3K4DA

Crystal structure of e. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
603
structure length
596
Chain Sequence
b'SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 185
structure length 596
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4dA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4dA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4dA03
3G6JE 5DI8A 5DRNB 1HL8A 1CFSA 3KPPB 3S88H 2FATH 4PBVC 3SCVA 4MA3A 1YC8A 3EGSA 1XH3B 1BX2A 1O5DT 3T09A 3S37H 5ITBL 4IM4A 1R0AH 2ATKA 3DO3A 4H8UA 3TBWB 3T77B 4JFYA 5BXRA 2P5EA 3NIDF 4JHWH 5B3JF 1TA3A 4M1DH 3FZUC 4GRMB 1Q72L 4MXWL 4PJAF 1NCUA 3GRWH 4MDOA 2XFXA 4WI7A 4FTVA 4BJLA 1KR1A 3GKWL 4L8SB 3UZEA 5TQ0H 1NOWA 5HNNA 4U6XA 1KCRH 4M8VA 5FO8A 4M1GH 2VN7A 4HKJA 1CICB 3RJDA 3KNBB 3RGVA 4Y5VA 3TIEA 5F89B 2IH3A 3VXME 3DROA 3QUXB 4PJIA 1HSAA 3DX8A 4GRWF 1AHWB 4MAUH 5FA4B 4LRIC 1IL1A 1JWSA 3EYSL 3K4AA 4MA8L 1NC2D 1UY4A 1MEXH 3N1AA 1MFEH 1RP8A 1Y18A 3R4DA 3PABB 4UZUA 1PZ5A 1J83A 5C2UB 3QPXH 2F74A 1R24A 2IANA 3K74B 3VXRB 3L4VA 1CXKA 4KXZH 1I1CA 1CFNA 4EVNB 3MCG1 2XWTA 3IETB 5GJSL 1YMME 5CZKA 4TSBL 2UYLA 2XZZA 2GVYA 1OQOA 1CGSL 2YBRB 4IMKC 2JF6A 5AZEL 2OYPA 1P7QB 1YEDA 5IWLC 2BVOA 2D7MA 4APQD 2OZ4A 2AEPH 1SBSH 2E9JA 3QIUB 2VQUA 4ZFFB 1BD2A 1JNDA 2IAMB 4FXKA 2ESVB 3ARZA 1NCNA 4QNPF 4OFYD 1ZVSA 4I4WB 3GBEA 5ABHA 4OGYH 1LD9B 1BLNB 1LO2H 5ISZA 2HKFL 3LKPA 4BSVA 1PMHX 4LEOB 3RY6C 4Z7OE 1LQSR 2I9LA 3LS5L 3T2NH 1DLFH 2CIPA 3MXWL 3F65A 1F97A 4MYWB 1A2YA 1CDGA 2P46B 4PV9A 2BVUA 8FABB 4DUVA 4UQ3A 4CUBA 3R06A 3QEQD 4HAGA 1LWJA 4BF7A 5F7NC 1WB0A 1HH6B 3BP5A 4PS4H 2ARWA 2P24B 4XVTL 3MRPA 2OWCA 5D9SA 5KZCD 3U0TB 1UWEL 5JW4N 3M46A 2RQ8A 2VH5L 3UNPA 2VJXA 3DUUB 3D85A 4NN6B 1RZ8B 2VR9A 4HT1L 2Y6GA 4U1NB 1EERB 2UZXB 5C7XH 4JO3H 5BVJA 2VDKL 1Y6KR 3BKYL 2VITA 3QQ4A 5KSBE 2RFXB 4NN7B 3WIJA 4L9LA 1HJUA 3KPMB 4HCRA 2VWEE 3WXVH 2EDRA 1X6NA 1UD3A 4Y7MA 3FRPG 3ECBA 5KOVC 5HI4C 1I3GH 5B4MC 4PJCF 5F3HB 2WIMA 4KZDL 4AIOA 4KRUA 5JXHA 3QRGL 4F80A 4MQ7B 2A1WL 3OKEA 2WVTA 1UCTA 4R6UA 4QCEA 5E5UB 2Y5TA 1VAHA 2DDQH 1IQWH 1R5VA 2ZXAA 4ZUWA 2HYXA 5DN2A 1QOKA 3WFLA 4S1DD 5MHSD 5DO2D 4TX6A 4JY5H 4M9OA 4FQXA 3EO9L 1D2KA 1N5YH 3WD0A 3RWFA 5DQJA 5ECJE 1H3XA 4UOJA 3LSOB 3VFRB 4ALAL 4NOFA 5F7MC 2Z9TA 3BKMH 5DWUH 4UT9H 4XAWL 4W50A 1GONA 5GPRA 4EEEA 1U30A 5FHBL 3WD3A 1WWWX 2OZ4H 4N0UA 3DOSA 1CDBA 1WIOA 5DVOA 5I19H 1RZKH 2A38A 2VWEC 5GRWA 1NC2B 3N13A 3QHNA 3K2UL 4MLIA 5KEZA 1TZGL 4BQCA 1OD0A 4C56D 3U7BA 2ZPKH 4HQQL 4LQ1A 4LLMB 5FA3A 5GISH 2EDXA 2V38A 3ARBB 2ORXA 4XUQA 3DXAD 4Y0GA 4P2QD 3GBML 5KVMC 3WEXB 5TQ2H 4BQ4A 4M4RA 3CH9A 3C7GA 2RB8A 3VXNA 3FFDA 4N8PA 4NQSB 5GHWH 4AEHL 5DT1L 2DB8A 3E8UL 4FFVD 5KSUB 4Z2HA 1V02A 4KQ4L 1I5PA 4LLYB 2EEBA 1OM3H 3V9FA 1JV5B 1UWXH 3ARGD 1JHJA 1V03A 4D0BB 4ZS7L 1DWJM 3W6LA 5E4IA 4JRYB 2RV9A 4M48H 3PV6A 2VLKD 2MCPH 2YL9A 5CQ1A 5I15H 5E9DB 2VXQL 3SQOH 4NM8H 1R87A 4NM4H 1TR1A 4GJTB 4URIA 4ISVB 2XN9E 3I9GH 1UT9A 1SJHA 3HCVB 4NKOA 3SE4A 4HCRH 1A47A 2M1KA 3BAEL 4LK4A 3WDQA 4HKZA 5IHZB 1EJOL 1E4LA 5D1XD 5FHAH 4F58H 2YD1A 1KJ2A 1UM4H 4QF1A 1A9BA 1NAMH 1GIGL 2EE9A 3TJEL 3ZKQD 2DT2A 1A7QL 4DAGL 3OR7A 2XQBH 3HI6L 1UADC 2NNAB 3GGLA 3RO8A 4IHOA 2VXSH 3OKMB 5I3DA 3CJJA 3FHQA 5M7QA 1NLDH 3VD7A 1N7MH 5MEND 3WN5B 4D0QA 3DX7B 5EBAA 4JO4L 4OYUA 4QXTA 2Q6WA 4Y2DB 4XPAH 4PJXB 3MNVB 1NQ6A 3UBXG 1UWXK 5DSCB 3ZKMC 3CX2A 4LOUC 4EJ1C 2ICES 1NCBL 1PQZB 5F7EL 3ULUD 5HYJA 3LPFA 4A41A 4DXSA 5IB2B 1VKXB 4R2GC 4L29A 3GSUA 2R1YA 1JNLH 4B41A 1MI5E 1L7RA 1UKPA 3VI4E 1AIFB 3TNNB 3WIIH 5CPTA 3MOBH 3V4PL 1S7SA 4XWOD 2V3EA 5F7YC 4RMWA 1F4WH 1HQ4B 4U1IA 5H37H 4LIQL 2DQJL 1KXQE 5D5MB 4TNWF 4OUEA 3VXSE 3AHTA 2NT1A 4MNGA 3E6HA 3MKKA 3LKSB 2D23A 3PL6C 4JB9H 2OSWA 2VCBA 3IFLH 3QSKB 1MPAL 4JM4H 4CN1A 2VXVL 3MLSL 4UUJB 4MADA 1N64L 1C7TA 1HSBA 1N0LA 4RFOH 5EOTA 2LAAA 4F7CA 3C6LA 4HK3N 3FB6B 4ZO6A 2FH8A 2V7HB 5B8CA 5H2BA 3AY4A 4NQUA 2ADFL 2P42B 3WDJA 3MCKB 3ULVH 4OFIA 4CADB 5DFVC 5E6ID 4MAZA 5BZDA 2KL6A 2Y6SC 1G7MA 5F9WC 32C2A 4AZIA 2Y06L 4U0RB 3VGAB 3ES6B 5FKAB 1BJMA 1CGTA 5TFSL 5C0CA 3VFVA 4PJFE 4C56B 2CSPA 4M6OL 2KDGA 2W9DH 4PLJC 4RAUB 4YZFE 4ELMB 4JFDB 5L9DH 4TTDC 3WSUA 2J8HA 1HVQA 3UTTE 2AJVL 5I8OH 4FFZH 3DXAB 2J2ZA 3QDAA 4DKDC 2DQHH 3A0OA 4ODVH 1B0GB 4P2QB 4UDUA 3VILA 3V0WH 4P7LA 3Q1SL 1RURH 2B1AH 1FGVL 1GOQA 1Z5LB 3VH8A 1INQA 3OX8B 3ALWA 4OKDA 1KJ2H 3MACH 1KJ3L 5F1OB 3WUGA 3VG9B 4RMSA 5D8JL 4DEQA 1T2QH 2WMFA 1GGIH 2R56L 2CDGB 2HH0H 4PMZA 2KZWA 1LP9B 3BH9A 5C08A 4AD3A 4NQVA 2DAVA 2YC1B 5C7GA 5ID1A 3IXTB 2VLKB 2Z35A 4XUPA 4HD9A 4UFJA 5DUBA 2R29H 2XFFA 2AABL 1W0NA 5JNYA 1GHRA 3DUHA 2EE6A 3ILQC 1FFPA 1OTTC 3P1IA 4GAJH 1WAAA 1IBGH 1N2RB 4YHIA 3O11A 4RGMB 2PNDA 5D1XB 4KKBC 1AD0A 3CC5A 3EOYG 4AWEA 1OP3H 4WUUA 3GFUA 3OAUL 3C9NA 5FYJL 4PUEA 2BVQA 1KIPA 2EDDA 2O61B 1VERA 1WDRA 4LASL 1WBXA 4D9LL 2JELH 5EFFA 2IPUK 3QDGB 1QI5A 3BW9A 1H0IA 5B39A 4FQJL 2E7LC 5SWZE 2WVVB 1EZVX 3LQZB 5E8PB 4AD5A 3NFNA 4H8WL 2IBGA 3CDFA 4P46C 3RBGA 1K8IB 3QO0B 3MV8E 2AQ1A 5EWIH 1GL4B 1HHIA 1L7TH 1JK8A 1QBLL 1J0IA 2GDVA 1LWRA 1T03L 3MA7A 4LNRB 4K3JL 5I75C 3N15A 3U4AA 5JXEC 4NWUH 3SGEH 2BFVL 5EU5B 3G5VB 1TNNA 2WBJC 3QA3A 2EDKA 1MFCL 3IDYB 3VRIA 3W4RA 2A73A 2W0FB 4HGMA 3E2HB 2XXCB 1I4FA 1IAOA 4X8JB 4GRLB 1LE5A 1JHTB 1OF2A 3DX9B 4H88H 2D4FA 4JL1A 1OP3K 1L9NA 2IC2A 1D9KA 1U3ZA 2ZJSH 1B3JA 2Q8BH 1JFHA 1ODUA 2RGLA 2PYFB 4YQXH 3NIGF 1VGEL 4OLYL 4OF8A 4PJAB 4PJEF 3VXUB 5JXAH 4R5EA 3Q5OA 1WKYA 25C8L 3TPUB 1B0RB 4P2CG 1D5BA 2IMMA 2YN3A 4WFGD 2FIRT 2ZICA 1TMQA 1J1PH 1U6AL 3NTCL 4HA3A 5F1KC 5FUZH 4J3XA 2VN4A 5E6IB 5I8CB 2YPLD 5GSVB 1A7PH 1I7UB 4GMTH 4GXPA 4W5ZA 4GRWB 1J1OL 1DHKA 3KJ4B 4I77H 1UJ3C 1RUQH 5KVEL 1WV7T 1V6YA 1BQHB 1LEIB 2Z91B 4ZFGL 5EBWB 5IP4A 1E9LA 4M00A 2ZKHH 2O5YL 4H25B 4HMDA 1C5DB 5KSVB 2NXYD 2EDLA 4OM1H 2XXMB 1EK3A 5EBLA 4YWGL 4DWSB 1QI3A 4DQOH 1MCOH 1CVSC 4POZC 4J8RA 3MRBB 5EZIL 4ZYKB 1HWHB 2IH1B 4F7EB 2LQRA 3BUYA 5D70H 3DRTA 4XPBH 3OXRB 3ZLQC 1GCFA 1OSEA 1RMFL 1L6XA 1CIYA 2C1PA 4OBSA 1OB1B 4GAFB 1KUMA 3C60B 4XCCL 2W1WA 1O7AA 1UM5H 3PBGA 4TUJA 2CHOA 1A3RL 5C8BB 3ZE0E 5B38G 4JN2A 2YDRA 12E8L 5L6YH 4Y5YA 5D1ZB 5D2NA 4DFIA 3GHBH 4LCCB 1INEL 1SEQH 4D0CA 4UOZA 3THDA 5FUOH 5AWNL 5FKPA 1AQMA 1ZLUH 1RUML 3QHFL 3WIHL 2Z8RA 4JG1H 3CFCH 4RISH 3KDMA 4W4OC 2XM2A 1A3LH 3GEWB 5DQ9A 4L8SC 5TGBB 1A22B 3K0WA 5I1GH 1MFBH 3U7VA 3K1DA 3P77B 4HUWA 4LYRA 2E7BA 5F6IB 4FQLH 1KOAA 2EC9T 4L4VA 1ISWA 2Z8VC 2ESVE 1CICC 1KN4L 4KJYB 2X7LA 4QXUL 5C0AA 1EGZA 2I07A 4OBRA 3K2MC 3QUXC 4HUMB 4R26L 4PJ7F 2ZUYA 4L8CB 1ONQB 5EC1B 1VA9A 3AIWA 1AHWC 3CO4A 3BGFC 5E4EB 1KGCD 4ZD3L 2J1SA 2XWDA 4KK5D 2NY0C 3LMJL 5GGVL 5TH2B 4QWWD 2HVJB 4LLQA 3QAZB 3T1WA 3LZFH 3MMEB 4OJFL 3RIKA 4PRNA 2ZUWA 1WF5A 3VXQB 2YXMA 5MP6L 3P11L 4X80H 5BOPA 3G6AA 4PJCB 4UBDC 2IEPA 4H5SB 1ZLUK 2H8PA 4RGOL 4HF5L 3L4WA 2XPGA 3NZ8A 1KPUA 1KTDB 3QIUC 3EYPA 2CDFB 3QUYC 4U1HB 1B3XA 2IAMC 1K5NB 2GK2A 43CAA 2NY6C 1F5WA 3CFJB 3BKCH 2R0LL 3VW3L 2R15A 2A3AA 5CHNA 1B88A 1E4XL 2DJUA 1PSKL 3HJRA 5DK0B 3D18B 5DMJB 1IAIM 1MCWM 1EOKA 4QDSA 2VXUH 1QNOA 3NABH 3HLAB 3MRNA 4N1HB 1A6ZB 1SHMA 1OF3A 4OFKA 1A4JA 1QRND 4HK3J 4Z7VF 3V7AE 2MMXA 1F42A 3T1FB 1KCVH 4JM2A 1DBJL 2C3WA 1F58H 4KJQD 4CKVX 15C8L 2AKRB 2D7OA 2PCPA 3WV0A 2GUYA 4HHAB 5AD0B 2A6IA 7A3HA 2BX5A 4X6FA 4FQQA 5IVXA 1JYXA 2NXYB 2QADD 1EXUB 3HPNA 3JUYA 4NRZA 4V28A 4V1DB 1WWAX 1KYOJ 1OT2A 2FCBA 4KK6D 3DO7B 2QMKA 1GZPA 1OQXA 1MCWW 4JKPH 1FBIH 4KTEH 4GZ9A 5C6PB 2XRAH 4NN7C 2M2DA 2OYLA 3SE9L 1MFDL 5HGBB 1C16B 5GS0L 2ILLA 2VDOH 1FO0A 4UINL 2W1SA 5GGRY 1DEDA 5FL1A 2FLRT 3F58H 3LEYL 4GZJA 5HGAB 1G9ML 1PFCA 3O45A 3QI9A 3T0EA 4WW1B 1B0WA 2AMGA 2OKXA 4MA1B 4HA1A 5ERWB 2YXFA 4KI5C 1WEJH 4OCYH 3O2VH 4HZLB 3X3FH 4JHZA 3BCDA 3VXOA 2OL3L 2IF7A 3OGVA 1FV1A 5T1DL 1YN6B 3KJ6H 1FFNA 5CAYB 4A6OA 1CL7I 1FPTH 7FABL 1WVZA 2JJWA 3C8HA 5GRXG 2XQYG 2XA8L 3C5SA 2X4TA 4URTB 3I6LD 4B3LA 5CWSB 1UVQA 4RNRA 4B7IA 5F96L 1QLFA 1IM3B 5E9DE 3GMMB 3MUAA 3ARQA 1FRGL 5SX4I 1SY6A 4MNJA 2BVYA 3ZR5A 4G7YL 4NP4L 5DXWA 1EX0A 2GSGB 3KLHD 2PYED 1BYCA 4HMEA 5EUOA 5IMMB 3LB6D 4L3AA 4S11A 4F8QA 3QEQE 3WFEL 3NA4A 1EMTH 1JGEB 2EIZB 3EOTH 3ARBC 5J1AB 1HXJA 3D0VA 1X7QA 3PZMA 4K8RH 3CLFL 2FX8L 4X0KB 2X4SB 4AYFA 3CLEH 4LVHB 2WW8A 1W3HA 5IB4A 3I02B 1EFXA 4BZ1H 4NO5B 4H2CA 4QRPB 3AM8A 5JHDD 2WAGA 2EZ0C 4YHOH 2CJUH 1YMHB 4PJXE 5GRVK 1U8LB 3A67L 3U7WH 5CEZE 4GW1A 4XNXH 3TZVB 2BK8A 4JVWA 4YDIL 1YN7B 2CIIB 4ZTOH 3RWJB 4EANA 1OGAA 3MRDA 2NW2A 1H8SA 3REVB 3BC9A 5C0EA 3KYNB 1G7PA 2YPVH 5E8DH 3WMCA 1QRNB 2AERT 1FZJB 3N9GL 1P4LA 3QCTL 3EYOB 4MXVE 2F5BL 4K7PL 1R64A 3SOBH 5DQ0A 5D5ME 2EKJA 5FM5M 1NCCL 1SM3H 1ACYH 3MOQA 3KL5A 4XHJC 3HRZA 2AEWA 4W5UA 3WD2A 2AK1L 1VPOH 2FNBA 4DM1A 2PETA 5MHSE 1YEFH 4IDLA 1MIML 3PTKA 3KYKH 4DGIL 3L7FB 3X17A 1YEGH 2FSEA 2QADB 3PZOA 1RHFA 1OVZA 3HE6A 3MRGB 2L9LA 3AAZA 3WN5C 2A3HA 1M7DA 1BFOB 3SDCB 5ESAA 4PJBF 4Y2DC 1BIHA 3OJDB 3TFKC 1A6TA 1GHFL 4P57B 1MYRA 1W9DM 1XR9B 2OQJB 3MQIA 3MREA 3L5XL 2DSKA 4PRPA 1EHXA 3DHPA 2J1TA 4LSUH 1BQLL 4LSVH 3A4XA 4YDJA 1J0JA 3X12B 2EYTA 4UIKL 4Y7EA 2P7TB 1NLBH 4C56E 5I2UA 3PZQA 3FONB 4LQFL 3ILPA 3PWPB 5C8JA 3GUTB 1V3HA 1BZ7A 3P9LB 3V0VA 3DXAE 3HI5H 1SY6H 2QHLA 4P2QE 3QEGL 5T1KA 4G6JL 5E7BA 2FR4B 3NCBB 2HKHL 1NH6A 5K9OB 3KPQA 4EK7A 3PHOB 1QYGL 1JI2A 1T0NA 2P8PB 5C0RL 4QX2A 2YPKA 3ACHA 1Q0YL 4JLRB 1S9YB 4F8TA 2XKSA 3MRFA 5HHOB 1KF9B 4RRPA 2BJMH 3VI3E 1D5IH 1RULH 5BO1L 3CDGA 4N9GB 5ABEA 1MNUL 1BJ1H 2VLKE 4C83A 3FMGH 3FKUS 2HVKA 1HN1A 4DGVH 1G9NH 5CZXD 5CBEB 3WO3B 1B6UA 2OLDA 3ZDYE 3PZNA 3QDJA 4PB9H 2BSRA 4U0RC 4OZHF 4OI8A 2V5RA 5F97E 5M03A 4KRNA 1CI5A 4K3EH 1KXVA 4RAVB 1ZLSL 4LP5A 1H3VA 2BV9A 3PWNB 4PBXA 2AQ2A 1ZVHA 4ZAKC 5IVZB 4JHBA 4OZ4B 4P4KB 1CLXA 4P3DB 4U1JB 1I7RB 5EU3B 4PREA 4LARL 5C0DB 1U8MA 1EUTA 3TPKA 2BCKA 4UT6H 5I2IA 4X9IA 2ENYA 3U9PL 2VYRE 3QDGE 3OXSA 5IIEB 2X89A 5JIPA 3VG9C 1RK1A 5JHDB 2GHWB 5E94A 2VVSA 3BT2H 4R4NC 1EH9A 1HE7A 4BK4A 3ULUE 2Y36L 3GI8L 2F54A 3FFCA 1WITA 4JAMB 2NY1D 5JXIA 1MAMH 1S78D 2BSSB 4NUGH 2NY4D 3MUGB 2VC2H 1QLEH 2WP3T 1CDYA 4DN3L 2IFGA 2MHAA 4A6YA 1U8KA 1BOYA 1FVCA 1ZA3B 4PJEB 4X0VA 4ZQKB 5DS8A 2N7AA 2G4FA 2VLMD 5G04L 2B20A 5DA0B 1ZT4B 3GSRB 2P47B 1ZGLP 4NQXB 3B9EA 3WE6B 4QRTB 2BHZA 2Y07L 5BW7A 1HXMB 3NCFB 4PRAB 2DM4A 5M5DA 1JN6B 5CCKL 3CMGA 2WXDM 1EGJL 1QBMH 3LRHA 4HFWA 4JPIA 2OTPA 2QSCL 3VGEA 1O7SA 2AI0H 4KZEL 4I9WD 2H9GB 3VFOB 1UB6A 4M5YH 2JEPA 1H0DA 1MREL 4RX4A 5B3JE 4UNUA 1CE6A 4TTGA 3BDYH 3J7HA 3KR3H 1K2DA 1TCMA 3VXUE 1TVNA 2ZIDA 3NIFE 2Q3ZA 3QJHB 1IFHL 3IDGB 4RA3A 3SGJC 1DBBL 3QIBD 4NC2B 1OLLA 3VFTA 1N59A 1W2KT 3RY6A 3S5LB 4QX0A 4DW2L 3B9DA 4QHNA 4TXWA 1FH9A 2ITCB 2YHGA 1Q4NX 2J7EA 1T89A 2VDRL 3RVVC 5BXFB 3RM8A 1MCHA 5KVFL 1JUFA 2X4QB 3BJLA 5GGRB 3I50L 4KRTA 3HC3L 3PWVA 3LEVL 4OF7A 2AAAA 4KQ3L 1QFWI 1HILB 1M7XA 2CKBL 3MLZL 3MYJB 1PYWA 4Z78A 2WDBA 5GRUH 3IDYC 4WHTB 5HHNA 3E2HC 2XWJA 3C5JB 1GH7A 3KPNB 3SCMC 4I0CC 3O2LA 1G0XA 2JJSC 3TCLA 3ARPA 4GRLC 1O8SA 1AGFA 1KLGA 3VWJD 3HZYA 4P49A 5BROA 3NCYS 4O51B 4NPYB 1QBBA 2V3FA 1E4KA 1E4WL 1F8TL 3LN4B 5DLML 3OKKB 3T0ED 4HULB 4KMTH 4AZ7A 1OARL 3TVMA 1OOAA 1V3JA 4OF5A 5DHVA 5DVMA 3ZL4H 1ZANH 4XPFL 3L5WB 4ZY9A 3CK0L 3BMWA 5DZNA 3U2SB 4NO0D 3DMMB 3IVKA 5I1DB 3MV01 2YD5A 1AI1H 4ZZ5A 4OZIB 1M05A 3KJ4C 1NCAL 4F37K 3BI9X 3P4MB 3VPLA 5JW4Q 1NP2A 3S7GA 2XV6B 3D48R 3K1KC 4HFUH 1OPGL 4A6YH 3OF6D 5E99H 4U4BA 3SDAD 3T65B 4JFEA 4RFNC 1DE4A 1I9IH 3GSXA 1T7VA 2DPEA 4WEMB 4DWSC 2WHJA 5F1NA 1PAMA 5HY9A 4CDHA 4X9FA 4X9YA 3RWGB 2IWGA 3A21A 3LOWA 3RVTC 4NI3A 2ZOLB 4OOUA 1K9TA 5ECUA 3WQ5A 2BVPB 5DURB 1ULPA 5IR1B 4JO1L 2V2TA 1MVFA 4NZRL 3B3IB 2ARJQ 3AREA 2D31B 2NY1B 1TJHH 4WHYH 2NY4B 2AK4D 3MA9H 5DR5L 2XWEA 3F7VB 2Z92A 5FUCC 2XONA 2DN7A 2ZUQB 3EO1B 4IS6B 5D1ZC 1JP5A 1F45A 3KYAA 4LCCC 3BAKA 4HEME 1MJUH 5I16B 4NRRA 4J4PC 4PTMA 5FECB 3RZCD 3SKJL 2UY5A 1MF2H 1TZIA 2R0ZH 5EJZB 1AJ7L 4Z7VB 5JZ7C 1W1TA 1CFBA 1IAKB 2M26A 3GSQA 3VDBA 4HGWB 4TRPH 5IW6A 2AW2A 4R8WL 4XP6H 1UD8A 1EBAA 3D5OF 2GY7B 2HP4A 4UI2A 1MQRA 4Y4KB 2F19L 1AXSB 2OJZH 5BV7B 1F90L 4WFGE 1F02I 3LD8B 5E4EC 2LU4A 1U33A 4XWGL 2H32H 2E8ZA 2YPLE 4TQEH 1A7OH 3G5XA 1MAKA 4XVUD 5D7SH 2NY5L 5F9OH 1LDPH 3DBXA 2C5DC 4PJ5D 4Z7WF 1Q6CA 4DM2A 3RWIB 4HPGA 1HJWA 4MJID 3GSVB 1QPPA 3B9KD 3T3PF 1Q9LA 4M9PA 4TYUA 2DTML 2D3NA 3LV3A 3MRLB 5T3ZD 1UEMA 3S2CA 4FNLL 2OP4H 1MWAL 3VO0A 3B5GA 5DJCB 2DQFA 1AXTH 1R5WB 3EJZC 2JJTC 2IALB 4U1LA 3C8XA 5JTWA 4MNMA 2CK2A 2WBWB 5GS0C 2EQDA 1A4KB 4QRUB 1K85A 2OR9H 3MUY1 2YFUA 4ODHL 2DKMA 4LCWA 3CZFA 5I1IL 3PHAA 3X13B 1AH1A 4GG8B 1AQHA 1BZ9A 4JANB 1WBYB 1IQDA 3H42H 4WTZG 2XYLA 1BHGA 2AAVA 3PXHA 5D7IA 5IFAL 1KELL 2GITA 2X10A 4HIEA 1HJVA 2UV3A 1PG7H 4QLLA 5JOFA 2JK5B 3ZKNC 3OSKA 5L7XH 2QSTA 5D72H 1H0GA 1WC7B 5BMFH 1U3HA 3O41B 4P23D 3DV6A 4PUBH 1L7IL 3D3VA 3TYGH 1QKZL 4HBCL 1C12B 4HXAL 4NHUB 3O8XC 4U6HA 4NYLB 4M61A 2XY2A 4PGCB 2LFGA 3UEQA 3UC0H 4HXBH 1P53A 2H2SD 4DOHB 3A4WA 1KGCE 3MPCA 4AY0A 4S1SH 1FDLL 3MSDA 1BQHG 2NY2D 4NZDA 4XMPL 1NKRA 1E27A 2VZPA 4OLXL 2DJ4A 2AXGB 1S8DA 3EDDA 2BZDA 3MJ6A 4JRXD 2VIRB 1HNYA 1FN4A 1C1EL 3I2CL 4MNQB 1KXTA 4MA1C 2W87A 2HTLC 1HP4A 4EUPB 1W9WA 3EYUL 2DQGH 3UTPD 1OCQA 1KBKA 3IDNA 1XF2A 4G6AD 4M1CD 4X6CA 2APXA 5FIEA 2VDPH 2WMPA 3X3GL 4DKEH 1E28A 3K75B 4QRPE 1LEKA 4PY8I 1ED3B 4Y19B 4G8EA 3FRUA 2PW1A 1OCWH 4D9RD 5HOSA 4R4BA 2YOCA 3WDPP 4MNLA 4M8QA 3B8YA 4JG0H 5CSYA 4U7SA 1KWKA 4O2EB 4CVXA 2PTTA 4U1SA 1FZMA 4KC3B 3KG5A 1UXWA 3KLAB 4PJIF 3U0WH 4PJBB 5DFWH 1SMDA 2P43B 1QRNE 2CUIA 2ZOKA 4BKLB 3BP6B 3W28A 3RUGE 1J0KA 1AVAA 1PGRB 4CMHB 5E0QA 4CD6A 1S7VB 4TOYH 3OZ9H 4D6DA 4PJ5B 1YNTA 3U48A 2DWDA 1SVCP 5BRQA 1TVGA 5ESVB 1UH4A 3GJFB 4W8AA 4X6EA 2G41A 3QG6A 1L7QA 3B9KB 3R8BB 1IRAY 5AAWA 4LVHC 2XZQH 4P5KA 3IJSB 1CTOA 1YNKL 4PMNA 4TULH 3VINA 4BH7B 4OT1L 1GHSA 2A74B 3PV7A 5ICXB 1NEZA 3V5HB 2XZAH 4ZUVA 2P44B 5JORB 3V5KB 2HMIC 2PO6A 4Y1AA 2JFEX 3ARRA 3TZVC 1Z32X 4XCYB 2GCYB 3K46A 4KK8D 4W8BA 5DMGD 2VISA 3HMCA 4TPRH 3L3HA 1KNOA 5L2JA 3BGMB 3G6LA 2H2PC 5JXEA 4FQIL 4KV5E 4OD2B 3O4OB 3D87B 1U91A 3O6KH 2ADJB 3WJJC 2FBJL 3IU3B 4ZUSB 2R0KH 3ACFA 5IF0B 4DZ8B 1PZUB 1FAIL 2UZIL 3I6KB 5F9AC 3V5DA 5ITFB 3CFKB 1LO0L 1Q9OB 2XKNB 4WWKA 1B6DA 1MCPH 4ZFMA 5DO8A 1W32A 6CGTA 4OZHB 2ZNWA 4LSRL 4E5XA 3GJEB 3FO2B 4HKXA 3SDCC 2GJ6D 2QQQA 4ZSOB 3MSPA 4U05A 3I6LE 2HWZL 4Z8FL 2D0GA 2D3VA 2PXYB 3UZQA 4K9EL 4MD0A 1M4KA 1QNRA 3WH9A 3QQ3B 3PQYD 5BRPA 1JZ8A 3QDMA 1YJDL 1X5ZA 4I48B 1ODZA 2VCCA 4JZOA 3S35H 1WFOA 4JRXB 2PYEE 4NGHL 4HJJL 4OUOA 5J1TC 3OG6B 2FJFA 2WZHA 4G3YL 3S6TA 4J3WA 2AGJH 2D7PA 3KPTA 4IRJA 3S4SB 3P6BA 3SGDI 3HG1D 1LGVA 2IG2H 4WO4D 4CVZB 1N82A 4L4OA 5JMRA 3HUJE 2W94A 2ZOXA 5C6WH 5JPMA 1C08B 1H6YA 4FQHA 3TV3H 5J3HD 1S9XB 4O00A 4IOIB 3PWJA 4WIWA 4CRPA 2I26N 1MQPA 4OSUL 2UUDH 1G0CA 3FW6A 4Y8AA 2DQCL 1MHHA 4BXSV 4UNVA 2R9HD 1IZKA 5GIRB 5HHPB 5JHDE 3ZZ1A 2V72A 4R96A 1QA9B 3VFPB 1HXYB 3QPQC 1WIPA 4QXWA 5HGHB 3MLUL 3RNQB 4PY7A 4TVPD 1DLHB 1MCSA 4LKXB 3WHXB 2BSTB 2GYSA 1MHEB 4NHCH 3UPCA 4HV8B 3GMLB 1P1ZA 3T0VA 4NQCA 5C0BB 3X11B 4OGAD 3ETPA 3ARSA 3AXXA 3KYOA 2Y8KA 4XC3H 4OGZA 1UY0A 4DGYL 5E8NA 3WXWL 4IISA 1TUXA 4AY1A 1A7NL 3BMVA 3N1MC 1UY2A 3A23A 4P4KC 5CS7A 4KK9C 1TE1A 4LKCB 5TE4L 1F6AB 1GOHA 2F5AH 3ARDD 1RUAL 2AJZA 2FO4A 2UUDK 1J9YA 3MRQB 1CEOA 3QBTB 1IKFH 1UACL 3GXMA 4EN3A 1HKLL 2DH3A 4FMFA 4KRPD 4ZS6D 2VTFA 3G9VA 2JDAA 4B3KA 3EYQD 1F2XK 3P0VL 5D2LB 1CE1L 3ULVF 1NMCB 4QEGA 3E3QC 3P73B 3FQRB 4ONGH 1G6RL 3MJ9H 4Y4FB 5IEKB 4X0NA 3ULSA 4LLDA 2A6DB 4YLQT 4BZYA 2J88L 3C8DA 2GW5A 1OLZA 4FRWA 3VX1A 5E6YA 2NXZB 5TDOB 1H11A 1DVFA 3GXDA 1GJWA 4X6DB 4CAGA 4G9DA 1D5XA 3EOBB 1AQKL 4H7VA 4XAKD 1XCQB 3A6OA 1T5XA 4ZUUB 1CZ8L 3GM8A 3KXFA 3NFSL 1ZGLM 4LCWD 3ZOAA 1QFHA 3GKWH 3HAEG 2VQ1A 3SN6N 2WO3A 1C91A 5F8QC 4UFIA 4MDJA 2AJ3B 1CLZL 2XTJD 4GBXD 2SEBB 1B4JL 1BSIA 1RK0B 2R2EA 1AGEB 1WCBB 5FDWB 3IFPA 5CLTA 1OGGA 4OZIE 1SFSA 4MA8H 3MBEC 3L7EB 1PX8A 3O4LD 1FL6B 3UTSB 4D6JA 3SCTA 3MO4A 4QOKB 3QR3A 1U8JB 4F8XA 2Z31C 1R3KA 4XPGL 1OD7A 3HG1B 1RZ7L 2NY3C 4GH7B 4PJHB 2QSVA 1KFWA 5FM4A 3ZDXE 1S7WB 2WKGA 4R3SA 1QTYT 1XF5B 5GJSH 1UD4A 2V5SA 4GAYB 4ZXBA 5FXCH 5J12B 1GQJA 2VERN 2WBGA 4UDTB 5A2IH 2EEAA 1T0PB 4M7JL 4X5WB 3CXDL 1CGSH 2X0YA 5DJ6B 5AZEH 1MFVA 1UZ4A 3O2DH 2DI7A 3QJFB 4ACYA 5CUSH 5ICYA 1CBVL 1FZOA 1IGTA 5MEPB 5K9QI 3V6OE 3AZSA 3WBAA 4U1GB 3U0PB 1C3FA 3QUMB 1US3A 3QO1A 1AO7A 1FLRH 1GPFA 5ABDE 3DMMC 4HWZA 1UYYA 2WWKT 5DD6A 1JHKL 2HKFH 4PMXA 2VE6A 1EEYB 5M95B 2VLME 4G9FA 4UT7L 4XNQB 4N90E 4GS7B 2ORBL 1FNEA 5E5MA 3HI1B 5C0JB 3LS5H 1LO3L 3GNPA 3VFUB 3RJXA 2VDQL 3L3JA 4RL3A 5IHUL 2YWYA 1I8KB 2PWFA 1OAXL 3FT4A 4K2UL 1KFAH 3H9SD 3WUWA 5I66B 5E6ZA 4RMTA 4I9WE 3CD4A 3V4VL 3VDCA 4P59L 4QRSB 3QNYB 3SO3C 4OTXH 3FB5A 4Z7WB 1K6QL 2W62A 4XBEL 2PWGA 5GZND 4PB0L 1JF5A 1H15A 2YMXL 1HH9A 3B9VA 3FOMA 3MLWL 1DFBH 1W0VB 4Y2OA 1MOEA 3IDIA 4PRIB 4WY7L 3VXTA 3MV9A 3WFHA 4HT1H 1VENA 4RIRA 1RHHA 1CIUA 5EB9A 4BFBD 1FIGL 4QRQB 1MW2A 1JNHB 4J2XA 4F66A 2IJ0C 5HBBA 4PFEA 1YYLL 3EYVA 3GB7A 3LN5B 4CMMB 2CRMA 4DN4L 1HHHA 3PUIA 2ZUQC 5B4XA 4QHUB 4KZDH 5AG9A 4I0PD 2VRQA 1N8ZA 3ZT6A 5DJ0B 4PRDB 5EZLA 5HXMA 1J87A 3QRGH 2FL5B 4JVPA 1TIUA 1WAAF 4W4ZA 3QWRA 1RJCA 1Q9WB 1CFTA 1XGRB 5DD1L 3SCSA 1A7RL 4JDZA 4KKLD 2QQKH 1I1FB 4YPGA 5HI3D 4NQDD 1CD1A 4Y4KC 4BQ6A 4KHTL 2VCAA 3IT8D 4JL2A 3MNZB 4R90H 4ALAH 5BV7C 2XTJB 3NN8B 3VD4A 4ZFOB 3LD8C 1HHJA 1AC6A 1K4DA 1NC4B 1VFAA 5FHBH 4NC1E 2R8SH 3DURA 3QR2A 1QSFD 5MEOB 3RTQB 3UEZA 3ARFB 3I85A 3CFBA 3K2UH 4ODUA 4UZGA 5I8EA 5I6SA 5TE7L 4DZBB 1TZGH 2BXYA 4JFFA 1T3FB 4AZ8A 1IC1A 4HQQH 3RL1A 3ZJ8A 1CD8A 3DVIA 4WV1C 5ILTL 3KPRA 2NLJB 2Q76B 5HDOA 1PG7X 3BXNB 3SUSA 3MJGX 2XJ7A 5CG0A 5D9PA 1GQLA 4HUKB 4AM0A 5DUPL 3EFFA 3S5LG 1CFSB 3QWQB 1W8NA 2FYYA 4AEHH 3MLPA 4MA3B 3E8UH 5DT1H 2EDYA 4F15B 3EGSB 1SYVB 1BX2B 1I1RA 1NJ9A 2B2XL 4UOW1 4KQ4H 5JW3L 4PMVA 1JJUA 3BQUA 2Z4FA 3ULUL 1TXKA 1FORL 1BMGA 4JFYB 3PE9A 2P5EB 2XG4A 4ZS7H 5ELIA 1TA3B 2AK4E 4KJPD 4PJ8A 2WABA 2XFXB 2GJXB 2VRKA 4FTVB 4X98A 5SWSA 1NGZB 4BCEA 1RUPL 1UMIA 1HINL 2VLLA 2MTPA 3TO4A 5KW9L 5FO8B 5DRWB 3RGVB 4Y5VB 3TIEB 2IH3B 4KJWC 3DROB 3BAEH 1HSAB 3DX8B 1XRVA 1EJOH 1N5AA 3H9SB 4D6GA 4RWHA 3O9WD 1JWSB 1KB9K 2ZCHH 4OV5A 3TJEH 5KSAA 4J28A 1GIGH 1MRFH 1TENA 1YEKL 5JW5A 1A7QH 4DAGH 1PZ5B 2DM2A 3HI6H 4R0LB 3MGTA 5IVNA 4ENEC 1R24B 4OCXL 3OGRA 3VGHA 2IANB 2LTQC 1BF8A 1E71M 1FYTA 1CFNB 5DUML 4QPWA 4JJ5A 4JO4H 1D6VL 1NGPL 3QXAA 2WC7A 2J4WL 2XWTB 3LEXA 5A2FA 1IGJA 1ZV5A 1GZJA 2K1MA 3W0WD 1IM9A 2UYLB 1IEHA 4YC2B 1N3NA 1NCBH 5CJ5A 5F7EH 2ZWLT 2ZUVA 1JZ4A 3WSQL 4GT7A 3LKQB 1GCYA 2FEEL 1YEDB 4H26A 4P9ML 4BQ8A 3LEKA 3F5JA 2BVOB 1CQKA 2X9WA 4PJGA 1GMMA 3OWEA 3IU4L 4PJ5E 4HIIA 3ACIA 1G0YR 1FZKA 3H7LA 1BD2B 4I0PB 5GXBB 1EXPA 1EAPA 1WFUA 2MKWA 4MJIE 1ZVSB 3ZM8A 5LAXA 1CDJA 5L2KA 4LIQH 2DQJH 3BD3A 2YD2A 3IJYA 5T3ZE 2ICEA 4XCNA 1DZBA 3L1OL 1Q94B 5T1MB 4BSVB 3AB0B 1AY1H 1WT5A 3UJIL 4M7KH 1KEGL 5JW4M 1S3KH 3D6GA 3EDJA 4NQDB 4XP1H 4PGEA 2I9TA 3IKCA 1A2YB 3D69A 3PIQB 2QHRL 4PV9B 2VXVH 1N64H 2LE9A 4UQ3B 4KXZI 4HZ7A 3BIAX 1LNUB 4V2XA 3AIRA 3OLEA 1T0MB 2RGMA 5D9SB 3RILA 5FOJA 1LVEA 2ADFH 4YHPA 1QSFB 3MANA 1JPGB 1U8OB 2OXHA 4XVJL 4CMHC 1RIHL 3D85B 2WN2A 2X42A 2ARJA 3MRIB 4I5BA 3MNWA 3P4LA 2Y06H 4M1RA 3V6ZB 2G2RA 4Z2GA 2YSSB 5TFSH 3OKLA 2VITB 2G75A 3BIKA 1BYBA 5BRZD 2DIJA 4M6OH 4QHLB 2QQJA 4OZHE 1FHLA 1CXIA 3O2WL 2ZNXA 1GOIA 1UXSA 1EIBA 2AJSL 1LG1A 1INDL 2AJVH 3DRQB 3WSOA 1OB0A 3ECBB 1UENA 1HF6A 3BDBA 1NAMB 3Q1SH 3BGAA 4A44A 4ZSOE 2MQ0A 1FGVH 2RJMA 3Q5YA 4NZTH 1AGBB 4MGQA 1XGZA 5HYSB 1KJ3H 3OKEB 2CKSA 4K94C 4JCMA 5D8JH 4K9EC 4ERSH 3QYCA 5DJAA 2Y5TB 2CLZB 5J56B 2X70A 4ZPVA 4ZUWB 5IFJA 4D9QD 3BE1L 4F9LC 4W87A 4NRYA 4NN5B 5HYQB 1P7KA 4JRXE 3AJ7A 1XD0A 2AABH 4P7OA 3SCMA 3S35X 2EXYD 2JJSA 4XPTL 4X9BA 1F4XL 5C0ND 4NO2A 3H2WA 1OP9A 3SDXA 3EO0A 1IGFH 1XCTB 3NH7L 5LGJA 2OS7A 1EO7A 4HWNA 1QSEB 4JM2F 3MODH 1XGYL 3GMQA 2BC4A 3UDWA 2RIKA 3OAUH 1XEDA 4KRMB 2GK0B 2DBJA 2WMGA 4M7ZC 3HMWL 5FYJH 2VLRA 5IOPB 4ZEPA 1CZTA 5IVXF 4AEIH 4D9RE 4LASH 3GMPA 5DJ8B 3TA3C 2PXYC 1JF6A 2W92A 3EZJB 2PF0A 4HJ0D 3SDDD 1WZ1L 5FA3B 4YFEA 3WFZA 4BSJA 2IFFL 3S8WA 6A3HA 1ES0A 1MJ8L 3CHFA 4JDTL 1OWRM 4MCZA 5BQ7A 3VXNB 3FFDB 5CBAB 4H8VA 2J1AA 3MRCA 4YFLF 1T03H 3WIHA 4K3JH 2W61A 2BFVH 2BVDA 2NW3A 4OD3L 1M7IB 4X7TA 3WQ8A 3FB8A 1MFCH 1KQZA 4C7DA 4FLQA 4I3RL 1X4XA 4XZBA 5GGUA 2DSVA 5CJBA 2CO6B 3CQOA 2YKLH 4IIQA 1V7ML 3A3HA 3DUSA 4J3UA 4WF7A 3IS0X 2O5XH 2YC2A 3WBEA 3MCLH 1SJHB 4XC1L 4BFIB 1FCCA 4Z7NF 4FHBD 4HKZB 5CP7A 1VGEH 4OLYH 5D2LE 3LRSA 3WJLA 4HP5A 1KJ2B 1X5JA 4QF1B 1A9BB 2DI8A 25C8H 3RVUD 4EUPG 1HKIA 4LHUD 3OR7B 1T1WA 4B9ZA 2DD8L 3G5ZA 1U6AH 3NTCH 4IHOB 3C7HA 1NWRA 3SCPA 1ZGLB 5FUIA 1U9KA 3LEIA 3T4AB 1V6VA 1BIIB 5FEBA 1J1OH 4JQIL 2Q6WB 1RVFL 3DGCR 5KVEH 1IT9L 4X6DE 3B2UD 3IDMA 3KPLA 1IGCL 1TVDA 5EUOF 3NRUA 1T7ZA 2EC8A 2O5YH 4L29B 2YK1L 4N0CC 4QRRA 4V27A 3GSUB 4UNIA 4HA4A 4P2RA 3CDCA 3FT2A 2E6PA 4YWGH 1Q8MA 1RFDH 3EBAA 2J62A 1R3HB 2P5WD 4HG4J 5EZIH 2DYPA 3OKNB 4JFFD 2BERA 5IMKA 5I73B 3V6FA 5A2KH 1NMCC 1XH2A 4Y4FC 1RMFH 1C8PA 5KANI 4NKMA 1NDGB 3HNVL 4XCCH 1EQPA 1XAUA 1NBZA 2V5TA 1A3RH 3HG1E 2G3JA 2VMFA 12E8H 4PJHE 5TF0A 2VZSA 2W95A 2HT4C 1EA9C 3MR9B 4HTYA 1HSBB 4ATLA 4ZDHB 1INEH 1CT8A 1QVOA 4F7CB 5DD3H 3MRKA 5B8CB 5AWNH 3GIVB 1N0XL 5H2BB 4XH2B 1P6AB 1RUMH 5FL0A 3VIIA 2JJTA 5FB8B 4L0PA 1IGIL 3Q6GL 1UWWA 4BYHA 5BZDB 4PJ9C 2KQMA 32C2B 4Q22A 4KDWA 4HWEL 5C0CB 3KHOA 1KN4H 5JW4R 4Y8DC 2WZEA 4R26H 1Z3GL 1G1CA 2D1ZA 3LN9A 3D2UA 2WNGA 5E0CA 3MRHB 4UDUB 3P4OA 4ZD3H 4XXCC 5T5NG 1QRKA 1BBDL 5EO1B 5E9AA 4G8IA 1DYOA 3GXUA 2B4CL 3LMJH 5T3XE 3I2JA 2OWXA 1KN2H 5DA4A 2BNRD 2OL3A 4P2OA 3QIWD 1ZWIA 1OH4A 1CL7H 2VXTL 2W0PA 4P3WA 1RZGB 3BH9B 4S1DC 5C08B 4NQVB 4UFKA 3P11H 2D7QA 3VMNA 3U7YH 3RDTA 1F3DJ 3HMXL 3WELA 3DYPA 2OYMA 3SKOA 1U8NA 5DUBB 4WI5A 3C8KA 2AP2A 3MROA 3MU7A 4RGOH 3CVHL 3M1BA 4HF5H 4LLWA 4MAYC 1FFPB 3TBYA 4XRCB 4PRIE 4W4NA 1XIWA 3SKMB 1E6JL 1MHPL 2VZRA 4YHIB 4U1GC 1E6SM 1XZ0B 5EUKB 3VIOA 5M3WA 4MS8D 4FFYL 4I2XA 4JFHD 3S4SG 5F44A 4JREB 1JIBA 2R0LH 4GG6A 3VW3H 1REIA 4POUB 1E4XH 2V17H 1PSKH 1AD0B 4HKBB 4F37F 4WUUB 4UU9A 5DHYA 3C9NB 4P9HC 3SGKA 4Q2ZA 2XWBA 4YHNB 2BVQB 2GSIA 3BEVA 3Q3GA 5DHXB 3T04D 1JNEA 4JFWA 2VMCA 4J27A 1G0DA 3HE7A 3QNZA 3TT3L 2EDBA 3BP4A 5B39B 2JIXD 3AMKA 2J8GA 1DBJH 3NMEA 1QI4A 15C8H 4AH2A 5EO9B 1H49A 5I23A 3QULA 3VFWA 2XNAA 4P3CL 4XAKE 4XP5H 2X9XA 4K3DH 4LGPB 1JK8B 5GS1C 4KVCL 4GIAA 5I1KL 3EUUA 1I85A 5A8NA 2OCFD 2XTJE 1UR2A 4YE4L 3JUGA 3G6JA 3QA3B 2NSXA 3VRIB 4JGMA 2A73B 2P5WB 3CVIL 3MBXL 1JHLH 1IAOB 2Q87A 3SE9H 1ZBKA 3P9WB 3HZVB 5GS0H 1LE5B 4UINH 1FLTX 3O3DA 4QLKA 1W8OA 1JNJA 1MCEA 3LEYH 1D9KB 4YUEH 1A1MA 1OD8A 1Z9OA 4JQXC 2O92A 5HVGB 4GQPH 3REWB 4ZFZB 4LMQI 1GGTA 1SG3A 4BQ3A 5E2TL 2FX7H 5DT7A 5HHMD 3KVQA 5BS0D 2FGWL 2KPNA 3QUZA 3UYRL 4LBEA 1ADQL 2Y6HA 3VXMA 5HJ3B 3VIJA 3TN0A 1V3KA 4IOFC 4JFUA 4UAOC 2VL5B 4N0YL 1ZHLA 5IEHA 2K7PA 4WEBL 4F7TB 2V9TA 3AHYA 4FZEL 3SGEI 3PG2A 2XA8H 3UBXA 1QACA 3KPSD 4PGDB 4S2SA 3LKRA 3AU1A 5JDJA 3VFSB 5F96H 4IMLA 1WBZA 4WFHD 3Q6FA 1WZAA 3DVFA 3NACL 3ARFC 3IDAA 1FRGH 2FJGA 5EBLB 1YMMA 3C2AL 3NCJL 4WENB 3I6GA 3K8LA 4NP4H 5EU7E 2BNRB 5L8KB 1IEBB 2VX4A 2CLVB 2JJVA 3BUYB 4HLZH 1GVIA 1GUVA 3H9SE 3DRTB 3RNKB 5TD4A 3WFEH 4RZCA 3BHBA 2ZSVA 4K23H 2DS4A 4WCYH 3UMTA 4GUPB 2C1PB 4OI9A 1J88A 4MXQC 3CLFH 5IHLB 4JFXA 3PZGA 5KS9B 3BPCA 4JN2B 4Y5YB 5D2NB 1EO5A 4F15C 2QQNL 1R3LA 1U92A 4PUDA 1CK0L 1NAKH 2W5FA 4D0CB 5GSRB 3TH4T 3WHE1 3A67H 5FKPB 3CDYA 1C90A 4HUUA 1NCTA 4NKDB 2EKSA 3KDMB 5AY7A 5JO5A 1ZXQA 4Y4HD 3ZE1F 3SBWA 1K9FA 3DI3B 2FB4L 3KWWB 1Q38A 1KC5L 2FWOB 2LVCA 5DQ9B 5INDA 3BPOB 4QCIA 1VEMA 4HUWB 5CJQH 3JVGA 4NJ9L 5F1IB 3F8UB 4HWUA 4L4VB 2VLJD 4Y5VC 3N9GH 2W91A 2I07B 2F5BH 5HD8D 4K7PH 1GQKA 4R4FL 1M71A 1PLGL 3L95A 4TVDA 1YY9C 5T1LD 3RI5K 2AK1H 3LKOA 2OTWB 2NZ9D 4AG4L 2YLLA 5KSBA 1MIMH 1G7HA 4NQDE 3QHOA 1NL0L 5HPMB 3CZKA 2DLFH 3DHJA 4HX1B 4PRNB 4ZODA 2A6JB 3N85H 3U82B 4G6FB 3EYFA 2G5RA 3CSGA 4YGVA 1PEWA 4NC0B 3G6AB 3WO4B 1GHFH 3GSOB 5J6GA 5GRJL 4YC2C 2X4RA 5EBMA 3SJVD 4YAQA 1QSFE 4EI5D 4BFGA 4A42A 3L5XH 4DCQA 2G5BA 4IPLA 3H7BA 2OSLA 1BQLH 2XPGB 1Q6EA 5T5FH 1RZKC 2E4TA 4UIKH 5ABFA 4Y16A 1TZHB 3F5KA 5A69A 4PLKD 5CHNB 5A3HA 3AB0C 3CMJA 3POCA 4A4AA 4P8VA 3QEGH 2V7NA 4G6JH 4XBGB 1F3DH 4W6XB 4MO3M 2AOSA 5A40E 2HKHH 1A4JB 1G9EA 1W72H 3QXTA 3H9YA 3I75A 3VCLA 1QYGH 3F5WB 1GRWA 4DXRA 1DBAL 2D03L 4G43A 1Q0YH 4RDQG 3SY0A 4H1LA 2VMEA 1XYZA 4ZPTB 1OAZL 4X5XA 1ULOA 1CR9L 2PCPB 3KPSB 5BO1H 4OCSH 1UXZA 1MNUH 4OD1L 1YPZE 1BAGA 3RDKA 2CKBA 4MJ6B 4X6FB 3B83A 4FQQB 4E8CA 1PZ2A 4NRZB 3PN8A 4PY8J 2ZE0A 4ETQA 1GZPB 3C5ZA 5C09D 1J8HD 2EIEA 1R6VA 1QR1A 1IAIL 2JCCA 4L9LC 1QSEE 4AD1A 2PN5A 1BYAA 5E8OA 4HZ8A 1I7TA 3D2UD 2E3VA 4H0HB 2HTKC 4LSTL 4LARH 1MCFA 3QI9B 4TVUA 3I2KA 4OF0A 3BZDA 1JTPA 5KG9B 1JVKA 4CNIA 1E5NA 4V2CB 4IDJL 1JAKA 2XN9A 2BGPA 2Y36H 4NN5C 3OAYH 1H3UA 4FQXC 1G5AA 2DM3A 3WD4A 3L5IA 4DN3H 3FN0L 3ULVE 3UAJC 5KOMC 3ZTJH 1UYWL 2ZUXA 2J75A 1K8DB 3RMEA 4CGTA 4TX8A 3C5SB 2X4TB 3HZKA 4X6BA 3QGVA 4LPTA 1FNGA 2XVKA 5ACZA 1CFVL 1GOKA 1QLFB 5FK9A 4P5TA 3IJHA 5D7IF 1EGJH 1SYSA 1FG2A 2CGRH 5FO7A 2OK0L 2QSCH 4KZEH 4BA0A 2XICA 2VMDA 1WFTA 2VX5A 2BNQD 4RGNC 1MREH 5HVWA 1ZBVA 5FYKD 4LAQL 1W9BM 1MQKL 3RY4A 1IFHH 1DBBH 1JGUL 3D0VB 1X7QB 1EEUA 4WW2C 3V2AR 3BESR 4DW2H 1D7PM 4PQQA 2D22A 3OAYK 1UZ8A 4CN6A 2R1WA 1J05B 2CLRA 3IFOA 1CDUA 4H1LH 4Z7QF 4XZUB 2VDRH 5B38A 1A6PA 1KV3A 4KI1A 3QOKA 3ULVC 2VZ3A 3VXSA 3HC3H 3LEVH 5C86A 4KQ3H 5BRZE 5FYKU 3MLZH 4J1UA 4GW1B 3F7QA 4X7FC 4BQ9A 1EVUA 4HPYH 1BZQK 4MJ4A 1OGAB 3MRDB 5E1HB 4DFHA 5JLZB 1KJMA 1KB3A 4IRSA 5C0EB 1G7PB 3ZDZE 2Q1EA 3LRGA 4XT1C 3O6ML 1R8LA 1NGQL 5F70A 3SE4C 1P4LB 1PVHA 2YN5A 4WWID 4X6CF 3T0WA 3PHQA 1E4WH 1DL7L 1ZBCA 1F8TH 5GS3A 5DLMH 4LMQE 3W82A 3WFBL 4E8DA 2FECI 3VFGL 1NPUA 3THMH 1V0KA 1AKJA 3HRZB 1OARH 1I1AA 5FF6A 4HPHA 4D9QE 3SUVA 4XPFH 3EOAA 3PDOA 4F7PA 3CK0H 4PJFA 2B0SL 4LFHD 1PPIA 2ZUUA 3WS3A 5J1XA 3PHSA 4DUWA 4MDPA 3UTTA 3HE6B 4HAFA 1M7DB 1PKQB 3P0GB 1T5WA 5BWFA 5ESAB 1C5CL 2R39A 1XPWA 2YUXA 3STBA 3KAAA 4WHCA 1FVDB 5C09B 1A6TB 3C08L 5KTEH 2R4RL 2APBA 2YRPA 3D39B 3OJMB 4Z0XA 1H3PL 1QQDA 1F4YH 1OPGH 3MREB 2MPAL 4PRPB 2K3TA 1JI6A 3DVNA 5LGHL 2EYTB 5IQ7L 2Q8XA 3BUTA 2AXHA 4YHZL 3ILPB 1MXGA 3FQWB 1DQLL 5HHXL 5JDSA 1P9MA 5I73C 1BZ7B 2HJKA 1JDAA 3V0VB 2UY2A 5AC5A 4YFLI 4JO1H 5DD0L 5T1KB 1NMAL 2RGSA 1T21B 4GXVL 1NMBL 2EIBA 1MQ8A 4QX1A 3N06B 5KJRL 2IADA 1NOFA 2V2WA 4L9DA 1T0NB 3W0KA 3NPSB 3ZT5A 3MRFB 1RAMA 4HBQA 2XOMA 4B53A 1JYWA 4FFWC 3Q0HA 2XTKA 3CDGB 3VDAA 3C6LC 2WMKA 4C83B 3VIGA 5B4MD 5T3ZL 5B8CC 1G7LA 3AY4C 4WJXA 4HOZA 3R0MA 3SKJH 5HYSG 3AUVA 4R27A 3QFDA 1AJ7H 1S9WA 3GSWB 4FQPA 1JPFA 3ZKXB 4W84A 4OLVL 2BY0A 3GMRA 5SWZA 3U4BL 5D1QA 4R8WH 4DTGL 1DUYA 5HHVL 2W4XA 1ZT1A 1HL9A 3BD4A 2G9HA 1ZHBA 2VX6A 1ZSDB 3JWDL 4OZGB 5CFHA 3PP4L 3VWKA 4WUUE 4HC1H 1W9XA 1Q6GA 1UA6H 3BWAA 4MB1A 3FN3A 4LEXL 4PREB 2EYSA 4XWGH 4AMCA 1GGCH 2BCKB 5E2WL 1W9PA 5ICZA 4XZWA 3AMDA 3CIQA 5H37G 5IESH 4PTWA 5C9JB 4QT5A 2NY5H 2QR0B 4FXGB 4OFPA 1RK1B 1EHLH 4HIJA 1AD9B 4YGAB 5E94B 2ICWA 3NA9L 3OGSA 1A1OA 3LDBC 1NWTA 4X4ME 5LA0A 2F54B 3FFCB 2YD8A 4YXLL 5BVPL 1Z6JT 2ADIB 2DTMH 4XHQA 1UD6A 2PTVA 2NX5D 4FNLH 2MHAB 4A6YB 1SHWB 1MWAH 1KJVA 2ED7A 5DS8B 5GNYA 4PJDB 5DRNA 4BS0A 2E27H 2P5WE 1OAUL 4MJ5B 1FNAA 4KGLA 4JREC 4PMRA 4HFWB 5F21B 3S98A 4JPIB 1Q6FA 3O6FA 4E41D 3TBWA 2C7UB 5B21A 4ESKA 2CH8A 1H0DB 3NIYA 3TTOA 4AIZA 2X44D 3LKNB 5I1IH 2BY3A 2I25N 2IGFH 4G80A 1E0VA 1WQVT 5JA8B 1K2DB 3HB3C 5KVGH 2EE3A 4LL9A 1FJ1B 2W47A 3VFTB 5IFAH 2YA0A 4R9HA 1KELH 5HDQL 1R3IH 2BRQA 3DSNA 4LGXA 3VVGA 1B3VA 4AL8L 4EIGB 1JUFB 5K59E 3ARYA 3SKUD 2YDQA 1KLFA 2YL5A 3LS4H 1PYWB 4HXAH 4Z78B 2L7JA 4D1JA 3HPLB 5HHNB 1UG9A 1KGYA 1UXXX 3HNBM 4NZJA 4W81A 1E73M 3O9NA 3O3AB 5C71A 1FDLH 4XVSH 4XMPH 3IETA 4OLXH 2EBNA 5AZ2L 4JFQA 2A9ML 3NCCB 3D25A 1D9KC 5EOCL 5LA1A 2YBRA 3F6IA 3ZKMD 1QOXA 5A2BA 4LOUD 2BNRE 1IC7H 1KTLA 2H32B 4IM8A 1C1EH 4DXTA 3I2CH 4R2GD 4XUOA 2GJZA 4ZTPL 5IGXL 3EYUH 4PLOB 2WUBH 5TE6L 2QQOA 2GT9A 2Q7YA 1EDGA 2IUZA 5KS9E 3CFEA 1LD9A 1BLNA 1PDKA 2RAMA 5D2NE 3X3GH 1M05B 3C87A 2FIKA 2WQRA 3MRRB 4LEOA 4MQSB 1B31A 4QCFA 4F3FA 5D7JA 1JD7A 4JFHE 1CXFA 3RKDC 3OBAA 4I1NB 4RE3A 3WD1A 3PL6D 4JFEB 4KUCF 3I3BA 3BZEB 4C4KT 1NFDA 1DE4B 3AMGA 1YEHH 3FQUA 1FE8L 4FS0A 1U2CA 1FG9C 1HH6A 1UWTA 4L4VE 3U0TA 4HS8L 4D8MA 2YUZA 4QB6A 1H09A 3DUUA 1F4HA 3TF7C 3ZE2F 2IPKA 1QR4A 2IBZY 5DFVD 2X4PA 5A6AA 2PBGA 2V2TB 2Y6SD 1TETL 4U1NA 3NJVA 1K4CB 1S7UA 3AREB 2WLYA 1MI5D 2DM7A 3WENA 1KENH 2HJFB 1YNKH 2NX5B 3KPMA 1K42A 3TM6A 4OT1H 4TTDD 5D2NC 1BG4A 3QFJA 3SPVA 1E6RA 2WC4A 4W7WA 2IXVA 4PV8A 4KWUA 4N1CA 3GMNB 4LGSB 3C09C 3ZQ9A 3QXVA 1ECEA 4EZMA 5I76A 3TNMB 1HEZB 2MCG1 1WK0A 2DLTA 2X41A 3AIBA 4U3AA 2W1QA 4MNHA 4OCRL 3RBSA 3P2TA 4EOWL 2DDUA 5IW6B 2YA1A 4WVRA 3FJTA 4KI5M 4PTTA 1PKOA 5TPWL 2XQYK 5D93B 1BVKA 2GAZA 3H3KA 4GQ9L 2UZIH 3P0YL 1RZJL 5HTSA 4Z6AT 1G94A 3SO5A 4ML4A 3UZVB 4KKCC 1C92A 3ILQD 1OTTD 1TG7A 4GPNA 1I3VA 1AR2A 3EB7A 4HUVB 4M24A 2DQXA 4F33B 1AE6L 4LYPA 2J7MA 2DLHA 4LSRH 4W7UA 1NC2A 3DBXB 1UQSA 2H26A 1DQDH 5FGCB 4KKBD 1MH5A 4TVPL 3TLRA 1G6RA 1WCGA 1ZS2A 3KPSE 4OCLC 2HWZH 1QHZA 4Z8FH 4K94H 3EJYC 4K9EH 1Q9LB 3H9HA 4WFHE 3LV3B 5B39G 4PRWA 3B4NA 5DT5A 3MTRA 5C0FB 2DQFB 2NR6C 4U3CA 4NGHH 4P46D 4HJJH 2WINB 4APQA 3VKKA 2FATL 5C07D 1Z9MA 1T1ZB 4U1LB 1ZKAA 2JF1A 4PP2B 4EQ3A 2EDEA 1JV5A 2WHKA 4D0BA 4OFYA 3MYZA 1BGGA 1UZ6F 4WFFD 2WBJD 1ZTXL 2ZCLL 5ANMB 4OKVB 3CZFB 4OSUH 4K8RC 3MUHL 3HS0A 1R85A 4N0RA 1BZ9B 5CMAA 3U4EA 2CRZA 3RWEA 1IQDB 1TFVA 4JM2C 1IGMH 4MHHI 3WL0A 5D7IB 1KGWA 1F3JB 2GITB 4HIEB 4KKAD 3HCVA 2Q3AA 1UY1A 3M07A 4DK6A 5IHZA 4L3ED 3RM4A 1HOCB 3QEQA 4U7MA 1ESWA 3DV6B 2WMJA 1MFEL 4LVNB 3D3VB 2VLJE 4ORGA 2NNAA 5J9PB 5D7LD 2CR6A 5LA2A 4U6HB 3T0DA 3QOMA 4M61B 1YUHA 2ZG1A 3MV8D 1CF8L 3E6FB 4DGYH 2DWEA 3WEZA 3JXAA 3A22A 4PJXA 4M6NH 4PRBA 4D3CL 5TE4H 3MRMB 5TDPB 3IGAA 2VAAB 3QI9C 3T0EC 4OZFA 5G05L 2ITDA 2AEPL 2KBGA 1SBSL 3QZWB 4DUXA 1HKLH 3PWLA 3IDNB 3SJVE 2BMKA 1XF2B 1HQ4A 4GI9A 1CE1H 3RWDB 4POZD 5D5MA 5KAQF 4X6CB 2DT0A 5CIPA 1G6RH 3CGTA 3QEUA 3QB7C 4DKFH 1HIML 2EPKX 1LEKB 3W6MA 2J88H 4NO3A 3PGFH 4G8EB 3FRUB 3LKSA 1GZQA 4OCNC 3T2NL 4D71A 4DVRL 2FDBP 2A77L 1A6VH 1OAKH 3BZFB 43C9B 4N0FA 1A8JH 1MFNA 4CVXB 1JU3A 2PTTB 3SE8L 1FZMB 4MB3A 4WGWB 1UXWB 3LQCA 1GOMA 1I8LA 2BXZA 1AQKH 2ZOKB 3GTNA 1O6IA 1EJ6A 1CZ8H 1FOBA 3BLKA 3MCKA 3NFSH 4CADA 3BAJA 2CRIA 1WCQA 1AC0A 1T4KA 4WJ5B 3ES6A 3U6RA 3GZKA 5FKAA 1HJSA 4JO3L 2W1UA 3RWHB 3MLYL 4X6EB 4C56A 1EHNA 3QG6B 4L8BA 2OM5A 3U46B 6FABH 2NTSP 4P5KB 1CICD 1P69B 3AMLA 1U8HA 2JKXA 3QUXD 3WXVL 3RVWC 3TJHC 3BISA 3SQBA 5E08H 1I8IA 3DXAA 1PKQE 2EJ1A 4ZUVB 3SDYH 1JWMA 1B0GA 1G9NC 3A6BL 3AM8C 1I3GL 4P2QA 1K3IA 2P45B 5C09E 4Z76B 2F8OA 2PO6B 3OGCB 1HQRA 4XPGH 1LO4L 1RUKH 3VJ6B 4Y1AB 4PJGF 5C92A 2NY0D 3D39E 3WD5L 1VFUA 4MGXA 1P2CA 1RZ7H 5DMKA 4PGBA 2VISB 3VD9A 4R97C 3PNWA 1MELA 3VXRD 2DKSA 5I75B 2FJHA 3ARGA 1UH3A 2DDQL 4RE2A 1QFPA 4UTAL 3V79C 5BXSA 2D24A 5DTFB 4PG2A 3G08A 3IXTA 1U91B 2VLKA 3GO1L 2DQDL 4M7JH 1OSPH 5JOPD 4UBDD 2PWHA 1CBVH 1P7QD 4WWKB 4XUNA 5DWUL 3LAFA 4P48A 3HN3A 1DDHA 3QIUD 1N2RA 3QUYD 4FN0A 2EYRA 4OZFH 2IAMD 4TOQA 4L3EB 2ESVD 5D1XA 2NY6D 5I19L 3EFDH 3HE6C 4XPHH 4YBLB 4HKXB 4D0DA 2HLAB 1DWAM 3IDXH 5CJOL 4UT7H 2UWEA 5D7LB 2ORBH 3AIUA 5FGSA 4FMVA 3MUZ1 1LO3H 4OUUB 4P7QA 1KB5L 2E7MA 2O61A 2ZPKL 4GKSB 5CIPH 5IHUH 1H2JA 1VF8A 4MD0B 3RVXC 1S5HA 2F8XC 4K2UH 4GQRA 3QDMB 5E1AA 3LQZA 5E8PA 1U36A 3V4VH 3AC0A 3JV6A 1DWGM 4JZOB 2BNQE 2WP3O 1K6QH 1T83C 1VGKA 4XBEH 1VHPA 2FJFB 1S7TA 4PB0H 3JSSA 2DEPA 5F6HI 1D6EB 4A3HA 4XTRD 3MLRL 2YMXH 3MLWH 4OZGE 3BRFA 5JPMB 3DPBA 4FQHB 3W2DL 3G5VA 4JPKH 3UTZA 2W0FA 3VMPA 4R7NB 4XURA 1YYLH 2QKIA 4U1MA 3RHWK 5I15L 4DN4H 3D9AL 3NPSC 1MCBA 4R96B 1X5FA 1Z0NA 3QEHB 4AD4A 1XCWA 4EBQL 1J11A 3FTGA 3FN9A 2UY3A 2PYFA 4YPJA 3ZKXC 5IDIA 4YXHL 3SDXF 4EXKA 3DV4A 3SCNA 1NAML 2AS5M 1P1ZB 4KI5D 5DD1H 1A7RH 4NQCB 3JWOC 4PJDE 2VZ1A 1ITCA 2Z4QA 5E6IA 5I8CA 1RIUL 5GSVA 1KXVC 4KHTH 2J7DA 5E8NB 1HYSC 4N68A 4HH9B 1GPOL 1U8QB 4XPAL 1BG9A 5EBWA 5EJ1B 3L4YA 2WVUA 2P49B 3NCOA 4H25A 2BOBB 2AJZB 4CU9A 5KSVA 4EN3B 3WKNA 3BGFB 4U2YA 2FD6H 3UG4A 4D2NA 1UC6A 5BOZG 5TE7H 5HYIA 2NY0B 1GGBL 1EDTA 1IE5A 3WKML 2ZUSA 3O81A 5KZ6A 3ZKSD 4ZYKA 1UCBH 2IH1A 4M7LH 3ULSB 2BGOA 4LLDB 3JV0A 3ARBD 5DUPH 1KCKA 3NCYP 4JB9L 2R7EB 4QX3A 4XZUG 5GGTL 2VX7A 1QNZL 1DVFB 1J0ZA 2B2XH 1DSFL 5LBSL 3T3ME 5BW7C 5JW3H 2VR4A 4WI9A 3ULUH 1FORH 1LEGB 5DPNA 3QUYB 5D4YA 5EG6C 1D5XB 2EZ0D 4X7DC 1H9VA 3MOAL 2DL2A 5L8LB 4NSKB 2NY6B 1VACA 4QFUA 4JRYD 2A3EA 2VSDA 1VBUA 1HINH 5E9DD 3ZE1E 3W38A 5KW9H 4MDJB 5F7LB 2DT1A 3CUIA 3UX9B 2R2EB 4ZMAT 4QDRA 4KJYA 2VZQA 1FL3B 3MJ7B 5IBLC 1CX1A 2R2CA 1T89C 3IFPB 5EZJA 5C3LD 4PYSA 4RN5A 4FFZL 3VXPA 1OGSA 1ND0A 4KMQA 1KULA 3O6LL 2AXJA 4XHJD 2B1AL 1NSNL 1R3KB 2HVJA 3CU1A 4D6FA 3MMEA 4AD0A 2R2BB 4ODXA 3VIMA 5DUMH 3STZB 1D6VH 1L9MA 1WO2A 2HH0L 1JGIA 4K07A 3VXQA 4R3SB 1KBBA 2X4NB 4YEEA 3U1SH 4Y2DD 4LNVA 3NSXA 4WNQB 3TFKD 5CEZD 1E4KC 2OTUA 1LF1A 3WNLA 5FYLD 4OIIH 5IW1B 3EBVA 1A6WL 1YQ2A 5ICYB 3IU4H 3QWOB 1FZOB 1IGTB 5HI5C 2A9NH 1KTDA 3F62A 3TVMC 3UPRB 4GAJL 3PF2A 5CSUA 2CUHA 3M45A 2D3LA 1IBGL 3QO1B 4HPOL 4U1HA 1AO7B 1JWUA 4PSRA 1K5NA 1I8MB 4GFTB 3CFJA 4QO1A 4O2FB 2NX5E 4PD4J 3BYTA 3AHZA 5DD6B 4PLNC 2EXWC 4JFOA 4OMCA 4G9FB 3UJIH 4LDOB 1NUDA 5EN2B 2WPGA 1T1YA 5E5MB 1KBGH 4QB1A 4LPCA 5CILL 3L3JB 2YPLA 1BFVH 1F4AA 2QHRH 5D71L 3T1FA 3CIVA 3FT4B 5CGMA 2VO5A 4RRPG 4HDIA 1OTUC 5JOEA 4E41E 3BXWA 1G7JB 4W7VA 1YHTA 4QLRA 3WFDL 3FB5B 1V0NA 3L2MA 5AD0A 4EQ2A 1RZFH 1LWHA 4HOWA 1A6AA 1H15B 3UR7A 4GKOA 1HH9B 1RIHH 1EXUA 3IDIB 3VXTB 1PD6A 2DQTL 3MV9B 5IG7A 4RIRB 3B5HA 3DO7A 4LSQH 3SE3A 3AREC 5DD5L 5ADOL 3G6DL 2PF6A 3O2WH 4X4XA 3EYVB 4GZEA 5HGBA 1INDH 1C16A 1HHHB 4JFDD 3PXJA 2WMHA 2IQAA 2IBBA 3QXDB 5J13C 4ZAKD 1GUIA 5FGCE 1DUZA 4WW2A 5F7WC 1AGCB 5EZLB 4X4YA 1DANU 1P7HL 3FCTB 4LYQA 3GH5A 4YQXL 4WW1A 4BH8A 1KQYA 4NZUL 4KY1L 2BHYA 5ERWA 1A3QA 3H3PH 4M56A 2DL9A 4NQTA 3BE1H 4R4ND 4WK9A 2HVMA 4OIBA 5D93C 4GG6F 3WDIA 4YPGB 3ECQA 2O5ZL 3V0AC 1CD1B 5GGVY 4C7GA 4MTVA 3BSZH 4GMTL 1EV2E 4YFDB 3R1GL 1N6UA 4XPTH 3RI5F 1RUQL 1F4XH 3WUBA 4MJ2A 4U3HA 1BBJB 1VFAB 1K4DB 2J12B 2NCMA 4CKQA 3QT2A 5EA0L 5ANME 2APWA 1FAKT 1KIRB 5EORL 1XGYH 4LCIH 4PG9A 1T80A 3S36X 3GMMA 4ODUB 4UIMA 1RPQA 1E3ZA 4LFHG 5I8EB 4DVBA 5EFIB 3HMWH 5IKCB 4WHYG 2E6JA 2VM9A 3HPJA 1ORSA 3G6JF 3QDGD 1MRCL 1B4RA 2IFFH 3EFFB 4P8UA 4CVWA 1NDMB 2NQCA 1LQ0A 1KEML 2FYYB 4JDTH 1HI6B 1N26A 5F72S 3MLTA 2DDXA 4KVNH 5L6YL 1NJ9B 3H8NA 1HHKB 3ZJ6A 5AYUL 4ONHB 2IPTH 3BQUB 5DJYA 1SEQL 4OD3H 4X83A 3ARUA 4LCYB 1YMHA 2C3GA 4PJ8B 1YN7A 2CIIA 4I3RH 2GTZA 5I30L 1BGAA 4EAMA 5CD3B 5SWSB 1E0OB 1V7MH 1GC1L 2AJYH 1HKFA 3HAEA 2ZP0T 3GM0A 3W39B 2VLLB 1IQDC 1RJZA 3TO4B 2YL6A 4GRLD 4FQLL 1QRNA 4XC1H 1UR0A 3RUGA 4XMLL 3LE0A 2VZOA 1N5AB 3NPZB 1QSZA 5EU6D 3A47A 3CFDA 1U93A 5KSAB 1U3HC 3VXUD 1E56A 2YZ1A 5JW5B 3CZLA 4LVNC 1UUQA 3GHEH 3MGTB 2DD8H 2EO1A 2A83A 3PZ9A 3DX6A 5EZOL 3BN6A 3HMXA 2Y2WA 4MWFB 3LZFL 1QHPA 2ZUNA 1FYTB 4J3OC 3MRGA 4JJ5B 2E0PA 3T4YA 1WTLA 4JQIH 1RP9A 1BFOA 3QXAB 1RVFH 4O4YL 3M8OH 3CVHA 3LEXB 3P4NB 3WNPA 1IM9B 4NZCA 3OJDA 4CU7A 1QFWM 2L0DA 3NFPA 4P57A 1MVUA 3WY1A 4H26B 1J1XH 1MCJA 4ZG1A 2YK1H 3OGOE 4K55A 2R23B 3OKOA 4GKLA 2Z93B 4ZAKB 4N8CL 1FZKB 2WM0A 2C4XA 3X12A 5I1LB 4U5IA 2P7TA 3IAGC 1JFXA 3CUPA 4F9DA 5LAXB 2Q8AL 4DWSD 3FONA 4XVHA 2WO2A 3IJYB 5J11C 2ICEB 4TSAL 4G7VH 5BZWA 3RVTD 2HN7A 3ROOA 1NWUA 1W2VA 2X1IA 4Z7OF 1NAEA 4JFPB 3B6SA 1T20B 4UR9A 2WWMC 1F11B 3EJJX 1Q9KA 3HNVH 4PGEB 4QLJA 2I9TB 3WMBA 3IKCB 1HKMA 4Y1AE 1LLOA 3D69B 1VRXA 3C60D 5C07E 4XUTA 1S7QB 2ZX7A 4JLRA 1S9YA 1CZ1A 3RZWA 4O02H 5D1ZD 1UH2A 4X5LA 4WFFE 4N9GA 1MY5A 2P1YA 1IV8A 4J4PD 2H6PB 3UROR 4OOZA 2DI9A 2EH7H 1H3TA 5CBEA 1W1VA 4TVCA 4I5BB 3AI0A 3MNWB 1UX7A 2W38A 1Z0MA 2AXFA 2G2RB 5KSBF 1G84A 3DETC 3TCXA 3OKLB 3BIKB 3IDJA 2PYEA 2J77A 1FVEA 5JR2A 2CK0L 3Q48A 4L3EE 2C3XA 3HAEH 1ORQA 4M62H 3FAXA 2ID4A 3AFLA 3HUJA 5LGKA 5IVZA 3AQUA 2N4IA 4P3DA 5EIVA 3TIDA 1BBDH 5D7LE 1Z9LA 4LSPH 3F58L 2B4CH 1V7NH 5C0DA 3LQAL 2XY1A 2PO6C 1ZJBA 1XGTA 1ADQA 5A8MA 3HC0A 5JHDA 4K7PY 2HFGL 1E15A 3QDME 1MVYA 2X70B 4ZPVB 5IFJB 4NRYB 1HKJA 1P7KB 3D0LB 4TSCH 1A1NA 4I3GA 5K9KB 1GAFL 3BYYA 2BSSA 3SCMB 4PD4K 4D6CA 3CVHH 1V5JA 4BUGA 3KJ6L 4X9HA 2C3HA 4WWKC 3NVQA 1E6JH 1MHPH 4OB5H 1YQVH 3KPOB 7TAAA 3P3YA 3W9EA 1ZT4A 1R5IA 3WFCH 3WF4A 3MV7D 3GSRA 5A6MA 1I1YB 1OGTA 2CIKA 4FFYH 4J7RA 4NQXA 3EJZD 5EU6B 4AMKL 1JG9A 2CPUA 2WW5A 4GO9A 1JTOA 1PJ9A 5HVFB 1HXMA 1W0WB 3IRPX 4PRAA 1KACB 2BC4B 4PTXA 1CWVA 2CDEA 4HK0A 2QBXA 4YBLC 2ZCKH 2XPKA 2QHAA 2H9GA 3VFNA 3L3OA 1U8IB 3QHZL 1V0LA 3TT3H 3GMPB 1VFFA 5A16A 5IQ9B 4U6VL 1R3JB 1ZMYA 1W9TA 2QQNA 1ITXA 2W1NA 3HZMA 2I24N 3DECA 4P3CH 2JCCF 1ES0B 3B2VL 2MNUA 3FQNB 2VABA 4MCZB 3S37X 1JTTA 4JZNA 5BQ7B 4KVCH 2ITCA 5I1KH 2JB6B 3G04B 4IRJC 1R86A 2FHCA 4RFNB 2X4QA 1NCWH 2NW3B 5GZOC 2QQLL 4YE4H 2CJUL 4DK3A 4V1DD 3FB8B 4KJPC 3MYJA 3U7WL 2WUHA 5A6BD 3MBXH 3CVIH 1TNMA 4XNXL 1LHZA 4ZTOL 4WHTA 5GGUB 3O8XD 2FBOJ 3C5JA 1EDQA 4IIQB 5EPMA 1M04A 3KL0A 3DUSB 4Z95L 3A6CL 2BVEA 5HGDB 1I9RH 2P4AB 5DEFB 2YPVL 5DMYA 4BK5A 4AG4A 5I8KL 1FFOA 3SEEA 5CP7B 3QQ9C 1QI0A 3VXRE 2GIYA 5A95A 3QZWG 4MQTB 4JZJC 1UR4A 2FGWH 2OR7A 5JUVA 3WF3A 3UYRH 2WZIA 1ADQH 5JOPE 5I1DA 1YEGL 3TO2B 4LRNL 4LSDA 2DQEL 3P30L 4OZIA 1EAJA 4LKSA 4NKQB 3CX5K 5AYQA 1CLYL 4FZEH 5DQDL 3IDMB 4AZBA 3KPLB 2XFYA 1ZT7A 2F53B 3PWUB 1MHCA 3W25A 4QRRB 3UTOA 5IROA 3T65A 3BKJL 3VI4F 3NACH 4P2RB 2BOCA 3FT2B 4O58H 3RJYA 4EN3C 3RX5A 5E0FA 5CXPA 3C2AH 3NCJH 2YWZA 3F4VA 5AUMB 2X09A 5I1CL 4S1RL 1L0YA 1E4MM 2OSXA 2UY6A 2ZOLA 2DYPB 4GXUM 5IMKB 3V6FB 5MI0C 1EEQA 1MUJB 2YD9A 4X9GA 4NKMB 3B3IA 2WWKO 2X2YA 3IXAA 1NBZB 5GGQH 2D2OA 2XUCA 1QLRB 3F7VA 2GJRA 4M03A 1DVFC 3EO1A 4IS6A 1A14L 1CK0H 2OJEB 1MCLA 1CT8B 5IJKA 3LEGA 1QVOB 3MV7B 4QRPD 1D5IL 4L4TD 5IB5B 2O9OA 1A21A 3FMGL 2DGAA 2Y6JA 2HMID 1BJ1J 5FECA 5IFPA 1GNYA 4AQOA 3BSGA 3BAXA 3TZVD 4DGVL 1LK2B 5A8QA 2FB4H 2ZG3A 1KC5H 3CSYB 3F12A 3VIFA 4PJFF 4HGWA 4YZFF 2H2PD 3PGCA 2WCGA 5DK2B 1AO7E 5HHQA 4AW7A 4GW5A 3WEOA 5FGBA 4K3EL 1DBKH 4R4FH 1UR1A 1PLGH 3EMQA 4G42B 1KPRB 1CYGA 3QIBA 3P9MA 1SJVA 4KI5E 4QTHA 2HLFC 5EMYA 4AG4H 4G8IB 1TVBA 4MCYA 4Z77A 2ORZA 2AEQH 4UT6L 2X4UA 1KCUH 1ZWIB 1YEIL 4XP9L 4P00B 3IANA 5F9JA 4LPVA 3EW3B 3G9AB 5FV2A 3RWIA 3SDCD 4ZXBC 3RIFK 3O8XB 1U8NB 5GRJH 2DQIL 3GSVA 3C8KB 3CZJA 3FO0L 3MROB 4NUGL 2EXYC 3TOPA 4RWYH 3O3BA 1QLEL 1U0QA 1RZIA 3TBYB 1XIWB 3MV9E 4Q6YA 3VWJA 5DJCA 4I2XB 5CINL 1TPXB 4GG6B 5I1HL 1K3ZA 2YRZA 3PWPD 4FMKA 2YA2A 3BN3B 4UU9B 5LVEA 3GXFA 5DHYB 2J1UA 3AZRA 1MLCA 4PBWD 1JRHL 4QRUA 2AI0L 4AEEA 2F9BT 3BEVB 3Q3GB 4NO0A 3HE7B 1J84A 3ZO9A 4AT6A 1DBAH 2D4DA 3BP4B 3X13A 2D03H 5LQBL 4P8XA 3RCNA 4GG8A 2X4OA 4JANA 1WBYA 1W99A 1OAZH 4AH2B 2Q20A 1CR9H 5HHOD 5HVHC 2E7CA 2W65B 3QULB 3VFWB 3FNDA 1WZKA 1QFUH 4P4RA 1LO5B 1JZ2A 4JRYE 2JK5A 3OF6A 3SDAA 1YEEL 3VGFA 1HZHH 5A8PA 4CCDA 3EKCA 3HC4H 1MWOA 1L8NA 2B31A 4ARYA 1RY7B 1C12A 1XGQA 4GO6B 4NHUA 4PRHD 3GGWA 4UMGA 3VRLE 4NYLA 1FP8A 2HYMA 1IAIH 4IJ3B 4ZXEA 5B22A 5F7DB 5HDBE 4S3KA 1E4XI 1MCQA 3MMUA 5FYKL 4CW1B 1NGYB 4LSTH 4P4KD 1GW1A 1A1MB 4KK9D 2AK4A 1NKGA 1W9SA 1MW3A 2K7QA 1J12A 3F7YB 4KMTL 5B3NA 1O59A 1PBGA 2H1PL 4L4TB 4EUPA 4P0DA 3ZL4L 3HR5A 4LBEB 3RZCA 1X5GA 2E40A 5FYLE 3OIHA 3R0NA 1ZHLB 2YS4A 3AYRA 3B2UC 3FN0H 1SEBB 3RQ3A 4ODTH 1XC6A 2W07A 4X7SH 1AGDA 3UBXB 2P8LA 4S2SB 3LKRB 3W29A 3IFNL 3AU1B 1CFVH 3L4TA 2D9QB 5E99L 1WBZB 1FO0H 5SWSE 3Q6FB 1FHGA 4A2MA 3C6SB 4O2EA 1GC1C 2FJGB 2OK0H 1YMMB 3L3GA 4KTYA 5GRYA 4LLUA 3I6GB 5DRZA 4BKLA 1YC7A 5CEYA 1X5YA 4M6MH 3O3EA 4LAQH 1W72B 2CBUA 2Y7QB 1S7VA 5H94B 1MQKH 2IMNA 2YDSA 3WF2A 4PJ5A 4IOSD 4RZCB 3BHBB 4WI8A 2W9LA 1JGUH 1PY4A 5DRXB 3ZE0F 4MJIA 2WLZA 3B9KA 1CLVA 4JHOA 3BPCB 1TJHL 3QUKA 2GUOA 4GSDH 4BSWA 5CJXA 2Q7NA 4U0QB 5IV2A 3TESA 1NUNB 2A74A 3G5YB 3ZYIA 1B3WA 5ICXA 4FXLA 5FFLA 3V5HA 3BQUC 5JHLH 1ZL1A 3V5KA 4J12A 2W59A 1T83A 4HUUB 1FGNH 2Z31D 5DDHA 3L3KB 4PIRF 4JO2L 1BVNP 2VDNL 2EKSB 4PJ8C 4XCYA 4ELME 5CJ8A 2CDOA 1W3JA 2GJPA 2GCYA 2C9AA 2R0ZL 4JFDE 1X3DA 4YDVB 5JO5B 3BO8A 5MERB 2QPUA 5E8EA 2NY3D 3BGMA 4QCIB 4HIXL 5DVKA 4J6RL 3TO4C 4U6TA 3O6MH 3L3IA 1NGQH 5H35A 4NT6A 4NDMA 1NFIB 2ADJA 1GOOA 3BN9C 1CG9A 3CCHA 1M71B 3OG4B 4X99B 3L95B 3WFBH 3I6KA 1OAYL 4GAGH 4W89A 5ITFA 3VFGH 1Q9OA 3QH3B 1A0QL 5KSAC 3SURA 2NT0A 1LP9E 1P84K 5KSBB 2B0SH 4YX2L 3UG3A 3GBNH 1G7HB 4OZHA 3EDFA 1HYRC 4FQ1L 4W88A 1NFDF 1BM3H 5D7SL 3DMMD 5F9OL 4AXNA 3GJEA 2G60L 4P23A 4K7FB 3CHEA 3RPIA 3FO2A 2F61A 3BH8A 3EYFB 1C5CH 4ZSOA 4PRHB 4YBQC 1EQCA 3C08H 3BSHA 3TWCL 5J6GB 2R4RH 1OP5K 2X4RB 4YAQB 2I60L 5CGYD 1H3PH 2V2XA 2MPAH 5EC2A 2W60B 2G5BB 3IRZA