3K3VA

Crystal structure the gyf domain of s. cerevisiae smy2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
79
structure length
79
Chain Sequence
ESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SMY2
total genus 24
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3k3vA00
3FMAA 1SYXB 1GYFA 1WH2A 1L2ZA 3K3VA 4BWSC
chains in the Genus database with same CATH superfamily
2R92G 5C8YF 2FK1A 4J9QA 2DZDA 3OTOH 5KFCA 1Y1VA 1BNCA 2UUBH 3HOZG 1C3OA 2WTFA 1W96A 1VAJA 2VOBA 1HR0H 2FP4B 4ED1A 3VPBA 2W9CB 5IYCG 3PVXA 3GTQA 4ED7A 1IOWA 4PWQA 4O3NA 4WBNF 1JX4A 4A3LG 1Y14B 3RV3A 3VMMA 1A9XA 3L4KA 5LXTF 1CQJB 2WE6A 2NVYA 3N8DA 4DL6A 3T1YH 2I8CA 4DR3H 4F4WA 1M0TA 1I50A 4ECZA 4CC5A 2PMZE 4O4LF 2FPIB 4LFBH 5FLXW 4GKJH 3I4MG 3U9SA 4RUAA 5KFYA 2WAQA 1TWGA 3BA9A 4RAYA 5EOYA 2RGVA 4I55F 2UVRA 4YP3A 5KFOA 1SEIA 4UCOA 4BY1G 4IRDA 1ULZA 3CQZA 5DGAA 1K83A 4MV1A 4LMYA 2C35B 3BQ2A 4EBEA 2E2HA 1RJPA 2YZGA 5CAEB 4QWEA 2R7LA 4MA5A 5LL6b 3GIJA 2W9AA 2R7ZG 3R23A 2DWCA 1BGWA 1XNRH 4HYKA 3ETHA 2OLSA 4TQRA 4Q8EA 2JA7G 3VPCA 3GV7B 1ZQ7A 2HHHH 3KAKA 1RK6A 5LA6F 1M7JA 5DLGA 3ORQA 1IBKH 4YAKB 5L9XA 2VQEH 1AUVA 4GKKH 1RYSA 4A3IG 2UXBH 4X64H 1EUCB 3V4ZA 2FLNA 4Y8VB 4YY3H 3IN5A 2F4VH 1P8LA 4FBTA 2VPSA 4RNMA 3TIGA 1O75A 1OWTA 4HNUA 2FLPA 2FMAA 4J9MA 4M9UA 2C2DA 1VBGA 5I47A 2R6FA 1Z2OX 2VQDA 2XIGA 2R93A 2O03A 4ZHQF 1UC9A 2HVQA 1L2ZA 1FVIA 1I7LA 5K2MA 5LOVF 1KJQA 2YCHA 4RNNA 1GGOA 3KHGA 4EYHB 3V6HA 2UUAH 3SE7A 2V4RA 2R7MA 4RB1A 5LMUH 3MR2A 5KG2A 2Y0SA 2W6QA 4C5CA 4B3MH 5IP7G 2FE3A 4J0MA 4X66H 3R5HA 1N36H 4DV3H 4I50F 4O3SA 4O3QA 4OX9H 3RUPA 3H4BA 4NXNH 3N43B 3QFFA 4JI3H 2V4QA 2YZMA 5JVDF 1Y1VG 5KFJA 5EZYF 4FU0A 3G8CA 3Q1KA 2VR1A 1TA8A 3K5HA 5KFEA 4O3RA 1JDBB 5KG3A 4A3GG 4FBUA 2W9BB 1TAEA 3GIKA 2V5AA 4HR7A 4M7EA 1GSHA 4DR2H 4IRKA 4Q45A 4RAZA 3GTGA 3HB9A 5H80A 1X9NA 1EUDB 4ZOLF 3RFCA 2CKZB 3IG0A 4JUZA 4U7CA 1JLLB 2W9CA 2ASJA 3GLKA 3GTPA 1KJJA 2XCLA 1E4FT 4EEQA 4AYBA 3UFXB 5KFWA 4QWAA 4F50A 2VQFH 1T3NA 2YU9A 5C5JA 3PW2A 4A3EG 4A93G 3QZ8A 4QIWA 1JIHA 3CVZA 3GILA 2W57A 2R84A 4TV9F 3WO0A 4HNVA 3M9OB 4DV4H 1M0WA 1SYXB 5KFKA 1GYFA 4NLGA 4YR0A 3Q8RB 1WR2A 4DR4H 5KFUA 2V58A 4A2BA 5KFHA 3I4NG 2DLNA 4C5AA 2YZNA 3ETJA 1JKJB 5KFAA 5KFDA 3T1HH 3WNZA 3RB6A 4C5BA 2W9BA 5IT9W 2XCAA 4MTEA 4DR1H 1Y1WG 2YW2A 1AN7A 1T94A 2P0AA 5KFLA 3N40P 5FPRA 4JV1A 2VUGA 3PW5A 3MWDA 5L1KA 4DR5H 1RK5A 4JYAH 2XGQA 5KT6A 1WCMA 1CS0A 2PBZA 2W6NA 4ED6A 2VA2A 2W7OA 2R8IA 3PO3G 2FPGB 5KT4A 3MR3A 4EYIB 3OSPA 4RB3C 3C0FB 1SFOA 3M9MB 3JRWA 4HQ6A 4ECQA 2GPWA 3V6JA 2IP4A 3KXYT 2YS7A 3MWMA 4EGQA 3RIZA 1TWFA 4EBCA 3RAXA 1HNWH 4R7RA 4DV6H 1V4YA 2YYAA 1A0IA 2FB9A 3L2PA 2FJZA 3H3VH 3BABA 3WO1A 2R8JA 2CW8A 2NU7B 2OH2A 1VS0A 3QZ7A 1B04A 3N42B 3PW4A 4TV8F 4MV3A 4KHPH 4JI2H 3MJFA 1C30A 2DPJA 2NU9B 3PR5B 4UCTA 5KFGA 4J9PA 4A3FG 2R82A 4ETSA 3G6YA 4DV5H 4QIWE 2B63G 2VPQA 3H0GG 2V59A 3PW7A 4ECYA 4ED3A 1ZETA 1S97A 1DIKA 1S0NA 4UFZA 2Y0SE 1WCMG 4F4ZA 2NVXA 5JVLA 4B3TH 1MZBA 4LF4H 4UCUA 3LWBA 4MTDA 2W71A 3GQCA 4J9KA 4DL7A 1RJRA 4LSXA 3HXLA 5KFVA 2IBKA 1Y1WA 4JI1H 4F4YA 3GTMA 4YR3A 4XZ3B 2GPSA 4R8UA 3H20A 3HOYG 1ZHSA 3BA8A 5KFMA 2XGPA 2V9WA 5HV6A 1WH2A 3SI8A 2I87A 1RJQA 1S0MA 3GIQA 1KC7A 3RB4A 3RB0A 2JEIA 5D1OA 5KG5A 3GTJA 5KFRA 1AUXA 2NU6B 2E5LH 2AGOA 4YQWA 1Z2PX 1R9TA 1S03G 2VUMA 2HJWA 1FJGH 2FKLA 2RDIA 4LH7A 5C1PA 2SCUB 2ZDHA 4I4TF 4A2AA 3Q8SB 4EEYA 2UVUA 5HBRB 2PVPA 5FJ8G 2R85A 4EG0A 3RGXA 4DUYH 4A3KG 3RAQA 2JA6A 3BQ0A 3OUZA 4O2BF 3RGZA 4J9OA 1XMOH 4IZOA 5C1OA 5L1LA 3DF7A 4BBSG 3OUUA 4AYBE 3N44B 3J81W 1VKZA 3H4DA 2ZDGA 4LF5H 5KT7A 3JSNA 1DV1A 1EYZA 3KAJA 2J6TA 5J2UF 4JI6H 5KFBA 4TUYF 1K1QA 3GIIA 2HGSA 3J80W 2XD4A 4R8UB 2C2EA 1WSCA 4Q0YA 2QYZA 3PO2G 3RTXA 4YJ2F 3U9TA 4Q8FA 3N6XA 4IR1A 3KHRA 4DV0H 4FS2A 1XMQH 1RYRA 5DQIA 2C00A 4ME6A 1GSAA 4XYMB 2FK2A 4J9RA 1KJ8A 1S0OA 2BQUA 4I7HA 3K3VA 5F9NA 2JEFA 2UUCH 4XX0B 1PX2A 2JEGA 3FMAA 3MR5A 4A3DG 2B63A 3OHBA 1HNXH 4EFEA 5KG1A 4RZRA 2AQ4A 3V4SA 2R87A 4LSAA 3RBEA 4NXMH 4CC6A 3HOVG 5KFZA 2W8LA 5C3EG 5L1IA 1W93A 2X0SA 3JZIA 3GTOA 5DQHA 4X62H 4ZI7F 4UCSA 2ATLA 3BJYA 2NU8B 2HVSA 5D1PA 3TQTA 2R8HA 4JI5H 1KJ9A 4ECUA 5KFQA 2UXDH 2E2IA 5KFPA 4O2AF 3UQ8A 4B3RH 5BR8H 1T36A 3HBLA 1IBMH 1XDNA 2AGQA 3F8NA 3PN1A 4YBZB 5IYZF 4K0KH 4DR6H 1V51A 1I6UA 3K3PA 4QWDA 4QWBA 1KEEA 2W6MA 3GTKA 4YHHH 4DL5A 1FKAH 4G3IA 2JEJA 3Q8QB 1I94H 3KHHA 2AU0A 2C28A 4LF9H 2W6PA 3M4IA 4J9LA 2ASLA 2BQRA 3Q2OA 4RUCA 5KT3A 4IRCA 1GLVA 4F4XA 4IHJF 2JA7A 3EYYA 3KHLA 2BQ3A 4E4TA 4L1KA 4IWXA 3OHAA 1N34H 1S68A 3MR6A 1JXLA 2GLTA 4RB2C 3PR4A 2C22A 4WD3A 3JAMW 5A2QW 4A3JG 1DV2A 4JI8H 3HOXG 3HOWG 3EPIA 4GC7A 2ZJTA 5BPHA 2J6UA 3TQ1A 4JI0H 1BXRA 4DV1H 3BG5A 4ED8A 4MV9A 3T5HA 4DL4A 3HKZE 3ORRA 4EGJA 3PZPA 5KFIA 3RB3A 3TIIA 4ECXA 1EZ1A 2YL2A 3GV8B 5C44G 3FKIG 3M9NB 3EPGA 4ED0A 5D8DA 1XNQH 1GSOA 4DLKA 3TINA 3H0GA 3J7AK 1VBHA 5JUMA 4U6PA 2UXCH 5CB4F 1N56A 1PK8A 4A3BG 5DG8A 5KG4A 4BWSC 2ZM6H 1N32H 4UCRA 2C2RA 4YB8B 5KFFA 1UNNC 3RF2A 3G6VA 4JI4H 4APMA 5DGBA 3HOUG 1I3QA 4ECWA 5DLFA 1HNZH 3K5IA 5FPOA 4DL2A 2IMWP 1N33H 5EWEA 2R92A 4EBDA 2R7ZA 3GTLA 1V9PA 2WB1E 5KT2A 5KFTA 1KBLA 3GIMA 2J6SA 4O4IF 2RDJA 4JV0A 2CZGA 1UC8A 5LYJF 2WYOA 3JRXA 5FD6A 1BJTA 4DUZH 4B3SH 5KT5A 1IOVA 1TWCA 4HNTA 1M6VA 4RNOA 1E4EB 3R5FA 4XYLB 5LMNH 2JA5G 5F9LA 4ED2A 4YJ3F 1ZHQA 4RZQA 4TQSA 4DL3A 4IR9A 3BAAA 4JI7H 2QK4A 5IYBG 1K1SA 5EDWA 4MAMA 4AQYH 2XC9A 3E5NA 2W70A 3KTMA 5KFXA 2FK3A 4MA0A 4BBRG 4LF6H 4J9NA 5CA0F 1I7NA 1SCUB 2J9GA 4IWYA 3AYHB 5KG0A 3FKIA 4Q43A 4QWCA 4IAJA 4YAJB 2ALZA 5T14A 3L4JA 1CQIB 2FPPB 4QW9A 4A3CG 2RGRA 2R8GA 3RV4A 4A3MG 3NGDA 4ECVA 5BMVF 2R86A 4GLXA 1EHIA 1IBLH 5C4XG 5EWGA 4J9SA 3V6KA 3PW0A 2W6OA 5FLMG 4LH6A 2UU9H 3MFHA 3RJ0A 4LF8H 3KALA 5EWFA 4JV2A 4PDBA 2YRXA 2VA3A 5IYDG 3Q8PB 5IP9G 2CQYA 5JQWA 2YS6A 4EFBA 5KFNA 2R7KA 4DR7H 3T5JA 2Q2UA 4LFAH 2JA6G 1N48A 4YR2A 1DGSA 1TWHA 4Q44A 3VPDA 1J5EH 2HVRA 2M05A 5DG9A 2RF4A 2VUMG 5BPFA 2XCPA 1B6SA 4GC6A 1E4GT 4DV2H 4LFCH 4UCVA 1JDEA 1GO3E 2W8KA 1KJIA 3MWEA 2BR0A 5FD5A 5GONF 5KFSA 4FM9A 2KSWA 2WAQE 3BQ1A 3RBDA 2NUAB 4X65H 3GIDA 4DV7H 4O4HF 2DIKA 2R7NA 5KG7A 2I80A 2YRWA 4O3PA 4ZQIA 3LMLA 3H40A 3MFIA 2DPIA 4ECRA 1CE8A 2CW7A 5DQGA 1S9FA 3I12A 4MV6A 5D1OB 5CA1F 2ZDQA 3GV5B 2UVVA 2Q2TA 2UVWA 4JV5H 3JSLA 3R5XA 3OSNA 4BY7G 4ECTA 4MV4A 3LP8A 2PN1A 2AGPA 2MCTA 3G6XA 2PMZA 5LP6F 2R8KA 4MV8A 1TWAA 3GIPA 3HKZA 4QJFA 2IA6A 4LF7H 4BXXG 5IWAH 2ASDA 2W6ZA 5J2TF 3T5KA 2WDTA 4RB0A 2JA5A 5DG7A 2OWOA 4QW8A 1Z2NX 1S10A 4FS1A 1B6RA 4MV7A 5KKNB 2W7PA 5JH7F 2JA8G 1B33N 2FLLA 5L1JA 2R93G 4ECSA 3N41B 4RU9A 4C2MA 3T5LA 5KX5F 4O3OA 2WB1A 5KG6A 1E4EA 3FDSA
chains in the Genus database with same CATH topology
3CVZA 1V9PA 3OTOH 2W57A 3DF7A 2UUBH 3N44B 3J81W 2VOBA 1HR0H 2WYOA 4LF5H 5FD6A 1BJTA 3JSNA 1M0WA 1SYXB 3KAJA 4DUZH 4DV4H 4B3SH 4JI6H 1GYFA 3L4KA 2HGSA 3J80W 5LMNH 2WE6A 4DR4H 3T1YH 4DR3H 4Q0YA 1ZHQA 4RZQA 3RTXA 4A2BA 1M0TA 4CC5A 3N6XA 3BAAA 4JI7H 4LFBH 5FLXW 4DV0H 1XMQH 4GKJH 3T1HH 4AQYH 3BA9A 4LF6H 4RAYA 5IT9W 4I7HA 3K3VA 2RGVA 5EOYA 4MTEA 2UUCH 4DR1H 4IAJA 1AN7A 3FMAA 3L4JA 3N40P 5FPRA 2VUGA 1SEIA 2RGRA 4UCOA 4EFEA 1HNXH 4DR5H 4JYAH 4LMYA 4LSAA 4GLXA 4NXMH 4CC6A 1IBLH 5LL6b 4LH6A 1XNRH 4X62H 4RB3C 2UU9H 3C0FB 3RJ0A 4LF8H 4UCSA 2HHHH 3KAKA 3KALA 1IBKH 2HVSA 5D1PA 4PDBA 4JI5H 2VQEH 4GKKH 2UXDH 3KXYT 3RIZA 3MWMA 1HNWH 4X64H 3UQ8A 4B3RH 2UXBH 4R7RA 4DV6H 4EFBA 5BR8H 1A0IA 4YY3H 3L2PA 4DR7H 2Q2UA 4LFAH 1IBMH 1P8LA 1XDNA 2F4VH 3F8NA 3PN1A 2VPSA 1DGSA 4K0KH 3BABA 1J5EH 2HVRA 4DR6H 1I6UA 1O75A 2CW8A 1VS0A 1B04A 3N42B 4YHHH 1FKAH 4KHPH 4JI2H 1I94H 1Z2OX 4LF9H 2XIGA 3M4IA 2O03A 2HVQA 1E4GT 4UCTA 1FVIA 4DV2H 4LFCH 1L2ZA 4UCVA 2YCHA 4ETSA 2UUAH 4DV5H 3EYYA 5FD5A 4FM9A 4RB1A 5LMUH 2KSWA 4X65H 4DV7H 1N34H 4B3MH 1S68A 2FE3A 4UFZA 4RB2C 4J0MA 4X66H 1N36H 3LMLA 1MZBA 4DV3H 4B3TH 3JAMW 5A2QW 4UCUA 4MTDA 4LF4H 2CW7A 4JI8H 4OX9H 4LSXA 3HXLA 5D1OB 2ZJTA 4NXNH 3N43B 4JV5H 4JI1H 2Q2TA 4JI3H 3JSLA 4JI0H 4DV1H 3H20A 1ZHSA 2MCTA 3BA8A 4MV9A 1TA8A 1WH2A 4LF7H 5IWAH 5D1OA 1TAEA 2WDTA 4RB0A 4M7EA 4DR2H 2OWOA 1XNQH 1Z2NX 2E5LH 4RAZA 3J7AK 1S03G 1Z2PX 4MV7A 2UXCH 1X9NA 4LH7A 2ZM6H 1FJGH 4BWSC 3IG0A 4A2AA 1N32H 4UCRA 4JI4H 3RF2A 4APMA 1E4FT 4EEQA 3RGXA 4DUYH 3N41B 1HNZH 2VQFH 5FPOA 1N33H 3RGZA 1BGWA 1XMOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  1SYX B;  1GYF A;  1WH2 A;  1L2Z A;  3K3V A;  4BWS C; 
#chains in the Genus database with same CATH topology
 2R92 G;  5C8Y F;  2FK1 A;  4J9Q A;  2DZD A;  3OTO H;  5KFC A;  1Y1V A;  1BNC A;  2UUB H;  3HOZ G;  1C3O A;  2WTF A;  1W96 A;  1VAJ A;  2VOB A;  1HR0 H;  2FP4 B;  4ED1 A;  3VPB A;  2W9C B;  5IYC G;  3PVX A;  3GTQ A;  4ED7 A;  1IOW A;  4PWQ A;  4O3N A;  4WBN F;  1JX4 A;  4A3L G;  1Y14 B;  3RV3 A;  3VMM A;  1A9X A;  3L4K A;  5LXT F;  1CQJ B;  2WE6 A;  2NVY A;  3N8D A;  4DL6 A;  3T1Y H;  2I8C A;  4DR3 H;  4F4W A;  1M0T A;  1I50 A;  4ECZ A;  4CC5 A;  2PMZ E;  4O4L F;  2FPI B;  4LFB H;  5FLX W;  4GKJ H;  3I4M G;  3U9S A;  4RUA A;  5KFY A;  2WAQ A;  1TWG A;  3BA9 A;  4RAY A;  5EOY A;  2RGV A;  4I55 F;  2UVR A;  4YP3 A;  5KFO A;  1SEI A;  4UCO A;  4BY1 G;  4IRD A;  1ULZ A;  3CQZ A;  5DGA A;  1K83 A;  4MV1 A;  4LMY A;  2C35 B;  3BQ2 A;  4EBE A;  2E2H A;  1RJP A;  2YZG A;  5CAE B;  4QWE A;  2R7L A;  4MA5 A;  5LL6 b;  3GIJ A;  2W9A A;  2R7Z G;  3R23 A;  2DWC A;  1BGW A;  1XNR H;  4HYK A;  3ETH A;  2OLS A;  4TQR A;  4Q8E A;  2JA7 G;  3VPC A;  3GV7 B;  1ZQ7 A;  2HHH H;  3KAK A;  1RK6 A;  5LA6 F;  1M7J A;  5DLG A;  3ORQ A;  1IBK H;  4YAK B;  5L9X A;  2VQE H;  1AUV A;  4GKK H;  1RYS A;  4A3I G;  2UXB H;  4X64 H;  1EUC B;  3V4Z A;  2FLN A;  4Y8V B;  4YY3 H;  3IN5 A;  2F4V H;  1P8L A;  4FBT A;  2VPS A;  4RNM A;  3TIG A;  1O75 A;  1OWT A;  4HNU A;  2FLP A;  2FMA A;  4J9M A;  4M9U A;  2C2D A;  1VBG A;  5I47 A;  2R6F A;  1Z2O X;  2VQD A;  2XIG A;  2R93 A;  2O03 A;  4ZHQ F;  1UC9 A;  2HVQ A;  1L2Z A;  1FVI A;  1I7L A;  5K2M A;  5LOV F;  1KJQ A;  2YCH A;  4RNN A;  1GGO A;  3KHG A;  4EYH B;  3V6H A;  2UUA H;  3SE7 A;  2V4R A;  2R7M A;  4RB1 A;  5LMU H;  3MR2 A;  5KG2 A;  2Y0S A;  2W6Q A;  4C5C A;  4B3M H;  5IP7 G;  2FE3 A;  4J0M A;  4X66 H;  3R5H A;  1N36 H;  4DV3 H;  4I50 F;  4O3S A;  4O3Q A;  4OX9 H;  3RUP A;  3H4B A;  4NXN H;  3N43 B;  3QFF A;  4JI3 H;  2V4Q A;  2YZM A;  5JVD F;  1Y1V G;  5KFJ A;  5EZY F;  4FU0 A;  3G8C A;  3Q1K A;  2VR1 A;  1TA8 A;  3K5H A;  5KFE A;  4O3R A;  1JDB B;  5KG3 A;  4A3G G;  4FBU A;  2W9B B;  1TAE A;  3GIK A;  2V5A A;  4HR7 A;  4M7E A;  1GSH A;  4DR2 H;  4IRK A;  4Q45 A;  4RAZ A;  3GTG A;  3HB9 A;  5H80 A;  1X9N A;  1EUD B;  4ZOL F;  3RFC A;  2CKZ B;  3IG0 A;  4JUZ A;  4U7C A;  1JLL B;  2W9C A;  2ASJ A;  3GLK A;  3GTP A;  1KJJ A;  2XCL A;  1E4F T;  4EEQ A;  4AYB A;  3UFX B;  5KFW A;  4QWA A;  4F50 A;  2VQF H;  1T3N A;  2YU9 A;  5C5J A;  3PW2 A;  4A3E G;  4A93 G;  3QZ8 A;  4QIW A;  1JIH A;  3CVZ A;  3GIL A;  2W57 A;  2R84 A;  4TV9 F;  3WO0 A;  4HNV A;  3M9O B;  4DV4 H;  1M0W A;  1SYX B;  5KFK A;  1GYF A;  4NLG A;  4YR0 A;  3Q8R B;  1WR2 A;  4DR4 H;  5KFU A;  2V58 A;  4A2B A;  5KFH A;  3I4N G;  2DLN A;  4C5A A;  2YZN A;  3ETJ A;  1JKJ B;  5KFA A;  5KFD A;  3T1H H;  3WNZ A;  3RB6 A;  4C5B A;  2W9B A;  5IT9 W;  2XCA A;  4MTE A;  4DR1 H;  1Y1W G;  2YW2 A;  1AN7 A;  1T94 A;  2P0A A;  5KFL A;  3N40 P;  5FPR A;  4JV1 A;  2VUG A;  3PW5 A;  3MWD A;  5L1K A;  4DR5 H;  1RK5 A;  4JYA H;  2XGQ A;  5KT6 A;  1WCM A;  1CS0 A;  2PBZ A;  2W6N A;  4ED6 A;  2VA2 A;  2W7O A;  2R8I A;  3PO3 G;  2FPG B;  5KT4 A;  3MR3 A;  4EYI B;  3OSP A;  4RB3 C;  3C0F B;  1SFO A;  3M9M B;  3JRW A;  4HQ6 A;  4ECQ A;  2GPW A;  3V6J A;  2IP4 A;  3KXY T;  2YS7 A;  3MWM A;  4EGQ A;  3RIZ A;  1TWF A;  4EBC A;  3RAX A;  1HNW H;  4R7R A;  4DV6 H;  1V4Y A;  2YYA A;  1A0I A;  2FB9 A;  3L2P A;  2FJZ A;  3H3V H;  3BAB A;  3WO1 A;  2R8J A;  2CW8 A;  2NU7 B;  2OH2 A;  1VS0 A;  3QZ7 A;  1B04 A;  3N42 B;  3PW4 A;  4TV8 F;  4MV3 A;  4KHP H;  4JI2 H;  3MJF A;  1C30 A;  2DPJ A;  2NU9 B;  3PR5 B;  4UCT A;  5KFG A;  4J9P A;  4A3F G;  2R82 A;  4ETS A;  3G6Y A;  4DV5 H;  4QIW E;  2B63 G;  2VPQ A;  3H0G G;  2V59 A;  3PW7 A;  4ECY A;  4ED3 A;  1ZET A;  1S97 A;  1DIK A;  1S0N A;  4UFZ A;  2Y0S E;  1WCM G;  4F4Z A;  2NVX A;  5JVL A;  4B3T H;  1MZB A;  4LF4 H;  4UCU A;  3LWB A;  4MTD A;  2W71 A;  3GQC A;  4J9K A;  4DL7 A;  1RJR A;  4LSX A;  3HXL A;  5KFV A;  2IBK A;  1Y1W A;  4JI1 H;  4F4Y A;  3GTM A;  4YR3 A;  4XZ3 B;  2GPS A;  4R8U A;  3H20 A;  3HOY G;  1ZHS A;  3BA8 A;  5KFM A;  2XGP A;  2V9W A;  5HV6 A;  1WH2 A;  3SI8 A;  2I87 A;  1RJQ A;  1S0M A;  3GIQ A;  1KC7 A;  3RB4 A;  3RB0 A;  2JEI A;  5D1O A;  5KG5 A;  3GTJ A;  5KFR A;  1AUX A;  2NU6 B;  2E5L H;  2AGO A;  4YQW A;  1Z2P X;  1R9T A;  1S03 G;  2VUM A;  2HJW A;  1FJG H;  2FKL A;  2RDI A;  4LH7 A;  5C1P A;  2SCU B;  2ZDH A;  4I4T F;  4A2A A;  3Q8S B;  4EEY A;  2UVU A;  5HBR B;  2PVP A;  5FJ8 G;  2R85 A;  4EG0 A;  3RGX A;  4DUY H;  4A3K G;  3RAQ A;  2JA6 A;  3BQ0 A;  3OUZ A;  4O2B F;  3RGZ A;  4J9O A;  1XMO H;  4IZO A;  5C1O A;  5L1L A;  3DF7 A;  4BBS G;  3OUU A;  4AYB E;  3N44 B;  3J81 W;  1VKZ A;  3H4D A;  2ZDG A;  4LF5 H;  5KT7 A;  3JSN A;  1DV1 A;  1EYZ A;  3KAJ A;  2J6T A;  5J2U F;  4JI6 H;  5KFB A;  4TUY F;  1K1Q A;  3GII A;  2HGS A;  3J80 W;  2XD4 A;  4R8U B;  2C2E A;  1WSC A;  4Q0Y A;  2QYZ A;  3PO2 G;  3RTX A;  4YJ2 F;  3U9T A;  4Q8F A;  3N6X A;  4IR1 A;  3KHR A;  4DV0 H;  4FS2 A;  1XMQ H;  1RYR A;  5DQI A;  2C00 A;  4ME6 A;  1GSA A;  4XYM B;  2FK2 A;  4J9R A;  1KJ8 A;  1S0O A;  2BQU A;  4I7H A;  3K3V A;  5F9N A;  2JEF A;  2UUC H;  4XX0 B;  1PX2 A;  2JEG A;  3FMA A;  3MR5 A;  4A3D G;  2B63 A;  3OHB A;  1HNX H;  4EFE A;  5KG1 A;  4RZR A;  2AQ4 A;  3V4S A;  2R87 A;  4LSA A;  3RBE A;  4NXM H;  4CC6 A;  3HOV G;  5KFZ A;  2W8L A;  5C3E G;  5L1I A;  1W93 A;  2X0S A;  3JZI A;  3GTO A;  5DQH A;  4X62 H;  4ZI7 F;  4UCS A;  2ATL A;  3BJY A;  2NU8 B;  2HVS A;  5D1P A;  3TQT A;  2R8H A;  4JI5 H;  1KJ9 A;  4ECU A;  5KFQ A;  2UXD H;  2E2I A;  5KFP A;  4O2A F;  3UQ8 A;  4B3R H;  5BR8 H;  1T36 A;  3HBL A;  1IBM H;  1XDN A;  2AGQ A;  3F8N A;  3PN1 A;  4YBZ B;  5IYZ F;  4K0K H;  4DR6 H;  1V51 A;  1I6U A;  3K3P A;  4QWD A;  4QWB A;  1KEE A;  2W6M A;  3GTK A;  4YHH H;  4DL5 A;  1FKA H;  4G3I A;  2JEJ A;  3Q8Q B;  1I94 H;  3KHH A;  2AU0 A;  2C28 A;  4LF9 H;  2W6P A;  3M4I A;  4J9L A;  2ASL A;  2BQR A;  3Q2O A;  4RUC A;  5KT3 A;  4IRC A;  1GLV A;  4F4X A;  4IHJ F;  2JA7 A;  3EYY A;  3KHL A;  2BQ3 A;  4E4T A;  4L1K A;  4IWX A;  3OHA A;  1N34 H;  1S68 A;  3MR6 A;  1JXL A;  2GLT A;  4RB2 C;  3PR4 A;  2C22 A;  4WD3 A;  3JAM W;  5A2Q W;  4A3J G;  1DV2 A;  4JI8 H;  3HOX G;  3HOW G;  3EPI A;  4GC7 A;  2ZJT A;  5BPH A;  2J6U A;  3TQ1 A;  4JI0 H;  1BXR A;  4DV1 H;  3BG5 A;  4ED8 A;  4MV9 A;  3T5H A;  4DL4 A;  3HKZ E;  3ORR A;  4EGJ A;  3PZP A;  5KFI A;  3RB3 A;  3TII A;  4ECX A;  1EZ1 A;  2YL2 A;  3GV8 B;  5C44 G;  3FKI G;  3M9N B;  3EPG A;  4ED0 A;  5D8D A;  1XNQ H;  1GSO A;  4DLK A;  3TIN A;  3H0G A;  3J7A K;  1VBH A;  5JUM A;  4U6P A;  2UXC H;  5CB4 F;  1N56 A;  1PK8 A;  4A3B G;  5DG8 A;  5KG4 A;  4BWS C;  2ZM6 H;  1N32 H;  4UCR A;  2C2R A;  4YB8 B;  5KFF A;  1UNN C;  3RF2 A;  3G6V A;  4JI4 H;  4APM A;  5DGB A;  3HOU G;  1I3Q A;  4ECW A;  5DLF A;  1HNZ H;  3K5I A;  5FPO A;  4DL2 A;  2IMW P;  1N33 H;  5EWE A;  2R92 A;  4EBD A;  2R7Z A;  3GTL A;  1V9P A;  2WB1 E;  5KT2 A;  5KFT A;  1KBL A;  3GIM A;  2J6S A;  4O4I F;  2RDJ A;  4JV0 A;  2CZG A;  1UC8 A;  5LYJ F;  2WYO A;  3JRX A;  5FD6 A;  1BJT A;  4DUZ H;  4B3S H;  5KT5 A;  1IOV A;  1TWC A;  4HNT A;  1M6V A;  4RNO A;  1E4E B;  3R5F A;  4XYL B;  5LMN H;  2JA5 G;  5F9L A;  4ED2 A;  4YJ3 F;  1ZHQ A;  4RZQ A;  4TQS A;  4DL3 A;  4IR9 A;  3BAA A;  4JI7 H;  2QK4 A;  5IYB G;  1K1S A;  5EDW A;  4MAM A;  4AQY H;  2XC9 A;  3E5N A;  2W70 A;  3KTM A;  5KFX A;  2FK3 A;  4MA0 A;  4BBR G;  4LF6 H;  4J9N A;  5CA0 F;  1I7N A;  1SCU B;  2J9G A;  4IWY A;  3AYH B;  5KG0 A;  3FKI A;  4Q43 A;  4QWC A;  4IAJ A;  4YAJ B;  2ALZ A;  5T14 A;  3L4J A;  1CQI B;  2FPP B;  4QW9 A;  4A3C G;  2RGR A;  2R8G A;  3RV4 A;  4A3M G;  3NGD A;  4ECV A;  5BMV F;  2R86 A;  4GLX A;  1EHI A;  1IBL H;  5C4X G;  5EWG A;  4J9S A;  3V6K A;  3PW0 A;  2W6O A;  5FLM G;  4LH6 A;  2UU9 H;  3MFH A;  3RJ0 A;  4LF8 H;  3KAL A;  5EWF A;  4JV2 A;  4PDB A;  2YRX A;  2VA3 A;  5IYD G;  3Q8P B;  5IP9 G;  2CQY A;  5JQW A;  2YS6 A;  4EFB A;  5KFN A;  2R7K A;  4DR7 H;  3T5J A;  2Q2U A;  4LFA H;  2JA6 G;  1N48 A;  4YR2 A;  1DGS A;  1TWH A;  4Q44 A;  3VPD A;  1J5E H;  2HVR A;  2M05 A;  5DG9 A;  2RF4 A;  2VUM G;  5BPF A;  2XCP A;  1B6S A;  4GC6 A;  1E4G T;  4DV2 H;  4LFC H;  4UCV A;  1JDE A;  1GO3 E;  2W8K A;  1KJI A;  3MWE A;  2BR0 A;  5FD5 A;  5GON F;  5KFS A;  4FM9 A;  2KSW A;  2WAQ E;  3BQ1 A;  3RBD A;  2NUA B;  4X65 H;  3GID A;  4DV7 H;  4O4H F;  2DIK A;  2R7N A;  5KG7 A;  2I80 A;  2YRW A;  4O3P A;  4ZQI A;  3LML A;  3H40 A;  3MFI A;  2DPI A;  4ECR A;  1CE8 A;  2CW7 A;  5DQG A;  1S9F A;  3I12 A;  4MV6 A;  5D1O B;  5CA1 F;  2ZDQ A;  3GV5 B;  2UVV A;  2Q2T A;  2UVW A;  4JV5 H;  3JSL A;  3R5X A;  3OSN A;  4BY7 G;  4ECT A;  4MV4 A;  3LP8 A;  2PN1 A;  2AGP A;  2MCT A;  3G6X A;  2PMZ A;  5LP6 F;  2R8K A;  4MV8 A;  1TWA A;  3GIP A;  3HKZ A;  4QJF A;  2IA6 A;  4LF7 H;  4BXX G;  5IWA H;  2ASD A;  2W6Z A;  5J2T F;  3T5K A;  2WDT A;  4RB0 A;  2JA5 A;  5DG7 A;  2OWO A;  4QW8 A;  1Z2N X;  1S10 A;  4FS1 A;  1B6R A;  4MV7 A;  5KKN B;  2W7P A;  5JH7 F;  2JA8 G;  1B33 N;  2FLL A;  5L1J A;  2R93 G;  4ECS A;  3N41 B;  4RU9 A;  4C2M A;  3T5L A;  5KX5 F;  4O3O A;  2WB1 A;  5KG6 A;  1E4E A;  3FDS A; 
#chains in the Genus database with same CATH homology
 3CVZ A;  1V9P A;  3OTO H;  2W57 A;  3DF7 A;  2UUB H;  3N44 B;  3J81 W;  2VOB A;  1HR0 H;  2WYO A;  4LF5 H;  5FD6 A;  1BJT A;  3JSN A;  1M0W A;  1SYX B;  3KAJ A;  4DUZ H;  4DV4 H;  4B3S H;  4JI6 H;  1GYF A;  3L4K A;  2HGS A;  3J80 W;  5LMN H;  2WE6 A;  4DR4 H;  3T1Y H;  4DR3 H;  4Q0Y A;  1ZHQ A;  4RZQ A;  3RTX A;  4A2B A;  1M0T A;  4CC5 A;  3N6X A;  3BAA A;  4JI7 H;  4LFB H;  5FLX W;  4DV0 H;  1XMQ H;  4GKJ H;  3T1H H;  4AQY H;  3BA9 A;  4LF6 H;  4RAY A;  5IT9 W;  4I7H A;  3K3V A;  2RGV A;  5EOY A;  4MTE A;  2UUC H;  4DR1 H;  4IAJ A;  1AN7 A;  3FMA A;  3L4J A;  3N40 P;  5FPR A;  2VUG A;  1SEI A;  2RGR A;  4UCO A;  4EFE A;  1HNX H;  4DR5 H;  4JYA H;  4LMY A;  4LSA A;  4GLX A;  4NXM H;  4CC6 A;  1IBL H;  5LL6 b;  4LH6 A;  1XNR H;  4X62 H;  4RB3 C;  2UU9 H;  3C0F B;  3RJ0 A;  4LF8 H;  4UCS A;  2HHH H;  3KAK A;  3KAL A;  1IBK H;  2HVS A;  5D1P A;  4PDB A;  4JI5 H;  2VQE H;  4GKK H;  2UXD H;  3KXY T;  3RIZ A;  3MWM A;  1HNW H;  4X64 H;  3UQ8 A;  4B3R H;  2UXB H;  4R7R A;  4DV6 H;  4EFB A;  5BR8 H;  1A0I A;  4YY3 H;  3L2P A;  4DR7 H;  2Q2U A;  4LFA H;  1IBM H;  1P8L A;  1XDN A;  2F4V H;  3F8N A;  3PN1 A;  2VPS A;  1DGS A;  4K0K H;  3BAB A;  1J5E H;  2HVR A;  4DR6 H;  1I6U A;  1O75 A;  2CW8 A;  1VS0 A;  1B04 A;  3N42 B;  4YHH H;  1FKA H;  4KHP H;  4JI2 H;  1I94 H;  1Z2O X;  4LF9 H;  2XIG A;  3M4I A;  2O03 A;  2HVQ A;  1E4G T;  4UCT A;  1FVI A;  4DV2 H;  4LFC H;  1L2Z A;  4UCV A;  2YCH A;  4ETS A;  2UUA H;  4DV5 H;  3EYY A;  5FD5 A;  4FM9 A;  4RB1 A;  5LMU H;  2KSW A;  4X65 H;  4DV7 H;  1N34 H;  4B3M H;  1S68 A;  2FE3 A;  4UFZ A;  4RB2 C;  4J0M A;  4X66 H;  1N36 H;  3LML A;  1MZB A;  4DV3 H;  4B3T H;  3JAM W;  5A2Q W;  4UCU A;  4MTD A;  4LF4 H;  2CW7 A;  4JI8 H;  4OX9 H;  4LSX A;  3HXL A;  5D1O B;  2ZJT A;  4NXN H;  3N43 B;  4JV5 H;  4JI1 H;  2Q2T A;  4JI3 H;  3JSL A;  4JI0 H;  4DV1 H;  3H20 A;  1ZHS A;  2MCT A;  3BA8 A;  4MV9 A;  1TA8 A;  1WH2 A;  4LF7 H;  5IWA H;  5D1O A;  1TAE A;  2WDT A;  4RB0 A;  4M7E A;  4DR2 H;  2OWO A;  1XNQ H;  1Z2N X;  2E5L H;  4RAZ A;  3J7A K;  1S03 G;  1Z2P X;  4MV7 A;  2UXC H;  1X9N A;  4LH7 A;  2ZM6 H;  1FJG H;  4BWS C;  3IG0 A;  4A2A A;  1N32 H;  4UCR A;  4JI4 H;  3RF2 A;  4APM A;  1E4F T;  4EEQ A;  3RGX A;  4DUY H;  3N41 B;  1HNZ H;  2VQF H;  5FPO A;  1N33 H;  3RGZ A;  1BGW A;  1XMO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...