3K4DA

Crystal structure of e. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
603
structure length
596
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
total genus 185
structure length 596
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4dA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4dA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4dA03
5FAAA 1S5IH 2JDAA 5F7YC 5KSAD 1B3JA 3M8OL 2Z91B 1CBVH 4KJQC 5IR1B 1FNLA 1ETZA 3G5YA 3C5ZC 3CHDA 1YECH 1FRGL 2R2BA 3AB0B 3S9DB 2UYLA 3SJVE 3QUMA 4HC1L 4GXUN 4ONHB 1XCTB 4BH8B 4GI6A 3P9MA 3H9SB 2OR8A 3JV5A 3SE3A 4F8TA 1WZ1L 2V3GA 3LN4A 3W27A 4LGPB 1IVLA 5C07B 3OR6B 3DXAB 3VD5A 5JZ7D 4G5ZH 2XNAA 1OAQL 2YRZA 2CLVB 3LEGA 2E27H 1PW3A 5DT7A 1E5JA 3VXUD 1NUGA 2DQFB 4PJEE 4NFBA 3D5OF 4PRNB 2DAVA 4QTIH 2JF6A 2IGFH 4GQRA 5FCZA 4JQIH 5FDWA 4QXUH 1YQ2A 1O5DT 4K2UL 2YZ1A 3MJGX 3ULUL 5E7FA 4IHOB 2KDGA 3OX8B 2AGJH 2EDFA 4PJXE 3CU7A 4YBLB 3BP5B 5BVPL 3DHMA 3C6SA 1Z0NA 4ONFL 4JFFB 5FO9B 2A83B 5A2BA 4IM8A 5EZLA 2BBAA 4OFYD 1MVYA 1ITXA 1WAAF 3GHEL 2EPLX 1WKYA 4UNUA 3MV8B 4Y5XA 5KSBE 5DUML 1FDLH 1UR8A 2GQHA 2XG9A 5AYBA 2XZCH 5F6HJ 5CFHA 1Q9KA 5ISZE 1UJ3A 2Q3AA 4WEUD 1MRFH 4ZO7A 4ERSL 2ZKHH 2EH8L 3PUIA 5EU7E 1QO3A 4PB9L 1T3FB 1FVEA 1EEZB 4I2XE 2VLJB 5EOCL 5T3XL 4GKLA 2CDOA 1UWWA 2R2HA 3ARZA 1FLRL 4Y4FD 5IK3A 1HHGA 4LSSH 4PY8I 3VFGH 3DLQR 4K7PY 5F3BA 4Y2DD 1DQMH 1WCQA 4W81A 3UXFA 4G80A 2UWFA 4XNXH 1P7KB 2IH3B 5HGGS 5KS9B 2B0SL 2GIYA 1GZJA 3Q6FB 4MCYB 3ZO0A 5I71B 12E8L 3UTTB 4A3YA 4Z7QF 4XBGB 1A6WH 1FC2D 2WDBA 3RIAK 4IUGA 4LF3B 1OGAE 2GITA 4N1CA 5EORL 1NEUA 3PJSA 4PV8A 5DS8B 3IB4A 1XZ0B 3QUKB 5FGBA 4UFJA 1A7OH 5B3JF 2VXTH 4KRPB 2XY2A 4EBQL 1X1NA 3NABL 2VKWA 3ARYA 3O2DL 4JJHA 3QUYA 3CZ8A 3BDBA 4ZQKA 4N90E 1YPZB 1DBMH 1C1EH 1RMFH 3GMOA 4P3WA 4BDVB 4MZ3A 2FATH 1IT9H 1L7QA 3WLBB 5A6BD 4NM8L 3PWVA 4HKZB 4QXTB 4KY1L 3SKJE 4BH8A 1DE4B 2M8XA 1ZEAH 2NY2C 1I9IH 1MY5A 4OCRH 1RZIA 4KUZL 3EYFA 1UCBL 1CDIA 5EO1B 2Y8VA 4XNQA 4X7FC 2CETA 2OL3B 1XD1A 3MJ9H 3L4WA 1F5WA 3PV7A 3K2UH 4ETQA 1OM0A 2EZ0D 4TNVF 3VRIB 2UWEA 3GMPB 4EN3C 1FL3A 5CWSA 5HHOD 2RCSH 2NY5C 3RX7A 4Z77B 4TQEL 4PJGB 5F9WB 4QCIA 3G6DL 4LPCA 4OZFH 4X80L 4OIFA 4ZS7H 2OSWA 2G60L 2P4AB 1FFQA 5F89A 4J27A 4YX2L 3RO8A 1IFHH 1JUFA 4ML4A 3FT2B 4CADA 3QIWC 3PWVB 3WEXB 3K46A 1JU4A 5EC2A 1EHAA 3CCHA 1LE9B 1B0GB 5EIIA 4BQ6A 2VMCA 2JB5L 2BVUA 3OG6B 4U6XA 4LGXA 4JFZL 1OGTB 3W9EB 1X6LA 2CITA 3QDJD 3WFLA 4FQXB 3V2AR 1F00I 2EDQA 3GMNA 5HYSB 3O4LE 2EPOA 4HA4A 3KWWB 3EBVA 3MRBB 1F4HA 2OS7A 4QWWC 1HKMA 4NRXB 3C60D 1RZKH 3I50H 1FHDA 1W9DM 1DQDL 5L7XH 1VEOA 3VKKA 2J2ZA 3TPUA 1RZFL 4LAQH 5HI5D 3N06B 1G9MC 4YFDB 3NPSC 3U37A 4C56A 1PD6A 1A1OB 2XIBA 2QBXA 3W0WA 3MRLB 4OZ4B 1HSBB 2MCG1 3KPPB 1AGCA 1UGNA 1UKTA 3PQYD 1QBMH 4LRIC 3EYFB 5F7HA 2AV1B 4OCXH 4PYHA 5E99L 3ZO9A 3TZVA 4B53A 4RFEA 3WEZA 1C3FA 3QQ4B 5MHSE 3CK0H 5LWYH 3VNZA 5HVGB 2NCMA 5E8OA 1EFXD 4U3XA 2H2SD 5CZXC 4WO4B 3L3KB 4UIMB 3UPRA 1NC2D 2ARWA 3KPNA 3W11D 5KSVB 1UXZA 2BVPA 2NLJB 1UJ3B 1K8DB 1P9MC 1T1YB 1JGDA 4MJ2A 4M8QB 4QXGH 5EOQH 4FTVD 4HPYL 3AQUA 4Y5VA 3QBTB 1KT2B 1XZ0A 2WVVB 4GRLA 4WNQB 1AY1L 3PQYA 1JE6A 1MFUA 4UFIA 3OZ9H 4DTGL 3LEYH 5BRZA 5E95B 1JHLH 5C92A 1LO0H 5ECJE 1HCVA 4WTXA 5D7LA 5CGYC 5ID0A 3RI5F 1KGXA 5BMFH 4UOJA 1LE5A 4OF3A 2VDKL 4NP4L 1SM3H 4HA3A 3U0PA 5CEXB 3ZM8A 4XCYA 2W62A 3QPXL 1DQTA 3WH9A 2C7UB 3U4AA 3AYRA 5BXSA 3EDJA 3BN3B 2DBLL 4LSVL 1QI3A 1S7UA 1X4XA 4LPTA 1FVCB 2XSAA 4J4PA 3S4SB 3QCUL 3H9SA 4I0PB 2DD8H 1WQVT 4DGVL 5DFVC 3VMPA 2VIRA 3QCVL 2RQ8A 3ACHA 2QMKA 4EN3A 1UB6B 4KJYA 5EU6B 1RZGB 2C4FT 2LQRA 5KW9L 4HZ7A 3PP3H 4XBEL 1OD3A 5BOPA 3QHNA 3VGGA 3B2VL 3B6SA 4OLZH 5E4EB 4Y5YA 4TYUA 4U1GB 4WHCA 5HGDA 2IPTL 3ROOA 3QHFL 4UB0L 3T09A 3SDDD 3BI9X 3C8KB 3GIZL 4NC1E 3PE9A 3FHQA 4UNTA 1KGCD 1MAJA 1ISWA 3FW6A 1KLUB 1TJHL 2P1YA 1ZHLA 5EZJA 2D7TL 1UA3A 3SKJL 3D3VB 4OQTL 3ZT6A 1W9WA 2WW5A 5CD3A 3C08H 2WN2A 5I79A 1E4XI 3RGVB 2RB8A 2J1SA 3QDJE 4I2XA 1ZTXL 5T1KB 3FT2A 3U9PH 4XNZC 4ELMF 1RQ5A 3MRDA 5EFDA 5DTFA 1MFBL 1KJMA 2XZQH 1JHTA 3VWJD 2ATKA 1Q0XH 2VDQH 3FO2A 4P8WA 2F53D 1CL7L 1IGFH 2NW3A 1BYBA 2E3VA 1GYAA 1UR1A 2VZ1A 5E2WH 3BAIA 4P2QA 2VX6A 1TCRA 4U1JA 2X4OB 3QUMH 1R85A 2BNJA 1QOXA 5INCA 4ZOCA 3WNKA 5J0BA 3TZVC 2A3AA 5ISZD 4L4TB 3QIWD 3IK2A 4G6AD 2RGSA 3MV9B 2G3NA 1AGDA 1UZ6F 3WSUA 4JPKL 5J6HB 3QG7L 3CZLA 1NAMA 1J86A 4DN4L 2IG2L 3N85L 4QB2A 3U9UA 1I4FA 4P23A 4P4RA 2EKJA 3TA3A 3IJSA 1LDPH 5HGAB 4JO1L 2G9HB 4JDZB 3QCVH 4KH2A 1ND0B 2LTQB 4NN7C 1F3JA 1E6RA 1BX2A 2W60B 2A3HA 4IRJD 3ALGA 3R0MA 1NKGA 3QIWB 3BESR 1K5NB 3U6RB 4HHAA 5E94A 5DMIL 2ZSWA 3MV7E 1DZBA 5E09A 2IWGA 4OLXL 4N8CL 2MKWA 3ZZ1A 3NNGA 2QADC 4G9FB 4EE9A 1WE5A 1FZMB 1JYXA 4WW2F 3WS6A 4D0CA 3Q5TA 3MOAH 4PGBA 3SKMA 2IF7A 3CFDB 4H8WC 25C8H 5HDQH 3WF0A 4YGAB 1AO7D 2I60L 2J4WL 4NC1C 4J3UA 4YUEL 4LKCA 3PWNA 1BQLL 3CD4A 3GSOA 3CSYB 4JPIB 4RFOL 1HDMA 4TTGA 1OSEA 3WYRA 3Q1SH 4PJFB 1UKOA 4MXQD 1N5AB 3BEVA 1GH7A 1ZWIA 5DQJA 3RWEB 1T1XB 3EJZD 4I77L 2ITCB 2G9HA 4JDZA 1UX7A 2WUHA 2VZVA 4MYWB 4UAOC 1QG3A 3UTTD 4TUFA 4P9HL 2WUBL 3P0VH 2D24A 4ZMAT 1RI8A 1MCWW 4YXKH 2YC1A 5TF0A 1CDYA 1GQLA 4OD2A 3BDXA 5I1JL 1MH5B 5FUCC 2YUVA 1WT5A 3HE7C 2Z31A 3KNBB 4KDVA 4LKSA 1FOBA 3BUTA 5EO9A 1CEOA 4GG8B 1GGYA 5HDOA 2C9KA 4C56E 5ALBL 3HE7D 1E27A 4P2RB 1DLCA 4BQ5A 5DQ9B 4BQ2A 1AGCB 3Q48A 3MUHL 3ZE0E 4X4ME 1INEL 1B0WA 1OD9A 1GGBL 1B9ZA 4PB0L 5JR1L 1OP5H 3AY4A 3X14A 1OGBA 4M29A 4UU9A 4WEBL 5DJCA 3SO3C 1SHMA 1RZ7L 1ZU8A 4JCMA 4P02B 1CVRA 3U36B 4TVUA 3VIIA 2ATKB 4Z7NE 4MXQC 4GMSL 3CFBA 5G04L 4IS6A 3OKKA 2A74A 1S78D 4G7VL 2R15A 3HMXL 1W9TA 2VZRA 2BSSB 4O9HH 4A44A 2Q87A 2A6IB 4RSVA 3O6KL 3NQHA 3HG1E 3V6OA 4NSKB 4Z7WB 1F58L 3BDYL 3FQRB 1XYZA 3WS3B 2Y2WA 1Z9LA 2OXGA 4J3VA 5CEZL 3MCG1 4D1IA 2P7TB 4YAQB 4UTFA 4PTTB 4E41D 4OV5A 2YDSA 3CZJA 4LLMB 5DT5A 5HYEA 5B8CA 2VDML 5IHLB 1L0XA 4RWHA 5B39G 2X9YA 1GC1H 1TG7A 3T0EB 5I1GL 4S1DC 3L5HA 4OV6F 3QQ3B 1XGUB 4ZYKB 1VFFA 4LCWE 1JZ7A 3DRTB 3S34L 4X98B 3I75B 5JOFB 4GW4A 2RJ2A 2UWEB 3GMPA 4YEEA 5A3HA 4YNYA 3SDXA 2Q8BL 2Z31B 5FA4A 2WBJC 1PX8A 1XGUA 4ZYKA 4OQTH 4HWBL 3QEUB 1DL7L 5C7XL 2V4VA 1FH5L 4R4FL 3VFVB 4X6BA 2BGPA 3A7QA 3MMUA 3NN8B 2YLLA 5C0JA 1V02E 3DSFH 3MRQA 1U92B 3MV7B 3MRIA 3ZTJG 5DZOA 5KSUA 3G9AB 1ZLUH 4E2OA 2P5WA 5IVZA 1O7VA 5GS2H 4ZUTB 3VFPB 5BJTB 1V5JA 2AK1L 1ODUA 5EMYA 8FABB 1JZ2A 1NUNB 1FZJA 4YQXH 4CU7A 4LSRL 1NPUA 2ADFL 5IVXB 5KSAC 1AE6H 1QSZA 2I07B 3A22A 1RZKC 3WKZA 5GXBB 4UBDC 1CD9B 5SWQA 4L29A 4ORGB 2C5DC 4HMCA 5IF0B 3RGVC 2VXTL 4Z7WF 4Z2LA 4PJ9B 2NY7H 1W3KA 2GITB 4DUVA 3PZVA 4IRSB 2GJ6D 1F3RB 1ZVHA 5HOSA 2NPLX 4X9GA 1U8OB 2CPUA 4MAYA 3MRNB 3BZEA 5J8OA 1IL1B 4H20H 4R90L 3PBGA 3ZKXB 5BXRA 2ESVA 1FYTE 3TBSA 1OARH 3FAWA 3V6FB 1VAHA 5A8OA 5IB2A 1PG7H 4NT6A 2AKRA 2I5YH 4NYLB 2BC4B 5IB1B 4NUGH 5JLZB 1BJ8A 3RWDA 2OYLA 2PW2A 1KJ2L 4KZEL 2EDLA 2WINA 1G6RL 1Q9KB 4HEME 1ZTXH 1K8IB 3C6LC 1QI0A 1NAML 1UOKA 3QG6A 1C08A 4XWOC 1TJIH 2DM7A 4MAYB 3CVHA 1WCBB 2LU4A 4U1SB 4AEIH 3DVNA 4TOQA 1HI6A 3O9WB 4LIQE 1FH9A 2MFNA 2N7BA 3L3JA 2AJXH 3T2OA 2YXMA 2QQLL 2NY3B 1MF2H 4F3FA 5LWYL 1Z3GH 4MTVA 4KKAC 3LKNA 5C9JB 3UTPE 3BWAA 4NRYB 3OKEA 5C8JA 1MWAL 4WI7A 1H3GA 2MHAA 4YR6A 5I30L 4CJ1A 3F2ZA 4PJCB 5E5RB 4OZIF 3VNYA 1T5WB 4X6FA 1NMAH 4J28A 2BNQE 5KW9H 5C6WH 4J7RA 3OLDA 2W60A 2XQYK 4IDJH 3WFZA 2H6PA 4MNLA 4WY7H 4ET7A 4QRPA 4RIRB 4WDIB 1PYWB 1TETL 1HSAA 1IGTB 2CJUL 1I5PA 1BOYA 1EEYA 4PRAA 4U6VL 5HGBA 2KBGA 2VUYA 4XAKD 1T22B 1U2CA 4LCCA 4BSVB 4MAVA 3NDZA 3WXVH 1XIWD 3KPTA 5DVLA 4D6GA 1MCQA 1IC5L 3NBNA 1VJSA 5F1IB 1GC1C 3IF1A 7TAAA 2W5FA 1QNSA 2UY4A 5IBLC 2YPLB 4GG6A 2QV4A 1W72A 4QX3A 1FCGA 3QXTA 4G6JH 2JJUA 4TUOA 3DV4B 4DVBB 5DRWA 2R0ZH 4Y4HD 4Y4FA 2D7MA 1QPKA 4K3DL 4GMTH 1G7IA 1ETZB 2DYPB 5D2NC 1P4LB 4HJJL 5ICZA 1G94A 1MI5A 1JG9A 2WMGA 4RIRA 1CFSA 4NZUL 3CZGA 4D0DB 1PBYA 1OSPH 4PJAB 5E9AA 1Q6DA 3O8XC 1XIWA 5JMRA 5DJXB 2JELL 2NQCA 4LPUA 4D9LL 4LPXA 4G8FA 3RX5A 3O3AA 5MI0C 3H3PL 1UWQA 3SOBH 1NCAH 5HI5C 3RGVA 2W07A 5KVEH 4MD0B 2XWDA 5C07E 1K2DB 4FG6C 1B88A 5CUSH 5HHPB 5TH2A 5GGUB 5LAXA 3X13B 1T0NA 2PTUA 3CLFH 5EU4B 2IAMC 3TV3L 3P0YL 5A6BA 1FN4B 1PFCA 1K42A 1EMTH 4M7JH 1SR0A 4YBLC 4F7PB 3NCCB 4D6HA 1QEWA 1AKJD 3NCJL 4D0BA 5EUOF 2RVAA 4MJID 4PJBA 3O2LA 4Y5YB 1BQCA 1DEEB 3V6ZB 3PL6C 3T0EC 5GGTL 3KPOA 3EO1B 4Y0GA 5I1AA 1N5YL 4BQ8A 1CXLA 1EQCA 1TQBB 3LAFA 1I3GH 3D1MC 4QY8A 1D5IH 3EO9L 4MNKA 5DD0L 3SGEI 3ZHLA 3G08A 2HFGH 3K7UA 4NN6C 5DJ6A 1SY6H 12E8H 1NGPH 4IM4A 5EZOH 5IB1A 1II4E 4Z7UF 3A47A 4P3CL 3PXHA 2B4CL 4OLWH 5HDRA 1KIRA 1XH3B 2Q86B 4IDJL 4LCWA 1KJ2A 3PXJA 5HBFA 1ADQL 4WWKC 4BUGA 5C0AB 5DXWA 2V9QA 3SDXE 1AGBB 3ARBC 5DJYB 3V79C 1RHHA 1Y7VA 2FX7L 1Q94B 3MYJB 4Y7MA 4M61A 3ULVC 1XNTA 3TTQA 1WIPA 4ACZA 2IPUK 3SN6N 5FD0A 1IC4L 2K7PA 2UY7A 5FYLD 4Z5RA 4MLIA 4PS4L 1O0VA 1KPRB 3A3HA 4F9DA 4XH2B 4PGZA 4WFHE 3JXAA 3FCTA 3QIUA 1Q9WA 3TF7C 3GK8L 2ZCHH 5K93A 4ZFOB 3ULVD 4NM8H 5HHMD 1UD2A 3IJ9A 2K7QA 5HYJB 1WV7T 4B9YA 1OT2A 4HPOH 5HD8C 5INDA 2VXSH 1T4KA 4KWUA 3WH5A 5CBEB 4HZ6A 4JQIL 1W0VB 2IGFL 3ARFC 3FO0L 4BYHA 3WEOA 2CKNA 2Z35A 1MCIA 4YHNB 3SCPA 4C59B 1A9BB 5DC9B 1FIGH 1D5ZB 4LLUA 1LD9B 4NWTH 5EG6C 2X2YA 3MTRA 2EXWD 2X05A 1ACZA 2O61A 3VG9B 1W0VA 5DO2C 4XB3A 1BM3L 1OAQH 4L8SA 1MYRA 5HYQA 3F5WB 4UNVA 4EDXB 5HPOA 1P6WA 2GTWA 4F37F 1QRKA 4MQ7B 1UR2A 3L5WA 1PY4A 2BSTA 4Z95H 3ROLA 1CFTA 2XICA 2H45A 1TZIA 5FYKU 1F4WL 2AEPL 3PL6D 2VITB 4AK1A 5JO5A 1R5WB 3O4LD 3VCLA 4UQ2B 1YN6A 5D96B 2QF8A 1GVIA 3JWNC 1KGYA 1A4JA 4AXNA 4HAGA 4OTXH 4N68A 1CDHA 1JWMA 3BH8A 3WD1A 3T1FB 1PLGL 1FL6A 2IAMD 1XH2A 1BIIA 4UQDA 4AD0A 3OZOA 3TT1L 3IGAA 1U8LA 1ZHBB 4W68A 3MV8E 3HC3H 1XGQB 1CZ1A 2OYKA 4WFFD 2J8UF 3D18A 4UT9L 4HJGB 5LCVL 1BZ7B 5C7GA 1CFNA 1OB1B 1C08B 4X4MA 3ARXA 3DX8B 5CP7A 2X4PB 1NMCC 2Z35B 4J6RH 4L3EB 4KZEH 3N9GL 3I6KB 5BVPH 3RMEA 4HUVB 4NNXA 4UNIA 4WDIA 5TFSH 5F9AC 1YEJH 1PG7L 2EICA 2Z4QB 3BGAA 2LS6A 4Y88A 4QY8B 1KYOJ 1AR1D 2P8MA 4GG6F 4PJEB 5IBLD 3AIBA 3N13A 2WBWB 3Q5YA 4YXLH 2WYSA 2YBRB 2XWTB 1XSKA 3QIUB 3FCTB 2VMFA 1HKLL 5CEXA 2BHZA 3SJVA 3D69A 1MCRA 2VDRL 1B90A 4YHOH 5J6GB 4H88H 2C3GA 1RUQL 4GW5B 1UCTA 4HFUL 3MOBH 4XUPA 3CH1A 4XBGA 3MV11 3C60B 1JGLL 1A5FL 1WAAA 4R6UA 3WHE1 5GRVL 3ARDB 3F5KA 3F6LA 2CHNA 4G9FA 2NZIA 1KENH 2X40A 4GPNA 4FNLL 3JTSB 3O3AB 2AXFB 2ZUQC 5E6ID 4P4RB 1E9LA 2V7HA 4JY4A 3RVUC 1MXDA 4FZ8L 4WKHA 5C07A 1JBJA 1S5IL 3EYQC 5MEQB 2IQ9H 5KN5B 1K12A 3ZDZF 1GIGH 1SBSH 4KTDH 4W5ZA 1MW3A 4GZIA 2DTMH 3EYOA 4EZMA 4AZ7A 1EHXA 4OCYL 2ENSA 2C1OA 1H3UA 2PW1A 3C5JA 5HHOB 1UD8A 3PHQB 3I85A 4N1EA 1MREH 4BSWB 3ZOAA 1JGVH 1KLFA 3UZEA 5I1AB 3LS4H 3GMMA 1IARB 4L4VB 1SMOA 4LQ1A 5E6IA 4JRXB 4OUUB 2WC7A 5BXFB 1E43A 4U6HB 2I9TA 1FAIH 3CDGA 4WU7A 1UEMA 2CKBH 1GOIA 4LPLA 4KK5D 5HGBB 2E6PA 2WV3A 4XX6A 1FNSL 5KJRL 3D3AA 4PPTA 1NGZB 1MFDH 3MRGA 1J18A 8FABA 4JFXB 4LXFA 3WBEA 2F8VA 4E5XB 1JF1B 5DQ0A 3QFJE 1DVFD 1QHOA 2PETA 2J7BA 3QEQE 3QHOA 2F15A 4P2OA 1TETH 1Y0LA 2P8PA 1M53A 1JXJA 3OIHA 4WY7L 2YL5A 1OT1A 4UOW0 5J89A 4J1UB 2X70A 1U8KA 3SURA 4RGNC 4NQDE 2ZXQA 3BO8A 4WW2A 3IDJA 1D5ZA 4XCFH 2V2XB 4DAGH 1CFVH 4G8IA 5FO8B 1PZ3A 5I1CH 3W9DA 2HG5A 5D2LE 4WUUE 4U1NA 4OD1L 5E2WL 3MR9A 2CD0A 2WAGA 1G7HA 5GRWA 1IGFL 3B8SA 3VG9C 3BP6A 4RL3A 2ERJB 2WBJD 3MNZA 4FABH 5K9OA 1S9KC 5LYRA 1UWXH 1MW0A 2B4CC 2ICWB 1CICD 2VO5A 2SEBB 2J62A 3WXWL 1KJ2H 4NC0B 3V8CA 1P4IH 3TIDB 5FOBB 4PRPE 2YUXA 3GRWA 1P4BL 1WBYA 1FFNB 1QFUL 4LDOB 3WN5A 2CBJA 4FFZH 4MNJA 5EULV 1MCLA 2QQQA 1EEUA 3LPFA 2Z8RA 3TEUA 2C3VB 2VDOL 2HLFD 4IOFD 1QRNE 1LEIB 4UZGA 4OFVA 2R0KH 1MAML 1ZT1B 4H8WH 1RH9A 4GAYA 5DMIH 5HGHA 1BPLB 3IDMB 3LRSA 4CN6A 5C0EB 2EYSA 5D2NE 2LV4A 5I9QB 4B7LA 1XFPA 2X1PA 1V03A 3VWKD 2DI7A 5JMOA 3O6AA 3B5GA 3L4TA 1ZMYA 3BQUB 3HG1D 1JXKA 3T3PE 2IAMA 5AZEL 2L7JA 2LAGB 2X44D 3SKOB 4JKWA 4DWSA 2WC3A 1AJ7H 4PJ8D 3RVVD 4OGXL 4PGCA 3CZKA 2APVA 5IGXH 1OTSC 3QCUH 1KBBA 2XKNB 3NAAL 3QIBA 1FFPA 4XVJH 3BSHA 4A3ZA 5TF1L 3MV8A 4Y1AD 1D3CA 3CMOH 4NKIH 3DMMC 3KL3A 2FGWH 1KJVB 1BZ7A 1MFCH 1EXUB 1W1YA 2Y5TB 4G8GE 1YJDL 3BJ91 4AENB 5JBDA 2FLBT 2D7QA 1HKFA 4MB3A 3U7WH 3KWWA 3WDHA 2DQJH 4UDUB 3UJJH 4Z7VE 1HJWA 4B16A 2O9OA 2VDQL 4XVTH 3FNDA 1FFNA 2GJ6A 3QIBD 2AJZB 5BZWB 4PUBL 2P5WE 4ONGH 1K2DA 3D6GA 3BZFB 1CT8A 2E9IA 2QJDA 1YEEL 3TBYA 1V08A 5A95A 6FABL 5IMMB 4GRMA 1I7ZB 1CZ8L 3S6CA 1VBRA 4F9LC 2E7LA 3QXDA 5EA0H 4QGYA 3RQ3A 4A2LA 4FZEH 5I66A 1DWIM 3GSUA 2Z4FA 4NZTH 5D1ZD 3OR6A 4KHTL 1VCAA 3RUGB 5K59E 4W6YB 2D9QB 5CEYB 4PJAA 4K23L 4KKCC 4MNGB 1AO7E 1XR9B 3U7AA 1AGFA 2LVEA 4KKBC 4UV4H 5D7LE 4UAPA 4HS3A 1AD0A 4Q7DA 4RGMB 1SBBA 4MVBC 5A6SA 4EEEA 4IRJC 2IBZX 2FEEL 2NXZC 2YEZB 1JGIA 3GBDA 3RWHA 1TVHB 1EGJH 4ALAH 1IT0A 5D7JA 1RPKA 3QEHA 5E6ZA 5GS2D 4A2MA 3PHAA 1MCPH 1R3KB 4Z0XA 2WIIB 1ZS8B 3F62A 1WBXA 4C83A 4JFUA 15C8H 5EO1A 4HOXA 3S5LB 2X9WA 3C2AH 3ZE2F 3VGFA 2PO6B 3AXHA 3GXDA 3MFFB 1YEIL 5IB5A 4QRPB 1TQCB 1OAYH 1JFHA 4B5EA 3DX9A 2XFXB 4XMPH 2OYPA 1FVCA 2JALA 1ZT7B 1Z5LA 1S7UB 1IGYA 2P46B 4Z7WA 2AMGA 3GJEB 3HUJB 4JAMA 5IXEA 5IB4B 3G5ZB 3IDMA 3QPXH 2A6IA 1CGYA 1E28A 1BTCA 3V4UL 2ZE0A 5I76B 3LQMA 1SG3A 3SCNA 1V3HA 2PC8A 2XWEA 1A47A 4TSBH 3VGDA 4AG4L 5A8QA 3ZL4L 3MRRA 4K71B 1MW1A 4PJ7E 4CVXA 3DHUA 5E8DH 5CMAB 2J1EA 1E4KA 1I1AA 3HEIA 1CXEA 4PMNA 1KXTA 4XGZB 2HJKA 1JGVL 3OJMB 3OZ9L 2NY0C 3RDTB 4HPYH 2E4TA 4G80B 3NSXA 5IYYA 2CLRA 1NGXB 3P4NB 4OZHE 1H5BC 1K8IA 1MCDA 4PQQA 4YBQD 3MACL 4HLJA 2HFEA 3QFJA 2A1WH 3CIQA 3EDEA 4N0FB 3SQOH 1OF4A 2IQ9L 2E33A 4D9QD 5HY9B 1S7RA 5J9PA 3SDDC 5HHXL 4Y4KD 2WN3A 4NKMB 2DLGA 3Q3GA 4IOSD 2PYFA 5D2LF 1D9KC 1VSCA 4MS8D 1M4KA 4KRUA 3WUWG 2DI8A 3QI9C 4ZOAA 1H4PA 3PNWA 4P2QE 1IEBB 3HZVB 4GBXD 4JFHE 4JY5H 1CL7I 4FLRA 4P49A 2IJ0C 4AL8L 1P6AB 3BO8B 1HHKB 3GZAA 1BLNB 3RVTC 4UTAL 4DZBB 3OGRA 5AC4A 2W9LA 5GNZA 4HXAL 2J8UB 2XG5A 4W4ZA 5LBSH 1JHJA 2J47A 1CIUA 1HKLH 2L0DA 1SY6A 3ARED 2UUDK 4RFNB 5GISH 1AXTL 2AJUH 2NZ9D 1FZOB 3MV01 3AIVA 1C7TA 4PLOB 1GHFH 2SEBA 2J7CA 5FGCE 3VFGL 3LRGA 1XAUA 1IAMA 2MQ0A 4WI5A 3ZR5A 2AJVL 5FUZH 1HKKA 5DJXA 1PQZB 5F3HB 2DKMA 4FABL 1B0GA 3CX2A 1DBBL 3QO0B 1RUAH 5BO1H 2R2EA 5D1XB 2GHWB 4P9ML 4PT6A 3CZFA 2DQTL 3OAYK 2HKFL 2WUCL 3DX8A 4HMEA 4M7KH 1FO0L 1DLHA 2LW8A 5JNYA 1CFNB 2VZPA 2XTJD 3PWPE 1J05A 3SGJC 1MFAH 4GW4B 5D2NA 3DSNA 4K3GA 1E6XM 4Z0BH 2B20A 1TLKA 1K6AA 5EO0A 4L9LB 4GJTB 2GDUA 2E9WA 3FRUA 1ZHBA 2PYEE 3B9EA 4KJYB 4LQFL 2E26A 3DX6A 1RJZB 4PMVA 1KIQA 2HTLD 1GMMA 2WLYA 1BD2B 3OXSA 2J7HA 4BXSV 5TDPB 3U83A 1OGTA 4OB5H 3W9EA 2OL3L 3EOBA 4CJ0A 5I8KH 2X0YA 5L2KB 2F19H 3HRZA 5LXGH 3FAXA 4XXDA 2FR4B 1VBUA 4UI9L 3VFWA 4XWGL 5I73B 1QW8A 5IJKC 5F6IB 4M02A 3UPCA 4ATDA 1I8MB 4P9HC 4ELMB 2Q7YB 1BGXH 1TXKA 4I3RL 4GUPA 5TD4A 4M1DL 3LMYA 5F7NC 4KQ3H 1WTLA 5GZOC 5BQ7B 1SYTA 4L9DA 1KLUA 5CD5C 4PR5B 5AAWA 3CXHJ 1R3IH 4GLRI 1A3RL 1OGAA 3OTTA 5C0GA 5FGSA 5T5FL 4LSSL 3V6OC 4KAQH 3RY4A 2ICWI 2YBRA 3O8XA 1RZIB 3PL6B 4TVPE 1HIMH 5BOZG 2HTKC 3HG1A 3V6OE 4GRWB 4S3JA 2WCAA 3V5DA 3INUH 1AQ0A 3M8OH 2ZP0T 2WWKT 1JGUH 1J88A 3O45A 1KCLA 4NT6B 1FNHA 2ICCA 4XHQA 4XP4H 2V5DA 1SEQL 2VX7A 3HAEA 3I2JA 1IC4H 2YA1A 2DQXA 4ACYA 5E24E 4HUVA 1E4WH 3WIIL 4AJ0A 4J3TA 4WV1A 3DGCR 5IWLA 1T83C 5CYYA 3ZHDA 2J79A 5AEAA 5E4EC 5DS8A 4Y16D 1I9JL 1HNGA 1YJDC 2BNRA 1I8KA 5D7JD 1SYVB 5DUBB 3VXRE 4TSAL 1QSED 3VDBA 1G5AA 4OI8A 1A1MB 3D18B 3IDAA 3NIFF 4RX4A 3I2CL 1NWRA 1YY8A 2O5XH 1CIDA 3CXHK 4DOHE 4AM0B 2D7NA 3W53A 4PP1C 4Q0XH 3OB0K 1QUNA 1KN4L 2J88H 1C5DA 3ESUF 1NLDH 4AZ5A 1GNYA 3I6LE 5DJZB 1MRDL 3WH6A 2AJYL 2QQNL 2DQUH 2Z4QA 4PJHA 4Z7WE 4OM0L 1ZBVA 1S9XA 1VEMA 1CR9H 2DSWA 1MCBA 2FHFA 2WLZA 1T04B 1QSFB 3FZUD 1M7DA 2CUIA 2R56H 1T66D 5JMOC 3WY1A 2UZXB 5E5UB 5J6HA 2IEPA 5D1QD 4FQ2L 5GPRA 3TZVB 3ARFB 5GRXG 4BFBD 3MQIA 2A1WL 5A8PA 2N1KA 2Q8XA 2V2XA 1PAMA 5C0IB 4XC1L 2DQGL 1NWTA 1XGQA 4OZHA 2XWJA 3HC3L 3QI9B 5IG7B 1CBVL 2YL9A 4QHMA 2X4SA 4KDTC 5GGSB 1K45A 1CWYA 4GO6B 1SEQH 3SDCD 1HH6A 3TT1H 1JIBA 3ESVF 2X41A 1ZL1A 3HPJA 2NY6D 1LVEA 3MJ9L 4M56A 1U8LB 1Q6FA 3MRDB 5C86A 5JUEH 3C09C 3SKUD 3AZTA 2DWDA 5IVXF 4LLAA 2A6KB 2BNUB 3VXSB 4XXDB 5D96C 3KJ4C 1MQKL 5C09D 1UYZA 2R39A 5H8DA 4XVUC 1HIZA 3QWRD 4QRQA 3QXVA 1S3KH 5HPMB 4UQ2A 2P24B 3BPNB 3W4RA 1UD3A 3V7AG 1YEIH 5ICXA 2KKQA 5C0DB 2R0ZL 3NVQA 4OZHB 2NSXA 5FHBH 1FGNL 2R2BB 4PJHF 1RJYA 3LDBB 1WNOA 5I8EA 1G6VK 2R29H 3G5YB 1MCNA 1L7IL 4UOW1 3SEPA 4UFHA 3ALPA 4QXWA 5EORH 1A1NB 5FHAL 1J05B 1IC5H 4G8GA 2VSCA 1A6WL 2HN7A 1UC6A 3GM0A 2YA0A 1VEPA 5D8WA 3PP4H 4AZ6A 1MJ8L 2I9LA 3DGGB 4PGCB 3NCBB 2EE2A 4XAWL 3ZE0F 1CPUA 3QUZD 1O8SA 3C5ZB 2R0WH 1X4ZA 1DWAM 4I9WE 1MRCL 3IFOB 2BVDA 4Z2KA 5C08D 3STLB 1GQIA 2E7HA 5DUPL 3ELAT 1KEGH 2ZG1A 3C5SA 4I3GA 4X6FB 4LVOC 2FZ3B 4NZTL 3EO1A 3QDMD 3UYRL 4TULH 1HHIA 3FB5A 4G8GD 4ARXA 4WUUD 1V6XA 4O2EB 4IPNB 5I8OH 4ELKB 1XHGA 4WI4A 2DQTH 1SVCP 4XTRC 1KWKA 5JPNA 1BECA 2GCYB 4U2ZA 5C6PB 4KRTA 3RAJL 2DQCL 5DUMH 4HQQL 1LE5B 1US2A 4BA0A 5EU4A 1VERA 1DBBH 4KFZC 2VXUL 1HHJB 4KJWD 4KGLA 4NO5A 5JIIA 2NNAA 4UCFA 4XURA 4H26B 2J5LC 1OAKH 3NCFB 4MD0A 2I27N 2N4IA 3C5JB 4KAQL 3S35X 3MLXH 4XUNA 1T1YA 1Q8MA 5FM8A 1KXVA 1Q72H 4PTXA 1KJ2B 1W8OA 2UWEF 4UTBH 4P3DB 2YB7A 5G05L 4LPWA 5JOPE 1ED3B 1G1YA 3JWDC 4ETYA 4RISL 3SKNA 3QEGL 1OWWA 1I1AC 2J8FA 1JTTA 4D0DA 5HY9A 4HXAH 5I17A 5DC4B 3SE9H 2EO7A 1ORQB 3DRQB 4RMRA 1GVYA 3V6ZA 5FDYA 5DRWB 4QDRA 4LCUB 1HH9B 3OL2A 3RDKA 3MLTB 4KMQA 1OAZH 3ALXA 4B3LA 4YDIH 3CZEA 4H1LH 3FB7A 5BVJB 5B3NA 3IS0X 4LHSA 4L1HA 3GSNL 1F3DJ 5A69A 5EU6E 1B0IA 1W2PA 4LQFH 4PJ7A 1JPGA 4Y4HB 4P2OB 3SUWA 3GKWL 1ES0A 3LS5L 4LSUL 4UFMA 4G43B 2I07A 3ARPA 5DHVH 1ZSDB 2G3IA 1S7WB 4B9ZA 2HVKB 5I71C 2DQIH 1XR8B 2WMJA 3QJFB 4MZ2A 4Z8FL 2JJSC 4GH7B 4QHUB 5DRZB 4FLOA 5HYFA 3MLPA 4GW1B 4X8JA 3MRQB 3MV7A 1B6DA 3BN6A 4NHUB 1D6VH 2GEEA 1QRNA 4NWUL 3MXWL 3AU1B 3KYMB 2F54D 3L5WB 1FNFA 4LKXB 3O6FD 1XCQB 3BHBB 4M9OA 4GMTL 3H7BB 2YD6A 3CMJA 4YXHH 2J75A 2NY5L 5E2TH 3P73A 4MXWH 1NARA 1AHWC 5I16B 3AYSA 1UUQA 4J3XA 4D2NA 1MIML 4V1DB 1T89C 2UVFA 3PHQA 1GGCH 1W3JA 1VADB 2IMMA 1W1PA 2NY2B 2EDWA 3MV7D 4AG4A 1AD0B 2GKIA 2WZPD 5EBAA 2DQUL 1T4KB 4LCYA 5FCUL 1FL6B 1IGCL 4GZ9A 3E8UL 3TM6A 3BGMA 4AY0A 1LK3H 2HT3D 1JNLL 4YDKL 1CDUA 2ERJC 1YYLH 5IVNA 3GSUB 4M5YH 3BKYL 4M43L 4JCLA 4ODXA 2VITA 4G7VH 3KG5A 4RE2A 4EAMA 2C4FU 3GIVA 1T20A 4MXVE 2E3ZA 1OSZB 2VH5H 1QNOA 4P46B 2ZCLH 2GTWB 3S96B 5DA0B 3X12B 1BFTA 4LF3A 3KDMA 1CU4H 3VIJA 2DSKA 1BF2A 4JQVC 5GRJL 3LEVH 2HT4C 1WPCA 2NMSA 2MPAL 4U1MA 5FK9A 4QCFA 3BPNC 3GHBH 1KB9K 3UYPA 3L1OL 1BBJA 1EJOL 1BJ1J 3KR3H 3AY4C 2IFFL 5SWZD 3RWJB 1R7AA 3PGDA 4JZ5A 2X4QB 4YGVB 4X5WA 1S7VA 5KOMC 3ZKSD 5M5DA 3ZTNH 1UG9A 4GAJH 1MEXH 2TAAA 3O3EB 4WLCA 2HLEA 1VKXB 1BQLH 2VZTA 2CXKA 2I5YL 5TE6H 3BUYA 1HIML 5T1LD 5CAYB 3HI6L 2Q76A 3RU8L 4Y5VC 3TJEL 3RUGF 3WDJA 3LKOB 2Z92A 2OM5A 1YJDH 5J06A 1SBSL 4G6KL 3MRHA 3P4MA 4DWHA 2A77L 2EDYA 1KCKA 2WKLA 4K3EH 3TT3L 1PEWA 5F88A 5BRZD 3W0WE 5EU7C 3G6LA 4L4PA 1KIPB 5F21B 2GCYA 4LLVB 5HHQA 3JWOH 2VLME 4URIA 4CMHC 3S36H 3TN0C 1SVZA 2FH8A 5DJ2B 1UR0A 2GFBA 1RUPH 2D3VA 5IUSA 1CGTA 4KPHL 4P0DA 1SDDB 5D71L 1IAKA 2ZZUT 2P45B 3EMZA 2VDRH 3LMJH 5HI3C 3U4EA 4HIEA 1BX2B 3OAYH 3VXPB 7FABH 3OZPA 2HJFB 2VE6B 1IAIH 1R3LB 3D25A 4M7LH 2GK1A 3WN6A 4L8CB 1NL0H 3GMLB 2J8OA 3HNSL 1ACYL 2BSSA 4APQB 1AO7B 4HUMB 4LIQL 2VDLL 3ULUD 4TTDD 2F2HA 3U9UB 4NRSA 1KFAH 1AQMA 2RFXA 1QQDA 3OKOB 3PGFL 1JAKA 1J9CT 4X99B 5C0RL 4JFED 4Y5YC 4DQOH 4FI9A 1B0RB 5EA0L 1JNHB 1G7IB 2DYPA 5L8KB 1S7QA 4XPGL 4MX7A 4WW2B 3DROA 4G42A 5ITFA 3KPQB 5FYLL 2ZNWA 5I1GH 4IMLB 5H35B 2VLJE 3I75A 4JRYD 5JOFA 3SCUA 4WTWA 4FQQB 2JJSA 3LKQB 4YAQA 4JFPB 5KBNC 4L5FL 4ZE5A 1KACB 4AW7A 1JPTH 1NAKL 3TH3T 4ZZ8A 4UV7H 2I26N 1GOKA 5M17A 1HINL 5I1EL 3K4AA 1HSAB 4JHBA 2A6KA 4L4TD 2DYPD 5ISZB 4XCFL 4Z8FH 1ACYH 5CHNB 1U2HA 4JG0H 2Y7QA 4JN1L 3VFSB 4DXSA 3TBYB 2GYSA 1R64A 4XRCA 3SDYH 1M6OA 1XR8A 1QNQA 4BZ2L 2UZIL 4MA3B 3FFCE 3LS5H 3OKEB 5C8JB 4XP6L 1WFOA 2ZX7A 1JPSH 3TCLB 2ZOKB 4PJ7B 1R0AL 2ZWYA 2VL5B 3VGAC 4JY5L 1JPFB 1UFUA 4XNZB 2Y6GA 3BH9A 2ZICA 3LKRB 3WFDH 1M7IA 4JRXA 3M1BA 2BJML 2BS9A 5DUBA 4R2GD 1XF2B 4AMCA 3RDTC 1G0YR 1HXMB 3U6RA 1UWIA 5F7EL 4KK9C 5EU3B 4LCUA 5SWZB 3D3VD 2QEJA 5FOOA 3CIHA 3TVMC 3PZTA 1C92A 3CVIH 2J1TA 1QBBA 4DWSB 5L8LB 3MRJA 3QEGH 3N12A 3HTLX 5FKAB 2NYYC 2WKGA 3IDNA 3MBEC 1JCKA 3G5VA 3RHWF 4CN4A 2XONA 2V6HA 1NGQH 3MUGB 3RZCC 2DIAA 1M04A 2CK2A 4GAJL 3D2UA 1N4XH 2MHAB 1G7PA 5EFFA 4QTHB 1CE6A 5DMJB 3HNMA 1CTOA 5JORA 5C0GB 2M1KA 3FHAA 4LU5H 5JXAL 2XT1B 1UKPA 2PI6A 2ADGB 3X11A 4OF0A 4LAJH 1QFWI 2R4SL 2VRKA 1IM3B 1HX0A 1V3IA 4FXKA 5TH2B 3RM9A 3IAGC 4BFGA 4ODVL 3DUSB 3TBWA 1KJMB 2XWTA 4ACPA 3FN3A 3RNQB 3TNNA 4JO2L 3MRCB 5KZCD 1EO5A 32C2A 5F9OH 3GGWB 5C3TA 4ZFGL 2AEWA 2ZSWB 3WN5C 4JM4H 1FZJB 3HAEB 5DUPH 1CQYA 4UIMA 3UPRB 5DJ8A 1NWUA 3ALFA 3CBWA 1J0JA 5L2KA 1HNYA 2ZPKL 1B4JH 4I5BB 1MCPL 1YYLL 5CG0A 2HWZL 3VWJB 2QHAA 2PXYD 1JZ5A 1EFXA 3AFBA 3VIHA 1IGCH 1OHQA 3QFJB 1A1NA 5ICZB 3PZOA 5D1XC 1RJZA 1NGPL 3CVHH 2W61A 5I8EB 4BZ1H 1A7NL 4OZOA 4AZHA 3F7QA 3PHSA 1NSNL 2YG0A 1UY4A 2W59A 2ZJSL 4CVZB 4TOYH 4GXUM 4G8GB 4ZXBD 1UY2A 1W72B 4AZBA 3MGOB 5I8CB 1MIMH 4O51A 5DEFB 3C8XA 1NC2B 3E8UH 3SGDH 1HILA 1T7YA 4PGDA 4QGTA 2NW3B 2F8OA 3LSOA 2BOCA 4MNQB 3I2IA 5KSBA 3S35H 1GZQA 3U2SA 2OWWA 3O4OC 4YXHL 2DEPA 3CUGA 2P43B 5AWNL 3KHOA 2DB8A 3OAUL 4JO3L 3KHQA 1D6VL 4K94H 3QUXC 3GBML 5DHXB 3N1AA 2O9TA 5H2BA 4O5LH 4LNVA 2QR0A 1VFBB 1X7QA 3IFLH 5HHOE 4U1IB 3UTSE 2P47B 2DSUA 4OCLC 4NSKA 2AEQH 2BNRE 5IESH 2E7MA 5L8JB 3EZJB 2FDBP 5CJ5A 2ZUMA 3LKSB 4EJ1C 2VLLA 3ZMRA 5SWZE 2V5RA 3OGCB 2YUWA 1ZS8A 1JMXA 3GIZH 4P57B 5HGDB 1OM3H 4GRLC 3RKPA 1JN6B 3G9VA 1HILB 4Z7VA 5ID0B 3RRQA 2KZ1B 4FQPA 4R0LC 1J8HE 1YPZF 1S7SB 2VLRE 2GJ6E 3DRTA 1JRHI 3QAZC 5LKNA 5DO8A 1KTDB 1ZHKA 4PRPB 5DMGC 4LSUH 4HAFA 4XNQB 5ABFA 2ATPB 2VRAA 2DQEL 1NCBL 1V6UA 3ZDXF 2AJSH 4ZNEE 1BZ9A 4EBQH 4AT6A 4O2FB 1KB5H 5A2JH 3A6CL 1H3PL 2RFXB 3MBEA 4XCCL 3LEXA 4LMQI 4QRRD 4GQPH 4WFED 4HF5H 3TFKC 3VXUE 2DPEA 2EC9U 3AS1A 4ZTPL 4HK0A 4BF7A 1JNNH 2AP2A 4NNYB 4U6VH 4WUUB 1EX0A 4M4PA 1V05A 4WW1B 3NCYP 3JWDL 5LGHH 2XHNA 1RIVL 3NCOA 4KJPC 2PR4L 4JAWA 4J3SA 5JBFA 1L6ZA 4PYSA 1FORL 1N26A 3EYUH 5E9DB 4X9FA 1ZAGA 3SPVA 1UJTA 2O5XL 4HGMA 3LVEA 3N9GH 2H32H 3N18A 5DI8A 3CH8A 1US3A 2ZKHL 3ARQA 4ZXBB 3TVMA 3ECBA 2XHYA 3P30H 3G6AA 5EOCH 2FEDD 3AXLB 2AJXL 5DEGA 3ZE1E 4NNYA 2HMID 3QUYC 3OKYA 3KLSA 4L3CA 1KIRB 1XH3A 3RI5K 2BY3A 5IWLC 1LE9A 4QOKD 1REIA 5D9SB 4LSQL 2B31A 2G8ZA 3GO1L 2C4XA 3BMWA 4FFWC 3D39B 2FJGA 5C3LD 3BUYB 4S0SD 3TA3D 5F70A 4W50A 5FL1A 1EBAA 1WDSA 3ZKXC 2V2WB 1UENA 3B83A 5IW6B 4NCC1 1ADQH 2WP3O 5C0AD 4HS8H 4EDWH 2EO9A 4J8RB 3U82B 2YPVL 5D7JB 1S5HA 3SDAA 3G6AB 5GS1A 1Z9OA 4MNHB 5DVNA 3TIEA 5T5FH 3WDQA 1MQPA 3RZCB 3NCEB 1ZGLP 1CZTA 3FJTA 1A3RH 1LJYA 4W6XB 1FJ1B 5DVMA 4U1MB 2ZG3A 3NJ3A 1SY6L 1HXYB 3N04A 1DE4A 1TJGL 5AYUL 4J12A 4MQXC 4YHYC 4PJIB 5FCSH 1I9RL 3R1GH 1BGXL 4HUUB 5SX4I 1K5NA 2WPGA 4K3JH 4JFQB 4RAUA 4OF8A 4HDIB 4PRNA 3H7LA 2XQYG 1DBKL 3GIVB 5H2BB 2NY3C 3F58H 5B3JE 2ENYA 3FO0H 5CKAA 5LXGL 5I24A 3PWJB 1MELA 2UUDH 1UQZA 3NCJH 2J8GA 5CD3B 3KJ4B 4Y2DA 4IS6B 4XVHA 1NCCL 5JA8B 4HPOL 2G60H 2G41A 5MENB 4Z7VF 2B4KA 4YDVB 4CADB 3D39D 4O2FA 2OR7A 3UTQA 4H25A 3JVGC 5GGTA 4G8IB 2CR6A 4C55A 5H94B 1JD9A 2J7EA 5FUOL 3B8YA 1VESA 3VM5A 1XF5B 3GK8H 3BFOA 4OKVB 3EW3B 2V3FA 3QUYD 4H25B 4P7OA 5DSCB 1FO0H 3WCYA 2XTKA 1NFDF 2W9DH 1NFIA 5L2KD 4KY1H 4PP2B 5MP6L 1S8DB 3GBNL 4LEOA 3MA9L 4JZNA 3GZKA 2ZUVA 4Y2DB 1I8MA 1RUML 3CUPB 4OZIE 4DUXA 2VIRB 3PWJA 1IM9D 4OJFH 4EIZC 1GC1L 2E32A 1CVSC 3F7PC 4KRLB 4WTZG 1NANI 2WZ8A 3IT8D 3OKDA 1VFBA 1X7QB 2PN5A 3HE6B 1NBQA 4X9BA 1X5FA 2FO1A 5EBWB 3A67H 4FMKA 4HFUH 1N3NA 1RZ8A 2IC2A 3BDYH 4H88L 1BQHA 3GXUA 5IB5B 1NSNH 4XNUH 2ILLA 3BIKB 3NCYS 2ZIDA 3MJ6A 3E0GA 4BZ1L 2GI7A 5IW1B 3WJLC 3CFIC 4Q0XL 5MI0B 2H26B 3KPRB 3PJSB 4Y7EA 2PYEA 2H3NA 2JJTC 5GGRB 1MRDH 1A9EA 1CICA 1SJHA 4HGWA 2E9BA 5BVJA 2WO2A 4UT7H 1K3IA 1X9QA 2QSCL 5A8MA 3HNBM 4TX6A 4HS8L 4GRLB 1ZLVH 1UY3A 3OJ2C 2BNQB 1B6UA 1BYCA 4PBVC 5EPMB 3MOQA 3ZYZA 4CCEA 3WE6B 1I3VA 3QDJA 5F9OL 2W9XA 4RE3A 5BV7B 1X5XA 4R8WL 2RGMA 3NJXA 1YY9C 1T3FA 3HN3A 3O45B 1UB5A 3GEWB 5T3ZL 4RGMC 3CHEA 3E2HB 3K81A 5E6YA 3VGHA 1J83A 5DN2A 2ICEA 1JGUL 4P5TD 3V8OA 4JKKA 1E4JA 4F15C 1JFQH 2HG5B 3QJHB 3KPSD 3BYTA 4M6OH 4ODWA 1JZ8A 1V7NH 1CICB 5EIQA 1NBZB 2VR9A 1U8MA 3FFDB 4I77H 4HP5A 3O3DB 3L3DA 1D5MA 3A23A 4PJBE 2X4UA 4PRDB 1FH7A 1S7XB 4L8SC 4NO3B 4AC1X 4ZD3H 5I1IH 2QQKA 2X7LA 2W91A 5D2LA 5FA3B 4U0RB 1XGTB 3MKKA 5BQ7A 4YWGH 3TPUB 3QPQC 2H1PH 4KXZH 3IJ8A 3O9NA 1XPWA 3KEHA 3BKMH 1PZ5B 3IAQA 4MDOA 3CVIL 1WFUA 5FYKE 3ZTJH 4I3RH 5IEHA 2J22A 2FGZA 2FH6A 2CKRA 1RV6X 5I19L 1JK8A 4KROD 3ARGC 2CLVA 2VUOA 1P7QA 1YN7A 5JW5A 1LWRA 2QQKH 3VFPA 1C8QA 3ACFA 3LKQA 3IVKB 4HF5L 4ZDHB 1J87A 5D1XD 1U3ZA 4I1NB 2EJ1A 1ZV5A 3ETBF 4OOZA 3NOIA 5KSAA 3DHJA 5F96H 1X5AA 4FQJL 1NCBH 3AHTA 4Z0XB 3CLEH 3QWOB 2YS4A 5CWSB 1NMAL 4MB4A 4O51B 5DEFA 2ZWZA 3VFRB 4OB5L 4OZFG 3UTZB 4F7MB 1U8KB 2W65A 2FBOJ 2OJZL 5D1ZA 3ZR6A 3E6HA 4JFVA 5J12B 3PIQA 3KGRA 1EO7A 4LVEA 3VH8B 1W72H 3FQNA 3GO1H 3WIFB 4Z2JA 4DM1A 3VXME 4K94C 5D1XA 2LAAA 5JXHA 1KCRL 3DARA 5I1HH 4R4FH 3QXDB 3U46A 2V2TA 3NGBB 1FP5A 4HWBH 3GJEA 3HUJA 3HS0B 4U6XB 2G3JA 1UEYA 4MAYD 5IV2B 1A4JB 4XP1L 3KLAB 5DJ8B 3V4PL 1I1YA 4QPWA 4U0QB 4OIIH 1FFOB 2AQ3A 2WO3A 5IEHB 1JPST 1ZE3C 3RNKB 4TVPD 3IDIA 4DXRA 3CUFA 3O6ML 4OBRA 5D4YA 2AERT 4U6YB 3MLUL 2LABA 1QI5A 1NAEA 4MADA 3VX0A 1A7PL 3MV9E 1HXYA 3TVMD 1KBGL 3DURB 1EAPB 2D31A 1HHKA 1LO3L 5I77A 2FYYA 4W89A 1BVKB 5C0IA 2VLKB 5CJXC 3S3JA 3VX1A 3RA7H 2DRUA 3HMXH 4R2GC 4NKIL 3CVHL 2GSIA 3OMZA 1FVEB 2OMNA 3NAAH 4XVJL 3VWJA 1JYNA 5L9DL 4OSUL 5IGXL 3QCTL 1KR1A 5B38G 4JFOA 4PJAE 5E8NA 4ZQKB 1S7VB 4KV5E 5KANI 2GSIB 1AO7A 5AZEH 5F8QC 1GGBH 4P2QD 4GT7A 5CZKA 3HCVB 4OCNC 4M82A 5JQ6H 2BVTA 5GNYA 1J0HA 3EYSL 5AD0A 3KPPA 1B30A 1ZWIB 1KLGB 1Q0YH 4I48A 5DQJB 2JJTA 1LL6A 2RGLA 4LHUG 3QDAA 4CD5A 4AH2A 2EYSB 3LZFH 1MCOH 4QRPD 2GFBB 4YLQT 2DBLH 2OSLB 2OP4L 3FQTB 3NZ8A 2BXYA 5CUSL 2R0KL 1F8TL 4DCQA 1YHTA 5SWQB 2AV7B 2J1KA 5HI4C 3D85D 3MC0A 4NJAL 5DFTA 3WLWC 2Z31D 4AEHL 1YEHL 2ITDA 2NW0A 1MEXL 4IJ3C 5A6LA 3UAJC 5E2VL 3B43A 3G04B 1DBJL 4LYQA 5KZ6A 4JZOB 1OPGL 2OWXA 1ZOXA 3SCVA 1FVDB 4YO0B 1R7OA 4MA7H 3VDCA 5HSFA 4JZNB 4M4RA 4H1LB 2EEXA 5DHYA 2GW5A 4Y5XB 3SGEH 3OKNA 4AD2A 4HD9A 2PWFA 4BH7A 4XMPL 4IMLA 5H35A 2A73A 3VXQA 1OH4A 2PWDA 3CO4A 5BYWA 4ZAKC 2C3XA 4NKDB 2ZCLL 3BD3A 5GRUL 1ZLWH 1TFVA 3AIEA 1ZVYA 1NCDL 4O9HL 2J7LA 3QDGD 4JFFA 3MREA 5D6CB 3IFNL 1FBIL 2H8PB 2RIKA 3C2AL 3MCKA 3LKSA 5DWUL 4DXTA 4MPKA 1V7MH 4OCMC 4NHUA 5DQDL 4P00B 1D2KA 5J3HC 3LD8C 4YPGB 4YDKH 3ULSA 1UWRA 3MUIA 5CEYA 3RPKA 5L9DH 1T7XA 1U3JA 2PTVA 4W93A 3WDIA 5ENWA 4Z18A 1MWAH 4PRIB 3MV9D 2BERA 5I30H 4MSWA 3DO7B 3RA7L 2X9XA 3UNPA 1D5BB 5A2AA 1JDCA 4FS0A 4UV4L 1CCZA 1U6AH 5JXJA 1A7RH 3BPLC 3QUZB 4PV8B 1VJZA 3WNMA 1ODZA 2BHUA 2VVNA 1FNSH 5KJRH 3DECA 1P5VA 4FOMA 4MDPA 2BSRB 4ZUUA 5CJXA 3WUZA 4NO3A 1UMHA 1CFQA 2R1WA 3MJ9A 1J84A 3MCKB 3WQ8A 3OPZH 2VAJA 3IDJB 3G6DH 4JB9H 1YQVL 4NBXB 4FK9A 3MNVB 4Y2OA 3K2UL 2B9VA 2FRGP 1KEXA 3U7BA 2JF1A 1MJUH 3KYMA 1G7JA 1IEAB 1QA9A 1RPQA 3M7SA 1IQWH 4ZG1A 3FQUA 2C9AA 4JANB 1TPXC 4KUZH 4KK8C 3JV4B 3KYNA 5D72L 5LVEA 1OGAD 3EOTH 1T5XB 4F80A 4W7VA 3DETD 4N0CD 1U91B 2DT0A 2GFTA 1KQYA 4WJ5A 1QFPA 5I15L 1URLA 3LMJL 5ADPL 2W1SA 3SEEA 4X7SH 3AS0A 1GPOH 1JK8B 2JIXD 3MXVH 1FNEA 4KPHH 4L3AA 1NOFA 3L4ZA 2APWA 5ESAB 4OGXH 4TUKL 2VQ1A 1A3LL 1BSIA 3NYDA 1DSFH 1KQZA 1P84K 3KPRA 4MAYC 3L95A 1EERB 4K8RL 4CMMB 3CHFA 1CK0L 4LRNH 3V52L 5ABHA 2VQ1B 1AGBA 1W32A 3VE0B 1XD0A 1MI5E 1HP4A 4LQRA 5FYKD 4H41A 2IALA 4RISH 5CSBA 2OSXA 3WF3A 1J7VR 5B4XA 4ZTOH 3VFNB 3N1PC 1E4NA 3LKOA 1LHZA 5I2UA 1HJUA 2NY4C 5I1EH 2BVPB 4LK4A 1QSFD 1IKFL 3WJLA 4PJEA 5MENE 1YNLL 4X4XA 1H0DA 1KNOB 1RU9H 1Z0MA 4BQBA 3RIAF 2QV2A 4LVHB 3FT4B 5JXEA 1R86A 3BGMB 3MRJB 4OGAD 2H32A 1XF4A 4RGNE 2WWDA 4JB9L 2X5PA 4CNIA 2B5IB 1GRWA 1UVQA 4PJBB 5IW3A 4ZODA 3V4PH 1DUZA 4WHTA 1UXSB 4OYUA 5M94B 5LCVH 4NBZB 4F7PA 4DQOL 4PJIE 3VTRA 1HXMA 4W7UA 4W85A 4C56B 2WNGA 1OP5K 5GGRA 5IJRA 1JWMB 1CLVA 3WF4A 4P4KB 2AAAA 2R1XA 3O3UN 2VL4A 2XN9A 4W7WA 3VJ6B 2VH5L 3ZIZA 4O2EA 4WFGD 4RBPK 1P69B 3TYFB 1BIIB 1C12B 2QLYA 3QO1A 4G8FB 4OGYH 4PTVA 3CFCH 1OLZA 1EQPA 4U05A 1SFSA 4UUJB 1UXWA 1RUPL 1MFNA 1QNPA 2COQA 4JGMA 4JKLA 2MSPA 1JNLH 3D39E 4QRRB 3VI4E 35C8L 1I1FB 3IU3A 5JOPD 2XG4A 4PJGF 5FCUH 3G6JF 1QI4A 5CCKL 2DDQL 4B41A 4DGVH 1MFEH 3GH7A 3FRUB 1FHGA 3JV6B 4WEMB 4GXPA 1I1AD 4H0HB 5D5MB 2IXUA 1BM3H 1KIUA 2EDBA 1UY0A 1BFNA 4GAFB 2PCPA 5E6IB 3UTZA 2E7BA 4R0LB 3V9FA 3HLAA 2EYTA 1N0XL 3QWOA 4CVZA 3RWHB 5F1OB 2LU7A 4ZAKB 2YD8A 3F12B 1SHWB 4ZO9A 4QDSA 4KRNA 3WQ6A 1KB3A 5E03A 1JF5A 3FO1B 3HMCA 5ALCL 1XR9A 4ODTH 2OTUB 4HG6B 4EK7A 4OLYL 3DBXB 3L2LA 4NYLA 4HULB 2DTML 4BUHA 5ERWB 1YEHH 3A4XA 1JI1A 1A6TA 3LN5B 2VZUA 4NCDA 2XVPA 3VXTB 2J4WH 3GMLA 1W99A 1ZA3A 1OCQA 2VE6A 3GNRA 5CKGA 3X17A 4Y4HA 4Q9QH 1SYSB 2YDRA 3JZ7A 2R1YA 1F8TH 1W9PA 5I18H 5DYOB 1GIGL 1Q94A 3MYJA 5DRNB 3TH2T 3LZFL 1NFDB 3HKFA 2EIEA 4AQ1B 5JW3L 4R27A 3CK0L 4KK8D 1E6NA 3BPLB 3QUZC 5C6TH 1KXQE 1U42A 4FNLH 4XHJC 4JHWL 1QBML 4M1CD 1UWEH 3F6IA 1W1TA 3KPLA 1K8DA 4U7SA 1EH9A 4P3CH 3HAEH 3QFJD 2BC4A 2Y4SA 2EXOA 5IJVB 4PMUA 5EZOL 1LQSR 2HRPH 3QG7H 3J8F7 4NKMA 4WUKL 5C8BB 1YMHB 4F9PC 5MEOA 1OL0A 2NY0B 1KN4H 2O5YL 4DVRH 4NNXB 1W2VA 1LL7A 1NKOA 4CCDA 3SGJA 5BS0B 5ABEA 1GQPA 3BAEL 4MDJA 2GY5A 4JFZH 4YHKL 5C09B 2EXYD 1QVOB 3MRLA 4X5WB 1OTUC 1NGYA 4HKJB 1FPTH 2W1QA 4LKCB 1BREA 5TFSL 4AQOA 4AIOA 4XVSH 4RN5A 4OLVH 1A14L 4OM1H 1JL8A 4C4KT 4LNRA 3LPWA 2NXYD 1B3WA 3CPLA 4MNQE 2IMNA 6CGTA 4OIIL 3O11A 4XPTH 4PF1A 5E9DA 3EMQA 1HJQA 3VU2A 5J3HD 1KELH 2WMIA 3GBEA 1I1YB 2HISA 2JJWA 2Y5EA 3MRMA 5J56B 1H0GA 1U91A 2B1HH 5F1SA 2BNUA 5I1HL 1G7MA 3O2DA 4LCYB 1BVLA 1MIEH 4XP5L 5F8RC 2XRAL 3L6FB 1D7PM 4DWSD 4OFPA 3QHFH 4UB0H 2NY4B 4PJXF 5L0QB 4Z7OF 1EIBA 1T0PB 4HWUA 4XI5D 4YDIL 4Q6YA 3D0LB 1WJ3A 3GJFB 4OCSH 2J4GA 2X1WL 4LVHC 4JL2A 3MRKB 1DLHB 2ADIA 4E8DA 5D6CA 3CDFA 4NUJA 4Z95L 5D5MA 3UBXI 3CMGA 1ZLSH 2BMKA 3STBA 3MO4A 3HC0A 2B5IC 4NQSA 4XX1E 4X99A 1HKIA 2FEDC 4Z7QE 2J74A 2DSVA 3N11A 1H3PH 1U58B 2CPCA 5B21A 1DYOA 3N1MC 4R5EA 4EUPH 3GM8A 2E5EA 3WUFA 1OCWH 3O0RL 3H9SE 1H6XA 4R7NA 2E7CA 4P2RD 3GGWA 4HC1H 1WFNA 3TYFA 2YC4A 1RIHH 3BP7A 4PTUB 4XP5H 3GMQA 2CRIA 2FR4A 3S88L 3UP1A 3VFNA 4G8EB 3KXFD 5JUEL 2VXUH 4W6WB 4A45A 2VZQA 3CJJA 4UR9A 4AWEA 3MJ8B 4AD5A 4KJPD 3A6BL 1BVZA 1GAFL 5GHWH 2EDDA 4CMHB 5EZIH 4PD4K 1OD7A 4JVWA 5GGSA 3PG2A 2DCKA 1KTLA 4JRYB 4ZSOE 1KPVB 1BQSA 4PRDA 4M6NL 4HC1A 4NQCA 2W94A 4FQCL 4RZCB 3MLRL 4LASL 4WU7B 3DUUA 1Q4NX 4HWBA 3MV8D 5IKCB 4HT1H 5DVOA 5CSUA 2YMXH 1MVUB 1KEGL 5KANG 1KELL 2BNRB 3I3EA 5EJZB 5JLZA 1UXSA 4JFFE 1K6QH 3W28A 4O5LL 5HJ3B 1E5NA 3NFSH 3ACIA 1FFPB 1ECEA 2E40A 2VZOA 5IFTA 5EUOA 1MXGA 4MAZA 2R0WL 4D9RD 2CKBA 5DD1H 1I8LC 1FG2A 2AJ3A 2O92A 3EYOB 2ITCA 4YHEA 1V3KA 4X5XB 1R3JA 4Q6IA 3OQ3B 3MA7B 5FOJA 1ED3A 5DURB 5SWZA 2B1AH 2FX9L 2GK0B 1OARL 1A22B 3ZJ6A 1G6RB 5TDNA 5EN2A 4GFTB 4QYOB 1BYAA 2AQ1A 5EZLB 1BYDA 3UJTL 3DXAE 4UFKA 4JM2D 3BE1L 3W0KA 2YWZA 3C6SB 4H2CA 1UWEL 1S46A 3FN9A 4FXKB 1T2QH 2NXYB 4AD1A 1JTPA 5TQ0L 4LLDB 1S3KL 2XPKA 4L4VE 5MERA 1N6QL 4OI9A 3S96A 1B4JL 1IGYB 2NY1B 1CLXA 1T6VN 1GHRA 2F74B 5DHVA 6TAAA 4ELMA 1QSVA 1R3HB 1J1XH 5KVDH 1DANT 3STLA 1F3JB 2FBJL 4OT1L 1ZGLA 1Q38A 4NDMA 5B4MC 1CG9B 2WINB 3ARGB 5F1NA 2XZZA 3P4OA 3CSPA 4EXPX 3QWRA 4JVPA 1AQHA 3T4AB 5HHME 5BJTA 4BJLA 1XIWB 3Q3GB 5CLWA 2J6EA 3THDA 2EIBA 3L3OB 1ZHLB 3QULA 1R3KA 1F2QA 1V3LA 4WFHD 3V6FA 1KYOK 3AI0A 2EKSA 5CSGA 5GS3A 5TPWL 4OIBA 3KPQA 3T0DA 1GHSA 3S88H 1AC6A 5FYLE 1BGAA 5FB8A 2G2RB 4EI6A 2JELH 3GNPA 2JIEA 4XNYH 4LGRB 1CD1A 4P7LA 5B4MD 2YL6A 3EDDA 5T1MB 2DKSA 1CX1A 5FF6A 4P2OD 3FQWA 1ISZA 3BT2H 4M80A 5DD5L 4ZFMA 1Y0LB 2P8PB 5TGBA 4OFYA 2ED8A 3NGBC 2CJUH 5E56A 3JTTB 1O8PA 4QLKA 1LP9F 1X5LA 1QHPA 3FN0L 3IDYC 4YHPA 4JM2F 3C6LB 1I9RH 4JFXA 3IIIA 4NQEB 2FX8L 2G5RA 3WXVL 5KSUB 4H8UA 3WENA 1IEHA 3JTTA 4U6TA 1EGJL 5EWIH 3PF2A 5DJ2A 1P8JA 5C9JA 2B0SH 4CL7A 4TNWK 4GMSH 4AZ8A 4OFDA 4L3EE 1RVFL 5JXGA 4P5TC 3AISA 2Z8VC 3SUSA 1DWFM 3HZKB 2JKXA 3HPJB 3NMEA 4Y4KB 3U0TA 2QL1A 3EO0A 4PJBF 4Z78A 3QR2A 1W9XA 1YY9D 2OSLA 3P3YA 1S5HB 3SDAB 1XV8A 2Y24A 4V1DD 5E9DE 4G7YH 1G9HA 1RUKL 4YBQC 2O61B 2RJMA 1OY3B 3O81A 2X4RB 2WVVA 4WI2A 4WKAA 4HZAA 1DQLL 4JRYE 4ZSOB 1MRFL 1IEBA 3CX5K 5C2BH 3X3FH 1WZKA 5I9QC 1MCCA 2D22A 2IANB 3FMGL 4JJ5B 1HJXA 1U3HC 4OM1L 1I75A 2PWEA 4A6YL 2YC1B 5JW4Q 2XN9E 1JHKH 3OF6A 2ZG2A 3KVQA 1E4MM 1NAMH 1FPTL 1E6JH 3GUTA 2W9EH 2AXJA 2AW2A 4XNMB 5HHVL 3FY1A 3UTOA 1F6AA 3MRPB 3NFPA 3MANA 3WV0A 3RBGA 1WWAX 3HJEA 3FB8B 2MQ3A 1OD0A 4M6AA 1PKOA 4JFDE 4DK3A 4MNQD 5DJDB 1CDBA 2B8OT 3X14B 3V5KB 3VRJB 1OF2B 2WZEA 3KLHD 5F71A 1JP5A 4KXZI 1BLNA 2ED9A 5IVOA 1P7KA 2H26A 3PQYB 4Z7UE 2VDNH 4H20L 4R90H 2GDVA 1FYHB 5F7WC 1OAXL 3O3BA 3FOLA 4P2RA 2EE9A 3FB6B 2J7GA 1LNUB 1OOAA 4JDTL 5FXCH 3RZWA 5TQ2H 5CPTA 3ILPA 4RMWA 4PRHA 4IJ3B 1UM4H 1CXFA 3MLWH 1VDGA 1LO4H 3WNPA 1TTFA 4D72A 1MCFA 1T21B 4DKFH 5JIWA 4J3OC 3K3QA 1NQBA 3IJYB 3MR9B 5DURD 5C0BE 2BY2A 2V38A 1DBAH 3LQAC 5A3ID 2F8XC 4DKEH 3H9YA 1AE6L 2HFEB 4KKBD 2IH1B 2W46A 5DD3H 3VI4F 4F58L 3LB6C 3G08B 1LEKB 1QTYT 4FQIH 1XGYH 4TTDC 3AAZA 1N7ML 3GI8L 2EYTB 4G3YL 3DIFA 4KUCF 5EIYB 2CLZA 3HR5B 2PQSA 2QSQA 1FP9A 5B39A 1J1PH 3SGDI 1TVHA 3MNWB 3MUY1 1JN6A 1I1AB 2X4QA 4YGVA 3VD7A 4M1RA 4U3AA 1QSEA 3LIZH 2Y07L 4P9MH 4H7VA 4NM4H 5DGRA 4JGJA 5BO1L 3TJEH 2FJFA 1A0QL 4JPVL 3KPRD 2VSDA 4OBSA 4Q9BA 5EB9A 1PY9A 4NN6B 1I7UB 4ZDHA 2WABA 2E7LC 4EUPG 2NXYC 4FQLL 2AJVH 4EI5C 3OKDB 2XZAH 4WGVB 5FOBA 3VINA 3BZ4A 1PSKH 1HEZA 3B9DA 1ROWA 4N0RA 5TDPA 1N59B 1B3VA 4F8QA 2VNCA 5A40E 2AJUL 2XGIA 3DVFA 3HRZB 5GISL 2EXYC 3DMMD 4O2CB 5SWSB 3SCQA 3SKJH 43CAA 5H37H 3LEVL 4JDVA 3N9KA 2WIIA 2FSEA 4HIXH 2X0HA 1FL5A 1JAEA 3F8UB 4PJ8B 1NC2A 1IGIL 4KQ4H 2ZUNA 4W8LA 1IKNC 2V5TA 2JE8A 4LBEA 5DJAA 3L3DB 4JHZA 4NUJB 5BV7H 5FB8B 4KRMB 4NJ9H 1NBZA 3MRKA 3C7EA 1EXUA 2DLFL 4HJ0D 4ZFZA 3F7RA 4YEFA 4HUXA 4RDQG 1EK3A 2CSPA 3BKYH 3P77A 1CD0A 5CBEA 2WWMD 5E70A 5I1DA 2QHLA 4URTB 4TVSa 1ZANH 4X7DC 4M1CC 4QFUA 2J12B 2CKSA 4LKXA 4K23H 4MB1A 1B2WH 2E9JA 1AXSA 4O2CA 4PRAB 4YO0A 4IIQA 2ORBL 4UIKH 5DR5H 3K4DA 4LGSB 2KQMA 4MJ5A 2J7MA 3DYOA 2XVLA 1J5OH 2KD7A 3QO0A 3TT3H 2I24N 3SDDB 4E42A 2OQJB 3WFCL 1R3HA 1B2YA 3DUSA 3GSXA 4QO1A 1P7QB 5JW5B 5D7IB 1NQ6A 3IDYB 4LLYB 4D8MA 3SJVD 5J1SC 1ZT1A 4PYGA 5J11B 1MJ7L 4NSBA 3TFKD 3JUGA 4WHDA 5BMFL 1JYVA 5TPWH 3TIEB 2YL8A 4MDIA 4MD5B 4NQDD 4OUUA 4XT1C 3BEWB 1N3NB 1RZ8B 1NGYB 1G6RA 1J1PL 4P46C 2GJJA 3CVHB 4U1SA 3SCWA 3PUCA 4Q58C 3SE4C 1H6YA 5D5ME 2DICA 2CIIA 3U79A 3MFGB 2QADB 3SDDA 4E42B 1E73M 5LA1A 4X7CC 1GGUA 1R5VB 1FG2B 2AJ3B 4F58H 5HGAA 4TXEA 5KVDL 4RGOL 4M48H 5E8PA 5A43C 4DKEL 1BWWA 3RVXC 5EOCJ 1OQOA 5IJVA 3O6FC 5GRYA 4D6CA 4POZC 2A6JA 4X7SL 1BZ9B 4HUWB 1QI2A 4M5ZH 2XI9A 1ZA6B 3D0VB 2VLRA 4WWKA 1MWAA 5EPMA 4AZGA 2CERA 1UWTA 4D3CL 3D85B 2KPNA 5CPSA 1RYYA 1E56A 4NO5B 4JRYA 2NR6C 2VCAA 2YD1A 1LO3H 4ZFFB 2YD7A 3H0TB 2HP4A 1IQWL 2CO6B 1PMHX 3X13A 3KYKH 2EIZA 3UBXA 4Q2ZA 4JFDD 5IM7A 5GGUA 4HWZA 4P2CG 3QA3A 2P8LB 3E3QC 2X89D 4NRXA 2C3HA 4K7PX 3VXUA 3FOMA 4GSDL 3LOWA 1R5WA 4XX1G 3VCLB 4W88A 4HG4J 1LLOA 3EJYC 1YUHA 5IB4A 4MSWB 2VLRD 1AVAA 3VFWB 1UR4A 4LSPH 5D93C 1I1RA 4HWEL 5CILH 1JHKL 3BD4A 3HFMH 1WISA 1JWUB 2XZQL 3L2MA 5C0JB 1F13A 3EIFA 3P77B 4JFDA 4AT6B 2MQCA 3F12A 3QDGB 1KR0A 5EB8A 4JFEA 3LV3A 3DV4A 4PV9A 1NFIB 1DQLH 1HHHA 1QHZA 3A6BH 3QEHB 1JJUA 3PUHA 2E6QA 2CLZB 1IC7H 4OTXL 3UZVB 3OV6A 5BV7C 1WTGT 4KI5M 4PRHE 4JY6A 4R26H 5T3XD 5DD3L 4U3CA 1EHNA 1F4WH 2AEPH 2VTFA 4HKXA 1R8LA 3ARUA 3DVGA 1SJXA 5C0BD 4F33B 2C1PA 4X4ZA 4WW2C 4PREB 4PMDA 2A9MH 1DBML 1UM4L 3BGFC 3MLWL 5KN5A 2W1WA 1IGML 4KZDL 4WV1C 2Z9TA 2OI9C 4HUUA 2DL9A 3MRGB 1L7IH 3OB8A 4RGOH 1HQ4B 3UTTA 3IRPX 4XUYA 4TVDA 1F6LL 1VIWA 2FJFB 2IH3A 5KS9A 1JNDA 2D20A 4S1QL 3I6GB 4MNQA 1ZGLM 1E4XH 5GGQL 4U1HB 3T0WA 2X4SB 4LCWB 3AHZA 5A2CA 1KB5B 2X4UB 3QG6B 4GINA 4LLUB 1MHEB 3I6LD 2QSTA 3DWTA 4NGHH 5BS0A 1DWJM 1K9EA 2O5ZH 3MLYH 1KPUA 4TRPH 5ACZB 4HUWA 3RDTD 2FGLA 4ZPTB 3GSWB 1UQSA 2Y9RT 5LGJB 1ERNA 5T1DH 5KVGL 5E8NB 3L3OA 3QULB 2PYFB 4TSCH 4BFIA 2CMRH 4PGEA 4I18B 1T80A 3FMGH 4KRPC 3LEYL 4QX1A 3RTQA 1T1ZA 5T3ZH 3V5HA 2FJGB 1UQSB 2ZEZA 3ZDXE 2J1RA 4DAGL 1R5VA 4ATWA 1DEEA 3L1OH 2VR4A 3QXAB 2FYYB 2IADB 3TVMB 4ZXBA 4XVSL 2CH8A 1DQQA 5DEGB 5DJDA 4ZOBA 1MRCH 3WFBL 5E5MB 1WGOA 1PIFA 3ZT7A 3WJJA 1T7VA 1L7RA 1JRHL 1LO2L 1UA6H 3AUVA 1EOMA 4NJ9L 3TIDA 4D0CB 4DVRL 4OZIA 2EPMX 4LOUD 3OLEA 4A3HA 2OMBA 1J0IA 1FZKB 1A6ZA 2OZ4L 2W38A 2R2HB 4QXUL 3SDCC 3T0BA 4OQ1A 3D2UB 2GJRA 5L88L 1O7SA 3O9WC 3RJYA 2MNUA 3WUEA 1R6VA 2VJXA 5C0CD 2ORZA 4S11A 4HUKB 5FHBL 5FO7A 2WVSA 5IP4A 1JZ4A 2V2TB 1MI5B 5CZVL 3THCA 4G5ZL 5JPMA 1FHLA 4W8BA 4ODUB 2BSTB 1WF5A 3SBWA 4DOHB 4NQCE 2OXHA 1S8DA 4UMGA 4S1SL 4PJFE 3P0YH 3SCMA 3MROB 4M1GH 5D1ZB 4D9RE 4F9LA 3O2VL 5FECB 2NY5H 4K8RD 4KDTA 5I18L 2X70B 1WAAE 1GSMA 4R2GB 3VD9A 3OGOE 4NWUH 3EGSA 4KI1A 5J1XA 4UILH 1TA3B 4CN1A 4GKOA 1GUIA 4IOIB 1VFUA 2DIJA 4KTDL 3AROA 4QRRA 3WLWD 1LNSA 4WIQA 4NO2B 4FZ8H 1RP8A 5HI4D 5CJQL 3GB7B 2EEBA 1F97A 2FATL 4AYSA 1RJLA 1NCCH 2DQGH 4OQTA 3AIWA 5C08B 1M7XA 2YUZA 4WWKD 1V6YA 4UINH 3O4OB 4MJ6A 4OF7A 4CVWA 1RURH 3DXAA 1NP0A 4PRID 1KJ3L 4X9YA 1L7TH 3EOBB 2GUOA 3DV6B 1FIEA 2H2PD 4Q2ZB 3FB7B 4RRPA 3VA6A 5BXTA 4HW6A 4RRPG 2VABA 5J7CC 3R4DA 3OEBA 2VLKE 3MJ7B 3CPLB 5ANMA 4KUCD 5GJTL 1TNMA 1TA3A 2D3LA 1DUZB 4WHTB 5CCKH 4ELME 4HLZG 3FL7A 4FFVD 4WHYG 3APGA 5ELIA 1KN2H 3ZKMD 3ECQA 3G6JB 3T4YA 1SMAA 4H5SB 3RY5A 2F19L 3MRHB 1CIYA 1VGKB 2QTEA 4XBPA 5LGKA 4X6DB 2Y6KA 3HMWH 1J9YA 2XA3A 4K68A 1A2YA 4LP4A 4ZOEA 2YKKA 3M07A 3ARGA 5F1NB 4APQA 4GO8A 3IJHA 2BVOA 4ERSH 4GKSB 3PZ9A 32C2B 5CD5D 4JFEE 1Q9WB 1EHLL 3OR7B 3K0WA 2CHOA 4FG6D 1Z2KA 4JFHD 5AY7A 3RM4A 5IQ9B 3B9VA 2J3SA 2NXZB 4JLRB 1CXKA 1HDMB 4I0PC 5I74C 4UT9H 1LEGB 3R06A 5GS1C 1ITCA 4M3KB 5HDBF 5MERB 2CBIA 4XGZA 3PWPB 4YN5A 3R0NA 3BWAB 4NRYA 1E4LA 3BH9B 3PZNA 2W1UA 1VPOL 1KC5L 4I4WA 2W0FA 1JPFA 4FP8H 4L8BB 4JFTA 5JPNB 4ONFH 1NOUA 2DH3A 3GSVA 5GHWL 1QACA 1A14H 4W4OA 1A6PA 5GGSY 3L3JB 3CIVA 5KAQG 4UQBA 1MVFA 3G5ZA 3GHEH 1HI6B 3O9WA 2HTLC 5SX4H 4CBPA 3POCA 5AZ2H 1F6FB 4XB8A 2Z0BA 1FO0A 2JK5A 4Y4HC 3F7YA 3ZDYF 1E72M 2XQBL 4UT7L 5FKAA 5F7FA 4HUNB 1I85C 3W82A 1ORSB 1HYSD 3L4YA 1XH0A 4ZEPA 2P42B 4QOKA 2XTJC 5C0FA 4GIAA 3BH4A 1PKQA 4F66A 4UFLA 4K2UH 3RY6C 1T1WA 4R96A 4LEOB 2BCKB 4I18A 1FGVL 1F4AA 2DIBA 3O3EA 2GSGB 3SE4A 2FX8H 2JD9A 1MHHA 1YMMB 4HBCH 4ZFOL 4NQXB 1P4LA 2NY7L 3U1SL 5BZDA 4L4TA 4POZD 4ZUVA 5K9KA 1KXQA 2Y36H 2ATPA 1IMHC 3UR8A 3DUUB 1RURL 5SX5K 1BBJB 1CGSL 5ACLA 3DX7A 4Y19D 2Y6SD 1H49A 3BT2L 4LSRH 2F54E 3UMTA 2YPLA 1PZ2A 1G0CA 4M6MH 2EDHA 3IF1B 1YEGL 3QQ9D 4MA3A 1U8IB 4XCEB 3BSZL 3HNTH 1DANU 1RFDH 1M6OB 3RTQD 5IF0A 3PZUA 4KKLD 3PZGA 5JR2A 3L5XL 3UG3A 1LO5B 5KVEL 1MFAL 2D7PA 5IFHH 1D5XA 1ADQA 3VIOA 2V3DA 4JKMA 1CE1H 3GB7A 4D6DA 2XFXA 3D3VA 1KBKA 4M03A 4XPTL 1FE8L 1GCFA 1GU3A 1HH6B 1SJEA 3MSGA 4OLYH 4K94L 4G6FD 4HPGA 5C0BB 3ARSA 4OLVL 5EO0B 43C9B 4Y4KC 5EU5B 1U8IA 1KIPA 1CFBA 2WVTA 3B6SB 3E6FB 2APTA 4NRZA 5AAMA 1RIUL 3QNZA 4N0UB 1N6QH 5IDIA 2FDMA 2VCBA 2CQVA 5TQ0H 2HA1A 4JIEA 5DHYB 1S7QB 1UH2A 4TX8A 1AXTH 2WWMC 4KJWC 4ODUA 3UJTH 5C2UB 2CEQA 3W24A 4PJDA 3N0PB 5DDHB 3HI1A 3MSDA 3MRMB 5I75C 4C58B 3D9AH 3MODH 3PWUB 1H0DB 1WCGA 3QIUD 4L3CB 4QT5B 5GGTH 4MMZC 4QCEA 1BFSA 4MO3M 3GTNA 2ESVB 4YR6B 4Z5RB 4W4OC 2AS5M 4JHWH 3BZEB 2Y6HA 3I2HA 4XCYB 2XN9B 5DK0B 4QNPE 1W0NA 3TCXA 3W39B 1M01A 3TYGL 3CDZB 3MGTA 3WQ5A 5IM7B 3HZYA 1WAWA 2J8UA 1W9BM 4LLDA 4NC2B 1UZ8B 4I3SH 3IJ7A 3Q6FA 1RK0B 3QDME 2P5WD 2D4DA 3T04D 4EI5D 3EBAA 3HI5L 4MA7L 2CGRL 1SYSA 4YPJA 5BW7C 4IBLT 4O02H 5DQ9A 1T2JA 2WIMA 5EU6D 3UO1L 4XUTA 3KPNB 5KSVA 3OBAA 1W3LA 1N4XL 1EEZA 3WL9B 3TTOA 2CBUA 4AMKH 4NZUH 1UB5B 3GBLA 4NBYB 2IANA 1PKQB 1U92A 2YLAA 3FFCA 3QQ4A 5JHDB 2XVGA 2J7FA 3QFDB 1GQJA 2WHKA 2OYMA 3KPLB 4Y1AE 1T1XA 4PRPD 1G7JB 1IEAA 1AXIB 3BVNA 4OZGB 5ANME 3LHPH 1CENA 2J77A 1F4XL 4HZLA 2FO4B 5KZCB 3TA9A 1CLOH 1EAPA 3N50A 4FXGA 5GGQH 4TUJB 5ESVA 2F5AH 1MCOL 5GS0L 3M6DA 4C4KO 4W8AA 3VUPA 4QLJA 1XF2A 1RK1B 5JBEA 3O2WL 3TN0A 5A3IC 1DFBL 1UYWL 4WI6A 2XVKA 1KV3A 1C16B 2RHEA 3C9NA 2ED7A 1AP2B 3RHWK 4EXKA 4KZDH 1S78C 1AFVL 2BV9A 1UYYA 4X0KA 3H8NA 1KTLB 4LSDA 2DS4A 4L4JA 4CRPA 3SGKC 2WCGA 3VVGA 3BN9C 4BELD 2QQIA 2Y06L 1HVQA 3NA9H 3V0WL 3BSGA 1MCKA 4F7EA 4OLUL 4I2XB 4ODXB 3VIKA 1TVBB 3GRWH 4ZO8A 2D4FA 5JDSB 3GNML 4TN9A 2R8SL 2G4FA 2PB1A 3CFCL 4NO0B 4FFYL 3T0XA 4XZWA 3S37H 1E6SM 3AM8A 3RWFB 4WU5A 5IHUH 2CK0H 5JO5B 2YBUA 2OTUA 5IT2L 2VCCA 3DVGB 1EJ6A 3EOTL 1BP3B 2BZDA 4GKNA 1IGIH 3VFVA 3L4UA 2HJLB 5E8EB 1UWUA 5CBAA 2NX5E 4UV7L 4Q74A 1T66C 3BP6B 3KPRE 1MPAH 3NH7H 3O6LH 2XN9D 1I1XA