3K3QC

Crystal structure of a llama antibody complexed with the c. botulinum neurotoxin serotype a catalytic domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
MSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords llama Aa1 VHH domain
publication title A Single-Domain Llama Antibody Potently Inhibits the Enzymatic Activity of Botulinum Neurotoxin by Binding to the Non-Catalytic alpha-Exosite Binding Region.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 45
structure length 165
sequence length 165
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2009-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k3qC01
4.10.1280.10 Few Secondary Structures Irregular Metalloproteases ("zincins"), catalytic domain fold Clostridium neurotoxins 3k3qC02
1E1HB 3K3QC
chains in the Genus database with same CATH superfamily
4JBWF 3AA0B 4PJJA 4AKLA 1L0VA 4PJMA 2I59A 4TV8E 1GQEA 3EDUA 4H9OC 4HKAA 2H7OA 4ZI2D 3CQXC 2I0MA 2K9AA 2C5IT 4AISA 2HN1A 3AE9A 3AECA 4COFA 4ZEYA 3CPZA 2VVSA 2MYSA 1HFAA 3PUSA 4ANJA 2CHNA 3P4QA 3RKOA 5AQGB 1VRBA 3P8CD 3NZQA 2MOZA 1J5ET 5DABA 5HXCA 2YDRA 4O4HE 4DVDA 3AEDA 3BQLA 3PUYF 2JRKA 2XAJB 1W9RA 4UVBB 2PG8A 1HNWT 3H3MA 1WR0A 3LJCA 4LMKA 2CXLA 2DWGA 2PFVA 2DHRA 1J1JA 1OEDA 2N2NA 1W0BA 2UU9T 3PJAJ 3K3OA 3AAIA 2FBWA 4YFSA 3N9MA 1SUMB 3AE6A 3A8YC 3QUJA 4BA9A 5LHGB 3AEAA 2VB6A 2WZIA 4PAGA 1H7CA 5JDNA 4U74A 3SFDA 3RC3A 3CQCB 4WZXA 2XSBA 3AE8A 4HWIB 2CM0A 3PV0F 2UXXB 2XAFB 4WBOA 3MKDA 2H89A 4G2AA 1MNEA 2LM9A 3LDQB 5J1GA 5LOVE 4B3ST 3SRZA 2E9XB 4TWFA 2QVAA 2K3WA 3TLWA 5CFBA 2CE7A 2FJAA 2Q9QB 2LLYA 2LOPA 2N1GA 3UQ7A 1XNQT 4OK0A 4Z90A 2R6GF 2AE9A 2NR4A 5AQFB 3OTOT 3NZPA 4LF7T 5LGNB 3C98B 5JRCB 4HTEA 4TUYE 4X62T 2K5BB 1Z0PA 5HWXA 2LM2A 2XQYA 3ZJ2A 2LSKA 3UU8A 2IMLA 1HCIA 2VL8A 5JDGA 3ABVA 4YSYA 4DR7T 3VKGA 2BKOA 1QLBA 2J47A 4YTPA 1MMAA 2LEHA 5LA6E 4ZXLA 5F3JA 4DV7T 1N33T 5FMNA 1IZNB 2CCQA 2KMFA 4I55E 4UXNB 3Q5DA 4QXBB 2M6IA 4DUZT 2YKSA 3N5LA 4CI2B 3HKBE 2W63A 1WRDA 2OLTA 3UFGA 4AKIA 3ZJ1A 4MFRA 3CX7B 4ZS2A 2W67A 3J9X1 2HN2A 3FZLB 1YKHB 1D0YA 5L4HA 3U3IA 3FZFB 5LBMA 3F31A 1IBLT 4OFZA 1NWMX 4DR3T 2GK9A 1M7KA 2XTLA 2VQFT 4LF6T 3N2KE 4UVCB 5AQJB 1XDPA 1QUUA 3FZKB 1OEDE 2BZBA 1HF8A 3LBXA 1IJ5A 3LK3B 2V8SV 2HPLA 2OV9A 4H63V 5JR9A 1UURA 2DLRA 2EHOA 2IC9A 2V26A 5HXEA 2XPKA 2WS3A 3LFMA 3P4PA 2BS4A 5IYZE 5LJNA 3F57A 4H9SE 2NW9A 5CJ5A 4P09A 4LF8T 2DNXA 4AKHA 3ZT5A 5LG4A 1OXZA 2D5UA 5FL1A 5FY7A 4DIDB 2V7JA 3Q5EA 5FVLA 4U72A 1I6ZA 3GMIA 5AQNB 2VKJA 5ABGA 2L3LA 1HNXT 1HTJF 2VKDA 3AXJA 2BBJA 4EYYR 2ZLYA 2Z6EA 2XJ7A 2WWVA 5L2LA 1S35A 1NAFA 2LSGA 1BR0A 3RQWA 1E1HB 4QH5A 1B7TA 3QB5K 2D2SA 1NEKA 3HKDE 3VRAA 1OEDB 4AQFC 4LF5T 4YJ3E 4CXWA 5L3BB 2LRKA 3UUMA 3O1HA 2G0UA 4A98A 2WU5A 3AVRA 3PUQA 4QWNB 4UV8B 3VR9A 4HFDA 2WMNA 3CX6B 2E8IA 4YTNA 4UIGA 4CXXA 5LCYA 4HEAA 1AJ3A 2XM2A 3QOFA 4O8SA 1VOMA 5H6QB 2UXCT 2A72A 1N36T 2SPCA 2UXDT 4AKGA 3DJBA 4EEDA 5FP3A 1IJ6A 1FMVA 3NVOA 4U7YA 1KF6A 3AAEB 4CN4A 2RA1A 4NXMT 4P0BA 3SOLA 2E5VA 2KWIB 3FHNA 2KINB 2JQKA 3P7IA 1XDOA 5CA1E 5HEOA 2JMKA 2ACXA 2P9BA 3KV4A 2E5LT 2VL0A 2JQQA 5AQRB 2NOXA 3MXZA 3OPCA 1QSDA 4EXTA 2A9UA 4ZI2C 4IIJE 2XZEA 4IL4A 4B3TT 3ZMZB 5JREA 2LOSA 2WY2A 3JC6C 3ZSTA 2CPTA 3EABA 4GOUA 3ZPOA 2W66A 4U2YA 3ZN1B 2IUBA 1XNRT 2E9XC 4UF0B 2B1EA 2XQ5A 2VQET 3N9NA 1BR1A 4N78D 5JDHA 1IBMT 2WWUA 3TLUA 4IGUA 4WBNE 5JDMA 1Y64B 3N9LA 3N9OA 4B6XA 1HR0T 1YW0A 1X79A 2XSAA 2WM9A 3LBXB 4IE0A 3O4XE 2CMRA 3NRYA 4EB6E 3QC9A 2CBJA 5JR9B 4GKJT 4LFBT 3R84B 2EHOB 4I43B 4JUYA 3ZT6A 1T7SA 3P4SA 5JDLA 4IDOA 3PU3A 2KXPB 5J2TE 3TLVA 2LSIA 2L8KA 4PW8A 2X66A 2FJBA 3ETVA 3JAFA 4O2AE 3UTKA 3WI3A 2I6HA 3ZYLA 4AQGA 2KT9A 3RHWA 2CLYB 1WLXA 1KEYA 3JC6D 1ZHCA 2LHRA 4PNIA 2C0SA 2X67A 4PK5A 2E9XD 4H9QC 4XAXB 3N9QA 1N32T 3AXJB 1OWAA 2Q9QD 3ZC0A 3QK6A 4CI3B 4DMWA 3RC8A 4JI5T 1XMQT 1XWMA 2FUPA 4HWCA 4L0RA 4LMJA 2W62A 5CA0E 3AE4A 3L3PA 2LJLA 3O1JA 2CWYA 3AB3B 4YXDA 2WCAA 2IDOB 4JI6T 2LSJA 3MK7C 1MIWA 3RYIE 4DNDA 3ONXA 2CWOA 2CXDA 2XHEB 3PUGA 3BQIA 4ZI3D 5AQTB 2VWAA 2XASB 4YT0A 3I9WA 3Q2MA 4TWDA 5EK2A 3HKEE 4FI5A 2IAKA 4J2CA 4ILUA 2V6XA 4XZCA 2PBIA 4HFHA 1CUNA 4LF9T 2BG9E 1KNPA 5GONE 4ZHQE 2RPAA 2BBHA 2L9QA 2YN6A 2QRXA 4NUUA 3NWIA 2JPFA 4KBMB 3RGLA 4DR2T 4F6RC 3CIRA 3ZMVB 1OEDC 3T8OA 2WMOA 4PFOA 1WFDA 2W0GA 2V1DB 5LMNT 4QHOA 3CK6A 4NPPA 3LSVA 1W0AA 3UULA 4DR1T 2MPKA 3JADA 4QKNA 4ZOLE 5J2UE 5FYMA 4HFIA 4IDZA 3AE2A 4A5XA 3FXDB 1UUSA 4V1Av 2CBIA 3WAKA 5KXJA 3GA8A 1KNRA 1U5PA 3Q5WA 4KUMB 4CI1B 2UUAT 4IT4A 4CQIA 3UUNA 3GWHA 3KFWX 3FZHB 1CHUA 1XMOT 1YKEB 5BMVE 4Q25A 2M6BA 4TX5A 3OBVE 4LMLA 2H88A 2XAGB 2X9XA 5ABHA 3HL6A 4UF0A 3RIUC 5IWAT 1FIOA 4OYJA 2J1DG 2PJQA 4H9PC 5L3CB 3K3QC 5E0OA 4UELA 3ZEFB 5L47A 3OVUA 4IHJE 2AXDS 4ADZA 2JQHA 4U33A 3I9YA 4CN6A 3CQGB 3RRCA 3NKZA 2YEVC 3DP7A 1LKXA 4BJMA 3CMLA 5HXHA 3TLSA 2XY8B 3SWHA 3RQUA 3N2OA 2QYWA 3DTOA 1HS7A 2VK9A 4HFBA 2J4GA 5F5WA 1WYCA 5KMGP 3CVRA 2ODVA 2UUBT 4DBRA 1N34T 3X1DA 5J0ZA 2ZM0A 5IUXA 4ISSA 3H37A 4ASKA 2BS3A 3CKDA 4BAYB 3RYCE 4CN1A 2DCFA 4GK5E 5ETWA 3PUZF 4B3RT 4JI8T 4AI6A 2QA7A 4AQFA 3A5XA 3NRXA 1MMNA 2LKHA 5EK4A 1T98A 5FXVA 5BR8T 3MZKB 1O3XA 1MIYA 4ZI7E 4IE6A 2D0TA 4UEMA 5IHYA 1D1CA 4DMVA 3Q9DA 3ZLIA 2NTYA 5FXXA 3AA7B 3UU3A 4O2BE 2HHHT 2JJ9A 3E08A 2MBGA 3HR0A 4HFVA 4TN7B 3N9PA 4IDQA 1YQ4A 4O4IE 3K3NA 2XUEA 4EZHA 2YDQA 1YD8G 5ABFA 2KSRA 1D1BA 4B3MT 3LK2B 5EK3A 1MMGA 5FY1A 4ZZBA 3EHZA 3RIFA 5FVKA 5HEGA 5JDQA 3ANWB 1ZKEA 2ES0A 4EZ4A 2N9DA 5KDMC 2FJDA 4JEUB 2WDQA 3P4RA 3PUAA 4TZ4C 3IEEA 1D1AA 1E7PA 2BS2A 4HWHA 5LGUB 3Q5XA 4A56A 4E7ZA 5L3EB 4IE5A 4QH4A 4U7IA 3LG7A 5AQMB 2E2AA 4JEHB 4NIQA 2EHOD 2XAQB 3AE7A 4E7SA 2LHNA 3IF8B 2LT3A 1G8XA 1VCSA 1M62A 2K48A 3ONJA 3AVSA 3PDYA 5ADXL 1V9DA 5LMUT 1SA0E 4KHZF 2ZM8A 4AQYT 1FEWA 3ZN0B 1UX5A 1W09A 3J7Yq 2ACZA 2DL1A 5AQHB 2D0UA 1UX4A 5A1LA 3IA3A 4JI7T 2CRBA 3B13A 4EYUA 2K24A 3KBUA 2Q9QC 3ZC1A 2VASA 1WYBA 4LFAT 5C2TA 5HYAA 3EAMA 5AQSB 4DBQA 3RX6A 1SHZC 2IIUA 4PK6A 4LF4T 3SFEA 2WDVA 1WR6A 2VKHA 4I4TE 2WSSV 2BG9A 5M4YA 3N2GE 1HNZT 4HN9A 2CXFA 5LP6E 3VHLA 3RH3A 2UUCT 3P50A 4ZI3C 2BKNA 3EDVA 3UT5E 2X0YA 3K1SA 2X9HA 2X51A 3I0OA 3PTRB 4MHCA 3RI5A 2IC6A 2X0HA 2Y6XA 4DR6T 3AEFA 3UQ4A 4KI0F 3I1AA 4K0KT 1US7B 3A7MA 4JI0T 2V5DA 4U3CA 3BK9A 2JIWA 3G06A 2V7MA 4TV9E 1ZP0A 3PE0A 3WAJA 4DV2T 4OX9T 2X9WA 4F8HA 3MACA 4X20E 5HCJA 3E22E 2PTFA 3UU4A 3L09A 4KX6A 2YK0A 3AA1B 5LNKA 2XQ9A 4GK0E 5AQPB 2RP4A 4DV6T 3ZYKA 5HEHA 4X1YE 3FBZA 2YOEA 1VCTA 3SS1A 4H63H 2V7LA 1MMDA 5LYJE 4CZZB 4I0UA 3AEBA 3KV6A 4X65T 4DV3T 1YQ3A 4H9NC 3RRWA 2W61A 3HKCE 5HEUA 2WDRA 1KK7A 2V7KA 3PURA 2LSYA 2NP9A 5C8YE 4OYKA 5ABFB 4O4LE 4UV9B 3ZT7A 5JTGA 2XQ3A 4DV5T 1SE7A 3OKQA 4QXCB 3RYFE 4EV6A 2W00A 2HH7A 4IL9A 2ZM6T 3L8RA 4HFEA 3JCFA 1G73A 4DR5T 3OJAA 2NTXA 4ERRA 3UU6A 4GIWA 2YU1A 3VKHA 3ANWA 1U4QA 4MALA 3FB2A 4FJOA 4KMCA 4TWHA 2UXNB 4AIUA 4EAHA 4C91A 4GYRA 3NBXX 1UK5A 2D9DA 3HI2A 2MTQA 3RPUA 4HWDA 1HG5A 3FXEB 4CXYA 5HWYA 4IDPA 5C3JA 3KDSE 4P1NA 3JAEA 3QB5A 3CX8B 1JNZA 2NWBA 2WB5A 1LVFA 3ZMTB 2V6YB 3OYZA 2V5CA 3QNUA 1I94T 3RIUA 5CGMA 2LRLA 4EEBA 3V5SA 2H7VC 4I50E 3KV5A 4PJNA 4U2ZA 3AAAB 3OYXA 5HAXA 4X66T 2KNDA 4JYAT 5LB7B 4C90A 2LKGA 4MLKA 5FNVE 3UFEA 1E2AA 3ZCJA 2XQ6A 5AQOB 5L4EA 4WNKA 3ZMUB 1Z8UA 4YLHA 3C64A 5KX5E 4JI4T 3ESLA 3GN5A 3MA9A 4EIWA 4ISTA 4X5TA 4BJNA 2YDSA 4PJLA 4X1KE 2CEAA 3ZCIA 2DWKA 5L3FB 4PFPA 2X9YA 4LFCT 4L5GA 2BG9B 4M1PA 3AA6B 1D0XA 2X68A 2JQ9A 1FMWA 4YSZA 2A2FX 5L3DB 1DU2A 3K8PC 1MIVA 4G63A 5H6RB 2YU2A 3KV9A 1LVKA 2XQ4A 3O1IA 5JH7E 3AE3A 2DI4A 3ZSSA 4ILAA 3VR8A 3C4WA 4YSXA 4TNWA 3H3AA 2M67A 2J62A 1D0ZA 2XQ8A 3IBPA 5HCMA 3RKGA 4YY3T 2FJEA 2BKPA 1KFYA 4KP3C 2WU2A 3C4XA 1HX1B 2JMHA 2XAHB 3RLFF 5FXWA 1IBKT 2XM1A 3ZMSB 5TAOA 1BR4A 5AQKB 3PUXF 3EI0A 3KVBA 4JI1T 5FL0A 2WAUA 3M65A 5LJMA 2XQAA 2CA5A 3B57A 4X64T 5AQQB 5AQVB 3F2EA 3VRBA 3P4WA 1ZV4X 4DR4T 4IREA 1T8BA 1UCUA 3M3ZB 1T72A 4HGAA 3T1HT 4JI3T 2OA5A 3U78A 4UR9A 5JR9C 2MAWA 2BVLA 4U31A 4ILCA 1NENA 5JDFA 2XQ7A 3LK42 2C5KT 2EHOC 4GKKT 5EZYE 5LHIB 3IHRA 1R8IA 3KBTA 1HG2A 1LRZA 4MBQA 4A97A 5LGTB 1FJGT 3W15B 2KZ7B 3ETUA 4JV5T 3C50A 3PUVF 3B5MA 3TKLB 5HXRA 2BVMA 2LE8A 1J5WA 1UGOA 5LG3A 3EVYA 2NW8A 2CHOA 5FKYA 3FZMB 4DV1T 3PJAA 2C5JA 3KVAA 4Z8XA 5LHHB 3D0TA 4QH1A 3ZKRA 4WYVA 2CLYC 3KINB 2WZHA 5AQUB 4GYSA 4ZZCA 2VVNA 5ABEA 4YHJA 1ZOYA 3AEGA 3ONLC 1WCRA 3RF1A 4EOZB 4IDNA 2NW7A 3AEEA 4JLEA 3ZYMA 4PK4A 1HX8A 5CB4E 3E0ZA 4HFCA 4O4JE 3L39A 5FXZA 3HA4A 4JI2T 3UU5A 2F4VT 3FBLA 4QX8B 5DQWA 1Y01A 1YXRA 2IW5B 4AKRB 2IHR1 3RYHE 4Z91A 3T1YT 2W4XA 3EUHA 2ZM2A 4YHHT 2WQYA 2E9XA 4YJ2E 4P0AA 5JQGE 3AE5A 4TNVA 4HWFA 4AXPA 2Q9QA 2V6YA 2KLQA 3UUXB 2BDEA 3C4ZA 4EGWA 5DJQC 3C51A 4KHPT 5AFUL 4NXNT 5HEJA 3R6NA 2VURA 2QGSA 5JRCA 2WP9A 1XZYA 4ILBA 4NUVA 2KWHA 3TLTA 1ZEEA 4DO0A 4DV0T 4DV4T 2YINA 4XBFB 2WBLA 2A3DA 3GN5B 4OHFA 5AQIB 5HXSA 1KNZA 2Y8DA 5FY0A 4ZS3A 4X1IE 4DUYT 2ODUA 1EZ3A 3AE1A 4WW0A 5AQLB 5F8PA 2Y48B 4K0UA 3BQKA 1JNRA 4H9RC 1X9BA 4IE7A 1MNDA 3S4UA 4L9IA 2H3RA 5LXTE 4UVAB 3PUWF 3I0QA 1IAPA 4IE4A 1BR2A 4QXHB 3MJXA 2W2UA 2X0LB 4YTMA 5DQVA 4HE8A 3V5UA 3CWZB 2VKOA 2HPJA 3O9XA 1S94A 3RIAA 5LBQB 2V7IA 5JVDE 2UXBT 2ZMAA 3UUBA 2B76A 2BG9C 4QX7B 3PU8A 5L3GB 3VU7H
chains in the Genus database with same CATH topology
3OYZA 2DCFA 4GK5E 5ETWA 3AA0B 4PJJA 3FHNA 2KINB 4AKLA 4PJMA 2I59A 3P7IA 4TV8E 5CA1E 3EDUA 2JMKA 4H9OC 4HKAA 3V5SA 2H7OA 4AI6A 2H7VC 4ZI2D 2ACXA 4I50E 2QA7A 4AQFA 3A5XA 3KV5A 4PJNA 2P9BA 3KV4A 3CQXC 3NRXA 1MMNA 3AAAB 3OYXA 2K9AA 2JQQA 2C5IT 5EK4A 2KNDA 5HAXA 1T98A 2NOXA 5FXVA 4C90A 3MZKB 3MXZA 1O3XA 4MLKA 1MIYA 1QSDA 4EXTA 4ZI7E 4ZI2C 3CPZA 5FNVE 3UFEA 2MYSA 1HFAA 3PUSA 3ZCJA 4IE6A 4IIJE 4ANJA 2D0TA 4UEMA 5IHYA 1D1CA 3RKOA 3ZMZB 4DMVA 2LOSA 5JREA 4WNKA 1VRBA 3P8CD 3NZQA 3JC6C 3ZMUB 3Q9DA 3ZLIA 2MOZA 2NTYA 4YLHA 5FXXA 3C64A 5DABA 3AA7B 4GOUA 5HXCA 5KX5E 3ZPOA 3ESLA 3GN5A 3MA9A 3ZN1B 4O4HE 4O2BE 2E9XC 4DVDA 3BQLA 4UF0B 4EIWA 2B1EA 2JRKA 2XAJB 4ISTA 2JJ9A 3E08A 4BJNA 3N9NA 1BR1A 4UVBB 4PJLA 4X1KE 2CEAA 4N78D 3ZCIA 2DWKA 5L3FB 2MBGA 3HR0A 4HFVA 5JDHA 2PG8A 4PFPA 2X9YA 2WWUA 4TN7B 3LJCA 3N9PA 4IGUA 2CXLA 2DWGA 4WBNE 4L5GA 2PFVA 4M1PA 3AA6B 1D0XA 5JDMA 1Y64B 2X68A 3N9LA 2DHRA 2N2NA 1FMWA 3K3NA 4O4IE 3N9OA 2XUEA 4EZHA 2A2FX 5L3DB 1YD8G 3K8PC 4B6XA 1MIVA 3K3OA 1YW0A 4G63A 5H6RB 3AAIA 1D1BA 2YU2A 3KV9A 1LVKA 3ZMTB 3O1IA 5JH7E 1X79A 3N9MA 4YFSA 3LK2B 5EK3A 1MMGA 2DI4A 5FY1A 2WM9A 3LBXB 4IE0A 3O4XE 2CMRA 3QUJA 4BA9A 5LHGB 3NRYA 3C4WA 2VB6A 4PAGA 1H7CA 4EB6E 3H3AA 2M67A 3QC9A 3VU7H 5JDQA 3ANWB 5JR9B 1ZKEA 2ES0A 5JDNA 1D0ZA 3IBPA 4EZ4A 2N9DA 5KDMC 4U74A 3R84B 2EHOB 3CQCB 4I43B 3RC3A 4KP3C 4JUYA 4JEUB 3C4XA 2JMHA 2XAHB 5JDLA 3PUAA 5FXWA 4TZ4C 2CM0A 2UXXB 2XAFB 3IEEA 4WBOA 3MKDA 3PU3A 1D1AA 3ZMSB 4G2AA 1MNEA 2LM9A 5TAOA 2KXPB 5J2TE 5J1GA 1BR4A 5LOVE 3SRZA 2E9XB 5LGUB 2LSIA 3Q5XA 3KVBA 4A56A 2CE7A 2L8KA 2Q9QB 4E7ZA 5L3EB 2WAUA 3M65A 5LJMA 4PW8A 2LOPA 2N1GA 2X66A 4OK0A 4IE5A 2CA5A 3ETVA 3LG7A 3B57A 3NZPA 3F2EA 4JEHB 1ZV4X 4O2AE 3UTKA 5LGNB 3C98B 3WI3A 2EHOD 2XAQB 4E7SA 2LHNA 3ZYLA 3IF8B 1UCUA 4AQGA 5JRCB 4HTEA 2KT9A 2LT3A 4TUYE 1G8XA 4HGAA 2OA5A 3U78A 2CLYB 1WLXA 2K48A 5JR9C 3JC6D 3AVSA 2K5BB 2BVLA 1Z0PA 3PDYA 1ZHCA 2LHRA 5ADXL 5HWXA 1V9DA 5JDFA 1SA0E 4PNIA 3LK42 2C5KT 2EHOC 2C0SA 2XQYA 2ZM8A 2X67A 4PK5A 3ZJ2A 2E9XD 4H9QC 4XAXB 3N9QA 1FEWA 3ZN0B 1UX5A 2LSKA 5EZYE 5LHIB 1OWAA 3IHRA 1HCIA 3KBTA 1HG2A 1LRZA 4MBQA 5LGTB 3J7Yq 2VL8A 3W15B 2Q9QD 3ZC0A 2KZ7B 3ETUA 3QK6A 2D0UA 1UX4A 5A1LA 5JDGA 3C50A 3TKLB 4CI3B 3VKGA 4DMWA 3RC8A 3B13A 4L0RA 1MMAA 4EYUA 2LEHA 2W62A 5LA6E 2K24A 3KBUA 2Q9QC 5HXRA 5CA0E 5F3JA 2BVMA 2LE8A 3ZC1A 3L3PA 2LJLA 3O1JA 2CWYA 3AB3B 5FMNA 2VASA 1IZNB 2CCQA 1WYBA 3EVYA 2NW8A 2KMFA 2C5JA 4I55E 2LSJA 3MK7C 3KVAA 4UXNB 5HYAA 4Z8XA 4QXBB 1MIWA 3RYIE 4DNDA 3N5LA 4CI2B 5LHHB 3HKBE 2W63A 1WRDA 3ONXA 2CWOA 3RX6A 1SHZC 4DBQA 3D0TA 2CXDA 4AKIA 4PK6A 3ZJ1A 4MFRA 3CX7B 4ZS2A 2XHEB 3J9X1 2CLYC 1WR6A 3KINB 3PUGA 1YKHB 3BQIA 2VKHA 1D0YA 4ZI3D 4I4TE 2WSSV 3U3IA 5M4YA 2VWAA 3N2GE 2XASB 4GYSA 3I9WA 5LBMA 3F31A 3Q2MA 4HN9A 4OFZA 4YHJA 2CXFA 5LP6E 1NWMX 3VHLA 2GK9A 3RH3A 2XTLA 5EK2A 3HKEE 4FI5A 4ZI3C 2IAKA 4J2CA 3N2KE 4ILUA 4UVCB 3EDVA 4XZCA 1QUUA 2BZBA 3UT5E 4EOZB 2PBIA 2NW7A 2X9HA 4JLEA 3ZYMA 1CUNA 1HF8A 3LBXA 1IJ5A 2X51A 3I0OA 3PTRB 3LK3B 2HPLA 4PK4A 1HX8A 5CB4E 3E0ZA 4O4JE 4H63V 5JR9A 4MHCA 5GONE 4ZHQE 5FXZA 2DLRA 2IC6A 3HA4A 2L9QA 2EHOA 2IC9A 2Y6XA 3FBLA 2V26A 4QX8B 5DQWA 3I1AA 4NUUA 2IW5B 2JPFA 4AKRB 4KBMB 5HXEA 1US7B 4F6RC 3LFMA 3RYHE 3ZMVB 5IYZE 5LJNA 3T8OA 2WMOA 4PFOA 3F57A 4H9SE 3EUHA 2ZM2A 2W0GA 2NW9A 2V1DB 2E9XA 3BK9A 4YJ2E 4P09A 4P0AA 2V7MA 5JQGE 4TV9E 4AXPA 4QHOA 3PE0A 2DNXA 4AKHA 3WAJA 2Q9QA 2KLQA 3UULA 2X9WA 3UUXB 3MACA 4X20E 5LG4A 3E22E 4QKNA 4ZOLE 5J2UE 2BDEA 3L09A 5FYMA 2YK0A 3C4ZA 3AA1B 4IDZA 5DJQC 5LNKA 1OXZA 2D5UA 3C51A 5FY7A 2V7JA 3FXDB 5AFUL 4V1Av 3R6NA 3WAKA 4GK0E 2QGSA 5JRCA 2RP4A 3GA8A 1U5PA 3Q5WA 3ZYKA 4U72A 4X1YE 3GMIA 3FBZA 4KUMB 4NUVA 4CI1B 2KWHA 2VKJA 1ZEEA 4DO0A 2L3LA 3SS1A 2YINA 4XBFB 2WBLA 4H63H 4CQIA 3UUNA 3GWHA 2V7LA 3KFWX 2A3DA 3GN5B 4OHFA 1MMDA 1HTJF 1YKEB 2VKDA 5BMVE 4EYYR 2ZLYA 5LYJE 4CZZB 4TX5A 2Z6EA 3OBVE 5HXSA 1KNZA 2Y8DA 3KV6A 5L2LA 5FY0A 2XAGB 2X9XA 1S35A 3HL6A 1NAFA 2LSGA 1BR0A 4H9NC 4UF0A 4ZS3A 3RRWA 4X1IE 1E1HB 2W61A 3HKCE 1B7TA 2D2SA 1FIOA 1KK7A 2V7KA 4OYJA 3HKDE 2J1DG 2PJQA 4H9PC 3PURA 5L3CB 2LSYA 1EZ3A 2NP9A 2ODUA 3K3QC 5C8YE 4OYKA 5E0OA 4AQFC 4YJ3E 4O4LE 4CXWA 4UELA 5L3BB 4UV9B 4WW0A 3UUMA 5F8PA 3ZEFB 3O1HA 2G0UA 2Y48B 4K0UA 3BQKA 4H9RC 4IHJE 3AVRA 3PUQA 4QWNB 4ADZA 4UV8B 3OKQA 4QXCB 2WMNA 3I9YA 3RYFE 3CQGB 1MNDA 3CX6B 4IE7A 3RRCA 2E8IA 2W00A 3S4UA 2YEVC 4UIGA 2HH7A 4CXXA 4L9IA 3DP7A 2H3RA 5LCYA 4HEAA 1LKXA 5LXTE 4BJMA 3CMLA 4UVAB 1G73A 5HXHA 1AJ3A 3OJAA 2NTXA 4ERRA 3I0QA 1IAPA 4GIWA 2YU1A 1VOMA 4IE4A 4O8SA 3ANWA 1U4QA 5H6QB 1BR2A 4QXHB 3SWHA 3MJXA 3N2OA 3VKHA 3DTOA 4MALA 1HS7A 2X0LB 3FB2A 4FJOA 4KMCA 2VK9A 2UXNB 2A72A 4EAHA 2SPCA 5DQVA 4C91A 4GYRA 3NBXX 4HE8A 3HI2A 3V5UA 1WYCA 5KMGP 3CWZB 4AKGA 2VKOA 3CVRA 2HPJA 2MTQA 2ODVA 3DJBA 3O9XA 3RPUA 5FP3A 1IJ6A 1S94A 4DBRA 2ZM0A 1HG5A 1FMVA 3FXEB 4CXYA 5LBQB 5HWYA 2V7IA 3KDSE 5JVDE 3AAEB 4ISSA 3H37A 4ASKA 3CX8B 2ZMAA 2RA1A 2NWBA 4QX7B 4P0BA 3PU8A 3CKDA 5L3GB 4BAYB 3SOLA 1LVFA 3RYCE 2KWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1H B;  3K3Q C; 
#chains in the Genus database with same CATH topology
 4JBW F;  3AA0 B;  4PJJ A;  4AKL A;  1L0V A;  4PJM A;  2I59 A;  4TV8 E;  1GQE A;  3EDU A;  4H9O C;  4HKA A;  2H7O A;  4ZI2 D;  3CQX C;  2I0M A;  2K9A A;  2C5I T;  4AIS A;  2HN1 A;  3AE9 A;  3AEC A;  4COF A;  4ZEY A;  3CPZ A;  2VVS A;  2MYS A;  1HFA A;  3PUS A;  4ANJ A;  2CHN A;  3P4Q A;  3RKO A;  5AQG B;  1VRB A;  3P8C D;  3NZQ A;  2MOZ A;  1J5E T;  5DAB A;  5HXC A;  2YDR A;  4O4H E;  4DVD A;  3AED A;  3BQL A;  3PUY F;  2JRK A;  2XAJ B;  1W9R A;  4UVB B;  2PG8 A;  1HNW T;  3H3M A;  1WR0 A;  3LJC A;  4LMK A;  2CXL A;  2DWG A;  2PFV A;  2DHR A;  1J1J A;  1OED A;  2N2N A;  1W0B A;  2UU9 T;  3PJA J;  3K3O A;  3AAI A;  2FBW A;  4YFS A;  3N9M A;  1SUM B;  3AE6 A;  3A8Y C;  3QUJ A;  4BA9 A;  5LHG B;  3AEA A;  2VB6 A;  2WZI A;  4PAG A;  1H7C A;  5JDN A;  4U74 A;  3SFD A;  3RC3 A;  3CQC B;  4WZX A;  2XSB A;  3AE8 A;  4HWI B;  2CM0 A;  3PV0 F;  2UXX B;  2XAF B;  4WBO A;  3MKD A;  2H89 A;  4G2A A;  1MNE A;  2LM9 A;  3LDQ B;  5J1G A;  5LOV E;  4B3S T;  3SRZ A;  2E9X B;  4TWF A;  2QVA A;  2K3W A;  3TLW A;  5CFB A;  2CE7 A;  2FJA A;  2Q9Q B;  2LLY A;  2LOP A;  2N1G A;  3UQ7 A;  1XNQ T;  4OK0 A;  4Z90 A;  2R6G F;  2AE9 A;  2NR4 A;  5AQF B;  3OTO T;  3NZP A;  4LF7 T;  5LGN B;  3C98 B;  5JRC B;  4HTE A;  4TUY E;  4X62 T;  2K5B B;  1Z0P A;  5HWX A;  2LM2 A;  2XQY A;  3ZJ2 A;  2LSK A;  3UU8 A;  2IML A;  1HCI A;  2VL8 A;  5JDG A;  3ABV A;  4YSY A;  4DR7 T;  3VKG A;  2BKO A;  1QLB A;  2J47 A;  4YTP A;  1MMA A;  2LEH A;  5LA6 E;  4ZXL A;  5F3J A;  4DV7 T;  1N33 T;  5FMN A;  1IZN B;  2CCQ A;  2KMF A;  4I55 E;  4UXN B;  3Q5D A;  4QXB B;  2M6I A;  4DUZ T;  2YKS A;  3N5L A;  4CI2 B;  3HKB E;  2W63 A;  1WRD A;  2OLT A;  3UFG A;  4AKI A;  3ZJ1 A;  4MFR A;  3CX7 B;  4ZS2 A;  2W67 A;  3J9X 1;  2HN2 A;  3FZL B;  1YKH B;  1D0Y A;  5L4H A;  3U3I A;  3FZF B;  5LBM A;  3F31 A;  1IBL T;  4OFZ A;  1NWM X;  4DR3 T;  2GK9 A;  1M7K A;  2XTL A;  2VQF T;  4LF6 T;  3N2K E;  4UVC B;  5AQJ B;  1XDP A;  1QUU A;  3FZK B;  1OED E;  2BZB A;  1HF8 A;  3LBX A;  1IJ5 A;  3LK3 B;  2V8S V;  2HPL A;  2OV9 A;  4H63 V;  5JR9 A;  1UUR A;  2DLR A;  2EHO A;  2IC9 A;  2V26 A;  5HXE A;  2XPK A;  2WS3 A;  3LFM A;  3P4P A;  2BS4 A;  5IYZ E;  5LJN A;  3F57 A;  4H9S E;  2NW9 A;  5CJ5 A;  4P09 A;  4LF8 T;  2DNX A;  4AKH A;  3ZT5 A;  5LG4 A;  1OXZ A;  2D5U A;  5FL1 A;  5FY7 A;  4DID B;  2V7J A;  3Q5E A;  5FVL A;  4U72 A;  1I6Z A;  3GMI A;  5AQN B;  2VKJ A;  5ABG A;  2L3L A;  1HNX T;  1HTJ F;  2VKD A;  3AXJ A;  2BBJ A;  4EYY R;  2ZLY A;  2Z6E A;  2XJ7 A;  2WWV A;  5L2L A;  1S35 A;  1NAF A;  2LSG A;  1BR0 A;  3RQW A;  1E1H B;  4QH5 A;  1B7T A;  3QB5 K;  2D2S A;  1NEK A;  3HKD E;  3VRA A;  1OED B;  4AQF C;  4LF5 T;  4YJ3 E;  4CXW A;  5L3B B;  2LRK A;  3UUM A;  3O1H A;  2G0U A;  4A98 A;  2WU5 A;  3AVR A;  3PUQ A;  4QWN B;  4UV8 B;  3VR9 A;  4HFD A;  2WMN A;  3CX6 B;  2E8I A;  4YTN A;  4UIG A;  4CXX A;  5LCY A;  4HEA A;  1AJ3 A;  2XM2 A;  3QOF A;  4O8S A;  1VOM A;  5H6Q B;  2UXC T;  2A72 A;  1N36 T;  2SPC A;  2UXD T;  4AKG A;  3DJB A;  4EED A;  5FP3 A;  1IJ6 A;  1FMV A;  3NVO A;  4U7Y A;  1KF6 A;  3AAE B;  4CN4 A;  2RA1 A;  4NXM T;  4P0B A;  3SOL A;  2E5V A;  2KWI B;  3FHN A;  2KIN B;  2JQK A;  3P7I A;  1XDO A;  5CA1 E;  5HEO A;  2JMK A;  2ACX A;  2P9B A;  3KV4 A;  2E5L T;  2VL0 A;  2JQQ A;  5AQR B;  2NOX A;  3MXZ A;  3OPC A;  1QSD A;  4EXT A;  2A9U A;  4ZI2 C;  4IIJ E;  2XZE A;  4IL4 A;  4B3T T;  3ZMZ B;  5JRE A;  2LOS A;  2WY2 A;  3JC6 C;  3ZST A;  2CPT A;  3EAB A;  4GOU A;  3ZPO A;  2W66 A;  4U2Y A;  3ZN1 B;  2IUB A;  1XNR T;  2E9X C;  4UF0 B;  2B1E A;  2XQ5 A;  2VQE T;  3N9N A;  1BR1 A;  4N78 D;  5JDH A;  1IBM T;  2WWU A;  3TLU A;  4IGU A;  4WBN E;  5JDM A;  1Y64 B;  3N9L A;  3N9O A;  4B6X A;  1HR0 T;  1YW0 A;  1X79 A;  2XSA A;  2WM9 A;  3LBX B;  4IE0 A;  3O4X E;  2CMR A;  3NRY A;  4EB6 E;  3QC9 A;  2CBJ A;  5JR9 B;  4GKJ T;  4LFB T;  3R84 B;  2EHO B;  4I43 B;  4JUY A;  3ZT6 A;  1T7S A;  3P4S A;  5JDL A;  4IDO A;  3PU3 A;  2KXP B;  5J2T E;  3TLV A;  2LSI A;  2L8K A;  4PW8 A;  2X66 A;  2FJB A;  3ETV A;  3JAF A;  4O2A E;  3UTK A;  3WI3 A;  2I6H A;  3ZYL A;  4AQG A;  2KT9 A;  3RHW A;  2CLY B;  1WLX A;  1KEY A;  3JC6 D;  1ZHC A;  2LHR A;  4PNI A;  2C0S A;  2X67 A;  4PK5 A;  2E9X D;  4H9Q C;  4XAX B;  3N9Q A;  1N32 T;  3AXJ B;  1OWA A;  2Q9Q D;  3ZC0 A;  3QK6 A;  4CI3 B;  4DMW A;  3RC8 A;  4JI5 T;  1XMQ T;  1XWM A;  2FUP A;  4HWC A;  4L0R A;  4LMJ A;  2W62 A;  5CA0 E;  3AE4 A;  3L3P A;  2LJL A;  3O1J A;  2CWY A;  3AB3 B;  4YXD A;  2WCA A;  2IDO B;  4JI6 T;  2LSJ A;  3MK7 C;  1MIW A;  3RYI E;  4DND A;  3ONX A;  2CWO A;  2CXD A;  2XHE B;  3PUG A;  3BQI A;  4ZI3 D;  5AQT B;  2VWA A;  2XAS B;  4YT0 A;  3I9W A;  3Q2M A;  4TWD A;  5EK2 A;  3HKE E;  4FI5 A;  2IAK A;  4J2C A;  4ILU A;  2V6X A;  4XZC A;  2PBI A;  4HFH A;  1CUN A;  4LF9 T;  2BG9 E;  1KNP A;  5GON E;  4ZHQ E;  2RPA A;  2BBH A;  2L9Q A;  2YN6 A;  2QRX A;  4NUU A;  3NWI A;  2JPF A;  4KBM B;  3RGL A;  4DR2 T;  4F6R C;  3CIR A;  3ZMV B;  1OED C;  3T8O A;  2WMO A;  4PFO A;  1WFD A;  2W0G A;  2V1D B;  5LMN T;  4QHO A;  3CK6 A;  4NPP A;  3LSV A;  1W0A A;  3UUL A;  4DR1 T;  2MPK A;  3JAD A;  4QKN A;  4ZOL E;  5J2U E;  5FYM A;  4HFI A;  4IDZ A;  3AE2 A;  4A5X A;  3FXD B;  1UUS A;  4V1A v;  2CBI A;  3WAK A;  5KXJ A;  3GA8 A;  1KNR A;  1U5P A;  3Q5W A;  4KUM B;  4CI1 B;  2UUA T;  4IT4 A;  4CQI A;  3UUN A;  3GWH A;  3KFW X;  3FZH B;  1CHU A;  1XMO T;  1YKE B;  5BMV E;  4Q25 A;  2M6B A;  4TX5 A;  3OBV E;  4LML A;  2H88 A;  2XAG B;  2X9X A;  5ABH A;  3HL6 A;  4UF0 A;  3RIU C;  5IWA T;  1FIO A;  4OYJ A;  2J1D G;  2PJQ A;  4H9P C;  5L3C B;  3K3Q C;  5E0O A;  4UEL A;  3ZEF B;  5L47 A;  3OVU A;  4IHJ E;  2AXD S;  4ADZ A;  2JQH A;  4U33 A;  3I9Y A;  4CN6 A;  3CQG B;  3RRC A;  3NKZ A;  2YEV C;  3DP7 A;  1LKX A;  4BJM A;  3CML A;  5HXH A;  3TLS A;  2XY8 B;  3SWH A;  3RQU A;  3N2O A;  2QYW A;  3DTO A;  1HS7 A;  2VK9 A;  4HFB A;  2J4G A;  5F5W A;  1WYC A;  5KMG P;  3CVR A;  2ODV A;  2UUB T;  4DBR A;  1N34 T;  3X1D A;  5J0Z A;  2ZM0 A;  5IUX A;  4ISS A;  3H37 A;  4ASK A;  2BS3 A;  3CKD A;  4BAY B;  3RYC E;  4CN1 A;  2DCF A;  4GK5 E;  5ETW A;  3PUZ F;  4B3R T;  4JI8 T;  4AI6 A;  2QA7 A;  4AQF A;  3A5X A;  3NRX A;  1MMN A;  2LKH A;  5EK4 A;  1T98 A;  5FXV A;  5BR8 T;  3MZK B;  1O3X A;  1MIY A;  4ZI7 E;  4IE6 A;  2D0T A;  4UEM A;  5IHY A;  1D1C A;  4DMV A;  3Q9D A;  3ZLI A;  2NTY A;  5FXX A;  3AA7 B;  3UU3 A;  4O2B E;  2HHH T;  2JJ9 A;  3E08 A;  2MBG A;  3HR0 A;  4HFV A;  4TN7 B;  3N9P A;  4IDQ A;  1YQ4 A;  4O4I E;  3K3N A;  2XUE A;  4EZH A;  2YDQ A;  1YD8 G;  5ABF A;  2KSR A;  1D1B A;  4B3M T;  3LK2 B;  5EK3 A;  1MMG A;  5FY1 A;  4ZZB A;  3EHZ A;  3RIF A;  5FVK A;  5HEG A;  5JDQ A;  3ANW B;  1ZKE A;  2ES0 A;  4EZ4 A;  2N9D A;  5KDM C;  2FJD A;  4JEU B;  2WDQ A;  3P4R A;  3PUA A;  4TZ4 C;  3IEE A;  1D1A A;  1E7P A;  2BS2 A;  4HWH A;  5LGU B;  3Q5X A;  4A56 A;  4E7Z A;  5L3E B;  4IE5 A;  4QH4 A;  4U7I A;  3LG7 A;  5AQM B;  2E2A A;  4JEH B;  4NIQ A;  2EHO D;  2XAQ B;  3AE7 A;  4E7S A;  2LHN A;  3IF8 B;  2LT3 A;  1G8X A;  1VCS A;  1M62 A;  2K48 A;  3ONJ A;  3AVS A;  3PDY A;  5ADX L;  1V9D A;  5LMU T;  1SA0 E;  4KHZ F;  2ZM8 A;  4AQY T;  1FEW A;  3ZN0 B;  1UX5 A;  1W09 A;  3J7Y q;  2ACZ A;  2DL1 A;  5AQH B;  2D0U A;  1UX4 A;  5A1L A;  3IA3 A;  4JI7 T;  2CRB A;  3B13 A;  4EYU A;  2K24 A;  3KBU A;  2Q9Q C;  3ZC1 A;  2VAS A;  1WYB A;  4LFA T;  5C2T A;  5HYA A;  3EAM A;  5AQS B;  4DBQ A;  3RX6 A;  1SHZ C;  2IIU A;  4PK6 A;  4LF4 T;  3SFE A;  2WDV A;  1WR6 A;  2VKH A;  4I4T E;  2WSS V;  2BG9 A;  5M4Y A;  3N2G E;  1HNZ T;  4HN9 A;  2CXF A;  5LP6 E;  3VHL A;  3RH3 A;  2UUC T;  3P50 A;  4ZI3 C;  2BKN A;  3EDV A;  3UT5 E;  2X0Y A;  3K1S A;  2X9H A;  2X51 A;  3I0O A;  3PTR B;  4MHC A;  3RI5 A;  2IC6 A;  2X0H A;  2Y6X A;  4DR6 T;  3AEF A;  3UQ4 A;  4KI0 F;  3I1A A;  4K0K T;  1US7 B;  3A7M A;  4JI0 T;  2V5D A;  4U3C A;  3BK9 A;  2JIW A;  3G06 A;  2V7M A;  4TV9 E;  1ZP0 A;  3PE0 A;  3WAJ A;  4DV2 T;  4OX9 T;  2X9W A;  4F8H A;  3MAC A;  4X20 E;  5HCJ A;  3E22 E;  2PTF A;  3UU4 A;  3L09 A;  4KX6 A;  2YK0 A;  3AA1 B;  5LNK A;  2XQ9 A;  4GK0 E;  5AQP B;  2RP4 A;  4DV6 T;  3ZYK A;  5HEH A;  4X1Y E;  3FBZ A;  2YOE A;  1VCT A;  3SS1 A;  4H63 H;  2V7L A;  1MMD A;  5LYJ E;  4CZZ B;  4I0U A;  3AEB A;  3KV6 A;  4X65 T;  4DV3 T;  1YQ3 A;  4H9N C;  3RRW A;  2W61 A;  3HKC E;  5HEU A;  2WDR A;  1KK7 A;  2V7K A;  3PUR A;  2LSY A;  2NP9 A;  5C8Y E;  4OYK A;  5ABF B;  4O4L E;  4UV9 B;  3ZT7 A;  5JTG A;  2XQ3 A;  4DV5 T;  1SE7 A;  3OKQ A;  4QXC B;  3RYF E;  4EV6 A;  2W00 A;  2HH7 A;  4IL9 A;  2ZM6 T;  3L8R A;  4HFE A;  3JCF A;  1G73 A;  4DR5 T;  3OJA A;  2NTX A;  4ERR A;  3UU6 A;  4GIW A;  2YU1 A;  3VKH A;  3ANW A;  1U4Q A;  4MAL A;  3FB2 A;  4FJO A;  4KMC A;  4TWH A;  2UXN B;  4AIU A;  4EAH A;  4C91 A;  4GYR A;  3NBX X;  1UK5 A;  2D9D A;  3HI2 A;  2MTQ A;  3RPU A;  4HWD A;  1HG5 A;  3FXE B;  4CXY A;  5HWY A;  4IDP A;  5C3J A;  3KDS E;  4P1N A;  3JAE A;  3QB5 A;  3CX8 B;  1JNZ A;  2NWB A;  2WB5 A;  1LVF A;  3ZMT B;  2V6Y B;  3OYZ A;  2V5C A;  3QNU A;  1I94 T;  3RIU A;  5CGM A;  2LRL A;  4EEB A;  3V5S A;  2H7V C;  4I50 E;  3KV5 A;  4PJN A;  4U2Z A;  3AAA B;  3OYX A;  5HAX A;  4X66 T;  2KND A;  4JYA T;  5LB7 B;  4C90 A;  2LKG A;  4MLK A;  5FNV E;  3UFE A;  1E2A A;  3ZCJ A;  2XQ6 A;  5AQO B;  5L4E A;  4WNK A;  3ZMU B;  1Z8U A;  4YLH A;  3C64 A;  5KX5 E;  4JI4 T;  3ESL A;  3GN5 A;  3MA9 A;  4EIW A;  4IST A;  4X5T A;  4BJN A;  2YDS A;  4PJL A;  4X1K E;  2CEA A;  3ZCI A;  2DWK A;  5L3F B;  4PFP A;  2X9Y A;  4LFC T;  4L5G A;  2BG9 B;  4M1P A;  3AA6 B;  1D0X A;  2X68 A;  2JQ9 A;  1FMW A;  4YSZ A;  2A2F X;  5L3D B;  1DU2 A;  3K8P C;  1MIV A;  4G63 A;  5H6R B;  2YU2 A;  3KV9 A;  1LVK A;  2XQ4 A;  3O1I A;  5JH7 E;  3AE3 A;  2DI4 A;  3ZSS A;  4ILA A;  3VR8 A;  3C4W A;  4YSX A;  4TNW A;  3H3A A;  2M67 A;  2J62 A;  1D0Z A;  2XQ8 A;  3IBP A;  5HCM A;  3RKG A;  4YY3 T;  2FJE A;  2BKP A;  1KFY A;  4KP3 C;  2WU2 A;  3C4X A;  1HX1 B;  2JMH A;  2XAH B;  3RLF F;  5FXW A;  1IBK T;  2XM1 A;  3ZMS B;  5TAO A;  1BR4 A;  5AQK B;  3PUX F;  3EI0 A;  3KVB A;  4JI1 T;  5FL0 A;  2WAU A;  3M65 A;  5LJM A;  2XQA A;  2CA5 A;  3B57 A;  4X64 T;  5AQQ B;  5AQV B;  3F2E A;  3VRB A;  3P4W A;  1ZV4 X;  4DR4 T;  4IRE A;  1T8B A;  1UCU A;  3M3Z B;  1T72 A;  4HGA A;  3T1H T;  4JI3 T;  2OA5 A;  3U78 A;  4UR9 A;  5JR9 C;  2MAW A;  2BVL A;  4U31 A;  4ILC A;  1NEN A;  5JDF A;  2XQ7 A;  3LK4 2;  2C5K T;  2EHO C;  4GKK T;  5EZY E;  5LHI B;  3IHR A;  1R8I A;  3KBT A;  1HG2 A;  1LRZ A;  4MBQ A;  4A97 A;  5LGT B;  1FJG T;  3W15 B;  2KZ7 B;  3ETU A;  4JV5 T;  3C50 A;  3PUV F;  3B5M A;  3TKL B;  5HXR A;  2BVM A;  2LE8 A;  1J5W A;  1UGO A;  5LG3 A;  3EVY A;  2NW8 A;  2CHO A;  5FKY A;  3FZM B;  4DV1 T;  3PJA A;  2C5J A;  3KVA A;  4Z8X A;  5LHH B;  3D0T A;  4QH1 A;  3ZKR A;  4WYV A;  2CLY C;  3KIN B;  2WZH A;  5AQU B;  4GYS A;  4ZZC A;  2VVN A;  5ABE A;  4YHJ A;  1ZOY A;  3AEG A;  3ONL C;  1WCR A;  3RF1 A;  4EOZ B;  4IDN A;  2NW7 A;  3AEE A;  4JLE A;  3ZYM A;  4PK4 A;  1HX8 A;  5CB4 E;  3E0Z A;  4HFC A;  4O4J E;  3L39 A;  5FXZ A;  3HA4 A;  4JI2 T;  3UU5 A;  2F4V T;  3FBL A;  4QX8 B;  5DQW A;  1Y01 A;  1YXR A;  2IW5 B;  4AKR B;  2IHR 1;  3RYH E;  4Z91 A;  3T1Y T;  2W4X A;  3EUH A;  2ZM2 A;  4YHH T;  2WQY A;  2E9X A;  4YJ2 E;  4P0A A;  5JQG E;  3AE5 A;  4TNV A;  4HWF A;  4AXP A;  2Q9Q A;  2V6Y A;  2KLQ A;  3UUX B;  2BDE A;  3C4Z A;  4EGW A;  5DJQ C;  3C51 A;  4KHP T;  5AFU L;  4NXN T;  5HEJ A;  3R6N A;  2VUR A;  2QGS A;  5JRC A;  2WP9 A;  1XZY A;  4ILB A;  4NUV A;  2KWH A;  3TLT A;  1ZEE A;  4DO0 A;  4DV0 T;  4DV4 T;  2YIN A;  4XBF B;  2WBL A;  2A3D A;  3GN5 B;  4OHF A;  5AQI B;  5HXS A;  1KNZ A;  2Y8D A;  5FY0 A;  4ZS3 A;  4X1I E;  4DUY T;  2ODU A;  1EZ3 A;  3AE1 A;  4WW0 A;  5AQL B;  5F8P A;  2Y48 B;  4K0U A;  3BQK A;  1JNR A;  4H9R C;  1X9B A;  4IE7 A;  1MND A;  3S4U A;  4L9I A;  2H3R A;  5LXT E;  4UVA B;  3PUW F;  3I0Q A;  1IAP A;  4IE4 A;  1BR2 A;  4QXH B;  3MJX A;  2W2U A;  2X0L B;  4YTM A;  5DQV A;  4HE8 A;  3V5U A;  3CWZ B;  2VKO A;  2HPJ A;  3O9X A;  1S94 A;  3RIA A;  5LBQ B;  2V7I A;  5JVD E;  2UXB T;  2ZMA A;  3UUB A;  2B76 A;  2BG9 C;  4QX7 B;  3PU8 A;  5L3G B;  3VU7 H; 
#chains in the Genus database with same CATH homology
 3OYZ A;  2DCF A;  4GK5 E;  5ETW A;  3AA0 B;  4PJJ A;  3FHN A;  2KIN B;  4AKL A;  4PJM A;  2I59 A;  3P7I A;  4TV8 E;  5CA1 E;  3EDU A;  2JMK A;  4H9O C;  4HKA A;  3V5S A;  2H7O A;  4AI6 A;  2H7V C;  4ZI2 D;  2ACX A;  4I50 E;  2QA7 A;  4AQF A;  3A5X A;  3KV5 A;  4PJN A;  2P9B A;  3KV4 A;  3CQX C;  3NRX A;  1MMN A;  3AAA B;  3OYX A;  2K9A A;  2JQQ A;  2C5I T;  5EK4 A;  2KND A;  5HAX A;  1T98 A;  2NOX A;  5FXV A;  4C90 A;  3MZK B;  3MXZ A;  1O3X A;  4MLK A;  1MIY A;  1QSD A;  4EXT A;  4ZI7 E;  4ZI2 C;  3CPZ A;  5FNV E;  3UFE A;  2MYS A;  1HFA A;  3PUS A;  3ZCJ A;  4IE6 A;  4IIJ E;  4ANJ A;  2D0T A;  4UEM A;  5IHY A;  1D1C A;  3RKO A;  3ZMZ B;  4DMV A;  2LOS A;  5JRE A;  4WNK A;  1VRB A;  3P8C D;  3NZQ A;  3JC6 C;  3ZMU B;  3Q9D A;  3ZLI A;  2MOZ A;  2NTY A;  4YLH A;  5FXX A;  3C64 A;  5DAB A;  3AA7 B;  4GOU A;  5HXC A;  5KX5 E;  3ZPO A;  3ESL A;  3GN5 A;  3MA9 A;  3ZN1 B;  4O4H E;  4O2B E;  2E9X C;  4DVD A;  3BQL A;  4UF0 B;  4EIW A;  2B1E A;  2JRK A;  2XAJ B;  4IST A;  2JJ9 A;  3E08 A;  4BJN A;  3N9N A;  1BR1 A;  4UVB B;  4PJL A;  4X1K E;  2CEA A;  4N78 D;  3ZCI A;  2DWK A;  5L3F B;  2MBG A;  3HR0 A;  4HFV A;  5JDH A;  2PG8 A;  4PFP A;  2X9Y A;  2WWU A;  4TN7 B;  3LJC A;  3N9P A;  4IGU A;  2CXL A;  2DWG A;  4WBN E;  4L5G A;  2PFV A;  4M1P A;  3AA6 B;  1D0X A;  5JDM A;  1Y64 B;  2X68 A;  3N9L A;  2DHR A;  2N2N A;  1FMW A;  3K3N A;  4O4I E;  3N9O A;  2XUE A;  4EZH A;  2A2F X;  5L3D B;  1YD8 G;  3K8P C;  4B6X A;  1MIV A;  3K3O A;  1YW0 A;  4G63 A;  5H6R B;  3AAI A;  1D1B A;  2YU2 A;  3KV9 A;  1LVK A;  3ZMT B;  3O1I A;  5JH7 E;  1X79 A;  3N9M A;  4YFS A;  3LK2 B;  5EK3 A;  1MMG A;  2DI4 A;  5FY1 A;  2WM9 A;  3LBX B;  4IE0 A;  3O4X E;  2CMR A;  3QUJ A;  4BA9 A;  5LHG B;  3NRY A;  3C4W A;  2VB6 A;  4PAG A;  1H7C A;  4EB6 E;  3H3A A;  2M67 A;  3QC9 A;  3VU7 H;  5JDQ A;  3ANW B;  5JR9 B;  1ZKE A;  2ES0 A;  5JDN A;  1D0Z A;  3IBP A;  4EZ4 A;  2N9D A;  5KDM C;  4U74 A;  3R84 B;  2EHO B;  3CQC B;  4I43 B;  3RC3 A;  4KP3 C;  4JUY A;  4JEU B;  3C4X A;  2JMH A;  2XAH B;  5JDL A;  3PUA A;  5FXW A;  4TZ4 C;  2CM0 A;  2UXX B;  2XAF B;  3IEE A;  4WBO A;  3MKD A;  3PU3 A;  1D1A A;  3ZMS B;  4G2A A;  1MNE A;  2LM9 A;  5TAO A;  2KXP B;  5J2T E;  5J1G A;  1BR4 A;  5LOV E;  3SRZ A;  2E9X B;  5LGU B;  2LSI A;  3Q5X A;  3KVB A;  4A56 A;  2CE7 A;  2L8K A;  2Q9Q B;  4E7Z A;  5L3E B;  2WAU A;  3M65 A;  5LJM A;  4PW8 A;  2LOP A;  2N1G A;  2X66 A;  4OK0 A;  4IE5 A;  2CA5 A;  3ETV A;  3LG7 A;  3B57 A;  3NZP A;  3F2E A;  4JEH B;  1ZV4 X;  4O2A E;  3UTK A;  5LGN B;  3C98 B;  3WI3 A;  2EHO D;  2XAQ B;  4E7S A;  2LHN A;  3ZYL A;  3IF8 B;  1UCU A;  4AQG A;  5JRC B;  4HTE A;  2KT9 A;  2LT3 A;  4TUY E;  1G8X A;  4HGA A;  2OA5 A;  3U78 A;  2CLY B;  1WLX A;  2K48 A;  5JR9 C;  3JC6 D;  3AVS A;  2K5B B;  2BVL A;  1Z0P A;  3PDY A;  1ZHC A;  2LHR A;  5ADX L;  5HWX A;  1V9D A;  5JDF A;  1SA0 E;  4PNI A;  3LK4 2;  2C5K T;  2EHO C;  2C0S A;  2XQY A;  2ZM8 A;  2X67 A;  4PK5 A;  3ZJ2 A;  2E9X D;  4H9Q C;  4XAX B;  3N9Q A;  1FEW A;  3ZN0 B;  1UX5 A;  2LSK A;  5EZY E;  5LHI B;  1OWA A;  3IHR A;  1HCI A;  3KBT A;  1HG2 A;  1LRZ A;  4MBQ A;  5LGT B;  3J7Y q;  2VL8 A;  3W15 B;  2Q9Q D;  3ZC0 A;  2KZ7 B;  3ETU A;  3QK6 A;  2D0U A;  1UX4 A;  5A1L A;  5JDG A;  3C50 A;  3TKL B;  4CI3 B;  3VKG A;  4DMW A;  3RC8 A;  3B13 A;  4L0R A;  1MMA A;  4EYU A;  2LEH A;  2W62 A;  5LA6 E;  2K24 A;  3KBU A;  2Q9Q C;  5HXR A;  5CA0 E;  5F3J A;  2BVM A;  2LE8 A;  3ZC1 A;  3L3P A;  2LJL A;  3O1J A;  2CWY A;  3AB3 B;  5FMN A;  2VAS A;  1IZN B;  2CCQ A;  1WYB A;  3EVY A;  2NW8 A;  2KMF A;  2C5J A;  4I55 E;  2LSJ A;  3MK7 C;  3KVA A;  4UXN B;  5HYA A;  4Z8X A;  4QXB B;  1MIW A;  3RYI E;  4DND A;  3N5L A;  4CI2 B;  5LHH B;  3HKB E;  2W63 A;  1WRD A;  3ONX A;  2CWO A;  3RX6 A;  1SHZ C;  4DBQ A;  3D0T A;  2CXD A;  4AKI A;  4PK6 A;  3ZJ1 A;  4MFR A;  3CX7 B;  4ZS2 A;  2XHE B;  3J9X 1;  2CLY C;  1WR6 A;  3KIN B;  3PUG A;  1YKH B;  3BQI A;  2VKH A;  1D0Y A;  4ZI3 D;  4I4T E;  2WSS V;  3U3I A;  5M4Y A;  2VWA A;  3N2G E;  2XAS B;  4GYS A;  3I9W A;  5LBM A;  3F31 A;  3Q2M A;  4HN9 A;  4OFZ A;  4YHJ A;  2CXF A;  5LP6 E;  1NWM X;  3VHL A;  2GK9 A;  3RH3 A;  2XTL A;  5EK2 A;  3HKE E;  4FI5 A;  4ZI3 C;  2IAK A;  4J2C A;  3N2K E;  4ILU A;  4UVC B;  3EDV A;  4XZC A;  1QUU A;  2BZB A;  3UT5 E;  4EOZ B;  2PBI A;  2NW7 A;  2X9H A;  4JLE A;  3ZYM A;  1CUN A;  1HF8 A;  3LBX A;  1IJ5 A;  2X51 A;  3I0O A;  3PTR B;  3LK3 B;  2HPL A;  4PK4 A;  1HX8 A;  5CB4 E;  3E0Z A;  4O4J E;  4H63 V;  5JR9 A;  4MHC A;  5GON E;  4ZHQ E;  5FXZ A;  2DLR A;  2IC6 A;  3HA4 A;  2L9Q A;  2EHO A;  2IC9 A;  2Y6X A;  3FBL A;  2V26 A;  4QX8 B;  5DQW A;  3I1A A;  4NUU A;  2IW5 B;  2JPF A;  4AKR B;  4KBM B;  5HXE A;  1US7 B;  4F6R C;  3LFM A;  3RYH E;  3ZMV B;  5IYZ E;  5LJN A;  3T8O A;  2WMO A;  4PFO A;  3F57 A;  4H9S E;  3EUH A;  2ZM2 A;  2W0G A;  2NW9 A;  2V1D B;  2E9X A;  3BK9 A;  4YJ2 E;  4P09 A;  4P0A A;  2V7M A;  5JQG E;  4TV9 E;  4AXP A;  4QHO A;  3PE0 A;  2DNX A;  4AKH A;  3WAJ A;  2Q9Q A;  2KLQ A;  3UUL A;  2X9W A;  3UUX B;  3MAC A;  4X20 E;  5LG4 A;  3E22 E;  4QKN A;  4ZOL E;  5J2U E;  2BDE A;  3L09 A;  5FYM A;  2YK0 A;  3C4Z A;  3AA1 B;  4IDZ A;  5DJQ C;  5LNK A;  1OXZ A;  2D5U A;  3C51 A;  5FY7 A;  2V7J A;  3FXD B;  5AFU L;  4V1A v;  3R6N A;  3WAK A;  4GK0 E;  2QGS A;  5JRC A;  2RP4 A;  3GA8 A;  1U5P A;  3Q5W A;  3ZYK A;  4U72 A;  4X1Y E;  3GMI A;  3FBZ A;  4KUM B;  4NUV A;  4CI1 B;  2KWH A;  2VKJ A;  1ZEE A;  4DO0 A;  2L3L A;  3SS1 A;  2YIN A;  4XBF B;  2WBL A;  4H63 H;  4CQI A;  3UUN A;  3GWH A;  2V7L A;  3KFW X;  2A3D A;  3GN5 B;  4OHF A;  1MMD A;  1HTJ F;  1YKE B;  2VKD A;  5BMV E;  4EYY R;  2ZLY A;  5LYJ E;  4CZZ B;  4TX5 A;  2Z6E A;  3OBV E;  5HXS A;  1KNZ A;  2Y8D A;  3KV6 A;  5L2L A;  5FY0 A;  2XAG B;  2X9X A;  1S35 A;  3HL6 A;  1NAF A;  2LSG A;  1BR0 A;  4H9N C;  4UF0 A;  4ZS3 A;  3RRW A;  4X1I E;  1E1H B;  2W61 A;  3HKC E;  1B7T A;  2D2S A;  1FIO A;  1KK7 A;  2V7K A;  4OYJ A;  3HKD E;  2J1D G;  2PJQ A;  4H9P C;  3PUR A;  5L3C B;  2LSY A;  1EZ3 A;  2NP9 A;  2ODU A;  3K3Q C;  5C8Y E;  4OYK A;  5E0O A;  4AQF C;  4YJ3 E;  4O4L E;  4CXW A;  4UEL A;  5L3B B;  4UV9 B;  4WW0 A;  3UUM A;  5F8P A;  3ZEF B;  3O1H A;  2G0U A;  2Y48 B;  4K0U A;  3BQK A;  4H9R C;  4IHJ E;  3AVR A;  3PUQ A;  4QWN B;  4ADZ A;  4UV8 B;  3OKQ A;  4QXC B;  2WMN A;  3I9Y A;  3RYF E;  3CQG B;  1MND A;  3CX6 B;  4IE7 A;  3RRC A;  2E8I A;  2W00 A;  3S4U A;  2YEV C;  4UIG A;  2HH7 A;  4CXX A;  4L9I A;  3DP7 A;  2H3R A;  5LCY A;  4HEA A;  1LKX A;  5LXT E;  4BJM A;  3CML A;  4UVA B;  1G73 A;  5HXH A;  1AJ3 A;  3OJA A;  2NTX A;  4ERR A;  3I0Q A;  1IAP A;  4GIW A;  2YU1 A;  1VOM A;  4IE4 A;  4O8S A;  3ANW A;  1U4Q A;  5H6Q B;  1BR2 A;  4QXH B;  3SWH A;  3MJX A;  3N2O A;  3VKH A;  3DTO A;  4MAL A;  1HS7 A;  2X0L B;  3FB2 A;  4FJO A;  4KMC A;  2VK9 A;  2UXN B;  2A72 A;  4EAH A;  2SPC A;  5DQV A;  4C91 A;  4GYR A;  3NBX X;  4HE8 A;  3HI2 A;  3V5U A;  1WYC A;  5KMG P;  3CWZ B;  4AKG A;  2VKO A;  3CVR A;  2HPJ A;  2MTQ A;  2ODV A;  3DJB A;  3O9X A;  3RPU A;  5FP3 A;  1IJ6 A;  1S94 A;  4DBR A;  2ZM0 A;  1HG5 A;  1FMV A;  3FXE B;  4CXY A;  5LBQ B;  5HWY A;  2V7I A;  3KDS E;  5JVD E;  3AAE B;  4ISS A;  3H37 A;  4ASK A;  3CX8 B;  2ZMA A;  2RA1 A;  2NWB A;  4QX7 B;  4P0B A;  3PU8 A;  3CKD A;  5L3G B;  4BAY B;  3SOL A;  1LVF A;  3RYC E;  2KWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...