3K3VA

Crystal structure the gyf domain of s. cerevisiae smy2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
ESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SMY2
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 24
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3k3vA00
1GYFA 1L2ZA 3FMAA 4BWSC 3K3VA 1SYXB 1WH2A
chains in the Genus database with same CATH superfamily
4O3RA 3GTLA 4GC7A 2NU9B 4DV2H 3JAMW 2V4RA 3RB0A 1S0OA 4YJ2F 1KJ9A 4EFBA 3GTQA 2JA5A 4MV3A 3NGDA 4JV1A 2WAQA 3OHBA 2C00A 2W6NA 1W93A 5JUMA 5KFNA 4IRDA 1I6UA 4I50F 5KT6A 1WCMA 2ASDA 1TWGA 1S0NA 1RYSA 4MTEA 4JI3H 3MR2A 3QFFA 2JEJA 4MV7A 3V4SA 4DL2A 1V51A 1CQJB 3JZIA 2JA5G 2NVYA 1HR0H 1KJQA 5K2MA 4DL5A 2R86A 5KFQA 4NLGA 4RUCA 5D1OB 5IT9W 2YRWA 1FVIA 5KFCA 4RB2C 2R7NA 4I7HA 5GONF 3RGZA 4J9OA 1WCMG 1SYXB 4PWQA 2XGPA 2W8KA 4XYMB 1UC8A 4DL6A 4TUYF 2W6QA 4JV2A 2UUCH 2V59A 4ZI7F 2R8JA 5L1JA 4Y8VB 1KEEA 5KFLA 4C5CA 2P0AA 2YRXA 3KHRA 4EBEA 4JI0H 3Q2OA 2Q2TA 5T14A 3TIIA 4NXMH 4IRKA 3H20A 5CB4F 5KFIA 1GSOA 4HR7A 3WO1A 4I4TF 4A3MG 3LP8A 4M9UA 1T3NA 3KTMA 4JI8H 3N8DA 5D1OA 3OSNA 3L4KA 2XCPA 4ED0A 5DQIA 1EHIA 4O3NA 5FD6A 3MR5A 5KFFA 3KHLA 5KFTA 1XNQH 4KHPH 2CZGA 5KT5A 2MCTA 4MV1A 5KFMA 2FPIB 4UCUA 1VBHA 1SCUB 4JV5H 2PMZA 2W57A 5L1LA 4HYKA 3K5HA 3GIKA 3J81W 2BQUA 4JYAH 3KHHA 4MV9A 3Q8RB 4QW9A 1B6SA 5KFAA 4DR1H 1BXRA 2R92A 2JA6A 4RB1A 2VA2A 1JLLB 3ORRA 4UCRA 4XYLB 5DGAA 2R7LA 2NU8B 3JSNA 4RUAA 3R5FA 4RNOA 3LMLA 2XGQA 3IG0A 3OUZA 4ECSA 2ASLA 4IR9A 2ZDGA 3VPCA 2F4VH 1X9NA 2R92G 1XMOH 1KJJA 5KG1A 4RU9A 3GV5B 2JA6G 1DV1A 1IOVA 3HOXG 5CA1F 1N34H 4X64H 3PN1A 4F4YA 5BMVF 3I4NG 3PW2A 2RGVA 4I55F 4LF8H 4MA5A 2FE3A 3M9MB 2HJWA 2CQYA 4AYBE 4DV4H 4IR1A 4A3CG 2I87A 1JDBB 4MV8A 3U9TA 4CC6A 5KFOA 4DR6H 4R7RA 3I4MG 3HB9A 3J80W 1K1QA 2XD4A 2R85A 4TQRA 3ETJA 5LYJF 4XZ3B 3QZ7A 4Q8FA 1EUDB 2I8CA 5KG6A 5CA0F 5C3EG 4YBZB 4DV3H 3AYHB 2WTFA 2UVUA 5JVLA 3FKIA 4BWSC 4DR5H 3ETHA 2WAQE 4QWEA 5IP9G 1CE8A 1MZBA 3V6KA 4YR3A 4EBCA 4ECYA 5A2QW 1B6RA 5KT4A 4IAJA 4MTDA 3GIJA 3QZ8A 4F4ZA 4ECXA 2UUBH 4JI5H 3SI8A 4DL3A 3HOYG 4PDBA 4Q8EA 2UVRA 2FPPB 3GIQA 1OWTA 4RB0A 1CS0A 3FKIG 2W9BB 1RK6A 2FP4B 2R8KA 3KHGA 5LMNH 4JI6H 4F4XA 2W9CA 1I7NA 4RAZA 2HVQA 5KFKA 3BJYA 3BG5A 2WB1E 4GKJH 2E2HA 2OLSA 4JV0A 2AGPA 3L2PA 3KAKA 4LF4H 4DR4H 3HBLA 3MR6A 5DQHA 3H4BA 3PZPA 4B3RH 1W96A 4DL4A 1EUCB 2R84A 3MJFA 2W71A 5KFBA 4ECUA 1S68A 3GV8B 5EOYA 2W70A 1RK5A 3BA8A 3HKZA 3K3PA 1ZQ7A 4LH7A 3RTXA 2QYZA 4C5AA 4F4WA 3WNZA 1HNWH 1B04A 2M05A 4UFZA 4B3SH 3RUPA 1I7LA 1VBGA 1V9PA 5C1OA 4FM9A 1ZETA 2FJZA 2VPQA 3MWMA 5J2TF 3RGXA 3Q8SB 5KFSA 4RNMA 1GGOA 2W6ZA 5DG9A 2W9BA 4X66H 4A93G 2NU7B 2NUAB 5IP7G 3MWEA 4GC6A 4IWXA 3GIIA 2W6MA 1CQIB 4RNNA 1ULZA 2WB1A 5FPRA 1Y1VA 4E4TA 2I80A 4HNVA 3Q8QB 2PBZA 5JQWA 3F8NA 2C22A 4YB8B 2DIKA 5EZYF 4AQYH 5KT3A 1E4EB 2PMZE 3G6XA 3GTOA 2ZDHA 4YAJB 5EWGA 4A3BG 2JEGA 4FBUA 3H3VH 4A3DG 5C44G 4FS2A 1GYFA 1EYZA 4XX0B 1PX2A 5DLGA 2CW7A 3OTOH 2R7ZA 1Y1VG 4TV9F 4LFAH 3BA9A 1N32H 3PW5A 5KX5F 5KT7A 5BPHA 2W6PA 2W7PA 3GILA 3PW7A 2RF4A 1JIHA 2R7KA 3TQTA 3HOVG 2GPSA 4O2AF 2R7ZG 4YHHH 3TIGA 4DV0H 2UU9H 4X62H 4DUYH 2BQ3A 2C35B 5JVDF 3MFIA 5DGBA 2YZNA 5FPOA 2R8GA 4O3OA 2VPSA 5KFGA 3VPDA 4R8UB 4DR2H 3PW4A 3T5JA 1E4EA 4UCTA 1BNCA 3G8CA 4DV6H 1IBKH 2IBKA 4J9LA 5KFDA 5IWAH 2GLTA 4IZOA 5CAEB 3J7AK 2VQEH 2YZGA 5EWEA 3Q8PB 2R8IA 3GIPA 3PO3G 5FD5A 1DV2A 4L1KA 4ECZA 2Y0SE 3T1YH 4O4IF 1S10A 5DG8A 4J9KA 2UXDH 3GTKA 4TQSA 2C28A 2B63A 4JI4H 2BR0A 2JA8G 2FPGB 1WR2A 1ZHQA 4MA0A 2AGQA 1GSAA 4C5BA 2R7MA 4IHJF 4IWYA 2RDJA 3TINA 2FB9A 2W8LA 5C1PA 2OH2A 1XNRH 2DLNA 2B63G 1S03G 3GIMA 2OWOA 2YCHA 2IA6A 1I3QA 2UXCH 4X65H 2E2IA 4TV8F 1KJ8A 2J9GA 3L4JA 2ALZA 4LH6A 1K83A 2YZMA 4O3SA 4ED2A 2VR1A 3TQ1A 2RDIA 4RAYA 3V6JA 3FMAA 2Y0SA 4A3KG 2R82A 3CVZA 4UCOA 1SEIA 4EGQA 3G6VA 1RJPA 5D1PA 3RBEA 2FLPA 4WD3A 3BQ1A 1HNZH 4LF9H 1TWAA 4ED1A 3HXLA 2AGOA 2YS7A 2J6TA 2NVXA 4YR2A 1JKJB 2NU6B 3R23A 2XCAA 3HKZE 5KFVA 1A0IA 1IBMH 4QJFA 4IRCA 3N42B 2VUMA 4K0KH 3K5IA 1Y1WA 4J9PA 1VAJA 1RJQA 3JSLA 2YYAA 2V4QA 5HBRB 5IYZF 4JI2H 3WO0A 3BQ2A 4ECTA 4A3LG 4LSXA 2VUMG 1RJRA 5KFEA 4O3QA 1AUXA 2HVRA 5KFUA 4EGJA 1Y1WG 3EPIA 4ED3A 2ZDQA 1UC9A 1HNXH 2VUGA 2JA7A 2CW8A 1DGSA 1I50A 4U7CA 3GV7B 2UVVA 3RV3A 4A2AA 1Z2PX 4HNUA 3Q1KA 3PO2G 3KAJA 5IYBG 1C3OA 4MAMA 4J9MA 3JRWA 1IOWA 4YJ3F 3RFCA 2JA7G 5KFPA 3PW0A 2KSWA 4QIWA 2UVWA 5LL6b 4DV1H 2ZJTA 1B33N 2SCUB 4YY3H 3M9NB 3FDSA 3DF7A 4QWBA 1GLVA 2HGSA 1Z2OX 4J0MA 1KBLA 3M9OB 1XMQH 1O75A 1UNNC 2R8HA 1FKAH 4BY7G 2IP4A 1AN7A 4J9NA 1WH2A 1TAEA 5KG7A 4ECVA 4QWDA 3T5LA 1J5EH 5EDWA 5KG4A 4QWAA 3E5NA 4A3GG 3OUUA 5KFRA 1N56A 3RB3A 4YQWA 3SE7A 3K3VA 2HVSA 2XIGA 5C8YF 4EYIB 3N6XA 5KG0A 3GIDA 2R6FA 4A3IG 3ORQA 2VQDA 1L2ZA 4GLXA 1AUVA 2QK4A 1M7JA 3VMMA 1N33H 5KFXA 3EPGA 5IYCG 5L9XA 3GTGA 4OX9H 4J9SA 1ZHSA 2HHHH 2JEIA 1DIKA 2VQFH 2YW2A 2J6UA 3BABA 3OHAA 4JI7H 1KC7A 1KJIA 3OSPA 3RV4A 3G6YA 3MR3A 4U6PA 5KFWA 2XC9A 3RAXA 4LFBH 5HV6A 3MWDA 1P8LA 3N44B 5FLXW 2DWCA 3N40P 2UXBH 4O3PA 2O03A 3KXYT 3H4DA 4ECQA 1N48A 2RGRA 4ECWA 5JH7F 3UQ8A 4DV7H 1RYRA 4BBSG 2FLNA 2FK3A 1N36H 2DPIA 4J9QA 1T36A 1TWHA 4G3IA 5KFYA 5C4XG 5LP6F 4B3MH 2AU0A 4O4HF 4APMA 4A3EG 4HNTA 1Z2NX 3GLKA 4DLKA 3RJ0A 4BXXG 4A2BA 5F9LA 5L1KA 2FKLA 1TWFA 2XCLA 4ED8A 5DG7A 1M0WA 2PN1A 5BPFA 3HOWG 2VA3A 3V6HA 3H40A 4Q43A 1I94H 2PVPA 2W7OA 1Y14B 4EEYA 3GTPA 5J2UF 4LFCH 4HQ6A 3R5HA 3RIZA 2AQ4A 3N41B 3H0GA 4DUZH 1PK8A 4QW8A 2DPJA 2FLLA 3T5KA 4ZOLF 4F50A 2CKZB 5KFZA 4EEQA 2WDTA 2YU9A 4YAKB 4YR0A 1BJTA 2R87A 4EG0A 4Q44A 1K1SA 2GPWA 1SFOA 4ETSA 3V4ZA 3RBDA 2IMWP 5D8DA 3H0GG 1S9FA 3GTMA 1M6VA 3R5XA 3PVXA 2V5AA 4O4LF 2V9WA 4R8UA 2R93A 2UUAH 4ZHQF 3CQZA 1IBLH 3EYYA 4LMYA 5DLFA 3HOZG 4NXNH 2X0SA 4Q0YA 2ATLA 2YL2A 2BQRA 3C0FB 5C5JA 4UCVA 3UFXB 2VOBA 4FS1A 4QWCA 3BAAA 2JEFA 2R93G 3U9SA 1VS0A 4Q45A 4J9RA 2E5LH 1GSHA 5EWFA 4MV6A 4RB3C 3PR5B 3IN5A 5DQGA 4B3TH 1M0TA 4ME6A 1WSCA 5L1IA 4ECRA 4ED7A 4UCSA 1EZ1A 4RZQA 1C30A 2FMAA 3RF2A 5BR8H 1TA8A 3I12A 4C2MA 5IYDG 3BQ0A 4DL7A 4GKKH 1S0MA 4A3JG 4DR3H 4YP3A 1A9XA 4BY1G 5KKNB 4CC5A 2W9CB 2YS6A 4QIWE 3KALA 4DR7H 3GQCA 4LF5H 5H80A 5KG3A 4EFEA 4JI1H 4M7EA 3M4IA 4RZRA 4DV5H 2C2EA 4BBRG 1E4FT 5LXTF 4EYHB 2V58A 2FK1A 5KT2A 2DZDA 1T94A 3PR4A 4LSAA 2WYOA 3LWBA 3T1HH 5F9NA 4A3FG 2C2RA 1GO3E 5FLMG 3T5HA 2W6OA 2C2DA 2Q2UA 3HOUG 5KG5A 2ZM6H 4LF7H 1V4YA 3N43B 1E4GT 3RAQA 4EBDA 3RB4A 3VPBA 1BGWA 1VKZA 5LOVF 1JX4A 2WE6A 4LF6H 4O2BF 5KFJA 4FBTA 4AYBA 4ED6A 1JXLA 5KG2A 5FJ8G 2FK2A 4JUZA 1JDEA 4ZQIA 3MFHA 3GTJA 1TWCA 3JRXA 2ASJA 4FU0A 4MV4A 5I47A 5LMUH 4WBNF 1R9TA 2J6SA 1FJGH 1XDNA 3RB6A 5KFHA 1S97A 5LA6F 2W9AA
chains in the Genus database with same CATH topology
1P8LA 4DV3H 4JI4H 3N44B 5FLXW 2UXBH 3N40P 2O03A 3KXYT 4DV2H 3JAMW 4BWSC 4DR5H 2RGRA 1ZHQA 4EFBA 3UQ8A 4DV7H 4DR4H 1MZBA 1N36H 5A2QW 4MTDA 4IAJA 1I6UA 2UUBH 1XNRH 4JI5H 4B3MH 4PDBA 4MTEA 1S03G 4JI3H 4APMA 2OWOA 1Z2NX 2YCHA 4MV7A 4RB0A 3RJ0A 4A2BA 2UXCH 4X65H 3L4JA 1HR0H 1M0WA 4LH6A 5LMNH 4JI6H 5D1OB 5IT9W 1I94H 1FVIA 4RB2C 4RAZA 2F4VH 2HVQA 4I7HA 4RAYA 3RGZA 3FMAA 1SYXB 4GKJH 4LFCH 3CVZA 4UCOA 1SEIA 3KAKA 3RIZA 3N41B 5D1PA 3L2PA 4DUZH 4LF4H 1HNZH 4LF9H 4B3RH 2UUCH 3HXLA 4EEQA 2WDTA 1BJTA 1S68A 5EOYA 1A0IA 3BA8A 4ETSA 1IBMH 3N42B 4LH7A 3RTXA 4JI0H 2Q2TA 1HNWH 1B04A 4NXMH 4UFZA 3H20A 4B3SH 4FM9A 3JSLA 1V9PA 4K0KH 3RGXA 2UUAH 3MWMA 4JI2H 4X66H 1IBLH 3EYYA 4JI8H 4LMYA 4NXNH 4LSXA 4Q0YA 5D1OA 3C0FB 2HVRA 4UCVA 3L4KA 2VOBA 3BAAA 5FD6A 1VS0A 5FPRA 1XNQH 2E5LH 4KHPH 4RB3C 1HNXH 2VUGA 4B3TH 2MCTA 1M0TA 2CW8A 1DGSA 3F8NA 4UCSA 3RF2A 4RZQA 5BR8H 4UCUA 4AQYH 4GKKH 1TA8A 4A2AA 1Z2PX 4JV5H 3KAJA 2W57A 4DR3H 3J81W 1GYFA 3OTOH 4JYAH 2CW7A 4MV9A 4CC5A 2KSWA 3KALA 4LFAH 5LL6b 4DV1H 2ZJTA 3BA9A 4EFEA 4YY3H 4DR1H 4JI1H 4LF5H 3DF7A 2HGSA 4M7EA 1Z2OX 3M4IA 4J0MA 4RB1A 4DV5H 1XMQH 1O75A 4UCRA 1FKAH 1N32H 1AN7A 1E4FT 1WH2A 1TAEA 1J5EH 3JSNA 3LMLA 3IG0A 4LSAA 2WYOA 4YHHH 3T1HH 4DV0H 3K3VA 2HVSA 2UU9H 2XIGA 4X62H 4DUYH 2Q2UA 4LF7H 2ZM6H 1X9NA 3N43B 1XMOH 1E4GT 3N6XA 1N34H 5FPOA 4X64H 3PN1A 2VPSA 1L2ZA 4DR2H 4GLXA 4UCTA 1BGWA 2RGVA 4DV6H 4LF8H 4DV4H 2FE3A 1N33H 2WE6A 1IBKH 4LF6H 4DR7H 4OX9H 5IWAH 1ZHSA 3J7AK 2HHHH 2VQEH 4CC6A 4DR6H 4R7RA 3J80W 2VQFH 5LMUH 5FD5A 3BABA 4JI7H 1FJGH 1XDNA 3T1YH 2UXDH 4LFBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYF A;  1L2Z A;  3FMA A;  4BWS C;  3K3V A;  1SYX B;  1WH2 A; 
#chains in the Genus database with same CATH topology
 4O3R A;  3GTL A;  4GC7 A;  2NU9 B;  4DV2 H;  3JAM W;  2V4R A;  3RB0 A;  1S0O A;  4YJ2 F;  1KJ9 A;  4EFB A;  3GTQ A;  2JA5 A;  4MV3 A;  3NGD A;  4JV1 A;  2WAQ A;  3OHB A;  2C00 A;  2W6N A;  1W93 A;  5JUM A;  5KFN A;  4IRD A;  1I6U A;  4I50 F;  5KT6 A;  1WCM A;  2ASD A;  1TWG A;  1S0N A;  1RYS A;  4MTE A;  4JI3 H;  3MR2 A;  3QFF A;  2JEJ A;  4MV7 A;  3V4S A;  4DL2 A;  1V51 A;  1CQJ B;  3JZI A;  2JA5 G;  2NVY A;  1HR0 H;  1KJQ A;  5K2M A;  4DL5 A;  2R86 A;  5KFQ A;  4NLG A;  4RUC A;  5D1O B;  5IT9 W;  2YRW A;  1FVI A;  5KFC A;  4RB2 C;  2R7N A;  4I7H A;  5GON F;  3RGZ A;  4J9O A;  1WCM G;  1SYX B;  4PWQ A;  2XGP A;  2W8K A;  4XYM B;  1UC8 A;  4DL6 A;  4TUY F;  2W6Q A;  4JV2 A;  2UUC H;  2V59 A;  4ZI7 F;  2R8J A;  5L1J A;  4Y8V B;  1KEE A;  5KFL A;  4C5C A;  2P0A A;  2YRX A;  3KHR A;  4EBE A;  4JI0 H;  3Q2O A;  2Q2T A;  5T14 A;  3TII A;  4NXM H;  4IRK A;  3H20 A;  5CB4 F;  5KFI A;  1GSO A;  4HR7 A;  3WO1 A;  4I4T F;  4A3M G;  3LP8 A;  4M9U A;  1T3N A;  3KTM A;  4JI8 H;  3N8D A;  5D1O A;  3OSN A;  3L4K A;  2XCP A;  4ED0 A;  5DQI A;  1EHI A;  4O3N A;  5FD6 A;  3MR5 A;  5KFF A;  3KHL A;  5KFT A;  1XNQ H;  4KHP H;  2CZG A;  5KT5 A;  2MCT A;  4MV1 A;  5KFM A;  2FPI B;  4UCU A;  1VBH A;  1SCU B;  4JV5 H;  2PMZ A;  2W57 A;  5L1L A;  4HYK A;  3K5H A;  3GIK A;  3J81 W;  2BQU A;  4JYA H;  3KHH A;  4MV9 A;  3Q8R B;  4QW9 A;  1B6S A;  5KFA A;  4DR1 H;  1BXR A;  2R92 A;  2JA6 A;  4RB1 A;  2VA2 A;  1JLL B;  3ORR A;  4UCR A;  4XYL B;  5DGA A;  2R7L A;  2NU8 B;  3JSN A;  4RUA A;  3R5F A;  4RNO A;  3LML A;  2XGQ A;  3IG0 A;  3OUZ A;  4ECS A;  2ASL A;  4IR9 A;  2ZDG A;  3VPC A;  2F4V H;  1X9N A;  2R92 G;  1XMO H;  1KJJ A;  5KG1 A;  4RU9 A;  3GV5 B;  2JA6 G;  1DV1 A;  1IOV A;  3HOX G;  5CA1 F;  1N34 H;  4X64 H;  3PN1 A;  4F4Y A;  5BMV F;  3I4N G;  3PW2 A;  2RGV A;  4I55 F;  4LF8 H;  4MA5 A;  2FE3 A;  3M9M B;  2HJW A;  2CQY A;  4AYB E;  4DV4 H;  4IR1 A;  4A3C G;  2I87 A;  1JDB B;  4MV8 A;  3U9T A;  4CC6 A;  5KFO A;  4DR6 H;  4R7R A;  3I4M G;  3HB9 A;  3J80 W;  1K1Q A;  2XD4 A;  2R85 A;  4TQR A;  3ETJ A;  5LYJ F;  4XZ3 B;  3QZ7 A;  4Q8F A;  1EUD B;  2I8C A;  5KG6 A;  5CA0 F;  5C3E G;  4YBZ B;  4DV3 H;  3AYH B;  2WTF A;  2UVU A;  5JVL A;  3FKI A;  4BWS C;  4DR5 H;  3ETH A;  2WAQ E;  4QWE A;  5IP9 G;  1CE8 A;  1MZB A;  3V6K A;  4YR3 A;  4EBC A;  4ECY A;  5A2Q W;  1B6R A;  5KT4 A;  4IAJ A;  4MTD A;  3GIJ A;  3QZ8 A;  4F4Z A;  4ECX A;  2UUB H;  4JI5 H;  3SI8 A;  4DL3 A;  3HOY G;  4PDB A;  4Q8E A;  2UVR A;  2FPP B;  3GIQ A;  1OWT A;  4RB0 A;  1CS0 A;  3FKI G;  2W9B B;  1RK6 A;  2FP4 B;  2R8K A;  3KHG A;  5LMN H;  4JI6 H;  4F4X A;  2W9C A;  1I7N A;  4RAZ A;  2HVQ A;  5KFK A;  3BJY A;  3BG5 A;  2WB1 E;  4GKJ H;  2E2H A;  2OLS A;  4JV0 A;  2AGP A;  3L2P A;  3KAK A;  4LF4 H;  4DR4 H;  3HBL A;  3MR6 A;  5DQH A;  3H4B A;  3PZP A;  4B3R H;  1W96 A;  4DL4 A;  1EUC B;  2R84 A;  3MJF A;  2W71 A;  5KFB A;  4ECU A;  1S68 A;  3GV8 B;  5EOY A;  2W70 A;  1RK5 A;  3BA8 A;  3HKZ A;  3K3P A;  1ZQ7 A;  4LH7 A;  3RTX A;  2QYZ A;  4C5A A;  4F4W A;  3WNZ A;  1HNW H;  1B04 A;  2M05 A;  4UFZ A;  4B3S H;  3RUP A;  1I7L A;  1VBG A;  1V9P A;  5C1O A;  4FM9 A;  1ZET A;  2FJZ A;  2VPQ A;  3MWM A;  5J2T F;  3RGX A;  3Q8S B;  5KFS A;  4RNM A;  1GGO A;  2W6Z A;  5DG9 A;  2W9B A;  4X66 H;  4A93 G;  2NU7 B;  2NUA B;  5IP7 G;  3MWE A;  4GC6 A;  4IWX A;  3GII A;  2W6M A;  1CQI B;  4RNN A;  1ULZ A;  2WB1 A;  5FPR A;  1Y1V A;  4E4T A;  2I80 A;  4HNV A;  3Q8Q B;  2PBZ A;  5JQW A;  3F8N A;  2C22 A;  4YB8 B;  2DIK A;  5EZY F;  4AQY H;  5KT3 A;  1E4E B;  2PMZ E;  3G6X A;  3GTO A;  2ZDH A;  4YAJ B;  5EWG A;  4A3B G;  2JEG A;  4FBU A;  3H3V H;  4A3D G;  5C44 G;  4FS2 A;  1GYF A;  1EYZ A;  4XX0 B;  1PX2 A;  5DLG A;  2CW7 A;  3OTO H;  2R7Z A;  1Y1V G;  4TV9 F;  4LFA H;  3BA9 A;  1N32 H;  3PW5 A;  5KX5 F;  5KT7 A;  5BPH A;  2W6P A;  2W7P A;  3GIL A;  3PW7 A;  2RF4 A;  1JIH A;  2R7K A;  3TQT A;  3HOV G;  2GPS A;  4O2A F;  2R7Z G;  4YHH H;  3TIG A;  4DV0 H;  2UU9 H;  4X62 H;  4DUY H;  2BQ3 A;  2C35 B;  5JVD F;  3MFI A;  5DGB A;  2YZN A;  5FPO A;  2R8G A;  4O3O A;  2VPS A;  5KFG A;  3VPD A;  4R8U B;  4DR2 H;  3PW4 A;  3T5J A;  1E4E A;  4UCT A;  1BNC A;  3G8C A;  4DV6 H;  1IBK H;  2IBK A;  4J9L A;  5KFD A;  5IWA H;  2GLT A;  4IZO A;  5CAE B;  3J7A K;  2VQE H;  2YZG A;  5EWE A;  3Q8P B;  2R8I A;  3GIP A;  3PO3 G;  5FD5 A;  1DV2 A;  4L1K A;  4ECZ A;  2Y0S E;  3T1Y H;  4O4I F;  1S10 A;  5DG8 A;  4J9K A;  2UXD H;  3GTK A;  4TQS A;  2C28 A;  2B63 A;  4JI4 H;  2BR0 A;  2JA8 G;  2FPG B;  1WR2 A;  1ZHQ A;  4MA0 A;  2AGQ A;  1GSA A;  4C5B A;  2R7M A;  4IHJ F;  4IWY A;  2RDJ A;  3TIN A;  2FB9 A;  2W8L A;  5C1P A;  2OH2 A;  1XNR H;  2DLN A;  2B63 G;  1S03 G;  3GIM A;  2OWO A;  2YCH A;  2IA6 A;  1I3Q A;  2UXC H;  4X65 H;  2E2I A;  4TV8 F;  1KJ8 A;  2J9G A;  3L4J A;  2ALZ A;  4LH6 A;  1K83 A;  2YZM A;  4O3S A;  4ED2 A;  2VR1 A;  3TQ1 A;  2RDI A;  4RAY A;  3V6J A;  3FMA A;  2Y0S A;  4A3K G;  2R82 A;  3CVZ A;  4UCO A;  1SEI A;  4EGQ A;  3G6V A;  1RJP A;  5D1P A;  3RBE A;  2FLP A;  4WD3 A;  3BQ1 A;  1HNZ H;  4LF9 H;  1TWA A;  4ED1 A;  3HXL A;  2AGO A;  2YS7 A;  2J6T A;  2NVX A;  4YR2 A;  1JKJ B;  2NU6 B;  3R23 A;  2XCA A;  3HKZ E;  5KFV A;  1A0I A;  1IBM H;  4QJF A;  4IRC A;  3N42 B;  2VUM A;  4K0K H;  3K5I A;  1Y1W A;  4J9P A;  1VAJ A;  1RJQ A;  3JSL A;  2YYA A;  2V4Q A;  5HBR B;  5IYZ F;  4JI2 H;  3WO0 A;  3BQ2 A;  4ECT A;  4A3L G;  4LSX A;  2VUM G;  1RJR A;  5KFE A;  4O3Q A;  1AUX A;  2HVR A;  5KFU A;  4EGJ A;  1Y1W G;  3EPI A;  4ED3 A;  2ZDQ A;  1UC9 A;  1HNX H;  2VUG A;  2JA7 A;  2CW8 A;  1DGS A;  1I50 A;  4U7C A;  3GV7 B;  2UVV A;  3RV3 A;  4A2A A;  1Z2P X;  4HNU A;  3Q1K A;  3PO2 G;  3KAJ A;  5IYB G;  1C3O A;  4MAM A;  4J9M A;  3JRW A;  1IOW A;  4YJ3 F;  3RFC A;  2JA7 G;  5KFP A;  3PW0 A;  2KSW A;  4QIW A;  2UVW A;  5LL6 b;  4DV1 H;  2ZJT A;  1B33 N;  2SCU B;  4YY3 H;  3M9N B;  3FDS A;  3DF7 A;  4QWB A;  1GLV A;  2HGS A;  1Z2O X;  4J0M A;  1KBL A;  3M9O B;  1XMQ H;  1O75 A;  1UNN C;  2R8H A;  1FKA H;  4BY7 G;  2IP4 A;  1AN7 A;  4J9N A;  1WH2 A;  1TAE A;  5KG7 A;  4ECV A;  4QWD A;  3T5L A;  1J5E H;  5EDW A;  5KG4 A;  4QWA A;  3E5N A;  4A3G G;  3OUU A;  5KFR A;  1N56 A;  3RB3 A;  4YQW A;  3SE7 A;  3K3V A;  2HVS A;  2XIG A;  5C8Y F;  4EYI B;  3N6X A;  5KG0 A;  3GID A;  2R6F A;  4A3I G;  3ORQ A;  2VQD A;  1L2Z A;  4GLX A;  1AUV A;  2QK4 A;  1M7J A;  3VMM A;  1N33 H;  5KFX A;  3EPG A;  5IYC G;  5L9X A;  3GTG A;  4OX9 H;  4J9S A;  1ZHS A;  2HHH H;  2JEI A;  1DIK A;  2VQF H;  2YW2 A;  2J6U A;  3BAB A;  3OHA A;  4JI7 H;  1KC7 A;  1KJI A;  3OSP A;  3RV4 A;  3G6Y A;  3MR3 A;  4U6P A;  5KFW A;  2XC9 A;  3RAX A;  4LFB H;  5HV6 A;  3MWD A;  1P8L A;  3N44 B;  5FLX W;  2DWC A;  3N40 P;  2UXB H;  4O3P A;  2O03 A;  3KXY T;  3H4D A;  4ECQ A;  1N48 A;  2RGR A;  4ECW A;  5JH7 F;  3UQ8 A;  4DV7 H;  1RYR A;  4BBS G;  2FLN A;  2FK3 A;  1N36 H;  2DPI A;  4J9Q A;  1T36 A;  1TWH A;  4G3I A;  5KFY A;  5C4X G;  5LP6 F;  4B3M H;  2AU0 A;  4O4H F;  4APM A;  4A3E G;  4HNT A;  1Z2N X;  3GLK A;  4DLK A;  3RJ0 A;  4BXX G;  4A2B A;  5F9L A;  5L1K A;  2FKL A;  1TWF A;  2XCL A;  4ED8 A;  5DG7 A;  1M0W A;  2PN1 A;  5BPF A;  3HOW G;  2VA3 A;  3V6H A;  3H40 A;  4Q43 A;  1I94 H;  2PVP A;  2W7O A;  1Y14 B;  4EEY A;  3GTP A;  5J2U F;  4LFC H;  4HQ6 A;  3R5H A;  3RIZ A;  2AQ4 A;  3N41 B;  3H0G A;  4DUZ H;  1PK8 A;  4QW8 A;  2DPJ A;  2FLL A;  3T5K A;  4ZOL F;  4F50 A;  2CKZ B;  5KFZ A;  4EEQ A;  2WDT A;  2YU9 A;  4YAK B;  4YR0 A;  1BJT A;  2R87 A;  4EG0 A;  4Q44 A;  1K1S A;  2GPW A;  1SFO A;  4ETS A;  3V4Z A;  3RBD A;  2IMW P;  5D8D A;  3H0G G;  1S9F A;  3GTM A;  1M6V A;  3R5X A;  3PVX A;  2V5A A;  4O4L F;  2V9W A;  4R8U A;  2R93 A;  2UUA H;  4ZHQ F;  3CQZ A;  1IBL H;  3EYY A;  4LMY A;  5DLF A;  3HOZ G;  4NXN H;  2X0S A;  4Q0Y A;  2ATL A;  2YL2 A;  2BQR A;  3C0F B;  5C5J A;  4UCV A;  3UFX B;  2VOB A;  4FS1 A;  4QWC A;  3BAA A;  2JEF A;  2R93 G;  3U9S A;  1VS0 A;  4Q45 A;  4J9R A;  2E5L H;  1GSH A;  5EWF A;  4MV6 A;  4RB3 C;  3PR5 B;  3IN5 A;  5DQG A;  4B3T H;  1M0T A;  4ME6 A;  1WSC A;  5L1I A;  4ECR A;  4ED7 A;  4UCS A;  1EZ1 A;  4RZQ A;  1C30 A;  2FMA A;  3RF2 A;  5BR8 H;  1TA8 A;  3I12 A;  4C2M A;  5IYD G;  3BQ0 A;  4DL7 A;  4GKK H;  1S0M A;  4A3J G;  4DR3 H;  4YP3 A;  1A9X A;  4BY1 G;  5KKN B;  4CC5 A;  2W9C B;  2YS6 A;  4QIW E;  3KAL A;  4DR7 H;  3GQC A;  4LF5 H;  5H80 A;  5KG3 A;  4EFE A;  4JI1 H;  4M7E A;  3M4I A;  4RZR A;  4DV5 H;  2C2E A;  4BBR G;  1E4F T;  5LXT F;  4EYH B;  2V58 A;  2FK1 A;  5KT2 A;  2DZD A;  1T94 A;  3PR4 A;  4LSA A;  2WYO A;  3LWB A;  3T1H H;  5F9N A;  4A3F G;  2C2R A;  1GO3 E;  5FLM G;  3T5H A;  2W6O A;  2C2D A;  2Q2U A;  3HOU G;  5KG5 A;  2ZM6 H;  4LF7 H;  1V4Y A;  3N43 B;  1E4G T;  3RAQ A;  4EBD A;  3RB4 A;  3VPB A;  1BGW A;  1VKZ A;  5LOV F;  1JX4 A;  2WE6 A;  4LF6 H;  4O2B F;  5KFJ A;  4FBT A;  4AYB A;  4ED6 A;  1JXL A;  5KG2 A;  5FJ8 G;  2FK2 A;  4JUZ A;  1JDE A;  4ZQI A;  3MFH A;  3GTJ A;  1TWC A;  3JRX A;  2ASJ A;  4FU0 A;  4MV4 A;  5I47 A;  5LMU H;  4WBN F;  1R9T A;  2J6S A;  1FJG H;  1XDN A;  3RB6 A;  5KFH A;  1S97 A;  5LA6 F;  2W9A A; 
#chains in the Genus database with same CATH homology
 1P8L A;  4DV3 H;  4JI4 H;  3N44 B;  5FLX W;  2UXB H;  3N40 P;  2O03 A;  3KXY T;  4DV2 H;  3JAM W;  4BWS C;  4DR5 H;  2RGR A;  1ZHQ A;  4EFB A;  3UQ8 A;  4DV7 H;  4DR4 H;  1MZB A;  1N36 H;  5A2Q W;  4MTD A;  4IAJ A;  1I6U A;  2UUB H;  1XNR H;  4JI5 H;  4B3M H;  4PDB A;  4MTE A;  1S03 G;  4JI3 H;  4APM A;  2OWO A;  1Z2N X;  2YCH A;  4MV7 A;  4RB0 A;  3RJ0 A;  4A2B A;  2UXC H;  4X65 H;  3L4J A;  1HR0 H;  1M0W A;  4LH6 A;  5LMN H;  4JI6 H;  5D1O B;  5IT9 W;  1I94 H;  1FVI A;  4RB2 C;  4RAZ A;  2F4V H;  2HVQ A;  4I7H A;  4RAY A;  3RGZ A;  3FMA A;  1SYX B;  4GKJ H;  4LFC H;  3CVZ A;  4UCO A;  1SEI A;  3KAK A;  3RIZ A;  3N41 B;  5D1P A;  3L2P A;  4DUZ H;  4LF4 H;  1HNZ H;  4LF9 H;  4B3R H;  2UUC H;  3HXL A;  4EEQ A;  2WDT A;  1BJT A;  1S68 A;  5EOY A;  1A0I A;  3BA8 A;  4ETS A;  1IBM H;  3N42 B;  4LH7 A;  3RTX A;  4JI0 H;  2Q2T A;  1HNW H;  1B04 A;  4NXM H;  4UFZ A;  3H20 A;  4B3S H;  4FM9 A;  3JSL A;  1V9P A;  4K0K H;  3RGX A;  2UUA H;  3MWM A;  4JI2 H;  4X66 H;  1IBL H;  3EYY A;  4JI8 H;  4LMY A;  4NXN H;  4LSX A;  4Q0Y A;  5D1O A;  3C0F B;  2HVR A;  4UCV A;  3L4K A;  2VOB A;  3BAA A;  5FD6 A;  1VS0 A;  5FPR A;  1XNQ H;  2E5L H;  4KHP H;  4RB3 C;  1HNX H;  2VUG A;  4B3T H;  2MCT A;  1M0T A;  2CW8 A;  1DGS A;  3F8N A;  4UCS A;  3RF2 A;  4RZQ A;  5BR8 H;  4UCU A;  4AQY H;  4GKK H;  1TA8 A;  4A2A A;  1Z2P X;  4JV5 H;  3KAJ A;  2W57 A;  4DR3 H;  3J81 W;  1GYF A;  3OTO H;  4JYA H;  2CW7 A;  4MV9 A;  4CC5 A;  2KSW A;  3KAL A;  4LFA H;  5LL6 b;  4DV1 H;  2ZJT A;  3BA9 A;  4EFE A;  4YY3 H;  4DR1 H;  4JI1 H;  4LF5 H;  3DF7 A;  2HGS A;  4M7E A;  1Z2O X;  3M4I A;  4J0M A;  4RB1 A;  4DV5 H;  1XMQ H;  1O75 A;  4UCR A;  1FKA H;  1N32 H;  1AN7 A;  1E4F T;  1WH2 A;  1TAE A;  1J5E H;  3JSN A;  3LML A;  3IG0 A;  4LSA A;  2WYO A;  4YHH H;  3T1H H;  4DV0 H;  3K3V A;  2HVS A;  2UU9 H;  2XIG A;  4X62 H;  4DUY H;  2Q2U A;  4LF7 H;  2ZM6 H;  1X9N A;  3N43 B;  1XMO H;  1E4G T;  3N6X A;  1N34 H;  5FPO A;  4X64 H;  3PN1 A;  2VPS A;  1L2Z A;  4DR2 H;  4GLX A;  4UCT A;  1BGW A;  2RGV A;  4DV6 H;  4LF8 H;  4DV4 H;  2FE3 A;  1N33 H;  2WE6 A;  1IBK H;  4LF6 H;  4DR7 H;  4OX9 H;  5IWA H;  1ZHS A;  3J7A K;  2HHH H;  2VQE H;  4CC6 A;  4DR6 H;  4R7R A;  3J80 W;  2VQF H;  5LMU H;  5FD5 A;  3BAB A;  4JI7 H;  1FJG H;  1XDN A;  3T1Y H;  2UXD H;  4LFB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...