3K3VA

Crystal structure the gyf domain of s. cerevisiae smy2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
ESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SMY2
total genus 24
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3k3vA00
1WH2A 3FMAA 1GYFA 4BWSC 1SYXB 3K3VA 1L2ZA
chains in the Genus database with same CATH superfamily
2VQEH 2BQRA 5FLXW 4JV1A 2W9BB 1K1SA 5KX5F 4AYBE 4B3MH 5KFBA 5EDWA 1EUDB 4A2BA 2VQFH 1BNCA 2FKLA 2JA6A 2DLNA 4QW8A 1V9PA 4R8UA 2XCAA 1T3NA 5DLFA 1UNNC 4PWQA 3Q8PB 3MJFA 4YHHH 3TIIA 2WAQA 4DUYH 4ED1A 3HBLA 4I7HA 2R93G 3PR5B 2UVVA 2FLNA 5LMUH 2QYZA 4A3MG 3JZIA 5IYBG 5F9NA 4LFCH 4ZQIA 2J9GA 3HOUG 5FD6A 1JDBB 3MWEA 1KJJA 4UCOA 4RUCA 1K83A 1HNWH 2MCTA 3J7AK 5KT5A 1TAEA 2FMAA 4FS1A 4AYBA 3RAQA 3JRXA 5CA1F 4YB8B 1S10A 2ZDQA 4WD3A 3ORRA 1CE8A 4RB2C 2C2EA 5C1OA 3LP8A 4EEQA 1E4FT 3PW0A 2JA5G 2R92G 4RB3C 4DV4H 3WNZA 3GIKA 4O3SA 3HOVG 4MTDA 3KHGA 1L2ZA 4I4TF 3OSPA 2UXBH 3GV5B 5EZYF 1SEIA 2J6SA 2CW8A 1W96A 4JV2A 2E2HA 1Y1WA 3JRWA 2O03A 4ECXA 4O4HF 5A2QW 4QJFA 3HKZA 5C44G 3V4ZA 3U9TA 1B6RA 4F4WA 3U9SA 4DV1H 1EZ1A 2I87A 4LF7H 2YW2A 2C28A 5DGBA 1AUXA 4XZ3B 2B63G 2OWOA 4Q0YA 2R92A 4O2AF 4ECZA 2PN1A 2IBKA 1N48A 1Y1VG 1K1QA 1B6SA 1BJTA 1CQJB 1O75A 3KAKA 2HVSA 1MZBA 4X65H 1E4EB 1S0OA 5KFJA 1OWTA 4K0KH 4YAKB 1EYZA 2PBZA 3M9NB 2R82A 2W6NA 3PW4A 3HB9A 4JUZA 1V51A 2W9CB 3SI8A 1JKJB 2YRWA 2W7PA 1HNXH 3N41B 1VKZA 3BABA 5KT6A 5KFHA 2YZGA 3Q1KA 3I4NG 4QWBA 3EYYA 5KFFA 4MV1A 1TWFA 2R84A 1WCMG 3F8NA 3IG0A 3MWMA 4HNVA 4LH7A 2W9AA 4IZOA 2JEGA 3ETJA 4EFEA 2JA6G 2YZMA 3GLKA 1JIHA 2AGOA 4O3RA 2FJZA 1XNRH 3M9OB 2F4VH 4EBDA 3N40P 2WB1A 4DR6H 5C1PA 5DG8A 1J5EH 2R8IA 1N32H 4MV9A 4QWCA 4DL2A 4DV5H 2JEIA 1HNZH 2CZGA 1RYSA 2AGPA 1CS0A 3PO2G 2WB1E 3E5NA 5KFGA 1ZHQA 2Q2TA 2QK4A 3RB4A 3HOWG 2R7ZA 1CQIB 4O4IF 2C2RA 4RNNA 4IHJF 1RYRA 1KC7A 3RB6A 2RGRA 3G6XA 4YBZB 4FM9A 4F50A 1V4YA 2VA2A 1N36H 3TQ1A 2FLPA 4FS2A 1GGOA 4IRKA 4LF4H 4FU0A 1ULZA 2JA7G 5DLGA 4JI3H 2PMZE 1IOWA 2WE6A 5DGAA 1N34H 5IP7G 3BQ1A 3QZ8A 3PZPA 2NU6B 2VUMA 3K5IA 2YS7A 3PW7A 3PW2A 2JEJA 1KJ8A 1GSAA 2WDTA 3G6YA 2ASLA 2WAQE 4E4TA 4R8UB 4ECRA 4DR1H 2R7NA 4A93G 2C35B 5FLMG 5KFPA 2ASDA 4ECVA 4X64H 3N8DA 2ZM6H 4DL7A 4NXMH 3RB0A 4A3KG 5LYJF 4RNOA 1Y1WG 3R5FA 2GPWA 5C5JA 5L1JA 1RJPA 1SFOA 2J6UA 2JEFA 4EYIB 2M05A 5KFVA 4A2AA 3V6JA 3MR2A 5KFZA 5KG3A 5L1LA 4O3QA 1C30A 4JI8H 5DG9A 4QWEA 4MA5A 4UCVA 5EWEA 4TV8F 3V6HA 5KG7A 2B63A 4J0MA 3RFCA 4LH6A 3HOXG 4DV2H 3Q2OA 4MTEA 4YQWA 1BXRA 4DR5H 4ECQA 5L9XA 1M7JA 2Y0SA 1N56A 2YS6A 2C00A 4BBRG 2FPGB 4RNMA 3KAJA 4EEYA 3LWBA 2DZDA 1IOVA 3N43B 1XMOH 1KJ9A 3RTXA 1X9NA 2FK2A 5KFAA 4A3LG 2NU8B 5KG6A 4U7CA 2UXDH 3GIJA 1RK5A 4A3EG 5KFUA 2HJWA 4QIWE 4KHPH 2VUGA 3V4SA 2E2IA 1T94A 4A3FG 2V59A 3GTOA 2R85A 2BR0A 1C3OA 1WCMA 3KTMA 4MA0A 4HYKA 4A3JG 5KFLA 4XYMB 3BA8A 1JDEA 4RB1A 3OSNA 3MFIA 5KFYA 1M6VA 4MV3A 4O2BF 3IN5A 2GPSA 2XC9A 2YCHA 2W57A 2W71A 5H80A 4ED0A 4DL4A 2V5AA 3KXYT 3RGZA 3Q8QB 4B3SH 3N44B 3H20A 4WBNF 4ECTA 3GV8B 5D1OB 5KFIA 4RB0A 2XD4A 5IYZF 5IYDG 2JA8G 3GIMA 2V9WA 5L1KA 5DQHA 4GKKH 2VQDA 1M0TA 4BXXG 2VPQA 4J9PA 2JA7A 5KFKA 4L1KA 5JQWA 2XGQA 4ECUA 1JLLB 3RV3A 4ED8A 4ECYA 2DPIA 4IR1A 4TQSA 2PVPA 3RF2A 4CC5A 4UCTA 1I7LA 1RK6A 2XCPA 5F9LA 3RBEA 2OH2A 1M0WA 3VPDA 2DIKA 4QWAA 1Z2OX 4UCSA 4GKJH 1I94H 3PR4A 1S03G 2V4QA 4F4XA 2VOBA 2W70A 4J9RA 1E4GT 2V4RA 5FD5A 3R5HA 2NVXA 4YR2A 3EPGA 3VPCA 4IRDA 1DGSA 1ZETA 3GTLA 1UC9A 1TWCA 1N33H 4DUZH 5KG2A 3T5HA 3H4BA 2IA6A 1VAJA 4C5CA 4A3BG 5DQIA 3UFXB 2W7OA 4G3IA 2XCLA 1TWAA 4J9KA 3RGXA 5KG4A 3T1HH 1AN7A 3RBDA 5D8DA 3C0FB 2ZDHA 5HV6A 5KFXA 5T14A 3H3VH 2YL2A 2VPSA 2R8KA 3GILA 4A3GG 3RB3A 2NVYA 2X0SA 4TQRA 5KFCA 3H0GG 4IRCA 5KFDA 3Q8SB 1TWHA 5KFRA 2I80A 5LMNH 2Y0SE 2FB9A 4I50F 4EYHB 2UUBH 4M7EA 1PX2A 4Y8VB 2VUMG 5KFTA 2R8GA 1A9XA 4YY3H 4BBSG 2YYAA 3L4JA 1FJGH 5KT2A 1WH2A 4DR4H 5BR8H 4ECSA 4C2MA 1Y1VA 1DV1A 1W93A 3G8CA 3I12A 5KG5A 4LFBH 4RUAA 3KHLA 2W9BA 4EGQA 5IYCG 5J2UF 4Q8EA 3AYHB 1KJQA 3N42B 3JSLA 2DWCA 4J9QA 4DV3H 4C5BA 2FPPB 4Q43A 3T5KA 1S0MA 4HR7A 1SCUB 4MV4A 4EFBA 4DR3H 4QIWA 3DF7A 1AUVA 5EWFA 1JX4A 2R7ZG 1VBHA 2R7LA 4F4YA 2NU7B 3MWDA 3WO1A 4GC6A 5FPRA 2W8KA 4J9SA 4ED6A 3PVXA 1GLVA 2R7MA 3GQCA 3WO0A 2UVUA 4IAJA 5KFWA 4TV9F 3TQTA 1Y14B 4IWYA 5KFEA 4Q45A 2VR1A 3I4MG 4ED3A 4JV5H 3OUZA 4LMYA 3NGDA 4EG0A 4YR0A 3EPIA 2RGVA 4BY7G 4ME6A 3VPBA 5J2TF 5KKNB 4ETSA 3OTOH 2GLTA 4JI7H 4APMA 1TA8A 3QZ7A 1GSHA 2I8CA 5JVDF 5DG7A 3LMLA 2HHHH 5KT7A 2C22A 5BMVF 3KALA 1WR2A 4LF8H 3CVZA 3OHBA 4GLXA 1XMQH 4EGJA 5CB4F 4IWXA 2UUAH 3L2PA 1FVIA 4FBTA 2R86A 1GSOA 1A0IA 2V58A 1VBGA 4YAJB 1T36A 3HXLA 4JI2H 4LSXA 2HVQA 4BWSC 4B3RH 4RU9A 2R7KA 2XIGA 5KFMA 2IP4A 4AQYH 2UVRA 4XX0B 4X62H 2FLLA 4LF9H 4PDBA 3RJ0A 2ASJA 2W6QA 3MR6A 2FK1A 4JI6H 5CAEB 2E5LH 1GYFA 5LOVF 1I6UA 3SE7A 5D1PA 3G6VA 2W6PA 5KFQA 4DR2H 1S97A 5FPOA 5I47A 4CC6A 5C3EG 2UXCH 1KBLA 4RZRA 3RV4A 4EBEA 2YRXA 4ED2A 2FK3A 5DQGA 4F4ZA 3J80W 2W6ZA 4BY1G 4QWDA 4DL5A 2FP4B 3BQ2A 3K3VA 3R5XA 4YJ3F 5JUMA 2R8JA 2UVWA 3MR3A 2R87A 5EOYA 4Q44A 1Z2NX 1B04A 3H40A 2AU0A 3GTJA 2RDIA 3GTGA 2R6FA 4RAYA 4C5AA 1UC8A 3PW5A 5KFNA 1BGWA 2SCUB 4R7RA 2UU9H 4MV7A 3K5HA 2NU9B 2NUAB 1WSCA 5FJ8G 4O3OA 2BQUA 3T1YH 2R8HA 2PMZA 3BJYA 2YZNA 5D1OA 1KEEA 2W6MA 2WTFA 3RAXA 2P0AA 1Z2PX 4HQ6A 3RUPA 5LL6b 3HOZG 3GTMA 1B33N 2Q2UA 3FMAA 3Q8RB 4M9UA 3HOYG 3GTQA 4LF5H 5LXTF 4O3NA 2FPIB 2J6TA 1S68A 1RJRA 2WYOA 4JI4H 2CKZB 3GV7B 4J9OA 3KHRA 2HGSA 1I3QA 1S9FA 3ETHA 4MV6A 4LF6H 2W8LA 5JH7F 4XYLB 2BQ3A 4DV0H 3GTKA 4JI5H 1FKAH 1HR0H 4U6PA 3H4DA 2FE3A 2RF4A 3GIPA 4ZOLF 4EBCA 1I50A 1IBKH 4DL6A 4YJ2F 4JI1H 4JI0H 4GC7A 5IP9G 2W6OA 1DIKA 4JYAH 4DLKA 2OLSA 3OHAA 5JVLA 5IWAH 4UCUA 2C2DA 5KFOA 4OX9H 1GO3E 3FKIG 5GONF 1EHIA 5HBRB 3GTPA 3MR5A 5KT4A 3HKZE 4X66H 4NLGA 3PO3G 4NXNH 1RJQA 4ZI7F 4A3IG 2ZJTA 5KT3A 3UQ8A 2ALZA 4LFAH 3QFFA 4UFZA 5LP6F 4DV7H 1IBMH 5IT9W 4ED7A 2HVRA 4DR7H 5K2MA 3TINA 4O3PA 4J9MA 4A3CG 1DV2A 1S0NA 3T5JA 3GIQA 4J9LA 1ZHSA 5KFSA 3BQ0A 5L1IA 1E4EA 1SYXB 2AGQA 3TIGA 3VMMA 1EUCB 3JSNA 4DV6H 1JXLA 1KJIA 4LSAA 3N6XA 3OUUA 2RDJA 4J9NA 4JV0A 3FKIA 3RIZA 4RZQA 3BAAA 3ORQA 5BPHA 3M9MB 2KSWA 1TWGA 4ZHQF 2YU9A 4RAZA 2ATLA 2XGPA 1ZQ7A 3BA9A 3GIIA 5BPFA 2CW7A 2JA5A 4B3TH 4YR3A 5C8YF 1IBLH 4IR9A 3K3PA 2DPJA 2CQYA 3M4IA 2VA3A 3KHHA 4FBUA 4O4LF 4DL3A 2UUCH 1P8LA 5CA0F 1XDNA 3H0GA 1R9TA 4MV8A 4A3DG 2W9CA 1XNQH 5C4XG 3J81W 5KG0A 3R23A 5LA6F 3GIDA 3PN1A 3T5LA 2AQ4A 3CQZA 4Q8FA 4HNTA 3JAMW 4QW9A 1VS0A 4HNUA 5EWGA 3L4KA 3FDSA 1PK8A 4TUYF 3MFHA 4I55F 1I7NA 3BG5A 4ECWA 5KG1A 2IMWP 2R93A 4UCRA 4MAMA 4YP3A 2ZDGA 3V6KA
chains in the Genus database with same CATH topology
5EOYA 2VQEH 1Z2NX 1B04A 5FLXW 4LF4H 1DGSA 4JI3H 2WE6A 1N33H 4RAYA 4B3MH 4DUZH 1N34H 1BGWA 2UU9H 4R7RA 4A2BA 4MV7A 2VQFH 1V9PA 3T1YH 2WDTA 5D1OA 1Z2PX 5LL6b 3RGXA 3T1HH 4DR1H 1AN7A 4YHHH 4DUYH 3FMAA 2Q2UA 3C0FB 4I7HA 5LMUH 2VPSA 4LF5H 4X64H 4LFCH 2ZM6H 4NXMH 1S68A 4JI4H 2WYOA 5FD6A 4UCOA 1HNWH 2HGSA 2MCTA 5LMNH 3J7AK 1TAEA 2UUBH 4M7EA 4LF6H 4YY3H 4A2AA 3L4JA 1FJGH 1WH2A 4DR4H 5BR8H 4DV0H 4JI5H 1FKAH 1HR0H 2FE3A 4LFBH 4JI8H 4RB2C 4EEQA 4UCVA 1E4FT 1IBKH 3N42B 3JSLA 4DV3H 4RB3C 4JI1H 4JI0H 4JYAH 4DR3H 4EFBA 4J0MA 4MTDA 1L2ZA 3DF7A 4LH6A 2UXBH 4DV2H 5IWAH 4MTEA 4UCUA 4DR5H 1SEIA 2CW8A 5FPRA 4OX9H 2O03A 4IAJA 4X66H 5A2QW 4NXNH 3KAJA 2ZJTA 3N43B 4JV5H 4DV1H 1XMOH 4LF7H 3RTXA 3UQ8A 1X9NA 4LFAH 4LMYA 2UXDH 4UFZA 4DV7H 1IBMH 2OWOA 4Q0YA 2RGVA 5IT9W 2HVRA 4DR7H 4KHPH 2VUGA 4ETSA 3OTOH 4JI7H 4APMA 1TA8A 1BJTA 1ZHSA 1SYXB 2HVSA 1O75A 3BA8A 3KAKA 3LMLA 2HHHH 1MZBA 3JSNA 4X65H 3KALA 4RB1A 4DV6H 4LF8H 3CVZA 4LSAA 3N6XA 4GLXA 1XMQH 4K0KH 2UUAH 3L2PA 1FVIA 2YCHA 2W57A 3RIZA 1A0IA 3KXYT 3RGZA 4B3SH 3N44B 3H20A 3HXLA 4RZQA 1HNXH 4JI2H 4LSXA 3N41B 2HVQA 3BAAA 4BWSC 3BABA 4B3RH 2KSWA 5D1OB 2XIGA 4RB0A 4RAZA 4AQYH 4DV4H 3EYYA 4X62H 3BA9A 3MWMA 3IG0A 3F8NA 3RJ0A 2CW7A 4LF9H 4PDBA 4LH7A 4JI6H 4GKKH 2E5LH 4B3TH 1GYFA 1M0TA 1IBLH 4EFEA 1I6UA 5D1PA 1XNRH 3M4IA 4DR2H 2F4VH 5FPOA 3N40P 4CC6A 2UUCH 1P8LA 4DR6H 2UXCH 1XDNA 1J5EH 1N32H 4MV9A 1XNQH 4DV5H 3RF2A 3J81W 1HNZH 4CC5A 3PN1A 4UCTA 3JAMW 2Q2TA 1ZHQA 1VS0A 3L4KA 1M0WA 3J80W 1Z2OX 4UCSA 2RGRA 4GKJH 1I94H 4FM9A 3K3VA 1S03G 4UCRA 2VOBA 1N36H 1E4GT 5FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH2 A;  3FMA A;  1GYF A;  4BWS C;  1SYX B;  3K3V A;  1L2Z A; 
#chains in the Genus database with same CATH topology
 2VQE H;  2BQR A;  5FLX W;  4JV1 A;  2W9B B;  1K1S A;  5KX5 F;  4AYB E;  4B3M H;  5KFB A;  5EDW A;  1EUD B;  4A2B A;  2VQF H;  1BNC A;  2FKL A;  2JA6 A;  2DLN A;  4QW8 A;  1V9P A;  4R8U A;  2XCA A;  1T3N A;  5DLF A;  1UNN C;  4PWQ A;  3Q8P B;  3MJF A;  4YHH H;  3TII A;  2WAQ A;  4DUY H;  4ED1 A;  3HBL A;  4I7H A;  2R93 G;  3PR5 B;  2UVV A;  2FLN A;  5LMU H;  2QYZ A;  4A3M G;  3JZI A;  5IYB G;  5F9N A;  4LFC H;  4ZQI A;  2J9G A;  3HOU G;  5FD6 A;  1JDB B;  3MWE A;  1KJJ A;  4UCO A;  4RUC A;  1K83 A;  1HNW H;  2MCT A;  3J7A K;  5KT5 A;  1TAE A;  2FMA A;  4FS1 A;  4AYB A;  3RAQ A;  3JRX A;  5CA1 F;  4YB8 B;  1S10 A;  2ZDQ A;  4WD3 A;  3ORR A;  1CE8 A;  4RB2 C;  2C2E A;  5C1O A;  3LP8 A;  4EEQ A;  1E4F T;  3PW0 A;  2JA5 G;  2R92 G;  4RB3 C;  4DV4 H;  3WNZ A;  3GIK A;  4O3S A;  3HOV G;  4MTD A;  3KHG A;  1L2Z A;  4I4T F;  3OSP A;  2UXB H;  3GV5 B;  5EZY F;  1SEI A;  2J6S A;  2CW8 A;  1W96 A;  4JV2 A;  2E2H A;  1Y1W A;  3JRW A;  2O03 A;  4ECX A;  4O4H F;  5A2Q W;  4QJF A;  3HKZ A;  5C44 G;  3V4Z A;  3U9T A;  1B6R A;  4F4W A;  3U9S A;  4DV1 H;  1EZ1 A;  2I87 A;  4LF7 H;  2YW2 A;  2C28 A;  5DGB A;  1AUX A;  4XZ3 B;  2B63 G;  2OWO A;  4Q0Y A;  2R92 A;  4O2A F;  4ECZ A;  2PN1 A;  2IBK A;  1N48 A;  1Y1V G;  1K1Q A;  1B6S A;  1BJT A;  1CQJ B;  1O75 A;  3KAK A;  2HVS A;  1MZB A;  4X65 H;  1E4E B;  1S0O A;  5KFJ A;  1OWT A;  4K0K H;  4YAK B;  1EYZ A;  2PBZ A;  3M9N B;  2R82 A;  2W6N A;  3PW4 A;  3HB9 A;  4JUZ A;  1V51 A;  2W9C B;  3SI8 A;  1JKJ B;  2YRW A;  2W7P A;  1HNX H;  3N41 B;  1VKZ A;  3BAB A;  5KT6 A;  5KFH A;  2YZG A;  3Q1K A;  3I4N G;  4QWB A;  3EYY A;  5KFF A;  4MV1 A;  1TWF A;  2R84 A;  1WCM G;  3F8N A;  3IG0 A;  3MWM A;  4HNV A;  4LH7 A;  2W9A A;  4IZO A;  2JEG A;  3ETJ A;  4EFE A;  2JA6 G;  2YZM A;  3GLK A;  1JIH A;  2AGO A;  4O3R A;  2FJZ A;  1XNR H;  3M9O B;  2F4V H;  4EBD A;  3N40 P;  2WB1 A;  4DR6 H;  5C1P A;  5DG8 A;  1J5E H;  2R8I A;  1N32 H;  4MV9 A;  4QWC A;  4DL2 A;  4DV5 H;  2JEI A;  1HNZ H;  2CZG A;  1RYS A;  2AGP A;  1CS0 A;  3PO2 G;  2WB1 E;  3E5N A;  5KFG A;  1ZHQ A;  2Q2T A;  2QK4 A;  3RB4 A;  3HOW G;  2R7Z A;  1CQI B;  4O4I F;  2C2R A;  4RNN A;  4IHJ F;  1RYR A;  1KC7 A;  3RB6 A;  2RGR A;  3G6X A;  4YBZ B;  4FM9 A;  4F50 A;  1V4Y A;  2VA2 A;  1N36 H;  3TQ1 A;  2FLP A;  4FS2 A;  1GGO A;  4IRK A;  4LF4 H;  4FU0 A;  1ULZ A;  2JA7 G;  5DLG A;  4JI3 H;  2PMZ E;  1IOW A;  2WE6 A;  5DGA A;  1N34 H;  5IP7 G;  3BQ1 A;  3QZ8 A;  3PZP A;  2NU6 B;  2VUM A;  3K5I A;  2YS7 A;  3PW7 A;  3PW2 A;  2JEJ A;  1KJ8 A;  1GSA A;  2WDT A;  3G6Y A;  2ASL A;  2WAQ E;  4E4T A;  4R8U B;  4ECR A;  4DR1 H;  2R7N A;  4A93 G;  2C35 B;  5FLM G;  5KFP A;  2ASD A;  4ECV A;  4X64 H;  3N8D A;  2ZM6 H;  4DL7 A;  4NXM H;  3RB0 A;  4A3K G;  5LYJ F;  4RNO A;  1Y1W G;  3R5F A;  2GPW A;  5C5J A;  5L1J A;  1RJP A;  1SFO A;  2J6U A;  2JEF A;  4EYI B;  2M05 A;  5KFV A;  4A2A A;  3V6J A;  3MR2 A;  5KFZ A;  5KG3 A;  5L1L A;  4O3Q A;  1C30 A;  4JI8 H;  5DG9 A;  4QWE A;  4MA5 A;  4UCV A;  5EWE A;  4TV8 F;  3V6H A;  5KG7 A;  2B63 A;  4J0M A;  3RFC A;  4LH6 A;  3HOX G;  4DV2 H;  3Q2O A;  4MTE A;  4YQW A;  1BXR A;  4DR5 H;  4ECQ A;  5L9X A;  1M7J A;  2Y0S A;  1N56 A;  2YS6 A;  2C00 A;  4BBR G;  2FPG B;  4RNM A;  3KAJ A;  4EEY A;  3LWB A;  2DZD A;  1IOV A;  3N43 B;  1XMO H;  1KJ9 A;  3RTX A;  1X9N A;  2FK2 A;  5KFA A;  4A3L G;  2NU8 B;  5KG6 A;  4U7C A;  2UXD H;  3GIJ A;  1RK5 A;  4A3E G;  5KFU A;  2HJW A;  4QIW E;  4KHP H;  2VUG A;  3V4S A;  2E2I A;  1T94 A;  4A3F G;  2V59 A;  3GTO A;  2R85 A;  2BR0 A;  1C3O A;  1WCM A;  3KTM A;  4MA0 A;  4HYK A;  4A3J G;  5KFL A;  4XYM B;  3BA8 A;  1JDE A;  4RB1 A;  3OSN A;  3MFI A;  5KFY A;  1M6V A;  4MV3 A;  4O2B F;  3IN5 A;  2GPS A;  2XC9 A;  2YCH A;  2W57 A;  2W71 A;  5H80 A;  4ED0 A;  4DL4 A;  2V5A A;  3KXY T;  3RGZ A;  3Q8Q B;  4B3S H;  3N44 B;  3H20 A;  4WBN F;  4ECT A;  3GV8 B;  5D1O B;  5KFI A;  4RB0 A;  2XD4 A;  5IYZ F;  5IYD G;  2JA8 G;  3GIM A;  2V9W A;  5L1K A;  5DQH A;  4GKK H;  2VQD A;  1M0T A;  4BXX G;  2VPQ A;  4J9P A;  2JA7 A;  5KFK A;  4L1K A;  5JQW A;  2XGQ A;  4ECU A;  1JLL B;  3RV3 A;  4ED8 A;  4ECY A;  2DPI A;  4IR1 A;  4TQS A;  2PVP A;  3RF2 A;  4CC5 A;  4UCT A;  1I7L A;  1RK6 A;  2XCP A;  5F9L A;  3RBE A;  2OH2 A;  1M0W A;  3VPD A;  2DIK A;  4QWA A;  1Z2O X;  4UCS A;  4GKJ H;  1I94 H;  3PR4 A;  1S03 G;  2V4Q A;  4F4X A;  2VOB A;  2W70 A;  4J9R A;  1E4G T;  2V4R A;  5FD5 A;  3R5H A;  2NVX A;  4YR2 A;  3EPG A;  3VPC A;  4IRD A;  1DGS A;  1ZET A;  3GTL A;  1UC9 A;  1TWC A;  1N33 H;  4DUZ H;  5KG2 A;  3T5H A;  3H4B A;  2IA6 A;  1VAJ A;  4C5C A;  4A3B G;  5DQI A;  3UFX B;  2W7O A;  4G3I A;  2XCL A;  1TWA A;  4J9K A;  3RGX A;  5KG4 A;  3T1H H;  1AN7 A;  3RBD A;  5D8D A;  3C0F B;  2ZDH A;  5HV6 A;  5KFX A;  5T14 A;  3H3V H;  2YL2 A;  2VPS A;  2R8K A;  3GIL A;  4A3G G;  3RB3 A;  2NVY A;  2X0S A;  4TQR A;  5KFC A;  3H0G G;  4IRC A;  5KFD A;  3Q8S B;  1TWH A;  5KFR A;  2I80 A;  5LMN H;  2Y0S E;  2FB9 A;  4I50 F;  4EYH B;  2UUB H;  4M7E A;  1PX2 A;  4Y8V B;  2VUM G;  5KFT A;  2R8G A;  1A9X A;  4YY3 H;  4BBS G;  2YYA A;  3L4J A;  1FJG H;  5KT2 A;  1WH2 A;  4DR4 H;  5BR8 H;  4ECS A;  4C2M A;  1Y1V A;  1DV1 A;  1W93 A;  3G8C A;  3I12 A;  5KG5 A;  4LFB H;  4RUA A;  3KHL A;  2W9B A;  4EGQ A;  5IYC G;  5J2U F;  4Q8E A;  3AYH B;  1KJQ A;  3N42 B;  3JSL A;  2DWC A;  4J9Q A;  4DV3 H;  4C5B A;  2FPP B;  4Q43 A;  3T5K A;  1S0M A;  4HR7 A;  1SCU B;  4MV4 A;  4EFB A;  4DR3 H;  4QIW A;  3DF7 A;  1AUV A;  5EWF A;  1JX4 A;  2R7Z G;  1VBH A;  2R7L A;  4F4Y A;  2NU7 B;  3MWD A;  3WO1 A;  4GC6 A;  5FPR A;  2W8K A;  4J9S A;  4ED6 A;  3PVX A;  1GLV A;  2R7M A;  3GQC A;  3WO0 A;  2UVU A;  4IAJ A;  5KFW A;  4TV9 F;  3TQT A;  1Y14 B;  4IWY A;  5KFE A;  4Q45 A;  2VR1 A;  3I4M G;  4ED3 A;  4JV5 H;  3OUZ A;  4LMY A;  3NGD A;  4EG0 A;  4YR0 A;  3EPI A;  2RGV A;  4BY7 G;  4ME6 A;  3VPB A;  5J2T F;  5KKN B;  4ETS A;  3OTO H;  2GLT A;  4JI7 H;  4APM A;  1TA8 A;  3QZ7 A;  1GSH A;  2I8C A;  5JVD F;  5DG7 A;  3LML A;  2HHH H;  5KT7 A;  2C22 A;  5BMV F;  3KAL A;  1WR2 A;  4LF8 H;  3CVZ A;  3OHB A;  4GLX A;  1XMQ H;  4EGJ A;  5CB4 F;  4IWX A;  2UUA H;  3L2P A;  1FVI A;  4FBT A;  2R86 A;  1GSO A;  1A0I A;  2V58 A;  1VBG A;  4YAJ B;  1T36 A;  3HXL A;  4JI2 H;  4LSX A;  2HVQ A;  4BWS C;  4B3R H;  4RU9 A;  2R7K A;  2XIG A;  5KFM A;  2IP4 A;  4AQY H;  2UVR A;  4XX0 B;  4X62 H;  2FLL A;  4LF9 H;  4PDB A;  3RJ0 A;  2ASJ A;  2W6Q A;  3MR6 A;  2FK1 A;  4JI6 H;  5CAE B;  2E5L H;  1GYF A;  5LOV F;  1I6U A;  3SE7 A;  5D1P A;  3G6V A;  2W6P A;  5KFQ A;  4DR2 H;  1S97 A;  5FPO A;  5I47 A;  4CC6 A;  5C3E G;  2UXC H;  1KBL A;  4RZR A;  3RV4 A;  4EBE A;  2YRX A;  4ED2 A;  2FK3 A;  5DQG A;  4F4Z A;  3J80 W;  2W6Z A;  4BY1 G;  4QWD A;  4DL5 A;  2FP4 B;  3BQ2 A;  3K3V A;  3R5X A;  4YJ3 F;  5JUM A;  2R8J A;  2UVW A;  3MR3 A;  2R87 A;  5EOY A;  4Q44 A;  1Z2N X;  1B04 A;  3H40 A;  2AU0 A;  3GTJ A;  2RDI A;  3GTG A;  2R6F A;  4RAY A;  4C5A A;  1UC8 A;  3PW5 A;  5KFN A;  1BGW A;  2SCU B;  4R7R A;  2UU9 H;  4MV7 A;  3K5H A;  2NU9 B;  2NUA B;  1WSC A;  5FJ8 G;  4O3O A;  2BQU A;  3T1Y H;  2R8H A;  2PMZ A;  3BJY A;  2YZN A;  5D1O A;  1KEE A;  2W6M A;  2WTF A;  3RAX A;  2P0A A;  1Z2P X;  4HQ6 A;  3RUP A;  5LL6 b;  3HOZ G;  3GTM A;  1B33 N;  2Q2U A;  3FMA A;  3Q8R B;  4M9U A;  3HOY G;  3GTQ A;  4LF5 H;  5LXT F;  4O3N A;  2FPI B;  2J6T A;  1S68 A;  1RJR A;  2WYO A;  4JI4 H;  2CKZ B;  3GV7 B;  4J9O A;  3KHR A;  2HGS A;  1I3Q A;  1S9F A;  3ETH A;  4MV6 A;  4LF6 H;  2W8L A;  5JH7 F;  4XYL B;  2BQ3 A;  4DV0 H;  3GTK A;  4JI5 H;  1FKA H;  1HR0 H;  4U6P A;  3H4D A;  2FE3 A;  2RF4 A;  3GIP A;  4ZOL F;  4EBC A;  1I50 A;  1IBK H;  4DL6 A;  4YJ2 F;  4JI1 H;  4JI0 H;  4GC7 A;  5IP9 G;  2W6O A;  1DIK A;  4JYA H;  4DLK A;  2OLS A;  3OHA A;  5JVL A;  5IWA H;  4UCU A;  2C2D A;  5KFO A;  4OX9 H;  1GO3 E;  3FKI G;  5GON F;  1EHI A;  5HBR B;  3GTP A;  3MR5 A;  5KT4 A;  3HKZ E;  4X66 H;  4NLG A;  3PO3 G;  4NXN H;  1RJQ A;  4ZI7 F;  4A3I G;  2ZJT A;  5KT3 A;  3UQ8 A;  2ALZ A;  4LFA H;  3QFF A;  4UFZ A;  5LP6 F;  4DV7 H;  1IBM H;  5IT9 W;  4ED7 A;  2HVR A;  4DR7 H;  5K2M A;  3TIN A;  4O3P A;  4J9M A;  4A3C G;  1DV2 A;  1S0N A;  3T5J A;  3GIQ A;  4J9L A;  1ZHS A;  5KFS A;  3BQ0 A;  5L1I A;  1E4E A;  1SYX B;  2AGQ A;  3TIG A;  3VMM A;  1EUC B;  3JSN A;  4DV6 H;  1JXL A;  1KJI A;  4LSA A;  3N6X A;  3OUU A;  2RDJ A;  4J9N A;  4JV0 A;  3FKI A;  3RIZ A;  4RZQ A;  3BAA A;  3ORQ A;  5BPH A;  3M9M B;  2KSW A;  1TWG A;  4ZHQ F;  2YU9 A;  4RAZ A;  2ATL A;  2XGP A;  1ZQ7 A;  3BA9 A;  3GII A;  5BPF A;  2CW7 A;  2JA5 A;  4B3T H;  4YR3 A;  5C8Y F;  1IBL H;  4IR9 A;  3K3P A;  2DPJ A;  2CQY A;  3M4I A;  2VA3 A;  3KHH A;  4FBU A;  4O4L F;  4DL3 A;  2UUC H;  1P8L A;  5CA0 F;  1XDN A;  3H0G A;  1R9T A;  4MV8 A;  4A3D G;  2W9C A;  1XNQ H;  5C4X G;  3J81 W;  5KG0 A;  3R23 A;  5LA6 F;  3GID A;  3PN1 A;  3T5L A;  2AQ4 A;  3CQZ A;  4Q8F A;  4HNT A;  3JAM W;  4QW9 A;  1VS0 A;  4HNU A;  5EWG A;  3L4K A;  3FDS A;  1PK8 A;  4TUY F;  3MFH A;  4I55 F;  1I7N A;  3BG5 A;  4ECW A;  5KG1 A;  2IMW P;  2R93 A;  4UCR A;  4MAM A;  4YP3 A;  2ZDG A;  3V6K A; 
#chains in the Genus database with same CATH homology
 5EOY A;  2VQE H;  1Z2N X;  1B04 A;  5FLX W;  4LF4 H;  1DGS A;  4JI3 H;  2WE6 A;  1N33 H;  4RAY A;  4B3M H;  4DUZ H;  1N34 H;  1BGW A;  2UU9 H;  4R7R A;  4A2B A;  4MV7 A;  2VQF H;  1V9P A;  3T1Y H;  2WDT A;  5D1O A;  1Z2P X;  5LL6 b;  3RGX A;  3T1H H;  4DR1 H;  1AN7 A;  4YHH H;  4DUY H;  3FMA A;  2Q2U A;  3C0F B;  4I7H A;  5LMU H;  2VPS A;  4LF5 H;  4X64 H;  4LFC H;  2ZM6 H;  4NXM H;  1S68 A;  4JI4 H;  2WYO A;  5FD6 A;  4UCO A;  1HNW H;  2HGS A;  2MCT A;  5LMN H;  3J7A K;  1TAE A;  2UUB H;  4M7E A;  4LF6 H;  4YY3 H;  4A2A A;  3L4J A;  1FJG H;  1WH2 A;  4DR4 H;  5BR8 H;  4DV0 H;  4JI5 H;  1FKA H;  1HR0 H;  2FE3 A;  4LFB H;  4JI8 H;  4RB2 C;  4EEQ A;  4UCV A;  1E4F T;  1IBK H;  3N42 B;  3JSL A;  4DV3 H;  4RB3 C;  4JI1 H;  4JI0 H;  4JYA H;  4DR3 H;  4EFB A;  4J0M A;  4MTD A;  1L2Z A;  3DF7 A;  4LH6 A;  2UXB H;  4DV2 H;  5IWA H;  4MTE A;  4UCU A;  4DR5 H;  1SEI A;  2CW8 A;  5FPR A;  4OX9 H;  2O03 A;  4IAJ A;  4X66 H;  5A2Q W;  4NXN H;  3KAJ A;  2ZJT A;  3N43 B;  4JV5 H;  4DV1 H;  1XMO H;  4LF7 H;  3RTX A;  3UQ8 A;  1X9N A;  4LFA H;  4LMY A;  2UXD H;  4UFZ A;  4DV7 H;  1IBM H;  2OWO A;  4Q0Y A;  2RGV A;  5IT9 W;  2HVR A;  4DR7 H;  4KHP H;  2VUG A;  4ETS A;  3OTO H;  4JI7 H;  4APM A;  1TA8 A;  1BJT A;  1ZHS A;  1SYX B;  2HVS A;  1O75 A;  3BA8 A;  3KAK A;  3LML A;  2HHH H;  1MZB A;  3JSN A;  4X65 H;  3KAL A;  4RB1 A;  4DV6 H;  4LF8 H;  3CVZ A;  4LSA A;  3N6X A;  4GLX A;  1XMQ H;  4K0K H;  2UUA H;  3L2P A;  1FVI A;  2YCH A;  2W57 A;  3RIZ A;  1A0I A;  3KXY T;  3RGZ A;  4B3S H;  3N44 B;  3H20 A;  3HXL A;  4RZQ A;  1HNX H;  4JI2 H;  4LSX A;  3N41 B;  2HVQ A;  3BAA A;  4BWS C;  3BAB A;  4B3R H;  2KSW A;  5D1O B;  2XIG A;  4RB0 A;  4RAZ A;  4AQY H;  4DV4 H;  3EYY A;  4X62 H;  3BA9 A;  3MWM A;  3IG0 A;  3F8N A;  3RJ0 A;  2CW7 A;  4LF9 H;  4PDB A;  4LH7 A;  4JI6 H;  4GKK H;  2E5L H;  4B3T H;  1GYF A;  1M0T A;  1IBL H;  4EFE A;  1I6U A;  5D1P A;  1XNR H;  3M4I A;  4DR2 H;  2F4V H;  5FPO A;  3N40 P;  4CC6 A;  2UUC H;  1P8L A;  4DR6 H;  2UXC H;  1XDN A;  1J5E H;  1N32 H;  4MV9 A;  1XNQ H;  4DV5 H;  3RF2 A;  3J81 W;  1HNZ H;  4CC5 A;  3PN1 A;  4UCT A;  3JAM W;  2Q2T A;  1ZHQ A;  1VS0 A;  3L4K A;  1M0W A;  3J80 W;  1Z2O X;  4UCS A;  2RGR A;  4GKJ H;  1I94 H;  4FM9 A;  3K3V A;  1S03 G;  4UCR A;  2VOB A;  1N36 H;  1E4G T;  5FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...