMKA 3K4AA 2QCSB 2WZHA 1W6MB 2LM2A 3DYMA 4U36A 2D44A 3ZIXA 4RSUA 4IDPA 2V5CA 3DECA 1IAPA 1D7PM 3HBKA 3Q2MA 4H9SE 3HA4A 1OSGA 4LO5B 4XJ9A 1W6PB 4PF1A 1GR3A 1XYPA 2WSUA 4ASLA 4LR4A 1YFWA 3PL0A 4D6RA 5DABA 1UU6A 1W9YA 4AEDC 3UNPA 5A3MA 3A4UA 2HH7A 1KITA 2C26A 1LKNA 3NV4A 4ORFA 4FAHA 1CJPA 4PLMA 2O0OA 3NAPC 1FT9A 3I2GA 1A6CA 2OV9A 3FZKB 4U3CA 4ZOLE 4AEDA 4I0UA 3NMBA 3MFCA 5CJ5A 4QGLA 3KSCA 1POQA 1TG7A 4UFMA 5KMGP 3NAPA 5JZGB 4HPKA 1G9CA 4DEQA 3PLQA 3ILFA 2HBUA 3HPNA 5L9RA 1H1AA 1ACCA 1I6ZA 1Y7BA 3UU5A 1RIRA 3TKLB 5JOYA 3WAJA 1C8M1 2RS11 5LBFA 4GB31 2WL1A 4LHLA 4EN8B 4Z1VA 5FUIA 3VHRA 1S55A 5DMYA 5FQ0A 3G7DA 3NV2A 3RZJA 1UCUA 4I0AA 4UV9B 1IZ3A 3DYOA 2QE3A 2X5IC 3GZEA 4JI0T 1R081 1BEV3 4C0BA 1D0HA 1MS0A 4DS0A 2X09A 4K0UA 4ZI2D 4CCOA 5FPZA 1C3HA 1KGYA 4P5YA 1K5JA 2X5IA 2DHRA 1AZDA 1UZVA 2VZOA 1L7LA 2JE9A 1UU5A 2ET1A 4NHXA 2XAFB 3AE4A 2JJ9A 1XNDA 4AFDA 1D0XA 4FXGB 5FP9A 3FHNA 1J58A 2X8KA 4XJAA 4URAA 1KEXA 3C7OA 1ZRIA 3ZYLA 3CJIB 1G9AA 4DV1T 5FKBA 1ALYA 3R0RA 4OUSA 1VRBA 5EK3A 2VPVA 4YSYA 2OW4A 4LE4A 1ZZBA 4XMAA 4F83A 4GWIA 1VBD3 1CPMA 1JBCA 3ZN0B 2C9KA 2ZGKA 4N8MA 1AXZA 5BPXA 4Z8BA 1HCIA 4IE7A 5J36A 2VNGA 3AE9A 2PQQA 2JG9C 4LKEA 4ZXKA 2Q0AA 2WSVA 3CIRA 4CUAA 3GZAA 1RL3A 5IFPA 1AR73 1YQ3A 3UFGA 3OY8A 2OX0A 4KGQA 4PHZA 3KF5A 2YY1A 1FV2A 2H0BA 4DUWA 1D1CA 4PJJA 5BNNC 5FYIA 1MS9A 1Y3TA 4DY3A 3U4XA 5I0DA 3L39A 1W2OA 2P1BA 2HWD3 2E5LT 3UETA 1ODMA 3GM8A 5EZYE 4UW3A 1UYPA 4TWHA 1NA1C 4JDOA 1ZREA 1HXS3 4IE5A 2OZ6A 2CSGA 2J1RA 3FE5A 4DB5A 5BNNA 2QQVA 2HWE2 3AEDA 4E4DX 1IJ6A 1K42A 4XAAA 4TTGA 2DNXA 2CPTA 4JI8T 2D6KA 3B69A 2M6IA 3POFA 1RUJ2 1NA1A 2KA3A 1GOFA 3SMHA 4WM7C 2SPCA 2BG9E 2B42B 2D3PA 2WINB 1WD3A 5JXHA 1SCSA 2VQAA 3LK2B 3AXDA 2WDVA 4AL9A 4TN7B 2Q1MA 1ASJ3 3K75B 1O4ZA 2QDRA 3J7NA 5LCYA 1YXWA 1XYNA 4U7YA 4WM7A 4M0NA 5LBMA 2RR11 4FOWA 2NLRA 1MZEA 2W46A 2PHFA 2JDUA 3UT0A 3ECQA 2X10A 4JLEA 4OI0A 1OOPB 4YG3A 4BQ1A 3AP7A 2DWRA 2JQ9A 3FWEA 4IHJE 3WDWA 4HXCA 4HKWA 1WMEA 1GANA 2PLV1 1C5HA 1JUHA 4C90A 1QJU2 2JDZA 4JAAA 3FZFB 3FXEB 2R062 2QGSA 3AEAA 4OHYA 1ZVFA 2XJUA 3HWJA 5FIXA 2WLQA 4YFSA 4NHKA 4Y4RA 5KXDA 3LE0A 3N9OA 5FYSA 3B3QE 5FY9A 5FCCA 1AVBA 1RMU3 3DGTA 3POWA 3A22A 3IM0A 4Q2FA 2XJQA 2ZM8A 4NHLA 1R093 4AI8A 2K9AA 4X5TA 3FC0A 5JMOA 4HKLA 2A72A 5CFCB 5A80A 1D0GA 4TWFA 1ZRRA 1XSQA 1RUG1 2R7EB 4WBNE 4WM8C 2YROA 4YG0A 5I8YA 3WNLA 4JHZA 4QHBA 3WHTA 4PNIA 1NZCA 3M7AA 2XQRA 1SBEA 2F4VT 3UULA 1E5RA 2YGLA 2JPFA 5JR7B 2DV9A 2EALA 2W1WA 2LSJA 4QX8A 3TB0A 4HWFA 2CL2A 4F3JA 1HB1A 4BHPA 1STMA 3LEMA 4WM8A 5LCWL 2CAVA 5D8AC 4G4FA 2OYZA 3RMYA 2XQAA 1O3RA 1XJAA 2XBO2 3VDBA 2JWPA 4LBKA 3WW1A 1OBNA 2V5DA 1GZWA 4CN1A 5T5OA 4M3CF 3FHQA 5D8AA 4YM1A 1HN0A 2ES3A 3U37A 4XQDA 2VVNA 1DQ0A 2EIEA 3ZFFB 1VAKA 1ND2B 1W8OA 4CZZB 1W6QB 3NKGA 3T4VA 4MBQA 3VZOA 4CEYC 1CONA 1DLCA 1T6BX 2XOMA 1XNRT 2WFF1 1W6OB 1VB4A 3GNEA 3PHMA 1IG0A 5LBQB 3NJZA 3K3NA 3LEKA 1TEIA 4R9DA 4B3RT 3L3PA 3NWKA 1VMJA 3MKDA 4NRMA 1MS8A 4CEYA 4QDSA 3TNPB 4CN4A 3AZXA 4FFHA 2Y6HA 3AZWA 2HEYF 4MADA 2H88A 3I2HA 4E2SA 3EHZA 3B57A 2H7OA 4UVCB 5LBEA 5JXGA 3DPRC 3KVAA 2W47A 2OA2A 3ZIWA 3C7HA 3R6NA 3E5UA 4KBMB 1ULFA 4JDMA 1LVFA 2E26A 2N9DA 3ABVA 1WLWA 2XB6C 5JR9C 4XDPA 4JEHB 3ZSTA 2E32A 1AX1A 1NZIA 3ETQA 2WP9A 4Z90A 2D6OX 2JB4A 4M1PA 3P4SA 2VBDA 4E8CA 4NIHA 5JR9A 2LS6A 1ZA4A 1JZ6A 2Y6KA 5LJMA 3ZSMA 5FOJB 1F4HA 1MVEA 2OPWA 1AXYA 5LYJE 3BIWE 1OUXA 4E9KA 5AFEA 3FXDB 2DBIA 5FKYA 2WYFA 3I3EA 4JI2T 2UURA 5AQLB 4WVMB 3QD6A 1K5MB 3RYHE 4EGWA 2GC0A 3H1WA 4KBZA 1FATA 1YD8G 1OVSA 3VBHC 4DV6T 2W92A 1WLTA 2C0SA 3AJYA 4PBOA 5I93A 2VQ0A 3Q8AA 1CZVA 3U0ZA 2ZMAA 3O1UA 1QJY2 3TLUA 4DRRA 2RJLA 3VBHA 2MPKA 3O1PA 3UKVA 1H2MA 1ZZ6A 5J48A 3VKNA 5IWAT 1PVC1 1NWMX 5L3CB 2IXKA 3MACA 1WGPA 1SLIA 1QWRA 4XJZA 3AKRA 4BH9A 1CZTA 1DQ4A 3WQ0A 3L8RA 3HQUA 3VKLA 2P9BA 4BWOA 1OA2A 2JQHA 1GQHA 1YJKA 3D6EA 1LEDA 3U3IA 1ZX5A 2BBHA 4M01A 4AEDB 1ZZ7A 5LY1A 1WWYA 4A6SA 2IIUA 2R063 3NAPB 4HPKB 2Q8OA 2R16A 3OYWA 2PTMA 2DUOA 3HR0A 5LRRA 3AFGA 5F5AA 5IVYA 2F4PA 2J42A 4YZ5A 2W3JA 2DLRA 3FLPA 2ADEA 2RJ2A 4GK5E 4YHJA 3ZCJA 2J1SA 4X64T 3WVJA 3V0AA 3VDAA 2WBKA 3WUCA 3N7LA 4NMIA 2VK9A 3PIGA 2V6XA 2C5DA 5FQ0B 4GQ7A 5BR8T 4WVVA 4M4PA 4E27A 2WZR1 4RL7A 4MGKE 1QXPA 2VULA 4XHBA 4E2QA 2A3YA 4XBLA 5KDMC 1S0BA 2D97A 4AOCA 5FZ0A 3P5BA 5KXJA 4X65T 3GYDA 3UQ4A 2JQKA 1YXRA 2FJEA 2V09A 2W5FA 3VGIA 3WNXA 2OLTA 5F1RA 1RUI2 2GMMA 4Q4V1 2X5IB 5LWBA 4O2BE 5IHYA 3M3ZB 1OT5A 3POEA 3C50A 1MMGA 4V1PA 1I5ZA 3AC0A 3RZGA 2RHPA 2WZIA 3LSEA 5HV0A 5H9QA 1UX5A 3V5SA 2XBO3 2G1MA 3I8TA 2UWCA 5KWRA 2ID4A 3PDYA 1VLNA 2MNGA 1WRDA 3KT7A 4QXKA 2HWB3 4ZZ8A 4OI1A 2ARBA 1S0JA 4S2GA 4M0HA 5AQJB 4CTEA 2VC9A 4KI5M 1OEDE 4W6YA 1X9TA 2JE8A 4LUMA 2XQ5A 3AECA 3CMLA 4QXCA 3I49A 3OY8B 4CDWC 2YPDA 4M3CE 1PNGA 5JRCA 3OCPA 2JG9B 4Y24A 4G9SB 4HFCA 2R6QA 4Q0QA 5C3QA 2O8OA 1D0ZA 4E7SA 1FJGT 4TNWA 3NRYA 3WW2A 5I0TA 5BNNB 1UU4A 1DU2A 2L8KA 4ILAA 4Q27A 2D6NA 1YHFA 3N2KE 2XUEA 1RVF2 3WF0A 5C70A 5A3TA 1VALA 1F5JA 3THCA 2WR9A 4D94A 1NA1B 4GAZA 2EICA 5F39A 2VCMA 4AW7A 1OEDA 4QPWA 2JIGA 3VUOA 2FJDA 4L9BA 4A44A 4AI9A 1KJRA 2LOSA 4UFHA 2LRKA 1GKBA 1GP4A 4M3CA 1BR4A 1IS6A 4WM7B 2PHRA 5F9TA 1FXZA 2JEMA 5JR2A 2JMHA 3POIA 2QVSB 2ZMLA 1R1A3 4EIWA 1SHZC 4X1IE 5FY5A 3AA6B 4MXWA 2YXSA 1AYN1 1AL21 4H63V 5FV3A 2RMU1 3OKQA 4UFKA 2E9XC 4AYUA 2Q1ZB 3MV01 4QT6A 3VLBB 3NNLA 3A7MA 4H9OC 1CIYA 2OVUA 5HEJA 2I45A 3ESLA 1HRI2 5FY7A 1GWMA 1YQ5A 5FLIA 3A7QA 2LT3A 2X29A 1HFAA 2E9XA 2UWBA 3MZHA 1QJY3 2GNMA 1PK6C 2WJSA 1W8NA 1C4RA 3EB7A 5KX5E 3BU0A 4ZZ5A 4P9XA 4A5XA 4GJYA 4AFAA 4RYDA 3EMRA 4HWHA 5L9VA 3VBFB 1HRV1 4DV0T 1KXGA 3CX8B 1X8EA 3P3PA 3NKZA 4KH9A 5FOBB 3N7MA 3J8F1 4K8FA 1EPZA 4Q0VA 5FUPA 2AZ5A 4AVBA 4EYUA 4Q0SA 1OPOA 5CFBA 1EAH1 1KQRA 3MLLA 3RZKA 3AVRA 4QX8B 3RC8A 5ACA2 4F8HA 5FLJA 2FDFA 1Q5OA 2VECA 4WM8B 5JDGA 5K7PA 2Q8EA 5FAXA 4Y20B 3OBTA 4JV5T 3T2TA 1G8XA 3W21A 1Q8PA 2Y0IA 1GZWB 4DV4T 4CQIA 5GONE 1XNKA 3CU7A 4NIQA 2ZMKA 5D8AB 5HPOA 4UEMA 1JODA 3RYPA 2GSYA 2CHNA 3AYDA 4RN5A 5EFUA 2QQJA 2WWUA 5JOXA 4OFGA 2WLPA 3OYZA 1VB2A 1MEC3 2PJQA 4PFOA 1NE4A 1CHUA 5FYUA 3OF1A 1S0EA 1YQ8A 3HT1A 2IDOB 3MLKA 4FPJA 1RUI3 3S7EA 1H2NA 3B93A 2DUQA 2XQ8A 2XLFA 2WDQA 1LGNA 4LBQA 5FZ1A 3C7GA 5LRSA 2C0ZA 4CEYB 1JI6A 1HS7A 3DL3A 1CAVA 1TNFA 1HW5A 4CCEA 5HXMA 2VR4A 5A3NA 3ZT7A 3UV9A 2GZWA 4OZXA 4XYXA 3T2QA 3AE5A 1PZ7A 3M3QA 4DR6T 2W2IA 2WS91 4MGZE 4ZPIA 1POV0 1S4CA 5ETWA 2XM2A 2EIBA 2FZ2A 4ZI3C 1LHUA 3EO6A 4L5GA 2LRLA 4IV3C 4FPCA 2Z79A 5JI7A 3ZDSA 2ARAA 1FMD2 5CADA 1TZOA 1BK0A 1FNYA 1MS5A 3DPRB 3UU6A 3H9AA 3FBZA 3RKOA 4IV3A 3LIGA 2VL8A 2HHHT 3OG2A 4JI5T 1PIV1 5K9YA 3JC6D 2YYOA 3H0OA 1M4WA 2VB6A 3UL2A 2NR4A 4QXHA 3SISA 3NRXA 2DUPA 5JR9B 1US7B 2EVXA 4PLOA 4Y26A 3ZYMA 3KCYA 4CYDA 4MZUA 1JS9A 1WW7A 3T08A 4XZUG 2N1GA 3ZC0A 4XFIA 4EQVA 5AQOB 3ME2A 1CD3G 5C3SA 4IE4A 4HFHA 4WW0A 3RNSA 3RFRA 5KHIA 1IBKT 4L2NA 1C1FA 2FQPA 4BJMA 2FDJA 3AYAA 4KG8A 1RVF3 1OFSA 2W87A 3WAKA 4V1Av 2QQIA 1VBA1 1O8PA 5FZ7A 3D0JA 1N34T 4U74A 2N7GA 1VOMA 2HYXA 1FI2A 4FBFA 4PIYA 2RDNA 2XONA 2KWIB 4XW3A 5EV7A 3ACLA 4K0KT 2DCZA 3J7HA 4KL1A 5GZDA 5ABJC 4FI9A 4KGGA 1US3A 1FOD2 1US2A 1KFXL 5LK5A 4CU9A 3WINE 3KV5A 4QAWA 4QQOA 3QOFA 3T1YT 2YBSA 2BWCA 1DQ6A 2R1BA 1NT0A 3VDCA 4DUXA 4MYEA 5ABJA 1OD5A 2BFUS 2BNMA 3OBRA 1WA4A 3MDPA 3M3IA 3OJAA 1AR62 3K3OA 2P17A 2VZ1A 3GGLA 4UBHA 5LG3A 4QH1A 2ODVA 2ZEZA 3F95A 1CVNA 2CGPA 4N9HA 1AHSA 3QK6A 1HRI3 3OPCA 1E5SA 3OYWB 5A70A 1V70A 3MI8A 4FFIA 3FMGA 5LA2A 5KC5A 5AQGB 3RZMA 1N3QA 2X53S 2FDIA 4BPZA 5JMCA 3K1SA 4XVHA 4BLJA 2YDRA 2ZX3A 1NEKA 4EEDA 2D0UA 2J7MA 1WLDA 4P08A 4A56A 2DVFA 2XHEB 2K0GA 3WNPA 2CM0A 1PMHX 2JRKA 4UF0A 3N9PA 3KBTA 3E6DA 4YG6A 5FP7A 3TN92 2XSBA 1MMDA 4LXLA 4MXVA 5I8SA 2WAUA 5IVVA 1AR82 2NMOA 3UJOA 1JYTA 3E6BA 2NYYA 2MPFA 2P4EA 3RIFA 2VKDA 4H63H 4NRPA 3B94A 3IDEA 5FPAA 2B46X 2W67A 2E6VA 3S5QA 3EQEA 1HQWA 3EVYA 2DWKA 2LUWA 3B01A 2GC3A 5HWYA 4Y5Z0 4B3NA 1J3QA 2MEV2 4IXLA 3N9LA 2FBWA 4Y1ZA 5HXEA 1D4M2 3IAPA 2CXLA 2W63A 3RI5A 2WZPP 3RIAA 4QH5A 2KLQA 5L47A 3SNMA 3WQBA 4DNDA 2L9LA 5C5UA 1O3TA 4TZ4C 3RI8A 2QQKA 2FDGA 4BXSV 5ABEA 1ULDA 1W6NA 3P6BA 3ZR6A 4SLIA 4XIKA 3O9XA 1YLLA 4IQPA 4Q29A 4EV6A 1IQAA 1J1JA 1LNSA 4TNVA 2ZGRA 1QJX2 5C8YE 4QU2A 5A7NA 2ACXA 4EZHA 1UMIA 3OD4A 4ILUA 2ZX0A 2C5JA 3ROUA 3ZMOA 3HKBE 3UUMA 1VRH1 3TWIA 4O4HE 2GDFA 1LOAA 2UU9T 1EUTA 4N9IA 5JDQA 4DIQA 1Y4WA 4QXCB 5AQFB 3H3LA 4FTEA 4LMJA 1CGPA 2NWBA 3BQLA 1LAJA 4O7XA 1PMJX 2CYFA 2IVJA 4CP9A 5JRCB 5A7PA 3TRSB 4ZKTB 3AKPA 4HVRA 3QUJA 1WMFA 3NBXX 2WS3A 3NL1A 2V7IA 3EI0A 2UXXB 3IB3A 1Q8SA 4XXPA 2RE9A 5GLTA 4CDWB 4AI0A 2O14A 2GC2A 1PO13 2XY8B 1L7QA 2XVGA 1PO23 5A3LA 5FZAA 4YT0A 1K45A 3NNGA 3O0WA 4I01A 1O4YA 3PUXF 3AK0A 4DRVA 1FMD3 5TSWA 1RHI1 4ZZCA 1F35A 4BQXA 1XMQT 1AYM1 2WNVC 3ZYJB 5ABGA 4BA9A 4TUYE 4JKKA 5BNOC 5ISLA 5DAWA 1GLHA 4XILA 1VAVA 1DLLA 2G19A 4HLTA 3VU7H 4XF3A 2XDVA 5E88A 2WNVA 3RKGA 4ZEYA 3E5XA 2RS12 1YC61 3E0ZA 2PAEA 5BNOA 3OSDA 5LATA 3PTRB 1F4AA 4M3CB 3UU8A 4YHHT 4NIGA 3LB9A 4AKHA 5AVAA 1WBLA 1A78A 1CQ9A 1PM7A 5AC92 1MQTC 3POBA 3VBOC 2X66A 4MXWB 1ZZ8A 2RV9A 4Z82A 4FSJA 4UW6A 3Q8FA 3T3YA 1KNPA 3T0BA 1W8TA 4AGGA 3UGFA 3FHAA 3OUIA 2VMIA 2XVLA 1MQTA 3VBOA 2Y26A 3ST7A 5DDJ1 4YARA 1POV3 2YEVC 1J83A 1WKYA 2XAHB 2P6CA 2G9ZA 3CDZB 2E9XB 5FBZA 4ZHNA 1UY0A 4GMP0 1YNAA 4ISRA 4DZGA 4NPPA 3KZ4C 4KUMB 3H8UA 1DQ1A 3J7LA 5EQUA 1LODA 5DQVA 5A3OA 1Z7S1 3LF7A 3I3QA 4DXZA 3LA3A 3M65A 5CG9A 1PK6B 1QXRA 2QQOA 4BIFA 3V0BA 3CQCB 3BALA 4B1LA 2WC2A 5FPLA 3MF9A 2UYBA 1SFPA 3THPA 5L3BB 3ZN5A 1AF9A 4UWDA 2QKDA 4YM0A 5DG2A 5A3WA 1ZBE2 3CNAA 3H37A 3JC6C 3VBRC 5CBLA 5J7MA 2LW8A 3GBFA 1I5PA 4X62T 1HKDA 3PE0A 1N47A 4XMIA 4YLHA 4CPBD 3MIHA 3SCGA 4HMZA 4A2UA 3BN6A 1WW4A 4DPNA 4DUYT 3T0DA 3PUQA 2OQ7A 4RA0A 4OYUA 3VBRA 5H6QB 3AYCA 2E8IA 3IDBB 3VBSC 3GJAA 4Q4Y1 3TN93 2BGCA 1URXA 5JQGE 3N9MA 5LB6A 4FPYA 1C28A 2LM3A 2VOTA 4ZU7A 2BBVA 1TVGA 2BGOA 1UY2A 2R073 3CJXA 3VBSA 1DU3D 4JV4A 3ZXGA 1C57A 5CKMA 2BVLA 3L09A 5A1LA 1H2LA 1IPJA 2MEV3 5LP6E 3EAMA 4RHV1 1K3IA 5FMOL 4LBQB 1D4M3 3LIHA 3GA8A 3ZPYA 3QB5K 2Y6JA 2DDUA 3HQXA 1Y64B 4X1YE 3BCWA 3VD4A 2BQPA 2GMPA 1HQLA 4IREA 2WDBA 4HWIB 1F5FA 3WF4A 3S7IA 2C4XA 2VZTA 1EV13 4QX5A 4YJ2E 4P1NA 1S2BA 5CKQA 1KF6A 3I54A 1RUD1 1XOYA 1QH7A 3I3MA 2GALA 3E08A 4ZS2A 3VL9A 5T3NA 4AVTA 3T8OA 1FEWA 4FO9A 2F17A 3LG7A 4B29A 2Y6GA 1NY72 4IV3B 1H4HA 4UOJA 2CE7A 4ZXEA 1V6MA 1JZ4A 3ES4A 4B4PA 3AE2A 1YQ4A 1TME2 2GK9A 3AP9A 4QXHB 5AQKB 3QH6A 1AJ3A 4TLFA 4CCCA 1UGOA 2BWAA 4XFAA 2YFZA 3OBZA 2WQ4A 3ABZA 1NXMA 3QACA 3VZJA 4F8AA 4JYAT 3L2YA 4FPLA 2PHXA 2RM22 5LA9A 4ILBA 2NMNA 3WP6A 1OLQA 4L92A 1QMJA 2RS51 2W95A 4RS5C 4UW4A 3NZPA 4AKGA 3GN5A 2J1UA 3AL6A 1QQP1 4N53C 3VRAA 1V9DA 3CKHA 4DXSA 4DXTA 4OVEA 2V8SV 4HETA 4YGBA 3HJRA 4RS5A 5LHIB 1EP0A 4I43B 1H1MA 2B9UA 3NNJA 4N53A 2QQLA 3LSDA 1C8M3 2RS13 4GB33 5ANNA 1YW0A 4ZU5A 2FDHA 1WCQA 3ASIA 4BJNA 3KQ4B 1UOGA 2ZKNA 3TBDA 2GNDA 2Y6LA 4I02A 4FOYA 4MUVA 3HKCE 3W15B 5JH7E 4B6XA 2C5KT 3FX3A 1WD4A 3DXUA 3F57A 5ABJB 4LEJA 3BK9A 4UV8B 2AENA 2TBVA 2V6YA 2V26A 5CU1A 3ZXJA 4HN9A 1YI7A 3C4WA 4D6SA 2VKJA 2D3RA 4IETA 1WFDA 2UUCT 4CRQA 4MO3M 4IEXA 4WZXA 2A7AA 4LFCT 1QJEA 2W68A 3RYIE 5LA6E 4EXTA 1SMVA 1ZKEA 4XFHA 1GQPA 2A5ZA 4CCMA 1VE0A 2YFUA 1ZBA1 3MIEA 4UF0B 4Q4W2 1CN1A 3KQRA 3I59A 3E1F1 3OPTA 2LSIA 4EB6E 5LMUT 1YCIA 5BNPC 4HK8A 4YVWB 2WCAA 3OPZA 3KT4A 4C1WA 2F4LA 4G63A 3HBZA 2RS31 3ZT6A 5A6ZA 2NQYA 1GU3A 3BTYA 3S6PA 2VZSA 1MZ6A 1W90A 5BNPA 4FPGA 2VUJA 2LOPA 1MVQA 4HL0A 5DUWA 2OIIA 3GJBA 2PTFA 5A33A 4Q1PA 1RUF2 3BOPA 4HFVA 4RGAA 1JOBA 2GU9A 4X20E 4Q26A 2LHRA 5T5PA 2DTYA 2JDHA 4LA2A 2E51A 3RC3A 1BBT2 4CU8A 3C2UA 3DF0A 1HLCA 4B4QA 3LDRA 1AR71 1V9U2 4K8RB 3P4WA 2R0FA 4H14A 4O4JE 3IAQA 3T1MA 1I94T 1HX6A 3PURA 1N3OA 3AZVA 3KDSE 2ZLYA 2KNDA 2CXDA 2HWD1 4OYKA 1DHKB 1EYBA 1LEMA 4JI4T 4NRQA 3PUYF 5DQWA 4PJYA 2B45X 2ZEYA 4AQTA 4AAPA 3C3VA 3P7IA 2LM9A 2ETEA 2YMZA 3ZVXA 2B76A 1DGWX 2J1DG 4IT4A 2ZGPA 3PDQA 4ZXLA 1UCXA 3R4DB 2XPJA 4AF9A 1H7CA 2RR13 2ZEXA 1Y43B 5AQQB 4CP9B 4XBFB 5B4XA 1QF3A 3H1MA 4B7EA 1SBDA 4BZ4A 3LAGA 1Z0HA 1VBE2 4PQ9A 2ZOEB 2E63A 1D2SA 4AGRA 4BU2A 3FB2A 3FUQA 2LEHA 2PLV3 2J1EA 5ADXL 2IC6A 2EXIA 2LSGA 3O12A 1OUSA 4ARYA 5LGUB 4MX3A 4I4TE 1SDDB 2I74A 4UW5A 3N9QA 4N43A 3AMQA 4HKOA 4CCLA 5HXCA 2YDSA 3AB0A 1ULOA 3I3BA 1U5YA 4H55A 2OKXA 3ZSEA 1LOGA 2BKOA 3AAEB 1JNZA 2WNVB 3VZNA 4LORA 2R041 4LMFA 4DV3T 5BUVA 3RLFF 5BNOB 4QX2A 4ISQA 4AKLA 2B8MA 3NJVA 4WV8A 4YTNA 5L2LA 3WEZA 4ZI7E 4Q4X1 3S4UA 2PAKA 4EJRA 1RITA 4O8SA 3C7EA 4P0AA 4W65A 5HBAA 3ZMSB 2ZTNA 3K2OA 1COV2 1W8ZA 3WD5A 3S5AA 5F8PA 3JD72 2BBAA 3PMEA 4AQYT 5IATA 3WW4A 2HN2A 3M8LA 1MQTB 3JB8A 3RWNA 2WQYA 3VBOB 4O9EA 2HBTA 1OXCA 4LIUA 2WNUC 5LY2A 2LE8A 5C8WA 5LGNB 2WUHA 5LBCA 3KGZA 1SLBA 2Y33A 3AMNA 3OD0A 3PUAA 3R05A 3LJCA 2BS3A 2BS4A 2C1FA 2WWVA 3IBMA 4DUVA 3IKWA 3V0BB 3OJBA 2X9WA 1SG3A 1SLAA 3J26N 3NW4A 3WG4A 3CKDA 3VHLA 1IBMT 3ZR5A 4EN6B 2W2UA 4HVQA 3TLSA 3WG1A 5JDNA 2WFF3 1VBB2 4XQ4A 2OZJA 3RH3A 4YZ2A 2XPKA 4Y33A 4BCUA 4XURA 4K3UA 1OWAA 4MGYE 4JTNA 1UK5A 3TLWA 3P8CD 4NUVA 5A3PA 1X8MA 5FP4A 5LA0A 4Z92B 3AFKA 5JSRA 3WNNA 1JOPA 4JBWF 4DVDA 4PI0A 1X50A 1TMF2 3VBRB 1GUIA 1F2NA 4CP1A 2AREA 4Q4W3 4META 2ZM2A 2UY8A 5DZEA 2WA3A 1UZZA 3ZFGC 3VZKA 1NG0A 3D5OA 4GWMA 3LDBA 3B7MA 3JB4C 3KCXA 4UI9L 2WYSA 4IEQA 4NR1A 4BB3A 3VBSB 1DF0A 4QPYA 4NPRA 3I0QA 2Q9QC 4AQSA 3ZFGA 3WR0A 1IPKA 3EHKA 3Q8EA 4XJWA 1LCLA 1Q43A 5A6YA 1QSDA 2CRBA 3AEGA 5EZWA 5CFDA 4MVTA 1BEV2 5F3GA 2WSSV 2DU0A 4N7UA 2Q9QA 4BK4A 4KMQA 1JZ7A 1BBT3 3WF2A 4P09A 4JGZC 1AR92 4J1WA 1ST8A 5GZFA 4TLGA 2VTFA 1J5ET 1U5ZA 2PA7A 3N2GE 4D7TA 1XU2A 2VWAA 1LHOA 1B35A 3UK9A 5H9RA 2FDKA 4AXOA 4CVUA 4KP3C 1NE6A 4JGZA 4F6RC 3UTKA 4GKJT 4K9SA 1XDPA 1X36A 4LLOA 1OKQA 4EN7B 5C2TA 3L9JT 1JMUB 4BIOA 4GH4C 3C64A 3H3MA 2ATFA 2BOIA 3GALA 3EABA 2QQWA 2HWE1 1W28A 4FP2A 5GALA 2VNVA 1JYXA 5A6QA 3SCHA 1KNRA 1VBD2 1PVC3 1RUJ1 4QPIC 4PCRA 2HPLA 2J1VA 4GH4A 4AISA 2DYCA 3OB8A 3ZMUB 1ZP0A 4AXPA 3B9IA 3N3HA 2VZPA 1HRV2 3U75A 3B13A 1VBE3 1CX1A 4H9RC 3BB6A 3HMYA 4XOGA 1BMV2 1DZQA 4QWNA 4QPIA 1M7KA 1UOBA 3T09A 2DU1A 5J98B 4AR2A 2Q8CA 1REFA 3TEWA 2XG3A 1QDOA 3AXEA 2WQ8A 2RJKA 3OTFA 1HNZT 3HI2A 2FHRA 4YW7A 2BYVE 1ZHCA 2ZA9A 3KMHA 1PMIA 1HXS2 3EXUA 4RS5B 5A32B 1QJU1 4IL7A 4JEUB 4N53B 2R061 4LHNA 3RPUA 3C4XA 5CEHA 3VN4A 1GOHA 4ASMB 1XZYA 2WU5A 4AEKA 5LA1A 2IXIA 4AGVA 2WZR3 5IYZE 4AI6A 4QQHA 2KMFA 3WG2A 3ANWB 2V6YB 1ASJ2 2VZQA 1BCXA 4J2CA 1OA3A 5JI9A 3BQIA 4QGNA 1LJ7A 3M3OA 3V5UA 3SKJE 4H9QC 1NLRA 1V6IA 4LK7A 2BRTA 5HCAA 2ARCA 5JAXA 4Q4V3 1W3XA 5DPNA 3T2OA 4XQWA 3QC9A 3GDBA 3VBUC 3ALQA 4EROA 4FPEA 2Z6EA 3RZLA 1IG3A 3P4PA 4ZHQE 5J3UA 2H0VA 2ZS6B 3VD9A 5FVLA 1Y9GA 2ZGMA 4DR2T 3SHRA 3O1OA 3VBUA 2JKXA 3KD4A 1YWKA 2ZGNA 2Y34A 3I59B 2ZBJA 1UY3A 4LO8A 4BJ0A 5DUXA 2OXBA 1GNZA 3WF1A 5FL1A 2ES0A 4Z07A 1IS4A 3RQUA 2XBO1 2CA5A 5LG4A 3WV6A 4PJMA 1ENQA 1BVVA 2K46A 1WCKA 1VBB3 3RJ2X 4AVSA 5K8SA 1RMU2 1VJ2A 4NE9A 5BNPB 2XWJB 1PIV2 2YPJA 1SHWB 5DAQA 4GXLA 2BPA2 1UUSA 4DQAA 2FUPA 4FOVA 5HEOA 2RVAA 3PVEA 4XEZA 1R092 1DIWA 5JVDE 1GOGA 5A33B 4I3PA 1DGRN 4CN6A 1REDA 3SH3A 2XMLA 3O1TA 3TLVA 1TMF3 3GCXA 4AI3A 2SBAA 2UXBT 2VQTA 2ZGUA 3TEXA 2VU9A 5EJZB 3MEPA 3AP4A 1YFYA 1BQPA 1OC1A 2X9XA 1S0GA 4NJ4A 2PMWB 4IGOA 3LZZA 3AM2A 2W00A 3GHNA 4QB1A 3ELNA 2NOXA 3ZN6A 4AHXA 1QUUA 1DZRA 5LK7B 2Q8DA 5C71A 3ZXLA 4TV8E 2JD4A 5HCMA 2NP9A 3FLTA 2W1QA 1XNBA 2BP6A 3C4ZA 5FZHA 2J22A 2V4VA 1O3QA 1J1TA 3ETVA 4DMIA 4DBRA 2ORXA 1HB2A 2OA5A 2E2AA 1HTJF 2DURA 2VW0A 1AR93 2AC1A 4LNVA 2HKXA 4Y1UA 1AYN3 3V64A 4KWKA 1AL23 4E2GA 2UXNB 4P0BA 2UU8A 3KBUA 4XBNA 1VIWB 1DGRA 1DGWA 3WY6A 4W6WA 4M00A 4BMEA 1IKQA 4X8NA 3AMHA 3UKNA 3MW2A 1ZV4X 1PZ9A 4E7ZA 4QDRA 5L4HA 5AQUB 5KHKA 4JZRA 3SFDA 2YG0A 4GA9A 3H3ZA 1AJKA 1Q3EA 4X6RB 2QQMA 3VZMA 1S0DA 5I0RA 2YDQA 1G86A 1JYIA 1HNWT 1TNRA 1HRV3 3AE8A 1QJY1 5EPAA 3W58A 4AHWA 1APNA 2JQQA 4HK9A 1RINA 1NLQA 2IHR1 2XAJB 4QHOA 1GQEA 4XF1A 1DGLA 1KRIA 2ZAAA 5J09A 3O1HA 2VQET 3B5MA 1S1AA 3ZO0B 3J8F3 3N2OA 3ZFEC 4CCNA 2A6ZA 3MFAA 4NPMA 1UAIA 1QHDA 3VKFC 4JQRA 4DO0A 1CESA 4RFT0 5M0TA 3ZX7A 1EAH3 4YWAA 1KJLA 4WVZA 1PM4A 4KQ7A 3KCCA 4KBBA 2AE9A 3M4FA 5AFUL 3ZFEA 5FPXA 1ND3C 4EEBA 4IEOA 4LO7A 1G6NA 1J3RA 2AGSA 4YGDA 2XJVA 2YZ4A 2EHOC 3BVCA 5FY1A 5HCJA 4RD7A 1O8SA 2XJTA 1LKXA 2J4GA 2WNUB 4GWJA 1XNAA 3R84B 1ND3A 3BTXA 3M3EA 4I50E 1F8VA 3I0OA 3WNOA 2EHOA 3GF6A 1U5PA 4GYSA 3MV11 1WCSA 3RYFE 4LF7T 5CA1E 4I0WB 5ERLA 3K4ZA 4L8QA 1LR5A 1L7RA 5FYVA 4XUTA 2H89A 2VOVA 2VCBA 5FZMA 2PHWA 4PLNA 5C5TA 3IF8B 1A34A 2BG9C 4IGQA 4X1KE 4QQLA 5G05L 3DUIA 2WT2A 1FMVA 3AAAB 1REEA 4LF8T 2ZCWA 2WS93 3IWZA 2G0UA 5JDMA 1OD3A 3JADA 2IZWA 4COYA 4G3YC 4ANJA 2BG9A 1DP0A 3Q8BA 2VMFA 4Y22A 3LA2A 4C0HA 2Y8KA 3IMMA 3CQXC 1CZSA 1FNZA 1VR3A 4AVAA 5AQRB 4CUBA 3LDKA 4AE2A 4AVVA 4JI3T 1UNBA 4FJOA 3OGJA 1RUE2 4XTPA 4XETA 2RPAA 2UUBT 2C9AA 2VL0A 1W39A 5C3RA 3LKJA 1PIV3 4FPOB 4YW5A 3ZFGB 1XQNA 1MACA 1ODNA 2GH2A 5C4WC 2P37A 2YV8A 4MH0E 1JZ3A 3BUCA 5JPMB 4G2AA 1MS4A 3RG0A 2Q9QB 1S2EA 1GMMA 5C4WA 1MZFA 4I30A 2A6VA 4IERA 1W8HA 4V2VA 1LOFC 5EK4A 4LPLA 4NIAA 4O61A 5DAVA 1S94A 3KHBA 3AEBA 2JE7A 2Z42A 5I0SA 4AKRB 3HIFA 1E5IA 1VBA3 3ZEFB 1X33A 3KWVA 2XQYA 3ZKUA 1W0PA 2XVKA 3RYCE 3KV9A 3ZJ2A 3WDVA 1LOFA 4YSXA 4LMKA 2JDAA 1H2KA 1GWKA 2WNOA 1MNDA 3K8PC 3AXJA 3EYPA 5F5QA 5IUQA 1GP6A 1KDMA 4QHZA 1JOJA 4JKLA 4OYJA 3CK6A 4EN0A 2I6HA 2HWB2 4BQ2A 3AA0B 3S57A 4GH4B 3WNMA 2PN5A 3IT8A 2IWGB 3UUXB 4H9NC 3LOBA 4QB2A 4O4IE 1YFUA 1CIWA 2PHLA 4QWNB 4QPIB 5FLHA 2EF6A 2LLYA 4KI0F 2WN2A 1O4TA 1ZOYA 2YKSA 1S0FA 2W1UA 1FX5A 1H9PA 1DCSA 4GKXA 1EUUA 3MPPG 1FPN1 2EXJA 5FXZA 3ZLIA 4OMCA 5CA6A 3PUZF 4NUUA 2W62A 4DINB 3WP5A 2CNAA 3USSA 5LHGB 1KEYA 1JZ8A 2Y48B 1M62A 1WUVA 1HRI1 2CMRA 4D6QA 4ZY9A 5JXIA 1IHMA 5JIUA 3S30A 1N1VA 4YNIA 1NCQC 1HJGA 2GN3A 4URTA 2DWGA 5K4LA 4JI6T 1YQ2A 5FMOS 3LWCA 5LGTB 5HXVA 3Q5EA 2XTLA 4AWDA 3AJZA 3MUY1 1FYUA 1W9SA 1GP5A 5JSPA 1GNYA 1L0VA 1UKGA 1JYVA 3ZYRA 1NCQA 3E97A 4KMCA 2AH2A 2WAOA 2NM1A 1R1A2 2QTWB 4BQ4A 2MHFA 3CMGA 4CCKA 1HB3A 5I91A 5JOZA 3H8XA 2BVVA 1D0YA 2A6YA 4DUZT 3HL6A 3DJBA 4ES9A 4LBLA 2WU2A 3SH5A 1TQ5A 1S0IA 3RYKA 1I3HA 5B4NA 4CU6A 2DVAA 5LXTE 5F2WA 3U78A 2ZMNA 3PUIA 2PQSA 5IVCA 1NLSA 2J1AA 2V7LA 3OUHA 4ZI2C 2O8QA 4GK0E 4IE6A 3RVHA 5ACA1 3VBUB 4CDXC 2P3KA 1WYCA 3NRUA 4ISTA 5AQNB 2ZX1A 4P9YA 2V7KA 1LENA 3LEIA 3EBRA 1QY4A 4WZFA 1RUD2 1H9WA 4QQ2A 1QH6A 4HT1T 4U7IA 2ZAHA 5A7SA 4CDXA 3SFEA 4RFRB 3MLJA 2KXPB 1S0CA 3JBG2 5SV8A 1VCSA 3MXZA 2WO3A 3M70A 2CBIA 1HF8A 3IHRA 3F2ZA 4XF0A 4IUGA 4GULA 2ZZJA 5HCFA 1UZ0A 1XPWA 1EZ3A 2OT7A 4GALA 2IAKA 1MPXA 3QH7A 1W8WA 1WW6A 4XACA 4TN7A 2GN7A 2B39A 4AQGA 5IAVA 3MW3A 2RDQA 3PJYA 1WW5A 3ZN1B 3UT5E 3LD8A 4AI1A 2V1DB 4KX6A 3C98B 4LBMA 2RS52 1NYWA 1RHI3 2BZDA 4BXFA 1AYM3 1QQP2 3F2EA 1RUE3 2VJXA 3D0SA 4A7YA 3A23A 4A97A 3JCFA 1LGCA 4XIOA 1SEFA 4KHPT 2V72A 3HEIA 3U10A 1JZ2A 2PELA 3CIHA 4CE8A 2N2NA 1FMD1 4DOUA 3RF1A 4HSJA 3ZYFA 2GP5A 4WNKA 1UY4A 5JDHA 3RWKX 3I2JA 3CZUA 3VKOA 2E7AA 5KHJA 4YLZA 5FMBA 5C9AC 4H2AA 1N1SA 4BLIA 1MEC2 3DTOA 1ULCA 5JDFA 4XUQA 2CLYC 3KVBA 4R52A 2NTYA 4D0QA 1YRZA 3MBWA 5EHDA 2TEPA 4QX1A 5C8CC 4XFBA 5IK4A 5C9AA 2VMGA 4QGMA 2IC1A 3FBYA 5FZCA 3RPQA 3WP3A 2QZ3A 1XNCA 1XU1A 5IK8A 1VBC1 2D93A 4YXDA 3OEAA 5DDJ3 1BLZA 2XH6A 5C8CA 5FZ6A 2BJSA 3T1LA 2WWSA 2X67A 2P6HA 3H8OA 3WDUA 1NQDA 4YRDA 3X29B 3PJQA 3FFQA 3I2IA 5HCHA 4OQ8A 1JH5A 4AQ2A 3KS7A 1F9KA 5F2SA 1DYOA 4JKMA 2AXDS 4BE3A 2D0TA 4DMWA 1LU1A 5JPNB 3UYJA 3MICA 1POV1 4Y1VA 1Z7S3 4UXAA 3FUOA 4A7ZA 5D21A 5E6HA 2W61A 4BK5A 1CPNA 1FOD1 3NSTA 4P5HA 2K24A 2Q5TA 4EWDA 4YYOA 3BOWA 2X51A 3MIBA 2DTWA 4P02B 2YGMA 3JUUA 2XJRA 3I1AA 1HB4A 1U4QA 1AR61 5FY4A 2W66A 2HN1A 4LFBT 1M06G 5FY0A 3ZFEB 1D4VB 3I97A 3MZKB 1W6OA 1OEDC 1MMAA 1QXJA 4ASKA 1NENA 3ZYIB 2AYHA 2WO7A 4XCAA 4LE3A 4Y1XA 1WCUA 2ZPXA 3PNAA 1YFXA 1KD7A 2LJLA 4LK6A 5K0UC 4ISSA 4XF4A 1H8VA 1W99A 2BNNA 3AEEA 3BODA 4S2FA 2TNFA 2EHOB 1ZM1A 3KV4A 1PGW1 5A7WA 2Q1FA 2KWHA 1KDKA 5FYHA 1J1LA 2P34A 3AL5A 4CXYA 2V7JA 3TN91 3AKSA 5K0UA 1GZ9A 1C8NA 4Z91A 1AR81 4RHV3 1MIWA 3ON7A 2LSYA 2K9ZA 4DNYA 4MV2A 4CI3B 1ENSA 5EWSA 2EA7A 2FJBA 3I9YA 3CX7B 4M4RA 1T98A 4NUBA 3RX6A 1QOOA 1E7PA 4IW3A 4C1XA 2MEV1 2VURA 4L0PA 1UZWA 3NKTA 1RUOA 4UAPA 1FMWA 1PX3A 3LQCA 4FP3A 2EXKA 2BG9B 3KLSA 2ZHMA 1CUNA 4Y22B 4PFPA 1RUD3 2JG8C 4YW4A 2WM9A 3C7FA 4HTEA 2BS2A 1HX8A 4LHKA 2YBPA 4HG6B 4A6OA 1DQ5A 1VCTA 1SLLA 1K5MA 4QKBA 1HV1A 1VPHA 3JBG3 3USUA 2JG8A 2W4XA 4OUMA 2HLEA 2WA4A 1QJX1 5FTTC 2D6MA 3IDAA 1I6XA 2P3JA 2Y6XA 2R042 4WYVA 3FLRA 4XAEA 2BZBA 3N7JA 3UGGA 1ZA7A 2Z5WA 4GD4A 2Y0OA 2YB7A 4Q4X2 1HX1B 3HNBM 3MJXA 3OPWA 4BM8A 2Y64A 2YC0A 4XF9A 5F7UA 3O1IA 1MIVA 5C4WB 2A6WA 4QX0A 1XNTA 1V6NA 4COUA 4IEPA 4TXWA 1BVP1 1BKZA 3GXUA 3T4HB 2RS53 4EYYR 4B1MA 1SPPA 4A7KA 2CTVA 1QQP3 1LB2A 3D0TA 2NW9A 1JU4A 4S2HA 5F6KA 2QUOA 3AE7A 1JUIA 1SFNA 1VMHA 4BQ5A 4LF9T 3PJAA 2FCVA 3AXJB 1YKEB 4UT5A 2I0MA 2VVSA 1U12A 2ZX2A 1WYBA 2DVBA 5L19A 2OPKA 4GKYA 5FZFA 3FN9A 4XZPA 3W9AA 3AZYA 5T50A 2VZ3A 5C6CA 1R1ZA 2ODUA 4NHMA 2IFRA 5CG8A 2AUYA 3I7DA 3UUBA 1MNEA 2VL4A 5L4EA 5J1XA 1H0BA 5AC91 5FY8A 2P5BA 4H9PC 2FCTA 2RDRA 4YW2A 2IVIB 3CL1A 4KNCA 2VTXA 2A2FX 3PJAJ 3SEPA 1BR0A 4LTAA 3H42B 3WXPA 5GLVA 5FYZA 1PO12 4CCDA 1PO22 3FL7A 4Q8LA 5ANQA 4IDOA 2H6BA 2LKGA 5CZKA 2D5FA 1KNZA 2A3DA 1CAUA 1W3VA 1GZTA 4LF5T 1ZBA3 1IBLT 5LMNT 2F6BA 1E2AA 5HXSA 4DR7T 5C33A 1RUC2 2ZHLA 4NAMA 1UZYA 1QOSA 4K40A 2VCAA 3UGHA 4L99A 1DQ2A 2RS33 2CWOA 3FZLB 2IXLA 1UXZA 1WMXA 2VTXJ 4FOQA 1NCQB 2UYAA 3SWHA 4LBOA 1PGSA 1WCRA 1HR0T 5KHGA 5F3EA 4HEAA 2WAAA 4F7ZA 4P00B 3FZMB 4YZ1A 1ZNPA 3UU3A 1OFNA 1OQ1A 4A3XA 3ZSLA 3PIJA 3ETUA 4PK6A 4LMLA 4Y5TA 1ZBE1 2P2KA 3ZXKA 3ITQA 3DCQA 2E33A 2PXJA 4HE8A 5F5IA 3N9NA 4HFIA 3Q9OA 2HWC1 3NJXA 4HKAA 2JG9A 3A8YC 4P9WA 3VBHB 5E89A 2JDYA 3CEWA 4CDXB 3BTAA 4YSFA 5FPVA 1X9BA 4R4XA 2NZ9A 4E4SA 2O1QA 2ZJCA 2X9YA 1I9RA 3PU3A 4GMP1 1JXNA 3TEYA 3CQGB 2WO1A 2W94A 4OHZA 3VV1A 2XGXA 4IESA 2AACA 1C1LA 2VW1A 5ABHA 3SKVA 2VCCA 4LBNA 3HNYM 4XXAA 3QBQA 3QLQA 2DFBA 5DZFA 2BKPA 3EDVA 4NO4A 3APBA 4QXBA 3VHNA 2VOWA 1J5WA 4HSLA 5FXVA 2PG8A 3VD7A 1OI6A 1FAYA 2YUEA 2DCTA 1E1HB 5FMCA 5IVEA 3GHMA 1J3PA 4IEZA 4HFEA 1LHNA 1GZCA 4OX9T 2DCYA 2PBIA 1NXD1 2ENRA 4PI2A 3BPZA 1JHJA 1MS3A 4QM9A 3V0AB 3UU4A 2WDRA 4INDA 4MHRA 5FP3A 5C7GA 2PFWA 4NIIA 3NQHA 5F5WA 1CAXA 1LRZA 2WIIB 2G9FA 4LIVA 2UXDT 4HWCA 2R043 5EJ3A 2VASA 1PVXA 3WDTA 3FJSA 2R072 1NY71 4ITCA 5A3UA 4Q4X3 3VBFC 3AKTA 2KXLA 3FZ3A 2OUHA 1UURA 3O0XA 5A7QA 1W06A 3SH4A 4MFRA 3ZKRA 1TME1 3VR8A 1O6UA 4Y4YA 3WSOA 4A45A 5C9AB 3VBFA 5F3CA 1SCRA 5CA0E 2CLYB 5IWFA 2CCQA 4COZA 4Q5OA 5DUUA 2RM21 4BOWA 4UELA 5C8CB 5KBFA 5CGMA 1G9DA 3A5XA 3AA7B 1EV12 1Z0PA 3WW3A 1PGL2 1CWPA 2XZEA 4AHYA 1V0AA 5JWPA 3Q5XA 1HQNA 2DVDA 2W91A 2A1XA 5FL0A 3MYXA 4Q1RA 4A98A 1UX6A 3BTZA 3OGVA 3JXSA 2RA1A 3KGLA 5FZKA 5GKAC 1W04A 4Y20A 2DCJA 1LOBA 3URFA 2J47A 1Z8UA 3FBMA 2XJ7A 5AQVB 5GZGA 1B7TA 1LHWA 3SOLA 2XQXA 4FPFA 3SC7X 3N5LA 5LEJA 5CVRA 3PUSA 4A42A 4OHVA 2VE1A 3SRZA 2XKPA 1G8WA 2VZUA 4A3ZA 3MW4A 4FPKA 2WNEA 4WVWA 2IW5B 1XNQT 2E9XD 4IE0A 5HEHA 2CGNA 2VZVA 2K48A 1QDCA 3NVOA 3ZSJA 2IUWA 2V73A 4QB6A 3DN7A 4YW3A 1JZ5A 4LLFA 3H7JA 1O5UA 5CIRA 2TUNA 1RUC3 2YK0A 3T1HT 2BVBA 3ILNA 2VQUA 1OEDB 2VXRA 3N36A 3NZQA 1W2AX 3AZZA 2VQFT 1R64A 1H30A 2R49A 1RTVA 1W9FA 5A7WB 1C8M2 4GB32 1EPWA 2AEZA 1V6OA 5FZDA 3A21A 2BU9A 2Z4FA 4Q4W1 3AMMA 4PJNA 2BVMA 3I2FA 2QFEA 5K0UB 4CEWC 5C3PA 2G4IA 4N78D 3IN9A 2KINB 1V6JA 2NW7A 3JZVA 1BZWA 4BA6A 3UESA 5G04L 3UFEA 4FTBA 2VMEA 3DPRA 5E16A 3HN1A 1PNFA 1R082 4BQYA 3RSJA 4CEWA 2SLIA 3DXTA 4KU8A 4FTSA 4TX5A 2D5HA 2PFVA 3CPZA 1RUF1 2DCFA 5M4YA 3ZSSA 5IW0A 4DFSA 3QOPA 3G6JB 3R6SA 4S2DA 4XJUA 4P14A 3JCIA 1GBGA 2ERFA 1UMZA 1W2UA 4I09A 3DKQA 1BBT1 5FZ8A 3LEGA 5D1IA 5FZOA 3N7KA 4BISA 3O1JA 1V9U1 3ZYGA 2VBBA 2JIWA 2XQ9A 4GIWA 2D7FA 2HWE3 3USUB 2JG8B 4LBQD 2OS2A 2VM9A 1RUJ3 4YM2A 4E4ZA 4ILCA 2E7QA 4NN0A 5T55A 4GKKT 1RUH1 3MF6A 3AE6A 2RP4A 4PF5A 3WNKA 1NAEA 2VXJA 4BYYA 4ERRA 3NV1A 3RQ0A 4DR5T 1T72A 1DZTA 3LSVA 4B3ST 4ZS3A 1GNHA 1LECA 3CO2A 2CU5A 1O5LA 4AQFC 3ACIA 4YFZA 1SPPB 4D3WA 2CWSA 4B3MT 3MK7C 3PUGA 4LF4T 1VBE1 1UWWA 2X0YA 4DR4T 4BQ3A 4ZI3D 2ARXA 3THTA 4CP2A 3DEMA 1V00A 4AQFA 1NCRC 4ONUA 1QJU3 2KZ7B 1XWMA 4XBQA 3M1HA 3ZOIA 4ATFA 5JXJA 5FZ4A 1SFYA 3HVDA 3ONXA 1NCRA 1WMDA 3VDDC 2QQNA 5FK7A 1QU0A 3J4UH 4DY5A 1UD1A 3T30A 1BHGA 4DBQA 1LOCA 1QNYA 1QJZA 3OOXA 1W05A 3BU7A 4E4HA 4AI2A 4PQQA 2HWF1 1CAVB 2RR12 2WQZC 3VDDA 4Z2WA 3WHUA 1ENXA 4GYRA 2DF7A 2OUJA 2VVEA 4CXXA 2PYTA 2I07B 4MG2A 4FAGA 1W0NA 3IPVA 1COV1 2VVDA 4Y3OA 2KT9A 2E9QA 3JD71 1FV3A 5FZEA 1YI9A 2PLV2 5JIAA 3P50A 2H7VC 1AX2A 5J0ZA 1U5XA 1KS5A 4OFZA 2YC2A 3SXWA 3OGRA 1YQCA 1CAUB 3ZPOA 1BYHA 2LSKA 4ARXA 1E5HA 4W50A 3FBLA 3H7YA 5EYYA 2CWYA 3KM5A 4E8DA 2CEAA 5FVKA 3V65A 5FXWA 4D7SA 2HJIA 5GJ6A 1ULEA 1AUYA 5FNVE 3HQRA 1MMNA 5AQMB 3QCWA 3ZXAC 3WDYA 1UN1A 3JAEA 4CSWA 1YEWA 3BPSA 2CBJA 2VUDA 2IXJA 3NJYA 1T8BA 2JXAA 3TYJA 1VBB1 1RUG2 1A8DA 5LW9A 1YUDA 1AJOA 4LQRA 5JVVA 5KXCA 3F31A 2HPJA 4XZCA 4TZDA 2ORZA 4LBJA 1OKOA 3H3AA 1OXZA 5IFTA 2DBNA 3ZDVA 2YU2A 1VAMA 4RGKA 3PUVF 2FMDA 2ZHKA 4LKDA 4JVAA 4H7LA 4K6BA 2WB5A 1TMF1 4UFIA 2MYSA 4DV7T 4CDWA 3VZLA 2FD8A 4RQPC 1IKPA 2HYKA 4CDQC 3D8CA 2KSRA 4R9CA 3MIFA 2XUMA 3G06A 2X68A 4X6QB 1R083 5AFBA 4OZOA 4RQPA 4CUGA 2JX9A 4IL4A 2WFF2 4CDQA 4JQTA 3ZCIA 4AKIA 4YM3A 4N7IA 3VB9A 1W2TA 4QXBB 5BYNA 1V6LA 4Q25A 5HWXA 1ULGA 4ZU4A 3UJQA 1UMHA 3MIGA 1BEV1 2GNBA 3Q5DA 3S0MA 2YBKA 2YN6A 2CWMA 4KWUA 1LOEA 3SEEA 4BMBA 4NVPA 4OQ9A 1FPN2 4UVBB 2VUAA 1T6GC 1AR91 1NKGA 5DQ0A 1Y9QA 2CV6A 2LTNA 2JDNA 2ZACA 4QKFA 5FREA 3WQ1A 4EAHA 1KFUL 1CAXB 4JUYA 5EK2A 2FBEA 5I8TA 5TAOA 1H4GA 1W9TA 2KD7A 3JAFA 3D82A 1DG6A 2J62A 4IDNA 4IV1C 4DR1T 2CAUA 1RB8G 3CHXA 4JI1T 2QNKA 3AP6A 4PK4A 4FQZA 5H6RB 1VBD1 2VZRA 2R0HA 2XHKA 1DYKA 1WR6A 4YJ3E 2VMHA 4HWDA 4L97A 3WX5A 4IV1A 3BI3A 2ZM6T 1GV9A 3HOBA 3H1YA 4YFWA 4XUPA 1PK6A 4FFGA 3ONLC 1HDKA 2D6PA 4Q8KA 1OQEA 3K48A 2IFWA 1UPSA 1BMV1 5IHRA 4AAXA 3OUJA 4U33A 3KB5A 2W39A 5FPUA 5H9SA 3PTYA 1W6NB 4BQWA 2A6XA 3AKQA 1W8UA 4IEVA 3OGGA 3AMPA 2C24A 2JKBA 4OCTA 2CHHA 1SBFA 4FQ4A 5DJQC 4H7MA 5JTGA 1NX9A 5GZEA 1SZBA 3I2OA 2E31A 2LROA 3EJKA 4CU7A 2NP0A 1CR7A 3ZYHA 4O9GA 1HXS1 3H8RA 3LFIA 3O1SA 5DAPA 4HGAA 5FMDA 1LVKA 1W0AA 4MHCA 5IK7A 2CHOA 3O1RA 5LOVE 4LULA 2A75A 3O0VA 1WLCA 2GNTA 1PVC2 5I0UA 4CI2B 1OF4A 1UY1A 2IMLA 1XB9A 2JDMA 3X1DA 4YPJA 3AEFA 4QX7A 1NQJA 4YVSC 2VKOA 4L11A 1ASJ1 2P3IA 3CX6B 2GMEA 5A1AA 2W08A 3PMSA 4LJHA 3PVNA 4N43C 4XC9A 1OMIA 4UR9A 4Z8XA 1XE7A 2FCUA 5DZGA 1N32T 2CGOA 1HN1A 1J84A 5FZLA 5IYYA 4YVSA 5SV5A 1QKQA 2J1TA 1SLTA 3RZZA 1D2QA 1D1AA 2D2SA 1SUMB 1JYNA 2GH8A 4AVCA 1IQDC 3HT2A 3OBAA 2IXCA 1WA6X 4TWDA 3MA9A 3ZYBA 3RYRA 3IZOA 2W9XA 3ZT5A 2ADDA 3Q5WA 2WZR2 4CPBA 3CZJA 1SE7A 4IEWA 3VHOA 1XBFA 3HNMA 4QPGC 4WZCA 3WCSA 1J59A 5HAXA 3O7OA 1RUG3 1RMU1 1KFYA 3ATGA 4OULA 5FYTA 1HIXA 2VNRA 4K1YA 1LULA 4HBNA 3O5SA 1ZEEA 4CEWB 3RRWA 4CI1B 5FR3A 3RRCA 3U1XA 4LUKA 3PUWF 3IA3A 1R091 1UPIA 1BJQA 1OA4A 4QPGA 2BDEA 1O91A 4J1XA 4Q4V2 3ZMTB 3ACHA 4LOTA 4FT8A 4PIZA 3RQWA 3INAA 2ZGLA 4JGYC 1IS5A 2OQ6A 4TYSA 4UXNB 3SQOA 1VBC2 4XUNA 2QA7A 5FZOB 5IJRA 3WI3A 4NPLA 2YOEA 4OMDA 5LBBA 2LKHA 4P9LA 3AX4A 4LO6B 4JGYA 3ZXEA 2JENA 1WZXA 2D40A 4HZFA 4P9IA 4JRAA 3E6CC 2B7YA 3TOJA 1W09A 4YY3T 4FI5A 3KF3A 2JJ6A 3POYA 3ZYKA 2WFPA 4GZ9A 1L3JA 4ATEA 4IDQA 5GLWA 1Y01A 1XSRA 1HG5A 3KHCA 1O3SA 2A73B 3ZC1A 4XDQA 5FK8A 3U11A 4TSVA 2GC1A 1UKRA 5JUVA 3ORJA 5ABFA 1A8MA 2JDKA 3HAGA 4COWA 4XHXA 5FUNA 4PJLA 1FPN3 1F15A 2VBPA 3LPGA 2ZGSA 1OH4A 1ZRDA 5F6LB 5C3OA 3QNUA 4UFLA 4HFBA 5IUXA 2E53A 2YINA 3GZUC 3O14A 1U0AA 4ADZA 3A0KA 4J6GA 3T0AA 4B3TT 4CUCA 2V7MA 4D7YA 1O7FA 3RIUC 4EWEA 1YQ6A 2H3RA 2JDPA 4XJ8A 5CFDC 3RRDA 1NCRB 5L73A 4YVWC 1T2XA 1RC6A 2WMNA 1ZZ9A 1CX4A 1PGW2 4UIGA 2DL1A 1IOAA 3RIUA 5DAXA 2QYWA 1IPSA 5FRAA 1UYZA 4ZONA 4TV9E 2QQUA 3VDDB 5JOWA 4YVWA 1B35C 1UXXX 1JNRA 5FJKA 3RZHA 1AL0G 5LNKA 1AYN2 3IPVB 3N35A 1Q56A 1AL22 2WKKA 2BEOA 4TWTA 2RMU2 1W9WA 5AVPA 3T2PA 1OF3A 1GWLA 4N90A 3DV8A 3UQ7A 1SDWA 4R9BA 2HEWF 5L7OC 1H6YA 2VOKA 4EOZB 3PUHA 5CB7A 4AZZA 5EXOA 3EUHA 1N33T 4D8MA 5ACA3 3RS6A 4CZSA 1GSLA 4MALA 3AP5A 3C51A 2ZHNA 4AEJA 5HXHA 4XDOA 5FFOC 1Y9MA 5L7OA 1H6XA 1XC6A 3M3CA 2L9QA 1CAWA 3P3NA 3L2HA 3MUZ1 3BYWA 1G73A 1K12A 1SLCA 5J2UE 3I4IA 4YGCA 1MIYA 2EIDA 1UL9A 4I55E 1UYYA 4J25A 4MLKA 2G9GA 1R8IA 4SBVA 4YGEA 4I2OA 2WY2A 3LBXA 3NNFA 2GP3A 1QOTA 4MOAA 1CJDA 1LRHA 3J8F2 5IVFA 2QVAA 2PAMA 5E1RA 3NO8A 1RUNA 1W0OA 4FPHA 3I9WA 3GN5B 4HN1A 1O3XA 4CXWA 4Q0UA 3RJRA 5L3FB 1EAH2 1RYYA 2K2SA 2GAUA 4U31A 2ZX4A 2AR6A 2W0XA 5A6XA 1GICA 4NWVA 4UBGA 5FZIA 5FJHA 2LHNA 1YIPA 3LPFA 4JTOA 2HEVF 3LFMA 2BKNA 3W20A 4GOUA 5CYYA 2EAKA 2DI4A 1NAFA 1OURA 4RR3C 4AQ6A 1XE8A 3GCWA 4ZZBA 5DG1A 2WZEA 4JX0A 4UFJA 5T5LA 4D69A 1B09A 3SS1A 1RUE1 2A70A 4A4AA 4HN0A 2YHJA 4K20A 4QKNA 4R4ZA 5KXBA 2Y60A 4RQPB 4R8HA 4IIJE 2QBXA 3IBPA 4RR3A 4XFFA 4CDQB 2X0LB 2VAUA 5CISA 1OHFA 2XQ6A 4MGTA 3CVRA 3MPBA 3WLUA 3UKTA 2AEYA 3GMIA 5AQTB 1G9FA 4YW6A 3CQOA 3PU8A 3OYXA 1VBC3 2H6CA 3ZKYA 2M67A 5L9BA 1VP6A 3WT3A 2WS92 4JC1A 5FO8B 5LJNA 4LHSA 3ZMZB 4OK0A 1BR1A 5E8AA 3OGSA 4I0BA 4PDWC 2XLAA 5JCTA 1T7SA 3NVCA 2DFCA 3TNQA 3ACFA 1ZRCA 5FXXA 1IS3A 1UIKA 3MGUA 4COVA 3WP4A 1UX4A 4BAYB 4PBPA 3POJA 2ILMA 4PDWA 1QJFA 1FOD3 3TAYA 5BXXA 4NXNT 1H8TC 3B5LB 2HWB1 5J2TE 2HH9A 3POGA 5F37A 1G7YA 2ZGTA 3W5NA 2UUAT 3UUNA 2WBLA 3NNMA 4EWAA 4IV1B 4LKFA 3J7Yq 2YU1A 3B9CA 4YZ3A 5LEKA 4IDZA 2CXFA 4HONA 5HEUA 5T52A 1H8TA 2B4KA 1AR63 4XTMA 4NAOA 1UW8A 1YJLA 3J9SA 4KG0A 3IIIA 5JDLA 3E22E 4W8JA 3ZXDA 4Y5SA 2A9UA 5IAXA 1NUKA 1I1EA 5A1FA 2B1EA 3EDUA 4QM8A 3IIAA 2BERA 5FYBA 3LK42 1YKHB 3I2KA 1VBA2 4QMAA 4CDUC 5JDBA 2VVFA 4KU7A 4PW8A 4OI2A 3DYPA 3W5MA 1BR2A 4WBBA 2BBJA 2HWC2 3RDIA 1SA0E 5BY5A 5JREA 3KT1A 1JYWA 2MAWA 4O65A 1XYOA 4CDUA 1W8FA 1XDOA 4DV2T 5L3DB 1UF2C 1RXGA 4QU1A 3MIDA 4QX7B 5HYAA 5A7OA 4B4RA 1AR83 2IC9A 4IEYA 2VG9A 4OI4A 3B02A 1RJ7A 4CA9A 1LHVA 3NWIA 2RMU3 2W0GA 4AFMA 2BTVC 4ES8A 2XSAA 1IGOA 1ZYBA 5F3IA 3P4QA 2CDPA 5KR7A 1R1A1 3ILRA 4YW1A 3B00A 4YVSB 2VNOA 1X82A 2ZXQA 4YSZA 3JQWA 2K5BB 2CY6A 2Z2SB 1MR5A 4N43B 3BQKA 4C8DA 1F31A 3CBNA 1WBFA 2LRPA 1GFF2 3LK3B 3RGLA 5T54A 2R30A 5GZCA 4KWLA 3O1MA 2ZABA 1UX7A 2XLGA 3PVOA 4CCJA 4O4LE 1QJX3 3SITA 3IMNA 4IEUA 4MGIE 4AK3A 4PAGA 2C6SA 3CWZB 4R9AA 1ZZCA 1QEXA 2XJSA 3CLPA 5FMNA 2XQ7A 3JBG1 1N1YA 3JU9A 2Q4SA 4QPGB 5KHHA 1NOVA 3ZM8A 4OUEA 4YTPA 2FZ1A 3FFZA 2Q30A 1AXKA 2K3WA 3O4XE 4NIDA 3BIEA 4XUOA 3J7MA 3ACGA 1ENRA 3O1VA 3LOIA 3VKHA 4JGYB 2EIGA 2WZ8A 4K1ZA 2XJPA 3AA1B 3H3UA 1G9BA 2W52A 1LU2A 2MTQA 5EIYB 4O2AE 2R1DA 4H3WA 3HD8B 4QQPA 5LHHB 2L3LA 1DYPA 2Q9QD 4HVOA 5A32A 1VRH2 5DN2A 3ETPA 4BDVB 3CF6E 3VR9A 1MZ5A 2Y6FA 1DBNA 1OH3A 2EAAA 4HOOA 1O59A 1FIOA 3OVUA 5ABFB 2BW8A 1MEC1 4LITA 5AC93 3KV6A 3KFWX 3OEBA 3ANWA 3POSA 4X66T 1RUI1 2QJVA 3WDXA 4XCBA 2XR4A 2XKOA 2EXHA 1XMOT 3P4RA 5D2AA 5FO9B 1E57A 1C5IA 2ET7A 4I3GA 2E7TA 2VKHA 5FP8A 1RHI2 1AYM2 2X0HA 4B8EA 4EE2A 2BDRA 4XAXB 4AFCA 1ZRFA 4JI7T 4LFAT 4YTMA 5HI0A 1Q8OA 4V2WA 2R32A 2BNOA 1HG2A 1W6MA 1OVPA 5F5CA 3THDA 2C5IT 5FBJA 3GBGA 4IL9A 5CFDB 4OHWA 3MO4A 2MOZA 3Q8CA 4LT5A 3U4SA 4P9GA 2ACZA 3LDQB 4U2ZA 1W6PA 3K46A 3AE1A 4OHFA 4QH4A 5FDBA 5IK5A 1W03A 4HANA 3VL8A 4EZ4A 1VMFA 4GJZA 2NTXA 2BOJA 4NOTA 5BMVE 3P1IA 4K21A 1JHNA 1UOFA 2BGPA 2XHNA 2E5VA 4HFDA 1S2KA 1B35B 5C3JA
chains in the Genus database with same CATH topology
3ESLA 3N5LA 2LSGA 3UUNA 1MMDA 3GA8A 4LXLA 2V1DB 5FY7A 2WBLA 5FZMA 3PUSA 3C98B 3ZN0B 2WAUA 3SRZA 2LT3A 5LGUB 4I4TE 5IVVA 3H3AA 1Y64B 5LYJE 1OXZA 5IYZE 4X1YE 1WYBA 4AI6A 2YU2A 3J7Yq 3N9QA 1HFAA 4BXFA 2YU1A 2E9XA 4UVAB 4FI5A 4IDZA 5HXRA 3FXDB 4CCLA 3F2EA 5HXCA 1HCIA 3IF8B 2KMFA 2IW5B 2CXFA 5FZFA 4IGQA 4IE7A 4X1KE 4HONA 2VKDA 3ANWB 4H63H 3ZYKA 2E9XD 4IE0A 1FMVA 5FPAA 3AAAB 4J2CA 5KX5E 2MYSA 3BQIA 2K48A 5FWJA 1HG5A 5JDLA 3EVYA 3AAEB 2ODUA 3E22E 3RYHE 2G0UA 5JDMA 3V5UA 4GJYA 2DWKA 4YJ2E 2OX0A 4H9QC 2N2NA 3HKDE 5HWYA 3N9LA 3ZC1A 2GP5A 1YD8G 4ANJA 4WNKA 5A1FA 2B1EA 5HXEA 1MNEA 3EDUA 1D1CA 5JDHA 4AKLA 2XASB 4PJJA 5FY8A 3E08A 5FYIA 5L2LA 5FYBA 2CXLA 3CX8B 1YKHB 3LK42 4ZS2A 2C0SA 2W63A 3CQXC 4ZI7E 2P5BA 5FUNA 3AAIA 3QC9A 3S4UA 2X68A 3T8OA 2YK0A 2KLQA 1FEWA 4H9PC 5E0OA 4PJLA 4PW8A 5FZ3A 5FP7A 5FYCA 3NZQA 2ZMAA 3LBXB 2Z6EA 4FJOA 2A2FX 4O8SA 4DNDA 3DTOA 4U72A 3LG7A 1BR2A 5EZYE 1BR0A 5JDFA 4ZHQE 2CLYC 4TZ4C 2WWJA 1D1BA 3KVBA 4CUGA 2CE7A 2NTYA 4P0AA 1SA0E 5FWEA 3ZMSB 5A7WB 5FYZA 4IE5A 3K2OA 3OBVE 5JREA 5FUPA 4EYUA 5FZDA 3ZCIA 4AKIA 1NWMX 5ANQA 4PJNA 5F8PA 5L3CB 2BVMA 1IJ6A 2GK9A 4QXBB 3MACA 5FZBA 2YINA 3O9XA 5HWXA 1S35A 1KNZA 2DNXA 5IVJA 2A3DA 4QXHB 5FZCA 4N78D 1AJ3A 3AVRA 4QX8B 4ADZA 5L3DB 3RC8A 2KINB 2NW7A 5C8YE 5HXSA 2P9BA 4QU1A 5A7NA 2SPCA 2V7MA 2YBKA 4QX7B 5HYAA 5FYYA 2ACXA 4LIUA 2IC9A 5A7OA 5LY2A 4G2AA 3UFEA 4EZHA 2ES0A 2LE8A 4ILUA 4PK5A 5JDGA 2Q8EA 2H3RA 4UVBB 2C5JA 5FZ6A 3U3IA 5LGNB 3LK2B 2Q9QB 2CA5A 5LG4A 2X67A 3HKBE 4PJMA 4TN7B 3UUMA 5L3EB 2W0GA 3IEEA 1G8XA 4O4HE 5LCYA 2WMNA 5IVBA 5LY1A 3DXTA 2CWOA 5JDQA 5F3IA 4DIQA 4V2VA 5KR7A 4QXCB 4CQIA 4TX5A 4UIGA 5GONE 5EK4A 5LBMA 3NZPA 2PFVA 4AKGA 3PUAA 3GN5A 4EAHA 2NWBA 3BQLA 3CPZA 3LJCA 3AL6A 3HR0A 5F2SA 3SWHA 4TV9E 2D0TA 4DMWA 1S94A 2DCFA 4JUYA 5EK2A 3UYJA 4DMVA 5TAOA 5F5AA 4UEMA 5M4YA 1IJ5A 5IW0A 5IVYA 1V9DA 5JVDE 5JRCB 2K5BB 2XAGB 5A7PA 4AKRB 4JLEA 3BQKA 5CB4E 4C8DA 3QUJA 2DLRA 3ZEFB 5E6HA 2X9WA 5F3EA 2WWUA 4GK5E 2W61A 4IGPA 3NBXX 4HEAA 4YHJA 2XMLA 5FJKA 3GWHA 2XQYA 4IGUA 2V7IA 3RYCE 3ZCJA 3KV9A 5FZ8A 3ZJ2A 3OYZA 2UXXB 3CKDA 5FZ9A 1WLXA 5FZOA 3VHLA 2Y8DA 2PJQA 4IHJE 5LHIB 3LK3B 5LNKA 4PFOA 4I43B 4BISA 2K24A 2WMOA 3O1JA 5FYUA 5JDNA 3ETUA 4PK6A 2X51A 4PK4A 5H6RB 1MNDA 2VK9A 4GIWA 4C90A 5FZAA 1YW0A 3K8PC 3RH3A 4BJNA 5FZ1A 1WR6A 3FXEB 4YJ3E 4Y33A 2QGSA 4EOZB 3I1AA 4OYJA 2PXJA 3HKCE 3W15B 5JH7E 1HS7A 2NW8A 4HE8A 4B6XA 2X9XA 3EUHA 3AA0B 2OS2A 4CCJA 2C5KT 4BA9A 1OWAA 4O4LE 5F5IA 3N9NA 5A3NA 2X9HA 1U4QA 3DXUA 4TUYE 3F57A 3P8CD 4NUVA 5KDMC 4HKAA 5A3PA 4YFSA 5ISLA 4IGOA 3BK9A 4UV8B 5FP4A 5FY4A 4Y4RA 4MALA 4PAGA 5FZ0A 2W00A 2V26A 3C51A 3UUXB 4H9NC 5HXHA 2RP4A 4O4IE 5FY0A 2NOXA 4XDOA 2W2IA 3N9OA 3CWZB 3MZKB 1QUUA 5FYSA 5ETWA 3VU7H 2L9QA 5FPUA 2Q8DA 4DVDA 4WBOA 2XDVA 4HN9A 5FY9A 4ERRA 4TV8E 4QWNB 2JMKA 1MMAA 4ZI3C 1G73A 2NP9A 3C4WA 4D6SA 4ASKA 4L5GA 3J9X1 5FMNA 3E0ZA 3C4ZA 3AVSA 5J2UE 5FPVA 5FZHA 4ZS3A 5LWBA 3PTRB 2VKJA 4O2BE 2ZM2A 5IHYA 2ZM8A 3C50A 1MIYA 2X9YA 5DJQC 1MMGA 4I55E 1IAPA 2K9AA 3PU3A 4AKHA 2D5UA 4AQFC 2MBGA 4MLKA 3CQGB 5FXZA 3ETVA 3ZLIA 3AB3B 2LJLA 3LDBA 2A72A 4DBRA 4NUUA 4ISSA 3Q2MA 4H9SE 2OA5A 3HA4A 1HTJF 3LBXA 3MK7C 5A80A 3PUGA 1UX5A 3FBZA 2W62A 2EHOB 3KV4A 3V5SA 2GP3A 3RKOA 3O4XE 2X66A 2VL8A 3RYIE 5FZGA 4WBNE 5LA6E 4EXTA 4ZI3D 5A7WA 5LHGB 4HGAA 2KWHA 1ZKEA 3JC6D 5FYHA 1LVKA 4MHCA 5LOVE 2Y48B 3I0QA 5IVFA 4CCMA 3EDVA 4C91A 2Q9QC 4PNIA 2VB6A 1IZNB 4AQFA 3AL5A 4CXYA 5DABA 4QXBA 4D6RA 2UXNB 4P0BA 2V7JA 3VKHA 3I9WA 3PDYA 3GN5B 5FXVA 2PG8A 3KBUA 2HH7A 4UF0B 3UULA 2CMRA 2KZ7B 1O3XA 4CXWA 4QXHA 4D6QA 3NRXA 4CI2B 2JPFA 3OPTA 1WRDA 2LSIA 3AA1B 5JR9B 5L3FB 1US7B 1E1HB 2LSJA 4QX8A 5IVEA 4EB6E 1QSDA 3ZYMA 5FZ4A 1MIWA 4QX7A 2YEVC 2LSYA 2XAHB 2N1GA 2PBIA 2WSSV 2MTQA 1ZV4X 2VKOA 2DWGA 4O2AE 4ZOLE 3ZC0A 5FZIA 5K4LA 4G63A 3CX6B 4E7ZA 2E9XB 2Q9QA 5FJHA 3ONXA 2LHNA 4CI3B 5LGTB 4IE4A 4P09A 5LHHB 2XTLA 2L3LA 4WW0A 3LFMA 2Q9QD 3I9YA 3CX7B 1KK7A 5FP3A 4GOUA 1T98A 4NUBA 4Z8XA 3RX6A 3CMLA 4QXCA 4BJMA 4KUMB 5KMGP 3N2GE 4DBQA 2VWAA 2VD7A 2LOPA 4KMCA 5FZLA 5DQVA 1LRZA 2DI4A 4L9IA 4E4HA 2YPDA 1FMWA 1NAFA 3WAKA 3HKEE 4V1Av 4LIVA 5JRCA 3M65A 4HOOA 4CCKA 1CUNA 5FZ7A 4U74A 2VASA 4KP3C 4GYRA 1FIOA 4CZZB 4PFPA 1D0YA 3CQCB 4HFVA 4F6RC 3TKLB 1D1AA 2D2SA 1VOMA 3HL6A 4CXXA 3UTKA 4MBQA 3SS1A 4LITA 3DJBA 4X20E 3KV6A 3KFWX 2LHRA 2WM9A 2JQQA 2KWIB 3WAJA 3C64A 4QKNA 4HTEA 2XAJB 3RC3A 3VKGA 5A7QA 3ANWA 3K3QC 1D0ZA 4QHOA 1HX8A 5LXTE 5F2WA 2YBPA 5FPLA 4E7SA 4Y3OA 3U78A 4IIJE 4MFRA 2KT9A 3O1HA