3K4DA

Crystal structure of e. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
603
structure length
596
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucuronidase
publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 185
structure length 596
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4dA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4dA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4dA03
1ORQB 4Z2IA 5ICYB 3NCYP 1LDPH 3HCVA 4MOAA 4FOMA 4UQAA 3I02B 4WUKH 4ZQKB 1DZBA 2V9QA 4F57H 1OAQL 3PL6D 1T1XA 3EOYG 3MROB 3MNZA 4ODXB 5FM4A 1BVLA 2D7OA 5L2JB 1QNOA 3GBLA 4DTGH 5C9KA 2IPKA 4HZAA 4EE9A 2V5DA 3WH8A 3HCVB 2Y25A 5E1HB 4N8PA 5BQ7A 2QF8A 3BPNB 1HWGB 3O2DH 3GRWA 2B39A 2D0FA 1T1XB 1DWGM 3MNZB 1BVLB 5F1NA 5IR1B 3D1MC 5KZ6A 2I25N 2IPKB 5I1GH 3MLZL 4HEME 5BQ7B 4CMHB 1VEOA 4GS7B 4ARYA 1BSIA 5F1NB 3GMNA 4XPFH 3PV7A 3JV6A 4MXQD 3BZ4A 4LAJH 3FO9A 5EPMA 2B1HH 2X10A 1IC4L 5FYLH 3S4SG 2PWFA 3WE6A 3GMNB 5C09E 1CDBA 1E55A 2E9BA 3WKMH 1WDPA 1FCGA 4LGPB 3GBEA 3BZ4B 3ZYIA 3FO9B 5EPMB 1KC5L 4Y1AE 3ZT6A 4M3JA 3QUKA 4TULL 2VITA 3WD5L 3WE6B 1D3CA 2X1PA 1X5KA 1XCQA 4JM2F 4HMDA 1FBIL 2W07A 5GISH 4U7KA 5TDNB 4S1RH 1E6JL 4RE2A 4P2OC 1OLZA 4U7MA 2ZEZA 1WCGA 5JUEL 2PF0A 3QUKB 2NTFA 2VITB 5KAQF 2Y6JA 3SKVA 1XCXA 4RSVA 1VENA 1P5VA 1XCQB 3GH5A 2YD7A 2VCAA 4LLYA 3AXLA 5BVPH 3MLRH 3WIJA 1J84A 3RY4A 5HDQL 5DRNA 1N7ML 1T89C 2NTFB 2WO3A 1A3LL 4M80A 3RVUC 3VM7A 5IESL 3CZFA 3MSGA 5DQDL 1EPFA 2YD4A 3AXLB 4LLYB 4GI6A 2D7NA 2BRRH 4LBEA 2EXWD 3CZEA 5DRNB 3O6LL 3MV9A 3K1KC 4X6FA 4JPKL 2UWFA 4NO3A 1LG2A 1CR9L 1XH3A 3CZFB 4HWBH 4PUBL 3SKMA 2MNUA 3WFZA 3ZTJH 3O6AA 4LBEB 4HCRH 3LKRA 3WF1A 1HI6A 4O5LH 4WI5A 3MV9B 2FDBP 2PYED 4X6FB 3BN9C 4Z95H 4NO3B 4ZPTA 1CFTA 4OIIL 1XH3B 5EB9A 4MA3A 3ZO9A 3SKMB 1GGIL 4NM4L 1KQZA 3LKRB 1HI6B 2HFTA 3NFNA 3MV11 4O58H 1QACA 3RVWC 1WC7A 1WUNT 1X44A 3MOQA 2ZUYA 4ZPTB 1CFTB 1OW0C 5BO1H 3HAEG 4MA3B 2NY7L 5I74B 1OD0A 1I1XA 1VGKA 5FYKD 1BQLL 3RWDA 5HGDA 1JPTH 1NAML 1SVZA 1H0DA 3NFNB 3PHOA 4POZD 5BOZG 1X5GA 2YR3A 1WC7B 4JHWL 3DI2B 3PG2A 3TBSA 5C2BH 4PLNC 3VFPA 3QFJE 1RMFH 1VGKB 3RWDB 5HGDB 1H0DB 3PHOB 1ADQA 2DB8A 4LLAA 3TCLA 4NQEE 2P5WE 3Q5OA 3DHJA 5KVFL 2FJHA 3TBSB 2P46B 1MLBA 4BFEA 4AAXA 2EH7L 2DI8A 3VFPB 3GIVA 3CFIC 1OP3K 2J1UA 1RAMA 4K3HA 2WHMA 1CD1A 4PJGA 3SUSA 3QO1A 4AH2A 3TCLB 3AHTA 2ZUNA 2FJHB 1MLBB 4KV5F 3DX7A 4Y7MA 3OGCA 5HHNA 1XF1A 5A6LA 3D0VA 3CX5K 1L0PA 3GIVB 4JFOA 3QXAA 4GMTL 4GAJH 3RGVD 5J13B 1NFDE 1CD1B 4PJGB 2E9JA 3WCYA 3QO1B 3QRGL 4AH2B 3TC9A 3O6KH 3DX7B 4QRPA 3OGCB 2EEAA 5HHNB 4LU5L 3D0VB 4B3LA 1GJIA 5E6IA 4JFOB 3RZWA 3QXAB 4X5XA 5F71A 5DK2A 3QI9D 4K3EL 5EN2A 2O9RA 4HDIA 4UFKA 4FNLL 4QRPB 1JNLH 3VGFA 4I2XB 5G04L 5E6IB 4D9QD 2OYPA 1IKFH 5F96H 1HKMA 4X5XB 3G5ZA 5DK2B 4YHMH 1E4MM 4L1HA 5EN2B 1PBYA 4HDIB 5HXMA 2WUBH 5ACLA 2ZXBA 2AJ3A 1H3TA 3ARDD 4LPLA 3O9NA 3RM9A 4WHTA 3G5ZB 5I8OH 3OLEA 3EGSA 3EYQD 4QY8A 3P1IA 1MCNA 2OYLA 4MAYA 3JSSA 2AJ3B 4WHTB 2WBJC 5MENE 3HJEA 5DD1H 1RU9H 3EGSB 3I3EA 4QY8B 2RIKA 4A3YA 3NUKA 4PRIE 4IRSA 2ITCA 4MAYB 2XT1B 1NWUA 4Y5YC 4D6JA 5I24A 1F02I 3UYRH 1TG7A 1IQWH 2B1AL 4LHJB 3CFDA 4XZUA 2DQUL 3P6BA 3T0WA 2WVTA 4IRSB 2ITCB 4JDTL 1X5ZA 5LGJA 5AYQA 4DK6A 2J25A 4UT6L 4N0CC 2WABA 1W72A 2GIYA 2ZE0A 4AT6A 1JF1A 3SO3B 2A9NL 1AE6L 2NX5D 3CFDB 4XZUB 6CGTA 1URLA 2JJTC 3WO4C 1FH9A 5EZJA 5LGJB 4PJXF 5IKCA 4F7PA 2EXOA 1W72B 2WLZA 4AT6B 1EDQA 1JF1B 3HC4L 3ZL4H 3UNPA 5GRYA 3THCA 3R1GL 5EZJB 1YJDL 3VUPA 5EDXA 5IKCB 1R24A 4F7PB 3WJJA 1MHEA 1N64H 5KSUA 4OCWH 1UYZA 4KK5D 4QOKD 1U8OA 3LQCA 4QNPF 1JAEA 4KWUA 3ARUA 1JFQH 1P1ZA 1W32A 1R24B 2VDPL 4P57A 4Q9RH 4QEGA 1MHEB 1CFSA 5KSUB 3BRGC 5D5MF 1UA3A 4AISA 3F58H 1YEIL 2E7MA 3NCMA 2NY3C 1U8OB 3CZLA 3BD5A 1P1ZB 4IM4A 2WC7A 4P57B 5F6HJ 1CFSB 1YEHH 3MMDA 4W6XB 3OAUL 1KBGH 5E1AA 2ZSWA 3L2MA 1ZJAA 3P4OA 1DLCA 2WKLA 2VDLL 3PHQA 4TXWA 4L8SA 1HSAA 4FQCH 4OCRL 3W81A 5KSBE 3T0DA 1PD6A 1SEQH 2E31A 5D96B 2CKNA 4BQCA 4L9DA 5E1AB 2YEZA 2ZSWB 3W0WB 3P4OB 2I9LA 4O4YL 3HMXA 1PX4A 4ZXBA 12E8H 3PHQB 4L8SB 2DMBA 4L4TE 4X9FA 1G9ML 1HSAB 1MWAA 4OOUA 2WIIA 2CR3A 2YEZB 4JFZL 4K8RC 2I9LB 5IFTA 2WBKA 5GZOD 1TTUA 2Q8XA 4ZXBB 1H2JA 4NWUH 3FQRA 1MWAB 2WIIB 2R8SL 4NGHH 2VZVA 5FKAA 3RBSA 4EQ2A 3EAKA 5HBFA 1F8TL 2XTJE 3FQRB 1GPOH 3ARBA 4QDQA 4WTZA 3RCNA 1W2KT 1ZVHA 1EVUA 4Y88A 2GSJA 3C09B 5FKAB 2GK0A 4CD6A 1CZ8H 3ARBB 1RZFL 4B16A 5I1CL 4MCYA 1UQSA 1YEKH 5E95B 5LXGL 2W1SA 1CNVA 4LCIH 3VDBA 1VADA 3U5UA 3VX1A 5FHBH 3SGJA 4XMKL 1BFVL 2GK0B 4K55A 5IGXH 3FT2A 4NM8L 2DDXA 3RUGF 4AQ1B 4K3JL 4MCYB 2VABA 4P3CH 3VFOA 1UQSB 4LSQH 5EO0A 1VADB 4LSUH 2PWHA 1U3YA 4H1LG 2J78A 1NMCC 3FT2B 4FFZL 4ZUTA 4KPHL 3L1OL 5DJAA 4GRWB 5A40E 2FBJL 4AMCA 4N1HB 2VABB 4Y1AA 3VFOB 1XSIA 5EO0B 1V0KA 5ITFA 4RMWA 3MV9D 3AIWA 1RZIA 4ZUTB 5DJAB 3WDRA 3ARFC 3VGAC 6TAAA 3UO1L 5MP6L 2QSVA 4XAKE 4Y1AB 4ZNCD 1V6UA 5ITFB 1G7PA 2BFGA 5T1MA 1P4BH 4F9PC 2CESA 3LKPA 4X4YA 1RZIB 3VIHA 1NEZA 1GZQA 2DQDH 3HI5L 1VFBA 1FGNH 2BHUA 2VMDA 4JGMA 1G7PB 5F9JA 4KVCH 3QZWA 4FQLL 5T1MB 3LKPB 5TFSH 4LVEA 4X4YB 1NEZB 3Q6GL 2C4FT 3RA7L 1GZQB 1VFBB 4PJ9A 1Q9OB 2QQLL 5CSBA 4W5ZA 3GJFH 3PUCA 4GPNA 1SBSL 3ZDYF 5F9JB 3QZWB 3OKMA 1A6UL 4D6DA 3J7HA 2ESCA 3B5TA 3QOMA 3MLPA 4OAWA 3ME0A 4PJ9B 2R9HD 5HI5D 1GGBL 5GJTL 3CDZB 5AG9A 4U6VH 3OKMB 4GOSA 2GQHA 4OAWB 3RIKA 1H9VA 4TVCA 5EFIA 3C2SA 3NSXA 5FYKL 4NN7C 3RPKA 2YFUA 2QQNL 4Q22A 3GM0A 5DD3H 4J3SA 5EC1A 3TO2A 3A22A 2E9MA 2DSVA 1DHKA 5EFIB 2VXSH 1CDHA 2R4RH 1RD6A 5IP4A 3K8MA 3FQTA 1FH7A 2F8OA 1A7OL 2ZXAA 2WUHA 3TO2B 5EC1B 4CUAA 2YLLA 4PQQA 4Z0BL 4PJAE 2W63A 3QFJA 3MJ9A 1MRFH 4DKEH 5E6ID 1JI1A 1Q9WA 2IPUG 3KYKL 3M46A 1KIUA 4RGNE 3V5KA 1CECA 3FQTB 3K77A 1JD9A 1FG9C 5T1DH 3ZJ6A 4Z7QF 4A6YH 3VFTA 2IANA 3AMLA 3QFJB 4FFWD 4HGWA 1P4IH 5C2UB 3T4YA 1NP0A 1Q9WB 2LAGB 1EH9A 2ADIA 3WL9A 2V5SA 3V5KB 5IWLC 2ZOXA 4LARL 3BAIA 5DJZA 1B2YA 3VFTB 2IANB 4TNVF 4P9HL 3DGGA 5DFVC 4HGWB 4PGBA 3T4YB 4W84A 4PLKC 4XNMA 2DLIA 1K6QL 4LASH 1NFDA 3VNZA 2ADIB 4S1SH 1ZHLA 3WL9B 4PY7A 1WTLA 4IEFB 4FQPA 5IFAH 3FO2A 5DJZB 1BECA 1AI1H 4L3EE 1MPAH 3CFCH 3DGGB 4MAYD 4PGBB 4HG4K 5I18L 5CJ5A 4XNMB 1NFDB 1EJOH 2XZZA 1ZHLB 2VVSA 1OAUH 1YMME 2MQ0A 4PY7B 5DURB 5ITBL 2YC4A 3ESUF 4N42A 2V3FA 1MNUH 3FO2B 1P6WA 4IRSD 4G6ML 2JCCB 4KRTA 1KQYA 4JE4B 3LSOA 3LH2H 3QISA 2XM2A 1AJ7H 1MLCA 1JDAA 4IPLA 3A4WA 2C7UA 3M8OH 4XVTH 4N5ED 1CLZL 2Y9RT 1BZQK 8A3HA 3A0OA 4HFUL 4KK9C 5M17A 4XMPH 3GMOA 3S35X 1MLCB 3WFCH 1U9KA 1CFVH 2C7UB 1A5FL 1HYSC 1RV6X 5F7EH 3PP4H 1VPOL 4X9BA 2DD8H 4U05A 2AVGA 3HZKA 3GMOB 4A44A 4YHZL 2XIIA 5FM8A 1NMBL 1I9JH 4BFIA 1FV1A 2GW5A 4M7KL 5K9QI 4KFZC 2PR4L 2YDRA 3C8DA 3HZKB 4LVHC 5LA0A 1HH6A 1KUMA 3SDDD 4NWTH 3U0PA 4G8GA 1TQCB 3ZZ1A 4BYHA 5C0EA 4Q6IC 4BFIB 2OP4L 1FV1B 4ZUUA 2FX7H 4FG6C 1SDDB 4RMTA 1G7IA 4GI9A 4P00B 1U3HC 2VXTH 1HH6B 5L88L 3U0PB 4G8GB 4TOYL 5C3TA 5C0EB 4ZUUB 2NY6B 1SJVA 1KJVA 1PSKL 4I77H 1G7IB 2ICWA 4XPGH 2HT4D 3IFOA 4LQ1A 3ARYA 4P02B 1KJVB 1X3DA 5IW3A 4EN3C 5JORA 2ICWB 3IFOB 5I9QC 1KPUA 3VIFA 1FNGA 3GKWH 5E0CA 3SQOL 3TV3L 1BM3H 5C7GA 4Q7NA 1EMTH 4GIAA 1UCTA 5HJ3A 4ERSL 1FE8H 2L7JA 3EYVA 4LGRB 3LZFH 5T3ZE 3OKEA 5JORB 5DLML 1HHGA 1Q6DA 3SCUA 1LO2H 1KPUB 1TDQA 1FNGB 3WIHL 4DQOL 3RU8H 4D94A 3CGTA 5HJ3B 4W5UA 1I5PA 1VRXA 4LSTH 2WSKA 3EYVB 1C92A 3IU4L 4XX1G 3OKEB 1EO5A 1CIYA 1HHGB 4LIQL 2W95A 2B2XL 4GSDL 3GI9L 3CPLA 2PW1A 1CLCA 1TJIH 1WWBX 1CU4H 1YECL 1DBAH 4ZO6A 4G8IA 3O2VL 1NM9A 4OF6A 3GRWL 5F6HI 4EOWH 3AICA 1RVFL 3CPLB 2PW1B 5DD5H 5KSBA 3ARBD 2Y6SD 1CYGA 4G8IB 1OAXH 2HLAA 2XKSA 4BELD 3HUJE 2DWDA 3QEGL 2VDKL 5IMMA 4DN4L 3CX5J 2BNUA 2EYRA 5I2UA 4L4TA 1OAQH 1M01A 4U33A 3DECA 1CK0L 3U9PL 1AVAA 4U0RB 4G6AC 1GGCL 5DMIL 3VFSA 1OCQA 2HLAB 2DWDB 1L7TH 5IMMB 2BNUB 2EYRB 1DBML 3V6OE 4L4TB 1C1EL 2Y7QA 2VZQA 4XCNA 4PJIE 3VFVA 2UV3A 3VI4E 3TF7C 3BC9A 1J01A 5EB8A 3LV3A 4L5FL 3MLZH 3VFSB 3P9MA 4BCEA 2O92A 1EBAA 3X3FL 2Y7QB 4XCNB 1WK0A 3VFVB 1XGZA 3ZIZA 4OIBA 4GXUM 3LV3B 3H7BA 4Y1AD 5KVEL 3MGTA 1KCVH 3OAYK 4GKZA 5D7IF 2A2QT 3P9MB 5GQBA 4UNIA 1RY7B 2NR6C 5EORL 2BV9A 5FYJD 3MRHA 1H5BC 1IC4H 1TZHA 2CKBA 2MOVA 2WVVA 5I6XC 4HF5L 1D5XA 4XP1L 3OEBA 1CZVA 2PTTA 1G6VK 3H7BB 3MGTB 4GKZB 1DQTA 5B8CA 1IEHA 5DJXA 3TM6A 2UWEF 1RQ5A 2CKBB 2V7HA 3MRHB 1TZHB 4PTMA 2WVVB 3S3SA 1RURH 4R5EA 4TULH 1MH5A 1D5XB 3WD5H 2PTTB 5HNNA 2NYYD 5CUSL 5ANMA 1FBIH 5B8CB 1E6JH 4ODHL 5DJXB 3MLUL 4N68A 4P5MA 1H8OA 2V7HB 3H3PL 3JWOL 5JUEH 4NUGL 1CLOL 1MH5B 1RUMH 4PJ9D 3L3KA 5ANMB 4MAUL 4M43L 4TTUA 2WKGA 5JBEA 4P5MB 5HDQH 3NZ8A 4AIOA 1N7MH 1TTGA 4Y8AA 1KYOK 2CDEA 2D31A 3L3KB 1A3LH 5EC2A 4JKKA 1R0AL 3PWJA 2O5YH 1Q9LA 3AB0C 5DQDH 4DEPC 4W8LA 1NFKA 1GYAA 1BQHA 4D9LL 4LCCC 3NZ8B 3VRIA 3O6LH 4DCQA 1GQJA 1IAII 4JPKH 4FQIL 5CCKL 4JZ5A 2CDEB 2D31B 4K7PL 4UT9L 1CR9H 5E5MA 5EC2B 3PWJB 5HI3C 1UWXH 4PUBH 3RAJL 4BM7A 1Q9LB 1MSPA 4Z7WE 3BIKA 4XZUG 4N0FA 4C58B 1WTGT 1BQHB 4CD5A 3VRIB 4DCQB 1Q1JL 4OIIH 3WFDL 4D6CA 5E5MB 2R2BA 3ZKXC 5CEYB 3SKOA 3BIKB 1E5JA 1GGIH 3PL6C 4NM4H 5JXEA 1UX7A 3QFJD 1XMWA 2R2BB 2NY7H 2NW2A 5F7FA 3SKOB 4PMVA 1BQLH 1NAMH 5F89A 4C83A 2IAND 4JHWH 2YBTA 1B88A 1MI5E 2NW2B 3CLEL 5EIIA 4M6NL 1FAIL 4QRQA 2XZQH 4HLZG 5F89B 3CDFA 1RP9A 4C83B 5HDRA 2ZUQC 3MRPA 2AP2A 5CHNA 5KVFH 4MXQC 3SUTA 3CU1A 2EH7H 5EIIB 3QDAA 3GMQA 3G9AB 5DURD 4NIKB 3A6BL 2FSEA 4BXSV 3MRPB 4RWYL 3KPRE 5EOCJ 5CHNB 2PKDA 5C0FA 4BKLA 3K3QA 4XUQA 3P9WB 3GMQB 5FL0A 3W82A 1T2JA 3OXRA 2FSEB 1RZKC 4GMTH 1ZGLP 1OT2A 1CXEA 1QI3A 4RISL 2J7DA 4P8UA 5FIPA 4PUEA 5C0FB 4BKLB 1A6TA 1QUNA 4NP4L 2AK1L 2EE9A 1WBZA 3CD4A 2NY1B 2GJ6A 3IU3A 4LU5H 4RGNB 5DEGA 3OXRB 3U4EA 2ZXQA 5EZLA 5HDLA 1ZHKA 4K3EH 4EI6A 1HHHA 2YG0A 4FNLH 2YWZA 1A6TB 2O93L 5DEGB 1ZHNA 1WBZB 4YHEA 2GJ6B 3IU3B 1CTNA 3SPVA 3U4EB 4KU1A 5EZLB 1ZHKB 4L3EA 1CZ1A 3NCEB 3WUGA 4JZJC 4EI6B 3JTSA 1QFUL 2EXWC 2APWA 3THML 4A42A 1Z0NA 1ZHNB 3GSQA 1V02E 1Z32X 4I9WD 1NL0H 3SPVB 1TZIA 1A7QL 1J0JA 4RRPA 4XNXL 3OA5A 2QSCH 4L3EB 5EU6E 5HHMB 1EQCA 4OZIF 3CUFA 5K93A 2E27L 3K74B 4WF7A 4WTZG 4LPTA 3GSQB 5A2BA 1E0OB 2QMJA 4G8GD 1J0IA 1OVZA 1TZIB 1W72L 2F5BL 3F8UB 4P59L 4NO2A 2NY6D 2ZEYA 4OFYA 4OF7A 4HA1A 4UQDA 1OD7A 1AO7E 2P45B 4U1GB 1QFHA 4DVRL 4MYWB 2VLLA 2WYSA 3HAEH 1QHZA 3N18A 3VILA 4TSCL 4X5LA 2B1AH 4FTVE 1UCBL 4ACYA 2DQUH 1H6XA 4M8VA 3W9DA 4KV5E 4POZC 4JDTH 2WANA 3CMGA 2VZTA 5JW3H 2VLLB 4J6RL 3RY6C 4UT6H 4NOBA 1NGQL 1I9EA 1TFVA 2DLHA 4PTVA 1AE6H 1VFAA 3W9DB 2ICCA 3M6DA 2PBGA 3C8KA 2P7TA 3HZVA 1KR0A 1S9KC 5L8LB 5F6IC 1QW8A 3O81A 5B39A 3MLYL 4K71B 3AM8C 3HC4H 4Y2OA 5J12B 2CYGA 1VFAB 4U1KA 3DVFA 3C8KB 2P7TB 3HZVB 2MCG1 4OZHF 2HFFB 5LYRA 1WT5A 5B39B 1A3QA 4YFEA 1L7IL 1NEZG 2CLRA 3BUYA 4RBPH 5J1AA 2CEQA 4NCDA 3SUUA 3W6LA 3BP7A 5CJXA 1ITXA 4U1KB 3RGVC 3PNWA 1LEGA 3QZWG 2VDPH 2QQIA 1FYHB 1IGIH 5C8BB 4P9HC 3M45A 4EVNA 4ODVL 2CLRB 3BUYB 4M9PA 5J1AB 1YEIH 2EE2A 3FT3A 3BP7B 1AGCA 3QI9C 1QI4A 3PNWB 4G6FB 1LEGB 1IARB 1Z9SA 5BW7A 4P48A 4Z7VF 4EVNB 4D6EA 5IXEA 5D4QA 1MAJA 1KWGA 4BZ1L 2V38A 3OAUH 3FT3B 1AGCB 4P7OA 4XV0A 4L4TD 3ZDXE 5LCWL 5HGBA 2Q76A 2ATPA 2VDLH 1FFPA 4R97C 4C7GA 4OCRH 3EBVA 3ARDC 4YHYC 1XCWA 4ODSL 3UJIL 3UXFA 3PHSA 4O4YH 5HGBB 2Q76B 3EYQC 1ZS2A 2ATPB 3VW3L 1FFPB 2DBLL 5JIIA 1G9MH 3QR2A 4OLZL 4JFZH 3AHXA 4EK7A 1GOKA 2FCBA 3K0WA 1CQYA 4HT1L 4UFMA 1GOFA 1HN1A 1IE5A 1CZSA 2J7LA 3HUJA 3OMZA 5B4MD 2R8SH 3ZLQC 4FZEL 5A6KA 2YPKA 4YWGL 4LYRA 4PGJA 4PMNA 1F8TH 3HUJB 2ZWLT 3RRQA 3SGKA 2B7DT 1GHFL 4HG4J 4PJIA 1UXWA 5FHAL 4CKQA 2YPKB 1BPLB 1FHDA 4R27A 2E0PA 1RZFH 5J56B 5I1CH 1FZKA 3NPSC 2OKXA 4UZGA 5LXGH 4PJIB 1UXWB 1CZTA 4PJFA 5FYJL 1PW3A 4XMKH 1BFVH 3WHE1 2BS9A 1J87A 3IDIA 4NM8H 4K3JH 3VWJA 1FZKB 1KT2A 1GQIA 4PJFB 2J1SA 4KK5C 4FFZH 3IDIB 3BE1L 4KPHH 3L1OH 3SCTA 4J3OC 2FBJH 3OKYA 3VWJB 4JFUA 5I6SA 1KT2B 5B3JE 3AGVA 5FCZA 4P4KA 3BYYA 4LVNB 4JR9H 2VC9A 3UO1H 5MP6H 1U3JA 1MELA 1EHNA 1CGSL 4ONOA 1NDGA 3H3KA 4P4KB 3BPNC 2X2YA 1UD8A 3HI5H 4Z2AA 1JHLL 3KPPA 1NDGB 4X83A 5JXED 3CUPA 3AXHA 4FQLH 1OY3B 2A6JA 4Y16A 4UDTA 4WFHE 5GHWL 4CMHC 3Q6GH 3RA7H 1UB5A 3VDAA 5F1OB 4GS7C 1CL7I 1XH0A 3KPPB 1SBSH 1U30A 2X44D 3CUPB 5D9MA 2EXYD 1A6UH 2A6JB 4Y16B 2DRUA 5L6YH 4UDTB 3O2WL 5EOCL 2EH8L 1UB5B 3HKFA 1NCDH 5GZOC 1GGBH 5GJTH 4WWID 4U4BA 1MW2A 35C8L 3U0WL 3F7QA 1JIBA 3MJ9L 3RUGE 3TYGH 3S6CA 3AHZA 5FYKH 4JAMA 5I76A 3T2NL 1MAML 2ESVE 2QQNH 3BN3B 4OJFL 3EMZA 1FNEA 2VE6A 3ZJ7A 4RGND 2NY1D 1S8DA 5HVFB 5IDIA 1J0HA 2F9BT 1A1OA 4JAMB 5F7DA 1OGGA 1D5BA 5E6YA 4WEBL 5I76B 1QFWI 3VWKA 3R0NA 1MI5A 1A7OH 4JM2A 1NARA 1FNEB 2VE6B 3BW9A 5H94A 4Z0BH 1IT9L 2J7HA 3W11C 1S8DB 2GJ6D 1ZLVH 3V8OA 1A1OB 3GBNL 3KYKH 5F7DB 1D5BB 3BCFA 4C54A 5CBAA 3VWKB 4TTGA 1MI5B 4JM2B 3AS2A 5H94B 1QSZA 3BW9B 4NZDA 1AC6A 1E71M 3BZFA 4H1LH 2PCPA 4JQIL 1J0ZA 1KB9K 1BLIA 2Z92A 2DQTL 3KPRA 4L3ED 5HHMD 3RX7A 3VMOA 5CBAB 3L95A 4LARH 3U4AA 1H6YA 4P7NA 2X4TA 3I2CL 2VX5A 2NY4B 1UD3A 4P9HH 5A95A 3BZFB 3DSNA 1C8PA 3IB4A 2PCPB 3MUAA 3JWOC 1K6QH 4WGVB 5BRZE 2KUTA 2Z92B 3KPRB 3V79C 4GFTB 1GQPA 3H7LA 3L95B 4UIKL 2X4TB 3OGOE 5JOEA 2OSXA 4AD0A 3H6JA 4YO0A 5I18H 1MREL 4JG0L 5ITBH 5JQ6H 5I74C 1HNYA 2JIEA 4OFYD 2XY1A 3C8XA 4P08A 4G6MH 4YO0B 1MCCA 4G9FE 2AK4A 2ED8A 3MUY1 3MOAH 3K7UA 3VXNA 1VCAA 5FO8A 1LO3L 3CAFA 3GHEH 1UM6L 2EC9T 3WBAA 4UOW0 3F5JA 2ZUSA 4YZFF 1YMHA 1FL5A 5K59F 4HFUH 5AYIA 2AK4B 2I24N 4KKNA 5EU6A 4AD1A 3ARZA 3VXNB 2OLDA 4WY7L 5FO8B 2H41A 2R9HC 2QL1A 1XGQA 3BPOB 2AABH 2YFZA 5KSAA 1YMHB 1VPOH 1FL5B 2KQMA 2OR9L 5EU6B 3CVIL 1A9EA 4YHZH 5BXFA 1NMBH 1WE5A 1AO7A 1XGQB 2J8UE 3WXVL 5KSAB 1EOKA 5J13C 4XPHL 4M7KH 5HGHA 1IM9A 1J86A 2PR4H 2OWXA 2VZSA 1G7MA 4KRNA 1MF2L 1A9EB 4M7LH 2BRQA 3NPZB 5BXFB 2OP4H 2YRZA 3OX8A 4R4ND 5HGHB 1IM9B 3BQUA 2IGFH 2GDUA 4TVDA 4G6FD 2AJVL 4OV6F 4L4JA 3VM5A 3V52L 1G7MB 5L88H 4JY6A 3M1BA 4TOYH 4N1EA 5E6IC 3OX8B 4RE4A 2UY3A 1PSKH 1UZ1A 1UZ6F 2P8PA 3BQUB 2GKIA 5SWSE 4MSWA 2MANA 4JY6B 3KG5A 3M1BB 5DJ8A 5K9KA 4FFWC 4F15B 1G1CA 3MOBL 3V7AE 3WNKA 2P8PB 3OLDA 1BQHG 4MSWB 3SQOH 2JJWA 3TV3H 3BKCL 5DJ8B 5K9KB 3ECQA 3CSYA 1LMKA 5T3XE 4N8VA 3E2HC 4ERSH 3BHBA 5I0DA 1B3XA 5DLMH 1PZ2A 1V3JA 4MB4A 4OFIA 4IOFD 1Z9OA 4MNQA 3WIHH 4DQOH 4MAYC 3H2WA 5SX4H 1KELL 5I30L 1DFBL 4W8JA 3CSYB 2WN3A 4N8VB 1JZ7A 1G0CA 4LXFA 5DHXB 4GO6B 3BHBB 3IU4H 2J88H 3G6DL 1QI5A 4LIQH 2B2XH 4GSDH 3GI9H 4MNQB 4MADA 5DTFA 4IRSC 4OYUA 2HMID 1YECH 2VQTA 4MZ3A 3O2VH 5ABEA 3T0EE 4LSRH 1I1FA 3GRWH 3TT3L 3GIZL 3QHFL 1RVFH 3SO3C 4TX6A 1C8XA 4PEEA 3NTCL 4N5EC 4E2OA 5DTFB 4PRPA 4UQ9A 3SO5A 3AU1A 1Q94A 1EHXA 1YPZE 3A23A 4YDIL 5CG0A 1I1FB 3BZDA 3QEGH 2VDKH 5DR5L 4DN4H 2ZUUA 4UOJA 1S9XA 5JHLL 3MU7A 1OCWH 4APQA 1FRGL 4PRPB 4JAWA 4PMXA 1CK0H 5A2AA 3AU1B 4GG6F 1Q94B 3U9PH 1GGCH 5DMIH 2ITDA 3PF2A 4PJXA 2K1MA 3Q3GA 3SUVA 3INUL 3RWEA 1S9XB 1DBMH 3QEHA 5HI4D 5CPQA 1C1EH 2CSPA 4APQB 1DWFM 3L3OA 4L5FH 3EJYD 3V0WL 3WJJC 1J8KA 2QTEA 4PJXB 3Q3GB 4P7QA 4QHMA 1BHGA 3RWEB 1CF8L 5HYJE 3QEHB 1LILA 1W3HA 3QUYA 4UUJA 4UAOB 4K68A 5DSCA 3L3OB 5I1JL 5JR2A 5KVEH 5KEZA 5AAMA 4QHMB 3QIBA 4P4KD 2XACC 4LSDA 3SE9L 4GKSA 3MA7A 3MMEA 5D5MA 5C0GA 4HF5H 4UUJB 4XP1H 5DSCB 2BJMH 5HPOA 3PTKA 2HT4C 4NQDE 4YE4L 3QIBB 1JF6A 2C0HA 4GKSB 3MA7B 5D96C 3MMEB 3AIVA 5D5MB 5C0GB 1BFOA 1UR8A 2W9EL 4MJ5A 2EPLX 5CUSH 4F58L 1SMOA 4ODHH 4L8SC 3MLUH 4Y16D 7A3HA 3H3PH 3JWOH 4RRPG 1BFOB 4NUGH 1CLOH 4MJ5B 5IVXE 4MAUH 1I1AA 4ZXBC 5I1HL 2WHLA 4M43H 2HJFA 3KPSA 2AMGA 3ZE1E 3MRQA 5TE7L 1R0AH 5HOSA 4EI5A 1I1AB 2I5YL 2HJFB 3KPSB 4D9LH 3TVMA 4OUOA 1FVDA 3JTTA 4LLDA 2EECA 1WFUA 1YYLL 3MRQB 1Y6MR 3GBDA 5CCKH 4FQIH 4WI7A 3WMBA 3KS0J 3WIFA 4K7PH 4UT9H 3C09C 3RAJH 1D6VL 5FO7A 2F53A 4EI5B 1VERA 1NOUA 2GJRA 1UWIA 1WPCA 4M61A 3TVMB 2A1WL 1FVDB 3ARBC 3JTTB 4LLDB 2Y6SC 3I84A 4P2CG 1N5AA 5AYUL 5T33H 1OF4A 1T83A 1HVXA 4KI1A 4HUUA 3WIFB 3QHZL 5FO7B 2F53B 2AW2A 5HVGB 5CFHA 1DLFL 2ZKHL 1JAKA 2A38A 4M61B 1R3JA 4TNVK 3VWKD 1MI5D 4AD3A 1PKQA 1N5AB 4JM2D 3DUHA 4HUUB 3SE4A 2X6MA 5B39G 1ZLSL 3SGJC 5JUVA 4OGXL 2HFGL 1VFUA 3IJSA 5FDWA 1R3JB 2NY0D 1PKQB 3RUGA 1NANH 2FL5A 2NY4D 1LGVA 3CLEH 4HLJA 4M6NH 1FAIH 3KPRD 1FFOA 3IJSB 5FDWB 2ESVA 5C9JA 3RUGB 2ZUVA 2ORBL 2NXYD 2FL5B 3ZDZF 2ZUWA 4HWZA 1UWTA 2FO1A 5I0ZA 3LD8B 5DWUL 4R7DA 5J0BA 3VRLF 2RGMA 1FFOB 2ESVB 3ZKMD 3HI1A 3A6BH 1ZANL 2G41A 5C9JB 4ISVB 4UNTA 3GYCA 3EDFA 4UFLA 3PTMA 4OCMC 1W3LA 4HWZB 4R7DB 3TWCL 5DFWH 3FFDA 1NUNB 1XF3A 3HI1B 3OEAA 1JNNL 2NYYC 4RE3A 4JKPL 2WZEA 3MODL 4RISH 3HNVL 1LNSA 1KGCD 3U79A 3SKJE 4NP4H 2AK1H 2NCMA 3FFDB 1XF3B 2YIHA 4KXZI 2ZSVA 4PJ9C 1NEUA 1J9CT 4PBVC 1S5HA 1RJCA 1XR8A 5DDHA 1GU3A 5EU6D 2ZSVB 1QYGL 4ET7A 4JQXA 5ENWA 3AS3A 5KSAD 5I19L 3MBXL 3AXIA 1S5HB 1XR8B 1F3DH 1QFUH 3FAXA 5DDHB 1ZWIA 3THMH 3RWIA 2QJDA 4BJ0A 1F2QA 5E9DE 1A7QH 5GPRA 4XNXH 1AO7D 5ENWB 1JFHA 4WLCA 1OQXA 2E27H 1IM9D 3UDWA 2BVEA 5CD5D 1ZWIB 4OLEA 3RWIB 3NIDE 1RULL 5ABHA 3GMMA 1W72H 1M03A 2F5BH 3E8UL 4G8EA 4P59H 2WAOA 2W46A 2P44B 1OH4A 3ULUC 3BQUD 2WDBA 4DVRH 1RK0A 5JMRA 2VZPA 2I07B 1WB0A 4Z2GA 3GMMB 4XI5C 4G8EB 4GRMA 3WV0A 1FFRA 4TSCH 3RBGA 4RAVA 2GFTA 1UCBH 2JF7A 5LQBL 3GI8L 5DUBA 5DZNA 2WP3O 3VXSA 5JXAL 2PO6C 1RK0B 4J6RH 1H3UA 4LSSH 2YDQA 4GRMB 1NGQH 5BZWA 3S98A 2X4NA 1E6OL 4RAVB 4XBEL 3MJ6A 4HLZH 5DUBB 3VXSB 3DSFL 3GZKA 2P43B 1T66D 3HE6C 5CZXD 4MO3M 1OSZA 5BZWB 4ZDHA 1PG7X 3MLYH 2DI7A 3ILQD 2HJLA 4JFEE 4KGJA 4C56A 2OWWA 3IDJA 3F6IA 1U0QA 1VBUA 2QLVB 4Q2ZA 4MNQD 1XF5A 2YPLE 3KPOA 1T0NA 1OP3H 1OSZB 1UOKA 5F1KC 4ZDHB 4NJAL 5T3ZL 4K94L 4P4RA 3AREA 2HJLB 4C56B 5C0CE 1L7IH 4CVZA 3IDJB 2XGIA 1NBZA 4PJCE 1ZAGA 4LLVA 4P23A 4Q2ZB 4ELME 1XF5B 1OF2A 3KPOB 3O2DA 1T0NB 1UY2A 2W1UA 5IJRA 5FXCH 4NBZB 3WF2A 1XGPA 4P4RB 3AREB 2YD5A 4M62L 4ODVH 4OZIE 4AY1A 4CVZB 1NBZB 1P2CA 2VDRH 1BJ1J 2N7AA 4LLVB 3HMXH 4P23B 5FF6A 4JG1L 3RDTA 3BAYA 1OF2B 4PRPD 4XC1L 3RX8A 5BJTA 1XGPB 1NX9A 4HV8A 1X5YA 4BZ1H 1P2CB 5KVMC 5FF6B 3RDTB 4NOFA 4HX1A 4APQD 1ZTXH 4FQQA 4MNHA 4HV8B 4OIFA 4OGZA 4JHBA 3RNQA 4ODSH 3UJIH 2VSCA 1TQCC 4JANA 1JI2A 5DO2D 1HYRC 4HX1B 3SDAA 4AY0A 4MWFA 1LP9E 4HKXA 3VW3H 2P47B 2WLYA 4LKXA 4MNHB 1RFDL 4NN5C 3UYOD 3RNQB 5EJ1B 3S97C 4OLZH 5D7JA 4JANB 1FYTE 1Q6FA 1KB9J 3QUYD 3QP3A 4XNUL 2NY6C 3SDAB 3VFWA 3PZ9A 4MWFB 1JJUA 5AAWA 4HT1H 1YPZA 4HKXB 4JQVA 2KPNA 4LKXB 3TTQA 1RZ8A 3ISWA 1JZ4A 3ZE0E 1H3PL 5F3HA 2YC1A 2B5IB 3QIBD 4DKFL 5D7JB 3SCPA 1KNOA 1T4KA 4FZEH 1KV3A 3AY4A 3I2GA 3VFWB 4MA7L 2IFFL 4YWGH 1YPZB 5KAQG 1RZ8B 2CXGA 3FY1A 1EGJA 2WV3A 5F3HB 2YC1B 1GCYA 4R3SA 1GHFH 4AZ8A 1KNOB 1T4KB 3ZO0A 5FHAH 3D3VE 4WHYG 4YK4B 4N1CA 3O4OC 2AJSL 2WP3T 4PBXA 3L5XL 2VCBA 5BXPA 2EDEA 3I97A 2E9LA 2OR7A 4R3SB 3ARGA 3DX6A 4JCLA 2X89A 43C9A 5FYJH 3SHSA 3ULVE 4QLJA 1I1AD 1OTUD 3DLQR 4Z7VE 1QPXA 3S7GA 3POCA 2J75A 3WD2A 3KPSD 1FHLA 3ARGB 3DX6B 4NSKA 43C9B 1UKPA 3BWUC 3F6LA 3ROLA 5EU3A 4EI5D 1KB3A 4NQDA 1LE5A 3FO0H 3Q5TA 3TVMD 5E08L 4ZO9A 2BVTA 4NSKB 2NSXA 5HDOA 4ZXLA 4JFYA 2D0HA 3ROLB 3QUML 4M4RA 2Z1SA 5EU3B 2F53D 4NQDB 1JGLH 1LE5B 2MJWA 3IJ7A 3JV4A 1CGSH 3QDGE 4L4VE 1PY9A 2HH0L 1UG6A 4U0RC 1MCHA 4JFYB 4O2FA 4OQTL 3LPWA 3MLVL 2ZICA 1JHKL 4K3DL 1JHLH 3JV4B 1JD7A 2YXFA 3K4DA 4P2RE 3WN5A 5F3BA 5JA8B 2EDFA 4O2FB 1RIVL 4LMQE 1KTLA 2APXA 3TT1L 5GHWH 1BLNA 4OTXL 1BGAA 2YL8A 1GC1C 4M03A 5F3BB 4OKVA 4XPBH 1QLEL 1W1TA 1KTLB 4QRTA 1FOBA 1REIA 3O2WH 5EOCH 1BLNB 2EH8H 3VXME 4XB7A 2ESVD 4OBSA 2KQNA 4OKVB 4ZUWA 1E43A 2ZEWA 1ISXA 35C8H 1TNMA 2V3DA 3QR3A 3CXHK 4QRTB 5B4MC 1KFWA 3U0WH 3MJ9H 5D7IA 3D39E 3BO8A 5E0FA 2D3VA 3T2NH 4ZUWB 5B8CC 1MAMH 3PWPA 4OJFH 4UV7L 5D7IB 4Z18A 4DGYL 3UTZA 3BO8B 2OXGA 4I13B 2XG4A 3QNYA 2UWEA 4PJ7F 5JBFA 1UD6A 3PWPB 1MHPL 3SUWA 1BD2A 2ADJA 3A4AA 3UTZB 4N8VG 1IT9H 1U8KB 1RIUL 4H8WC 3WO3B 2E4TA 3F4VA 3QNYB 2UWEB 2VX6A 3NJVA 1P7HL 1WWWX 3OJ2C 3GBNH 1GQLA 5HTSA 2JJSC 3L6FA 4H04A 4R7NA 1XGRA 2A0LD 4XVJL 3FB5A 5BS0A 3GGLA 3LMJL 1MFCL 1BD2B 2ADJB 1GUIA 2FH6A 1UEMA 1HEZA 4JQIH 5EIVA 5EO9A 3L6FB 2DQTH 4R7NB 4LCWE 1XGRB 1SJXA 3FB5B 5BS0B 3I2CH 4UB0L 1UY3A 3VD4A 1HEZB 5EO9B 1F11A 2DI9A 2NY2B 2DLGA 1Z9MA 4Z8FL 8FABA 4HU8A 4IBLT 4UIKH 3RP1A 3K75B 3MA9L 5TQ2L 2O9OA 3S3PA 4XX6A 1F11B 1MREH 2R0ZL 2WBWB 1IFHH 4JG0H 4ODBD 1JGIA 8FABB 3QDME 1E72M 2W5FA 1SEBA 1HKKA 1R3KA 2CITA 5JXEC 5BVJA 2DQXA 2X4PA 2XQXA 4PMUA 4CAGA 5C70A 1K9DA 4DM2A 1LO3H 2EO1A 3O8XA 4IDLA 4PJHE 1W9SA 5BXTA 1VBRA 2NQCA 1UM6H 1SEBB 3VXSD 4WU7A 1R3KB 1N0XL 5E9DA 5BVJB 4JRYA 2EXYC 4J4PA 2DJUA 3P3YA 2X4PB 5I17A 1MRDL 2XPKA 1X9QA 4WY7H 1MHCA 4YFDB 4QGYA 4LPVA 1FPTL 1P9MA 1RZJC 4EBQL 4WU7B 4JKLA 5D2LF 5E9DB 5JPMA 4JRYB 1W1YA 1U8IA 2OR9H 4Y5XA 1WAWA 1KR1A 2W9DL 3SDCA 2EQDA 5I17B 3BCDA 5EU7C 3W4RA 4NQCA 3CVIH 4C56D 4IJ3B 1MHCB 4F33A 1BX2A 4UQCA 4BK5A 5HPCA 3WXVH 4XPHH 3RIAF 1D5MA 4UR9A 5JPMB 1U8IB 4Y5XB 3SDCB 3ZR6A 1E4NA 1MF2H 2ZOKA 4NQCB 4MJ2A 3ARED 1KCUL 3RTQA 4F33B 4RGNC 1BX2B 2NY1C 2JIXA 4JJHA 3V4UL 5SWSD 4P23D 1D5MB 4P46A 2AJVH 1GOIA 1PEWA 3V52H 3U7BA 2ZOKB 2DICA 2DKMA 4UTFA 5A94A 3RTQB 2WVUA 4D72A 2JIXB 1NC4A 3M7SA 5AZEL 1P7QA 1OIMA 2OS7A 4P46B 3RDTD 4XBPA 3CZGA 3VGEA 4X5WA 1XD1A 4QDRA 4JFEA 4U7SA 1BVZA 5A1AA 4TUKL 1NC4B 5J6HA 4A45A 1QBLL 1P7QB 5EWIH 4YDJA 3WFLA 2LW8A 2YPLA 2VLME 4XBPB 1WWAX 5DGRA 2IBBA 3T3PF 4X5WB 3F7RA 4JFEB 1A1NA 1I8IA 3VU2A 3BKCH 4R4FL 3BKYL 5J4MA 4WJ5A 1BFSA 4ZG1A 5J6HB 5D70L 4YDJB 5LG1A 4ELMA 3CK0L 1MFBH 4JFHE 4Z2HA 2YPLB 3SDAD 3DUUA 1ZKAA 5LCVL 5GRVK 5ETUA 4Z7OF 3SJVA 4OZIA 1A1NB 1I8IB 4EXPX 2E3VA 2O5ZH 1KELH 4U1GC 5I30H 3NN8A 4WJ5B 4JO2L 3VCLA 2CR6A 4H8HA 4ELMB 4ZUSA 1S46A 4P8XA 3G6DH 1JHJA 4HS6A 2G3IA 3DUUB 5ETUB 3UEZA 3SJVB 4OZIB 2ZG2A 3QNZA 3NN8B 3AMCA 3VCLB 4Y4KD 5AWNL 5EA0L 1MCWM 4ZUSB 3TT3H 3S35L 1VFMA 3GIZH 4HS6B 2K3TA 3QHFH 3RDKA 4XNQB 3NTCH 5C0RL 2DIEA 2XZCL 3QNZB 2OYKA 3NCFB 2VCCA 3WH5A 4P2QE 4YDIH 2A6IA 2GJJA 4HUMB 4K71C 5DR5H 3N85L 1W8OA 4LNVA 5JHLH 4KHXL 3W38A 1FRGH 1E3ZA 1Z0MA 2ZCLL 1M7XA 5HYJD 1KLGA 3N06B 3FQNA 3OIHA 3ARGD 3SKUD 4OD2A 3MMWA 2X89D 1JYVA 3MXVL 2A6IB 3INUH 4J1UA 2AEIT 3B4NA 3EDDA 1CD0A 1TETL 3FOLB 4YHLL 1CENA 1LE9A 1MY7A 3QCVH 3WKNA 3PZOA 2DIJA 3V0WH 1KLGB 3FQNB 3NIFF 4KQ3H 1WT5C 4OD2B 4R0LA 1U33A 2F5AL 2FGZA 4J1UB 4OZHA 5DQJA 1CF8H 3FKUS 5GSVA 2VSDA 1UZ0A 4NQDD 2ENSA 1LE9B 3ZSTA 1C8QA 4V27A 1M7DA 4DK3A 7FABL 3SE8L 5I1JH 3OF6A 5I16A 1DBKL 4KDTC 4ZYKA 4MCZA 3MUGA 2LTQB 4PTXA 3AFLA 3D3VA 4R0LB 3BJ91 2XOMA 1VFFA 2ZUXA 4H8WH 1RHHA 4OZHB 5DQJB 5GSVB 3SE9H 5JIKA 3WUBA 4F79A 1M7DB 1MFEL 4AG4A 3DHUA 5I16B 4ZYKB 1O7VA 4EJ1C 4MCZB 3MUGB 5BW7C 2YN3A 4KROB 2YKLH 3D3VB 4QXTA 3BAXA 4YE4H 5FGBA 5J6GA 1IRAY 2Z9TA 1RHHB 5FK9A 1T22A 4K94C 3UTPE 3VDHA 4FMKA 4Z7VA 1T21A 1DQMH 1U58A 2W9EH 5IB5A 3ZKSD 4F58H 2NT0A 4QXTB 1QFOA 2LFGA 5J6GB 4YUEL 4FI9A 5FK9B 1T22B 2ZG3A 4WEMB 1ODAA 4X6DE 4Z7VB 1T21B 3HE7A 1Q0YL 1AXSA 3VFMA 1TNNA 1U58B 5IB5B 3V0VA 3P73A 3NFSL 1F3JA 5I1HH 5LGHL 4IOFC 2LABA 4D6FA 1CDIA 2XTLA 3NYDA 1TLKA 1AQMA 1R64A 3HE7B 5FUCE 1AXSB 4K23L 3VFMB 5TE7H 3V0VB 1DWIM 1W0VA 3P73B 3QDGA 4GG6E 1NGPL 1F3JB 2V5MA 4X6CE 3R8BB 1I8MA 3KWWA 2AEQH 5DVNA 5DRWA 2HMIC 4M48L 1A4JA 4A3ZA 1YYLH 1W0VB 3N1GC 1D6VH 3QDGB 5AZ2L 3R0MA 2DSKA 2AI0L 3KWWB 1I8MB 3CHDA 1B4RA 4M02A 2A1WH 4HP5A 2YD3A 5DRWB 5AYUH 4NNYA 1A4JB 3SGKC 2AJZA 2IEPA 4G6JL 3UC0L 3CZ8A 1F5WA 3U57A 3W29A 3QHZH 4GO9A 5D93B 1WSST 2D9QB 4CU7A 5IV2A 5JDJA 1DLFH 5FECA 3KZSA 1NCUA 4NNYB 1A22B 5JZ7D 4NNXA 2AJZB 4CDGC 3VXMA 2WC3A 4OLWL 1BD2D 4HKBA 4FXKB 2EDLA 1ZLSH 2VZOA 5DA4A 3UBXA 2HFGH 5HI4C 3WBEA 5IV2B 4LRIA 5DJ0B 2Z8VC 5FECB 2WUCL 3MRFA 3VWJC 4NNXB 2QKIA 5BS0D 3VXMB 3EJYC 3W5NA 4HKBB 1T80A 3E6HA 2Z4FA 3FT4A 4B7IA 4LYPA 1OGAA 2LE9A 3UBXB 4TOQA 1IMHC 2NY2D 3U1SL 1U93A 4LVNC 2IG2L 3MRFB 2NZ9D 2QKIB 5ID0A 1NP2A 3BJLA 4POUB 2ORBH 1O6IA 3E6HB 3FT4B 3VXQA 1X4ZA 1OGAB 2WW8A 5DWUH 3OAYH 1U93B 2OLHA 2I26N 1ZANH 3OJVC 5ID0B 4PJDE 1T0PB 2XWDA 1V6VA 1TE1A 1IVLA 1UQZA 3VXQB 1G6RA 1NCAL 3TWCH 3VVGA 3WDJA 3OKDA 1J12A 3V5DA 5GS2D 1JNNH 3HNTL 4JKPH 3MODH 1KBKA 5HD8D 4Y16C 1G6RB 2AJYL 4LCWA 4LLMA 3O8XD 3OKDB 4O00A 5CLWA 1JRHH 3V5DB 4ML4A 1XT5A 4JFQA 3IB3A 5E9DD 4HD9A 4JRYD 4ATWA 1W9TA 3MUIA 3I9GL 4J4PD 4LCWB 4LLMB 5ICXA 1QYGH 2JALA 4LRNL 4X9HA 2Y72A 4JFQB 1J7VR 5I19H 1FIEA 3MBXH 1I8LA 1MJ7L 4RMSA 3SDCD 4D0DA 1XCTA 3IJYA 5ICXB 3AFBA 3QDMA 1R85A 4HWUA 2DM3A 3EW3B 4TUOA 5A2FA 5JW5A 3S37X 3QT2A 3CSGA 4JO1L 3V6ZA 1XCTB 3IJYB 5A6MA 1IBGH 1RULH 4PJHA 3QDMB 2GDVA 4TUOB 3E8UH 2JIXD 3RHWK 4I0CC 4WNQA 5JW5B 1KEXA 3OZPA 1OPGL 2QR0A 3P30L 4P46D 5C1MB 3ZDZE 3HJRA 4R9HA 1U8MA 3V6ZB 3VWKC 3UZQA 1CBVL 3FJTA 5GRUL 4JM2C 3VRLE 4PJHB 2DL9A 4F7CA 2PWGA 3N15A 1JVKA 4HOZA 1NC4D 4MDIA 4WNQB 5CXPA 1P7QD 3U7WL 2QR0B 4LL9A 1U8MB 1CLVA 5D8JL 3MRDA 1MCBA 2OYMA 3GI8H 4JFED 2NY4C 3CVHA 4OSUL 4PJBF 4MDIB 3ZE2F 1F6AA 2XOTA 2NPLX 3Q6FA 4XBEH 4YBQC 3RY5A 3L4XA 2YPLD 2X8RA 1UKQA 3MRDB 4G7VL 3DSFH 2OTPA 3CVHB 4M7ZB 4YDLB 2RR3A 2WXDM 1NSNL 1F6AB 4PIRF 3Q6FB 2WWKT 1S9WA 1T2QL 4FK9A 1MUJA 3ZKMC 1WZLA 5CZKA 4EQ3A 5T3XL 3H9HA 3SJVD 1A0QL 3MLTA 4NJAH 5T3ZH 4K94H 2V3EA 1VJSA 4OF0A 3UX9B 1S9WB 1MUJB 4PB0L 3NGBB 3H9HB 1MCLA 4OV5A 5EFDA 2R2CA 5ILTL 5I79A 2H3NA 3MLTB 3OKNA 1N6QL 3VPLA 5J8OA 4U1LA 1J11A 2AEPL 1WZ1L 1PZ5A 2ICES 5CGTA 4AZ6A 1H09A 4CN1A 4AZGA 4BH8B 5GRWA 1LWHA 4JG1H 3BPOC 4MB5A 2BVDA 3R4DA 4OV5B 4XC1H 3PWNA 2H3NB 1ZBWA 1S3KL 3OKNB 1CD8A 4U1LB 1ED3A 1PZ5B 1G9NL 1UWEL 3LN5A 5C08A 4NI3A 5KSAC 3JV0A 3HU7A 4YLQT 3PWNB 1S78D 4OOZA 2NNAA 3EO0A 1F4XH 1JI6A 1MOEA 2EEBA 2YUZA 1ZV5A 1E1FA 1ED3B 4KZEL 3AC0A 1OAYH 4Z6AT 3LN5B 5E7BA 5C08B 3T4AA 2W0KA 1Z3GL 1JNDA 6FABH 2NNAB 3EO0B 5CD5C 1WWCA 2RCSL 1RFDH 5T5FL 2XXMB 3T65A 4WHDA 1NCTA 4XNUH 3T4AB 4JFWA 4DUWA 4P2QA 4ONHA 3OF6D 1WQVT 3BQUC 2WZPD 1BAGA 2CDFA 1H3PH 2D2OA 3D3VD 2FD6L 2D22A 5EZIL 4F15C 3D87B 3T65B 1HILA 3QWQB 1P6AB 5T5NG 1FC2D 4MA7H 5FA4A 2IFFH 4P2QB 1TUXA 4ONHB 5JOPE 4LDLB 2CDFB 3VJ6A 3NCYS 5TF1H 4P5TA 3WFHB 4C57C 1HILB 2X1OA 3OWEA 5FA4B 2F61A 2AJSH 3G6MA 5J11B 5CLTA 3L5XH 2O61A 4Y2DC 1BVNP 3VJ6B 1T66C 4WIWA 3QHTC 5CZXC 2WCAA 4P5TB 3CH1A 4Y19E 4XWOD 3UAJD 3HE7D 3ILQC 4ACZA 1JPST 2FDMA 1OGTA 1T3FA 1V05A 2O61B 2BXYA 3CSBA 4J3WA 2G8ZA 1E4IA 3CH1B 4ACZB 3QDGD 2H8PA 1OGTB 1T3FB 1NQ6A 3LIZL 4QKXB 5ID1A 5E08H 3CIQA 1QP1A 3MC0A 1TXKA 2VZUA 3QJFA 3QUMH 4NFDA 2H8PB 4H0GA 1N6UA 4P2RD 1CX1A 4IRZL 3AS1A 4IOSD 4CRPA 2BHYA 5DGQA 4Q97A 5ID1B 3G6JE 2HH0H 3S96A 1GHSA 4MD5A 4KHTH 1FNSL 3QJFB 3MLVH 5FGCE 3O4LE 2F2HA 5T1LA 3UYPA 2J1VA 1JHKH 1KCRL 4K3DH 2J8GA 5CIPH 4E5XA 3KPNA 4UQ2A 3X3GL 1YEJL 5E56A 4APQC 3RWCA 1JZ2A 3VXMD 3S96B 3QWOA 3TA3A 1AQKH 1RIVH 1TJHL 5K33A 3TT1H 4GG6A 4E42A 3IT8D 4OZ4A 5HYQA 4A4AA 5T1LB 4OTXH 5G05L 5DO2C 1ITCA 4E5XB 3KPNB 4UQ2B 5E09A 3A3HA 4UAOC 1HQ4A 4WV1A 3RWCB 1R3IL 1YZZA 1E9LA 4F8XA 1UG9A 3QWOB 1GOMA 4CGTA 3TA3B 1QLEH 3BOVA 4GG6B 5IIEA 4E42B 5HYQB 1HVQA 4X6EA 1US2A 4WV1B 1HQ4B 2FZ3A 3C7OA 4TYUA 4PMQA 4BS0A 3GXIA 2BY0A 4KQ4L 5IIEB 3RL1A 3QIBC 4H8UA 1QKZH 4X6EB 3FB8A 2D7QA 2FZ3B 1F4WL 2R0KL 2AXHA 4ZTPL 3GZAA 5F88A 3RL1B 3FQXA 4UV7H 2QSQA 4W70A 2DQJL 2X05A 4DGYH 3LEVL 4IMKA 3FB8B 2VDML 4WHYH 3VD5A 1A3HA 1XZ0A 3V4VL 4HA4A 4J27A 5F88B 4NKDB 3VOCA 3MLXL 5IVOA 5KSBF 3FQXB 1PG7W 4B15A 4LCWD 1RIUH 4NHUA 4YDKL 1S7WA 4OLUL 5CGYD 3GO1L 2CPUA 1XZ0B 1I1AC 1OTUC 3JWDL 3SKJL 3WQBA 4XVJH 2JF6A 5IBTL 2YC2A 1OBAA 1MFCH 3VXPA 1CICA 5KVGL 5FO9A 4NHUB 4FF5A 1S7WB 3RZCA 2J4WH 4AZCA 4HH8A 4EI5C 5FD0A 5A3HA 1NMAL 5E2JA 1MW1A 4TSAL 3TVMC 3PWLA 2J7EA 3VXPB 2X9XA 3A4XA 4MXVE 1CICB 2EEXA 5FO9B 4AZCB 3QDMD 3RZCB 3SCMA 4Z8FH 3BH8A 3WEMA 4U3XA 2FX9L 1XH2A 1M1SA 2Y36L 1WFOA 1U3ZA 3PWLB 1N2RA 3MA9H 4QO1A 5C0DA 1T83C 4HAGA 4C4KT 1MCOL 3H9SE 2R0ZH 2XA8L 3SCMB 1JZ8A 1G0XA 4MJIA 3BH8B 3UTQA 5IFPA 1N2RB 3ZHKA 5C0DB 3A6CL 3SE4C 1V08A 1T2XA 3A6OA 4IMLA 1MIEH 2RVAA 4HHAA 4MJIB 3UTQB 1K42A 2AEWA 4DKAA 2DJSA 3KDMA 4IM8A 3KPTA 4HXBL 4KVNH 1N0XH 3BAEL 4U2YA 1UXXX 4IMLB 1MRDH 4CVUA 1NGZA 1TJGH 3LD8C 4HHAB 4ZXEA 3QHMA 1M4KA 3KDMB 3CZKA 4EBQH 5FOOA 3I6LE 2W9DH 1AY1H 1NGZB 5FUZL 1HJXA 4PMOA 3FB7A 4D6IA 3TBVA 5I1IL 1P7KA 4NPYA 2EIBA 5H35A 1SMAA 1CGUA 3WH9A 4PMYA 2YZ1A 3QEQE 3V4UH 4BSJA 3TESA 1T1WA 4WW2F 1US3A 1OP9A 3FB7B 4G80A 4ZZ8A 5J57B 3TBVB 1P7KB 4NPYB 5D1XA 1QZ1A 5H35B 3ARQA 1E6SM 1MFAL 1DQLL 2VLMD 1E56A 1T1WB 4RAHA 5EO1A 5AZEH 3AUVA 4GG8A 4G80B 4NZTL 4UCFA 5D1XB 1JYXA 2A0LC 3VH8A 4XC3H 4DGVL 2XFFA 3TBWA 2GUYA 4JFHD 4TUKH 4BK4A 3SGEH 2KZ1B 4HPOL 1EDTA 3BSGA 5EO1B 1IKNC 1QBLH 4GG8B 3OG4B 1ZT4A 4JQXC 5C08D 4PMRA 5I8CA 5FUOL 4HJJL 3TBWB 4R4FH 1QSFA 3IDXL 2VIRA 3U30B 5D70H 4H20H 4LK4A 1ZT4B 3CK0H 1YC7A 5A8PA 2GTZA 5I8CB 3DYMA 2WM0A 3B6SA 3JWNC 5LCVH 5ADPL 4JDVA 3UDWC 5J89A 2IH3B 1QSFB 2G2RA 2VIRB 3DYOA 4JO2H 5I1KL 3W28A 2J1TA 2GTZB 3FZUD 4P2QD 3B6SB 3NA4A 5CINL 4JDVB 4EUPH 2VO5A 4MLSA 3WN6A 4BSVA 2ATKA 3HRZA 3NNGA 2G2RB 4PJAF 2AQ2A 1OSEA 5DC4B 1J0KA 5AWNH 1V8HA 3KPLA 5EA0H 1IQDA 3S35H 3UBXG 1ECEA 4JFXA 2IMMA 2G60L 2AAAA 2ORXA 1UGNA 1BAFL 4BSVB 2N1KA 5C0RH 2ATKB 2XZCH 3HRZB 4Y4FA 2AS5M 3OB0K 4P5TD 5MI0B 3KPLB 4MB3A 1IQDB 4JFXB 3B2VL 5I71B 4M7JL 3N85H 3MLSL 4KHXH 2G75A 4M6ML 2XQYK 4HIXH 3BLPX 4Y4FB 3DETD 2BFVL 2ZCLH 3GSUA 1T7WA 3MXVH 4GBXA 2V2XA 2APVA 2GITA 1QNSA 3DHPA 2G75B 4OI8A 1TETH 3SQBA 4MHHG 4YHLH 4AG4L 2UY6A 1HOCA 1DSFL 2BHZA 2WWDA 5BRQA 3GSUB 3ULVL 2CIIA 1MQ8A 4WFGD 4ZODA 3LPOA 2R56L 3AREC 2F5AH 4GBXB 2V2XB 2GITB 4NC2B 1AQ0A 1X5AA 5CSGA 4P23C 1HOCB 2WMJA 1GPFA 7FABH 3SE8H 2CIIB 3UTPD 4OQ1A 2QQLA 2FEDD 2Q20A 4C7DA 2MHAA 3WXWL 3SDXF 5GS1A 2PYEA 3B9VA 3RJXA 1MFEH 4NKMB 2LU4A 3RDTC 2EPNA 4JPWL 4Y19A 1MCPL 1DQDL 2ED9A 4MVBD 2MHAB 4GMSL 3VNYA 5T1LD 5GS1B 2PYEB 1F2XK 3HNMA 2X4QA 1Q9KA 3W2DH 1T7XA 3WL0A 4Y19B 2VZ1A 3MJGX 3TIDA 1KN2L 4KMTL 1ZT7A 1KEGL 4YUEH 1JMZA 4NNPL 1Q0YH 1EDGA 4DXTA 2QQNA 2X4QB 1Q9KB 2E9IA 3NFSH 4YBLB 5LGHH 3TIDB 1ZT7B 4UZSA 4F7EA 2RFXA 5GRVL 1UC6A 1L6XA 4W8AA 5D7JC 3WD3A 2YLAA 3MQIA 4K23H 4KAQL 2C3HA 3BD3A 1NGPH 4PJ5A 2HVKA 3RFZC 4N0UA 1B6UA 2J1AA 4F9JA 4JQVC 4DM1A 3RWHA 4TRPL 3O4LA 4F7EB 4M48H 2RFXB 4OB5L 2X9WA 4PTTA 5GS0L 1GJUA 3CDCA 5D72L 3AY4C 4YK4C 4PJ5B 2HT2D 2HVKB 4N0UB 4GQ9L 3NIFE 4JL1A 2JE8A 3RWHB 5FGCB 4HUXA 3O4LB 4D9RE 4G6JH 3UC0H 4PTTB 4HFWA 5FAAA 3NIGE 1JE6A 4CD8A 3MACL 5MEOA 3PIQA 2PI6A 4HIIA 5L2KA 15C8L 4HUXB 4UI9L 2XPGA 4OLWH 1FHGA 4HFWB 3ARGC 1Q4NX 4OLYL 2A9ML 3WNNA 3K46A 3S6TA 5M7QA 4U1NA 4WIQA 4JFFA 5MEOB 5GGVL 1MVYA 4B9YA 3TJHD 2AQ1A 3WD4A 3PIQB 4HIIB 5L2KB 1C12A 2XPGB 4BQ6A 1KOAA 3D85A 1G6RL 3RZCD 4U1NB 1GORA 4JFFB 2WMFA 3U1SH 1EBPA 2Z8WC 4KUCF 2C9KA 1JWSA 2A77L 1NGWA 2IG2H 1IC1A 3PWUB 3TYFA 4FQ2L 4ZE5A 3D85B 1FQ9C 4RFOL 2C3WA 2C4FU 3SCMD 2PWDA 4DAGL 1JWSB 1NGWB 5GRXG 3QUZA 2PTVA 3GMLA 3TYFB 1HE7A 5JPNA 4OGAD 5F9WB 3VMNA 4JHAL 2VWEE 2DYPA 2H1PL 1WF5A 1NCAH 3OKOA 3D0LA 4KTDH 5IF0A 3WH6A 4MJID 3QUZB 3QFDA 1HINL 3HNTH 2VRKA 1WIUA 3GMLB 5GGQL 3QDJE 2XM1A 5JPNB 3HZYA 1ULVA 2H26A 5E2VL 4YXKL 2DYPB 1KJMA 2AJYH 4OZOA 3OKOB 3D0LB 5IF0B 4CVWA 4LQFH 3RIAK 3QFDB 1OD8A 5DK0A 1DBBH 2FH8A 2PF6A 3U7YH 5F72S 5BMFL 1ZT1A 3HZYB 4KMLB 3N9GL 1TVNA 4W7UA 2H26B 1V7MH 1DBJH 3I9GH 3UJJL 3UTOA 2Z35A 4FRWA 1KJMB 4FLSA 1IAKA 1BZ7A 3E3QC 3D5OF 3EJJX 3TIEA 4MHHI 3GKZA 5DK0B 5JNYA 4LRNH 4EDWL 4M6OL 1ZT1B 3CBWA 3H9SA 1MJ7H 2Z35B 1IAKB 2KD7A 1BZ7B 1ISZA 1YEEL 2BXZA 3TIEB 5JNYB 4RQQA 4JO1H 3H9SB 3V95A 1NCWH 3CVHL 3BRFA 3BH9A 3RVVD 4AEFA 4DEQA 4CD7A 4HC1L 4M1CD 3P4MA 3RJQB 4WW1A 1TPXB 1OPGH 5KSVA 5D1XD 2F15A 4PJ7A 1CBVH 5JZ7C 2F54E 3S8WA 3BH9B 4V2CB 5CEZD 1OAZL 4TTDD 2B4CC 2J12B 3P4MB 3WIHA 3U7WH 4WW1B 5JW4R 1H3VA 1UA6L 3LDBB 1UT9A 5EULV 5KSVB 1ZBKA 1SG3A 2RHEA 5ALCL 2JD9A 2QBWA 4PJ7B 2CCRA 2ZX6A 4GZJA 4E41E 3W39A 1RUPL 4OSUH 5F7YC 1VJZA 5J3HD 3IANA 3QQ4A 4B0MM 3PZMA 2NY2C 5ALBL 4Q9QL 2F8XC 3CH8A 1UR9A 1J9YA 3P0VH 1BBDH 4G7VH 4RFNB 2R7EB 2NZ9C 4XNYL 4X8XA 5C0BE 3MZTA 3W39B 1QSFD 3G9VA 3QEQA 2HTLD 3DI3B 3QQ4B 3MV8A 3EYUL 3DOSA 3ZKND 4A6OA 4Z7WF 4WHCA 1K85A 5F8RC 1VSCA 3GXFA 1UWWA 1OLLA 3JWDC 4FZ8L 4ZOCA 1CGYA 3JVGA 3QEQB 1A0QH 2Y06L 1KXQA 3IDNA 1MRCH 3MV8B 3PDDA 1ORSA 3IFLL 4GO8A 1WAAF 2E7CA 4PB0H 4V1DE 1QSEA 5KANI 1NQBA 3BISA 5ILTH 5HD8C 5D9NA 3IDNB 1N6QH 3SIMA 1ORSB 1R8LA 2AEPH 2HP4A 1WZ1H 5J1TC 3JV6B 4CCEA 1CGWA 1IAIM 1QSEB 2IBZY 3EB7A 4Y4FD 1S3KH 4S10A 3C2AL 2WAAA 4GZ9A 2H32A 1G9NH 4IJ3C 1GGTA 1P9MC 4FQXA 1YEGH 2ID5A 3FHAA 5LVEA 1CCZA 4Y5XC 1M53A 3SDCC 4YN5A 1T0MA 5D2LA 2H32B 3N50A 4GBXD 1BYDA 5C07E 3NRUA 5L0QB 4RMRA 1GNYA 1DR9A 4H88L 3GMRA 4XUYA 4FQXB 2C3VA 1Z3GH 4BQBA 4PJBE 4XPTL 1EGJH 3ZE2E 4CADA 5A8QA 5KJRL 1T0MB 5D2LB 5T5FH 5TE4L 4LNRA 1WFNA 3UERA 3RTQC 4XXCA 4YPJA 5JOPD 5D71L 1Y0LA 3DO3A 3GMRB 2Y6GA 2C3VB 5E03A 4P46C 4DWHA 4M3KB 2W94A 1UD4A 3WNLA 4CADB 3L5IA 4LNRB 2FD6H 2G3MA 3BPLB 3ARSA 3HR5A 1Y0LB 4YGAB 2EE6A 1MPXA 1MW0A 1NGXA 5I78A 2YUWA 4WKAA 4X7DC 5CD3A 2J74A 2OK0L 4Y19D 3MXWL 3QBTB 2Y6LA 2OCFD 5LKNA 4D0CA 4KJYA 3CXDL 5CSUA 3HR5B 3C7EA 4DFIA 1MVFA 1CXFA 1GJWA 1PG7L 3SCNA 3BWAA 1NGXB 5H8DA 4AZIA 5CD3B 1RI8A 1P84K 4TVSa 2JDAA 4P2OA 4D0CB 3BGFB 4B3KA 1EEQA 2PNDA 2QQQA 4PR5A 3GJFK 3B3IA 3BWAB 3ALPA 4FN0A 3U82B 3O11A 2EZ0D 2V17H 7CGTA 3DHMA 2FNBA 1IT0A 4BQ9A 3VD3A 2UZYB 4P2OB 5ISZE 3F7VA 3WLBA 3MRGA 4PR5B 4S1DD 5AD0A 3VGHA 3B3IB 3WD1A 3QCUL 3O11B 3T1FA 1QOXA 4PJ5D 3TLRA 4K07A 4U3CA 2A3AA 3LIZH 4WUUE 3T8XA 4QX0A 1PIGA 2HAZA 3F7VB 3O4LD 4JB9L 4X7FC 3WLBB 3F7PC 1UY4A 5AD0B 2VQUA 4ONGH 4LYQA 2DPEA 2DAVA 3T1FB 1HJSA 1NPUA 3NACL 2MPAL 4IRZH 3C8HA 2ZZUT 3T8XB 1JU3A 3TJEH 3HB3D 1IEAA 1FNSH 2QPSA 3CDYA 4U1JA 1KCRH 1UEYA 3GMPA 1CT8A 1I9RH 1WZKA 5EUOE 1MXGA 2B0SL 5L2KD 3X3GH 3HZMA 2DM7A 1YEJH 5EBWA 4JFTA 1S78C 1INDL 4F9LA 3GNOA 3GDBA 2IAMA 4BZ2L 1IEAB 2V9RA 2X4OA 1TJHH 1LL4A 1RJYA 4U1JB 1T6WA 4JFFD 3NDYA 3GMPB 1CT8B 3UPRA 4YC2B 1AKJA 4MLIA 3FHQA 3HZMB 3MCKA 5EBWB 2DCJA 5A6JA 5L9DL 1R3IH 2IAMB 1GZJA 3DMMA 2LTQC 2X4OB 4R0LC 3D85D 1RJYB 3OPZL 4B53A 5D7LE 4FABL 3TNNA 2XVPA 1EEZA 1FORL 3UPRB 2DKUA 1AKJB 3LRSA 3MCKB 5HYSA 2WNWA 1MCIA 3DMMB 4OFVA 4KROC 4QRRE 1N26A 2B4CH 4KQ4H 3VD9A 3TNNB 4QGTA 1EEZB 3ZOAA 4P7RA 1L0QA 2W4XA 3LRSB 5GGSA 1F4WH 3QUZD 3VH8G 4F2MA 5HYSB 4ZTPH 3BAWA 2H9GA 3W9EA 1SMDA 2IJ0C 5FGBC 1NKOA 5JTWA 2DYPD 1KFAL 1LO0L 2L7UA 2VDMH 3ZDXF 2VL4A 1EXPA 3CNKA 1IAMA 3FRPA 5GGSB 3T08A 1FLTX 2IQAA 2QHAA 4F2MB 5C6PB 2FYYA 2H9GB 4CN6A 2DM4A 5HHVL 3W9EB 3MGAA 4XWOC 3HE7C 1ERNA 4YDKH 1W91A 4OLUH 2WCGA 2IQAB 2FYYB 3SKJH 3JWDH 5FKPA 1F6LL 3H42L 4NJ9L 2EICA 4HWEL 4U5IA 5GS2H 2PUQT 4ZFOL 1NMAH 5FKPB 2G3JA 4TSAH 3H9SD 1U8NA 4K7FA 4W7VA 4XURA 2PW2A 4I8DA 3O9WD 3QGVA 3MUHL 4F66A 3LQMA 4I0PA 4JPVL 5D93C 3EZ8A 4F9DA 3SDDA 2FX9H 2Y36H 3OSKA 1U8NB 2ZJSL 4K7FB 5D7KD 2PW2B 1MCOH 5EOQL 2XV6B 1AC0A 4LKSA 4I0PB 2XA8H 3P0GB 1UD5A 4PD4J 2CRMA 4XP6L 3SDDB 5A2JH 2FATH 3AZTA 1A3RL 3A6CH 5JO5A 1F97A 4PRHA 3B83A 5F97E 1ULOA 3D5HA 3WEOA 4LRIC 5DUML 4KUZH 1FH5L 1C91A 1B2WL 1A7RL 3DWTA 4K9EC 4TSBH 4HXBH 1K6AA 1UB6A 3HC0A 2EYTA 3BAEH 5JO5B 2BSED 4PRHB 3CU7A 1E3XA 3WQ6A 5JIPA 2DH2A 4UINL 1NCNA 5TD4A 1YNKL 5B3JF 3VXUA 1UB6B 1YN6A 2EYTB 3HC0B 1A7NL 3HHRB 4XWGL 5CEZL 3QEQD 3MV8D 3BP4A 3ZHLA 3ECBA 4M93B 5FUZH 4J28A 1KB5A 3TH2T 3VXUB 4GW1A 5I1IH 5IJVA 1YN6B 5HHOA 3TP4A 3ULSA 3BP4B 3ECBB 5KZCB 3IDYB 1U95A 1KB5B 3KLHD 1QSED 1SYSA 1H3XA 1QHOA 4OFPA 4GW1B 5IJVB 3BDBA 5DUPH 5HHOB 4HUNB 3ULSB 3NSMA 1DQLH 4WSKA 4QAWA 4A41A 1U95B 2OI9B 5CGYC 5C0BA 1SYSB 1OTSD 4PJEE 3JUYA 4NQTA 4CCCA 3MUJA 4DGVH 3SCOA 3L9RA 3RVTD 5TDOA 4HK3N 1XGUA 3L4ZA 4HPOH 5LWYL 3V5HA 4KKCC 5C0BB 1B3WA 2K7PA 4G5ZL 5GRJL 2BGOA 4FQXD 4LSVL 5FUOH 4HJJH 1I8LC 3N1AA 5ABDE 3L9RB 3MREA 5TDOB 5DHYA 3IDXH 4P99A 1QA9A 1XGUB 1HX0A 4OCYH 4V1DA 3V5HB 5DHVA 4NO5A 3U7VA 4GKOA 4O51A 1LEIA 1F42A 5C09A 4PCSA 1A7PH 3MREB 5DHYB 1QA9B 4N9GA 2JIWA 3W25A 4U1IA 4V1DB 2EDRA 5ABGA 5DHVB 3MZGB 5I1KH 3UR7A 4NO5B 2VN7A 5K9QG 1UH4A 4UOZA 3ZSSA 1XR9A 4O51B 4JFDE 5CINH 1QSVA 3N1MC 4MQXD 1LEIB 1FP8A 4YHPA 3OQ3B 5C09B 3BEWA 4N9GB 4U1IB 3WDHA 4PYSA 3NMEA 4BDVB 4I3RL 2G60H 5FV1L 3MMUA 1XR9B 1EZVY 1MCEA 4P2YA 4YHPB 4W81A 4YHOH 4YXLL 1BAFH 1QG3A 3WMSA 4YH6A 1ISWA 3BEWB 5C07A 7TAAA 4M7ZC 4YDLC 2QBXA 2DF3A 3DVNA 5K9OA 4UT7L 3MLSH 4PJBA 1GOHA 4M6MH 5DC0A 1S5IL 3CFJA 3UTTE 3EDEA 3QSKB 5HDBE 3BZEA 4K7PY 2BFVH 5C07B 4P2OD 4EKJA 2FECL 2XQYG 4M4PA 1KN4H 1QFWM 3T0VA 3VFRA 3DVNB 5K9OB 4MTVA 4PJBB 4H2CA 5FM5O 4AZBA 4DGIL 3GM8A 3MRBA 3CFJB 3NGBC 1NUKA 4AG4H 2EPOA 1MEXL 1DSFH 3DROA 4R96A 2AV1A 4YFLI 3BZEB 3FCTA 2ADGA 5H2BA 1SY6A 2FIRT 2R56H 2YRLA 2OR8A 3VFRB 2YOCA 3RVUD 4YIQA 3MRBB 4CBPA 1K8DA 1T04A 4YNYA 5ECUA 3WY1A 4R96B 3DROB 4AD5A 2AV1B 5HGGS 3FCTB 3GNMH 2ADGB 5H2BB 1NLDL 5BXRA 3KXFE 3G5YA 4QP0A 2ILLA 3VFGL 3WXWH 4YIQB 3FB6A 2XFYA 1K8DB 1T04B 4YNYB 4UOQA 4MGQA 1T1YA 1AD9A 4NZUL 3LRHA 3LVEA 1P53A 4JPWH 1GOQA 1MCPH 1DQDH 3G5YB 2Z0BA 3G6LA 3WQWA 2IPTL 2OZ4A 3FB6B 3RGHA 1ZVYA 1A6ZA 3EYFA 3BI9X 5ISZA 1T1YB 1AD9B 2EDJA 3DURA 4JY5L 4W4ZA 3RVWD 2IAMD 2W60A 1N82A 1E0VA 4KMTH 2J1KA 4NQEA 2P5WA 1KEGH 1NC2A 3KHOA 4AWEA 4NNPH 4PJ8A 2J8UF 2CHNA 1A6ZB 3EYFB 3O6ML 1AKJD 1M7IA 2H2SD 2PTUA 3KYNA 4WUUA 5ISZB 4HIJA 4OCXH 2BSTA 1RIHL 2HKFL 3DURB 3EYSH 4AIEA 4XT1C 2W60B 2FECI 3FRUA 4JVUA 5JW4N 4JREB 3DMMD 3K2MC 2P5WB 3JZ7A 4NQEB 1UWRA 1NC2B 4K2UH 1F4YL 3UG5A 4PJ8B 1M7IB 4YHIA 4WUUB 3KYNB 4HIJB 2XONA 2BSTB 4D9RD 3AHYA 1PX3A 4GKLA 3FRUB 4TRPH 5KOVC 4E9LA 4PP1D 4OB5H 5HVHB 1HIML 2B1HL 3AXXA 1XAUA 4QLKA 4YHIB 1D5ZA 2PXYA 5D72H 4A3HA 4GQ9H 4U5KA 4K9EH 2W62A 3J8F7 5DI8A 5J11C 5DRXA 3B2UD 1SYTA 4P5TC 3ULUF 1D5ZB 2PXYB 5HHXL 3IDAA 5DI8B 3IAQA 2NTSP 5DRXB 4X4ME 15C8H 4S1RL 3DETC 5D7LA 3IDMA 3SDXE 4AYFA 1PFCA 3LN4A 4OLYH 2A9MH 3DRTA 3LSOB 4L9LA 5GGVH 5ACMA 5ECJE 5LGKA 3UESA 1KULA 4QRRA 1SM3L 3H8NA 5D7LB 3IDMB 4WSJA 3LN4B 3SCWA 3AROA 4X99A 1DE4A 3ARPA 3U6RA 2ZX9A 4HGKC 2VKWA 4BQ3A 3DXAE 1G6RH 3DRTB 5CJ8A 5EU5A 4UNUA 4L9LB 4R26L 5MENA 4QRRB 4XCFL 1L0XA 2A77H 3QPXL 3NABL 1WLHA 4X99B 1FO0A 1DE4B 3U6RB 4PRIA 4FQ2H 5E2WL 2FEDC 4RFOH 5EU5B 4R90H 5MENB 2Y1VA 4I0PD 3MRJA 3KYOA 4DAGH 4I1NB 4XPAH 2WN2A 6A3HA 2CUHA 5CPTA 1FO0B 1YPZF 4PRIB 1GL4B 1B0RA 4I18A 4JHAH 5DQ0A 4MVBC 2H1PH 3CLFL 3MRJB 2YMXH 3KYOB 3WS6A 1JZ3A 4GQPH 4Y8DC 1HINH 3B9KA 5GGQH 1IZKA 1KGYA 1B0RB 2VAJA 4I18B 5E2VH 3ROOA 4YXKH 3TA3C 1OTTD 2YD6A 5CAYB 2NY5L 4PRHD 4Z7UE 1AGBA 3DTXA 2QADB 3GB7A 1DDHA 3B9KB 5E8NA 1HJUA 4WV1C 3N9GH 1NAKL 3ROOB 4F7MA 1AGBB 3DTXB 2OTUA 3GB7B 1DDHB 5E8NB 1E4LA 3U7AA 4EDWH 4RA0C 4M6OH 3VXUD 3D2UA 2EIZA 1P84J 1G7QA 4HH9A 1BGXL 1G5AA 2IADA 4F7MB 4P3DA 5E2UL 2UZXB 2FX8L 4NCC1 1YEEH 2OTUB 1SJHA 1PEZA 5KZCD 3SGDI 1KENL 2HT2C 1GVYA 1YEDA 1K45A 2D7MA 3D2UB 2EIZB 5HHOD 2R1WA 4HH9B 5LJYH 3CVHH 1LD9A 5DEFA 2IADB 2VERN 4P3DB 1SJHB 4HC1H 4IMKC 4LEXL 3ZKQD 3X17A 3FNDA 4YHGA 1AQDA 1YEDB 4AZHA 3PGCA 4HZ8A 2R1WB 1LD9B 5DEFB 1CGTA 3O6KL 1M04A 3LS5L 1YNLL 1ITBB 1OAZH 3E0GA 5JXIA 5EIQA 4CJ0A 5IVXF 5C0BD 5BWFA 3TJHC 1AQDB 1UA6H 1BBJA 4NDMA 3PGCB 5ALCH 3U2SA 2WIMA 4G3YL 3ZE1F 5DJDA 2WCSA 4QX3A 5JXGA 1QNQA 1CICC 1EK3A 1RUPH 5KSBB 3C60A 1ZA6A 2EPKX 3RZCC 3P11L 1RK1A 2GHWB 5ALBH 4Q9QH 1Q6EA 5EU4A 1BBJB 1QRNE 4F37F 4NDMB 3A21A 5DJDB 4XNYH 2XZAL 4FQ1L 1V6XA 1AR2A 2BOBA 3CLWA 3C60B 1ZA6B 4RNRA 4V1DD 1RK1B 2DIAA 3EYUH 5IJKC 1V3KA 3SCMC 5EU4B 2YA1A 4FXLA 4D9QE 1N59A 1PYWA 1IAIL 3HNBM 1KF9B 2EC9U 5C09D 1EUUA 3WQ5A 4OGAC 2BOBB 2Y06H 4RNRB 1G94A 4TNWF 4YAQA 3IFLH 4K8RD 5DD1L 3R8QA 1IM3A 3VI3F 2IBGA 2XTKA 3KLDA 4BUGA 1N59B 1PYWB 1PVHA 2XTJB 2J2ZA 2ZCKL 1L4IA 2X7LA 4YAQB 1UZ8A 4WI9A 4ETYA 2ORZA 2YA0A 2E6QA 3UYRL 1IM3B 2D4DA 1JGDA 4JZNA 1YJDC 4TX8A 5AC4A 4AW7A 1HQRA 1HZHL 1KC5H 1H11A 5JBDA 1J1XL 2XUCA 4MDOA 4GXUN 3OR6A 3PBGA 5C07D 3O6FC 2X7LB 5KBNC 1UZ8B 3C2AH 3L5WA 1E27A 2GY7B 4JZNB 1JGDB 4UQEA 4JGUA 2QQOA 1HQRB 1TITA 5T5NF 3S37L 5D2NE 5HYSG 3OR6B 5FM5M 5EIYB 1WV7T 3S5LA 1J83A 3L5WB 1E27B 4QB6A 3QQ9D 4JFDA 5HYEA 2MQCA 1PBGA 4H88H 1PZUB 2XSBA 2W91A 4Q6YA 3WHXA 3S5LB 2NX5E 4XPTH 4ZZ5A 2CETA 2WMPA 5IESH 1C5DA 1KIQA 5TE4H 3RVVC 1O5DT 1PDKA 2VVNA 4JFDB 2H2PD 4AZ7A 5D71H 4M1CC 3FRPG 2VR9A 2XIDA 1W0YT 3WHXB 4X4XA 4XZBA 1JFQL 4WW2A 1JTPA 1UWGL 1C5DB 1KIQB 2L9LA 4BQ8A 4TTDC 1BG4A 3THDA 4PRWA 1JCKA 3UTTA 3OGVA 1G9MC 4OZFA 4X4XB 2XA3A 3UP1A 4WW2B 4CDHA 5D1ZA 4QOKE 4YR6A 3MXWH 2OK0H 3EMQA 3ACGA 1WAAE 4N0FB 2CKRA 3CXDH 3WUFA 1I8KA 5J3HC 4RDQG 3U30C 3N13A 2CLVA 1KBGL 3UTTB 1PG7H 1ODUA 5LBSL 3TZVA 1NLBL 1GAFL 5ISZD 1SBBA 2ICEA 5D1ZB 4YR6B 3UCQA 1B6DA 4NQED 2P5WD 1FZMA 1Q6GA 1I8KB 1NC2D 1TCMA 3HN3A 2CLVB 4PJ8D 4WTXA 5M95B 3UG3A 3TZVB 5K9JL 1ZSDA 4WUUD 2ICEB 1C8YA 1GH7A 4ALAL 3NIDF 2O26U 2Q6WA 1FZMB 2V7NA 1MFNA 3QCUH 1ZSDB 3UMTA 4ZTOL 4HTYA 4L4PA 4GJTB 4QRQB 3L7EA 2Q6WB 1LK3L 4JB9H 2V7NB 3STLA 2XI9A 2CRZA 4HAFA 5MI0C 4PJAA 3QEUA 1IQDC 2PXYD 3PXHA 5I71C 3BD4A 3NACH 2MPAH 3OR7A 3L7EB 2AV7A 1GPOL 4O02L 4Y4FC 3LPFA 3STLB 2C9AA 4LEOA 5AC5A 1YN7A 2E8YA 4PJAB 1MHHA 3QEUB 3QRGH 2ZIDA 3OR7B 2B0SH 2BOCA 2ZPKL 3KJ4B 4GAYA 3GK8L 2AV7B 3T3ME 5D7LD 4XUTA 2E8ZA 4Z2JA 4QCIA 4LEOB 4OCNC 1MCDA 1YN7B 4BZ2H 2R0WL 2EDDA 1MHHB 5AEAA 1SFSA 4GBXC 4G7YL 4HQQL 4Y89A 5CP3A 4Q74A 1BREA 2BOCB 3I75A 4GAYB 4QRRD 5ADOL 2WZHA 4EIZC 5L9DH 4QCIB 2PN5A 4FLOA 2HYXA 1T7ZA 2ZUTA