The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
93
|
sequence length |
354
|
structure length |
349
|
Chain Sequence |
RSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSFRFPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insights into a novel histone demethylase PHF8
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Homo sapiens
|
molecule keywords |
PHD finger protein 8
|
total genus |
93
|
structure length |
349
|
sequence length |
354
|
ec nomenclature |
ec
1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase. |
pdb deposition date | 2009-10-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02373 | JmjC | JmjC domain, hydroxylase |
A | PF17811 | JHD | Jumonji helical domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Methane Monooxygenase Hydroxylase; Chain G, domain 1 | Methane Monooxygenase Hydroxylase; Chain G, domain 1 | ||
Mainly Beta | Sandwich | Jelly Rolls | Cupin |