3K4DA

Crystal structure of e. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
603
structure length
596
Chain Sequence
SHMLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alleviating cancer drug toxicity by inhibiting a bacterial enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-glucuronidase
total genus 185
structure length 596
sequence length 603
chains with identical sequence B
ec nomenclature ec 3.2.1.31: Beta-glucuronidase.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3k4dA02
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3k4dA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3k4dA03
3DV6A 2Y07H 4NO0A 1W0VA 2CK2A 4W89A 5HYQA 3QIBB 2FX8H 1MHCB 3LPGA 4HFUL 1FBIL 3AICA 1ZLUK 2R1XA 3VFUB 4GBXD 3P4OB 3W2DL 1K4CB 3RDKA 5A95A 5BS0A 5D7LD 1H3GA 4HUWA 3V95A 5EOCH 5A3HA 5FYKL 3IU3B 2W0LA 1MRCH 1EEZB 1UACH 1K3ZA 1BQUA 1GOGA 3VM5A 2XNAA 3O11A 3EO1B 5C0CE 2VB5A 1KC5H 2J4GA 4JO4L 1B0GA 4EXPX 3FO1A 1SG3A 3BQUB 4X5WA 3WUFA 2YRZA 1QA9B 1JI6A 1YDPA 1PIGA 4HA4A 1BM3H 3VVGA 1TTGA 2J4WL 1JGEA 3AXLA 3FOMB 4FTVE 5HDBE 5CGMA 3MRQA 4NNPH 3F7VB 3TO4D 4MD4A 1XSJA 4LLQA 3LV3B 5DD6A 3SN6N 3MA7B 3AIWA 1CX1A 4R27A 4XP6H 2EDHA 5EOTB 4YAQB 4APQA 1NP2A 2J74A 4KXZI 5DFAA 1MW2A 1YMMD 3KS0J 3SCMA 3VXPB 3QO1B 4ZAKD 3NIDE 3TPKA 3MLXH 3JTSB 2W46A 4ONHA 1FHLA 4MAUL 3NFNA 4XC1L 3K8MA 2V5DA 1C93A 5ID1A 4TPRH 5D2LF 1UA7A 1CFTA 5K59F 5ETUB 1GGBL 3GJEA 3SCMC 5GGVL 2CLVA 4JM2A 3L3IA 4PTTA 3L4WA 2DQHL 3DHUA 1QA9A 1QLEH 2VQUA 5ESAB 3G6AA 2OZ4H 4WW2A 3TT3L 3AGVA 1HEZB 1S8DB 3W0WE 1X3DA 4NZUH 1MCLA 3QG7H 5D2LA 3ARUA 3KPRE 1IAOA 1G7LA 2RQ8A 1EV2E 3WO3B 4DN3L 4ZPVB 1KXTB 4C57C 4OD1L 2R0KH 1N5YL 5IMMA 1UM4H 4PJIF 3TPUB 3OGSA 5GNZA 1N8ZB 1VFBB 5CSGA 4UQAA 1UFUA 4YHYC 4GRMB 4GMTL 3T0WA 5T3ZE 5GS0H 4MNQB 3VD9A 5F9JB 3S5LA 4KKNA 3QDGB 4XPBH 3KPSE 4HKJB 1XF4A 4TVUA 1AIFB 3O45B 2V5MA 3A4AA 2FIKA 4ACYA 2DQIH 1T7ZA 3CH1A 4E0RB 4Z7VB 4FQQB 4OZHB 5GGTL 1PJ9A 3VXTA 1EDGA 5BXSA 4YWGH 2VN7A 2DI9A 4JFHD 3QPQC 2CDOA 4PY7B 4P23B 3GXDA 5D2LE 3KPRA 1JG9A 5A6BD 4LBEA 1OD7A 2VZSA 2R4SH 4TX6A 5BXTA 1AHWB 2YKKA 4L4VB 1F42A 3KLSA 4MAUH 1QHOA 2A9MH 1ZVYA 2YPVL 2OL3B 3MUJA 4KZEH 2P49B 5GSRA 3BD3A 2Y4SA 4LCIL 5C9JA 2XT1B 1L9MA 1MHPL 2APTA 1WEJH 2BFVL 1XGZA 1NAMB 2ZX7A 2O9TA 1FO0H 4OD3L 4IOFD 4KRPD 2ZEXA 4K94C 1O8SA 2ERJB 2F5BH 5KG9A 5LYRA 4Z7QF 1NGPL 8FABB 3D85D 4IEFB 2ZXQA 5B3JF 1B3WA 3O8XC 2DQJH 4P3WA 3CO4A 1RFDL 5ICXB 1UWGL 3X11B 4DUVA 2XKUA 1AGBB 4H2CA 3UG3A 3OLEA 4Q6IA 1AD9A 2YD9A 4HEPG 2IBZY 1MH5B 5F89A 3JTTB 4D0DB 4Z76B 5GS0L 4WWID 1JN6B 4LEOA 3MMEB 3NIYA 2BXZA 4OLZL 5CLWA 2B4CH 4ESKA 4J3XA 4LLMA 5ID1B 1EHAA 2YBUA 1LDSA 1WVZA 2CMRL 1MVUA 4M6MH 3O6KL 3PQYD 4YLQT 1B0IA 1GONA 3A4WA 3JWOC 4X4YA 1WP6A 1D2KA 4H41A 5IOPA 1RU9L 1TITA 4XCNA 1PQZA 4U6XB 3GFUA 1MVFA 3CFDB 2R23B 1XIWA 1MW3A 3CFIC 5DD0L 4RBPH 4HW6A 2ZX6A 1K8IA 1FL5B 2H45A 1JGLH 4PJ5A 2PB1A 1WBZB 2HKFH 4WI9A 5ANMB 3THML 1C16A 2QMJA 3W26A 1K85A 3FFDB 2CEQA 3CZEA 3TWCL 1KJ2A 4ZXOA 3GUTA 1ETZB 4BQ6A 3Q2CA 3TPUA 3MUY1 4QOKD 5F89B 5GGTH 2VZOA 4D0DA 3ZE1F 3E2HB 3LD8B 3QUKA 4HKXA 3AIVA 2VDQH 3TYFB 2GT9B 5GS1B 4UQDA 4PJDF 3W9EB 1B3XA 5H35A 1CTNA 4MB5A 3E3QC 3BQUD 4ZO7A 2J8GA 2R2EA 2E8YA 4FQHB 3IJHB 4HIIB 1A3RL 4Y0GA 2ZJSL 2DYPB 4XUPA 3S3PA 4K71B 1F4YL 3WIIH 1A7QL 3HOBA 4QTIH 4Z6AT 1IL1B 2YA0A 2CITA 3AXHA 4ENED 5AC4A 3VX0A 3F7YB 1NL0L 3SDCA 2IXVA 2WC7A 3W5MA 4PJ5E 3O4LE 3EOYG 4LSRL 3T1FA 1CF8L 1JNDA 3F12B 3TBTA 5FO9B 3V4UL 1JU3A 2JCCA 5HYQB 3TLRA 3WQ5A 1U6AL 1G0YR 2BSED 3W29A 2NPLX 5JXHA 4W93A 4WFHE 4UIKH 2CO6B 5EH1A 1WV7T 5HBFA 4ONFH 2OR7A 2BVQA 2R9HD 4N5EC 3OGOE 4RIRA 4X98B 1HDMA 1XZ0A 4CKVX 1BBDL 4KWUA 1G7JB 1Z9SA 5JIWA 1EEZA 4Y1AD 1H3XA 2GITB 4JGUA 3VRIB 3DX7B 2QMKA 1MCIA 1VHPA 4GLRH 4AK1A 2R4RL 3EYSL 3TYGL 3U0WH 3QAZB 1YMHB 3QHFL 3TN0A 4M48H 2WSPA 2YUWA 2VZVA 3Q5OA 2VJXA 4ZDHA 5L8LB 3AFLA 4AY1A 1E4XH 4TSCL 4MAYB 1DBBH 2CGRL 1HI6B 3ARBC 3MRBB 1JU4A 4PRNA 5DS8A 2F54D 3T0VA 1QSFD 2K7PA 5DEZA 5JXJA 2FEEI 1G9HA 1I7ZA 1SQ2N 4OCSL 5DSCA 2Z31A 1YYMH 3WEXA 4EDXA 3QQ9C 3KLHC 1JPST 1WIUA 3FRUA 3VM7A 3G5YB 4XT1C 2WCSA 2FYYB 2W60B 2GK1A 3TA3C 3KL3A 1MCWW 4JVWA 2XOTA 3LSOB 3GK8L 3PWJA 4PTUB 1P5VA 2BVUA 2WAOA 3MO4A 4PJCA 3TONA 2WN2A 4OLVH 1U8PA 2Y7QA 4NHCH 2CBUA 5HI4D 5CBEB 4HH8A 3ZDZE 4GG6E 3JXAA 5E6IB 2NY4B 3MFFA 1VFAA 4XX1G 1A1OB 4P46A 3DGCR 5HHQB 4GG8B 1GGTA 1MWAA 25C8L 4LQRA 5L0QB 1ZT1A 4PV9B 3D2UA 4P00B 3WEZA 3T3PE 1TNNA 3KYAA 5F7EL 2DDQL 4ZO9A 4YK4C 4E9LA 4YXHH 1HK6A 4XTRD 3BN6A 2CRIA 1I3GH 1QLRB 1VF8A 1CGWA 4EZMA 1MSPA 4U6TA 2HFTA 1QHPA 3RCNA 3N1PC 2EDBA 12E8H 3VFGH 4PJCE 3ARBB 2CO7B 4PJ8C 3T0EB 4NRZB 5LA0A 4HWEL 4P8XA 3QRGL 1RJLB 5DQ9B 5DJXB 2F54A 4GG6A 3CUFA 1U2YA 3CSYA 5AUMA 4AH2B 5E6IA 4PREA 3VMOA 1AIFA 1QEWB 4PJHF 4BF7A 5JPNB 5SWSB 1QO3B 1NBZA 5E2TL 3HG1E 3QO0A 3G5XA 4CAGA 3AMCA 4PLKC 5HHXL 2H6PA 3DUSA 5JHDD 4P7QA 1IGYA 3CXHK 2QHRH 4O00A 2UUDH 3LRSB 5FKPA 3UTZA 1AHWA 5FKAB 3RM8A 1NCDH 3MNVA 4NHUB 3VRLE 3VFSB 1GOWA 4PB9L 5J1AA 4Y7MA 4FZEL 4Q2ZA 1W2VA 4DW2L 3PZOA 4GXVL 2OSLB 4IS6B 4G9FB 3U7VA 1BOGA 4NSKB 1DQDL 4UT7L 3NPSB 4PJ9B 4MAYA 1EMTH 1WPCA 3WKMH 5D1ZA 4P9HC 5CIPA 1UA6H 1J8HB 2VDOL 5GJSL 1HH9A 1ZA6B 4AD5A 1GCFA 1W1TA 4WCYH 2EBNA 5I76A 2HLAB 1W0VB 1IBGH 1DWFM 3ARFD 1VPOL 1LE5A 1SBBA 2W95A 5J1TC 1NCWH 4HXAH 4PFEA 4LRIA 5C09B 2J5LB 5C0JA 2N7BA 1ED3B 4M24A 2UY7A 1TA3A 4I0PC 3C2AL 5D1XD 1AXIB 2UY5A 2QV2A 1IAIL 3PE9A 4I9WD 1J1OL 2H9GA 1CGSL 1J7VR 3OBAA 2FL5A 3S3SA 4Z7QE 4PMZA 4ZQKA 1ZJAA 1TNMA 2C3VB 1A7OL 2CK0H 3OIHA 4EOWH 2WMIB 2H1PL 1Z3GH 3VDAA 4K7PX 4AZCB 4WJXA 2XN9D 3R8BB 1ORSA 5C0RL 4W85A 2YSSB 1HH6B 4MA8L 1TJHL 2HJFB 2PO6B 3VD7A 1YC8A 4QHKI 3VFNB 5C2BH 2VL4A 4U0RB 1U33A 5B39A 4H8UA 4PY8J 3BZEA 1WF5A 3VXRD 5FM4A 4X7EC 5D6CB 2GJXA 4HGWB 1OSZA 1T0PB 4NC1E 1AP2B 1Q9KA 2V3FA 5E9AA 3QA3B 4JQXC 5FHBL 1E43A 1QSEA 5LXGH 2E9MA 1ZHKB 5FEBA 5ANMA 2N4IA 2DOCA 4OB5H 3BRGC 4NRSA 2V3DA 1E6JL 4HFWA 1UH2A 3MGAA 4HHAB 3OKNB 2ESVA 3TNMB 3BO8A 3V2AR 1OGAE 2BSRB 1I7UB 1D9KA 1O59A 3ARGB 4DXSA 2P42B 1BF8A 1C5DB 4M7LT 3HNVH 1RJLA 1FHGA 5DQ9A 3DVIA 2PF0A 3S97C 1PZ5A 4NNXA 2JALA 1UWIA 1KLGA 3MBXL 3ARXA 4HWBL 2R0WL 4WIQA 3IJ9A 4BQ2A 1MY7A 2XVNA 4HKJA 1TVHA 4NRXA 2H6PB 5CAYB 2YWYA 2FBOJ 3JV0A 5BQ7B 3QA3A 4QOKA 2I24N 5GS0C 1GOMA 1DVFB 2R0LL 3NFPB 3SCSA 2OCFD 2ORZA 2EDDA 4B7IA 5IP4A 1V7ML 1ULVA 4LHUD 2QQJA 1G7PA 3GNOA 4JJ5B 4HS8L 1Z2KA 2YD6A 4J1UB 5GHWH 3SCQA 5CCKH 2VCCA 3MV7B 5EUOE 4X6DF 3G6JF 4O4YL 5B3JE 4C83B 1H11A 1US3A 5MENE 5T5NF 3U9UA 4M7LH 3TO2B 5C0AE 2BC4A 3V4UH 4XVJH 4HZ7A 1T66D 4OZOA 1HIML 3L3GA 3WLWD 4OT1H 3MRNB 2W62A 4PLKD 4IDJL 1BOYA 1EH9A 4R4ND 3A67L 3KPOA 3BUTA 3MRDA 4C56A 2YHGA 4OM0L 4EKJA 3VWKB 2C4FU 2QTEA 4HUMB 4LYQA 3QG6B 1IILE 4Z7VA 1W32A 1YEIH 1U3YA 4UU9A 1WAAA 3UXFA 1K9EA 2Q7YA 1HQRB 1T2XA 1BVLA 5DJZA 4HP5A 2IADA 1MIEL 1H5BB 4UNIA 4JPIA 4NKIH 5E1AA 4QRUB 4TQEL 3V4VH 1N2RB 3IETA 1KTLB 2EYRB 5EUOA 4PTWA 1U30A 1UD6A 1C12A 2D3NA 2YPLB 4J6RH 5MENA 1UCBH 3L7FB 1WCBA 3S4SG 5C0AA 3WDJA 2ZZUT 1F97A 1I8LC 4LKXA 2DKUA 2W4XA 4CN6A 3C7HA 1YJDL 4O2CB 1AGFA 1WZ1H 5E6ZA 4LK4A 2YG0A 5TQ0H 2HRPH 4LF3A 5IEHA 3OKNA 4B15A 1MWAB 2J2ZA 4HS8H 2A6KA 3VD5A 1XPWA 4M6ML 4P4KC 3SGDH 1AI1L 1BQLL 1E6XM 2O92A 2XWDA 3CPLB 4JPIB 1KNOB 4WF7A 4D6CA 2IPUG 4WDIA 1IGCL 2OYPA 2FEDC 4LVEA 2FWOA 1UWRA 4NNXB 2WN3A 4G9DB 5ACMA 1PX3A 1SDDB 4BJLA 4BUHA 3AQUA 1KTDA 2MHAB 3PQYA 1DBML 5GRUH 2EO1A 5JPMA 1K2DB 3LEVH 1YN7A 3QQ9D 3KPSD 3GMOB 4YHPA 3ZKSD 3IJHA 4DZBA 5JR1H 3T0EA 4L4VE 1E4MM 3WH6A 3MRMA 1I3RA 3N50A 1L7RA 3CK0H 4X6CF 1XYZA 2XTKA 1UD8A 4ZO6A 3BWUC 1MCJA 4KVNH 3HMCA 4F9PA 4HH9B 2D9QB 2VOTA 4I2XB 4JRYE 4NT6B 4UZUA 3S5LB 2YL8A 5BCAA 1E27B 3UYPA 1TPXB 2EXYC 5EC2A 2Z35A 4PCSA 4YO0B 4Z78A 3WFBH 3VCLA 1BSIA 1A1MA 3UYOD 3DBXB 3TVMD 4CU7A 4PJXA 1TQCB 5CSZB 1RIHH 4FRWA 1ZS2A 1XZ0B 3P1IA 3BISA 2GSJA 3WJLA 4MLIA 4M1GH 3T0EE 1AHWC 4L4VA 2F9BT 3S3JA 2A3AA 4ONFL 1UKTA 1K3IA 2KDGA 2JIXB 4AZBA 4BYHA 4QHLB 5CEYB 2NLJA 3QCUL 4U1SA 4KKCD 3O3BA 4M3KB 5CUSH 1XH1A 1QNOA 4ODWB 1F8TH 3GMNB 2G60L 5DJAB 1BBDH 2GTZA 1P1ZA 5A2BA 4TULH 4LGPB 4ZXBD 3HNSH 4PGDB 2HLAA 2F15A 3VGDA 5C0GA 4KPHH 3RVVC 2YB7A 3KXFA 3EBAA 3SUVA 3QUMA 3VGGA 5HGDB 4C4KO 2WBWB 1MVYA 3NN8B 4M8QA 3GBLA 1RIVH 4RNRA 4X98A 5IK3B 1U9KA 1MAKA 4QNPE 1CIUA 3OB0K 5ALBH 2VRQA 3R06A 3UJIH 2PO6C 4O58L 1KCUL 3VRIA 1J5OL 3S88H 2Y6GA 1FNGA 4U1IA 4QRSB 1FGVL 4KK5D 1ITBB 4MAYC 1TVNA 1VESA 1E4WH 1KJ2L 1OARH 5DEFB 1RHFA 3FO1B 5E9DD 5FUCE 3H9SB 3OKOA 2ARJQ 4XCYA 2I9LB 2MQCA 5BOPA 4FQLL 2Z9TA 4UDTB 2W0PA 5D8WA 5LGJB 3WL1A 1UB6B 3KXFE 2QEJA 5D4QA 3RY6A 2YRLA 2F58L 4LSTL 3AMKA 3QPQD 3J7HA 1J1XH 4R9HA 3VXUE 2B9VA 4OLEA 4ARYA 5TQ0L 5KVDH 3MRIA 2IPTL 3PWLB 5DQDL 3UZVB 2MKLC 5CJQL 1Z9OA 2FEDD 2DCKA 4BK5A 2DT1A 4RE3A 4YDIH 4CADB 1EUUA 2FR4B 2XFXB 2DM3A 4G7VH 4M1DL 5CHNA 2OK0L 1II4E 4RMSA 3EFFA 1U8KB 3AHXA 1BZ7B 4NQUA 4HU8A 4KJPD 3VRLF 4HBCL 3WSQL 5CEZL 4DFIA 3BDBA 1ADQH 3HTLX 4YX2L 3P0VH 1H1NA 2B5IC 1UACL 2CSPA 4HIEA 1GC1H 3WUZA 3S9DB 3KYKH 5E8EB 3RBSA 2XQBH 2J1KA 3WS6A 2C7FA 3NCMA 3HS0B 3ULUH 1V6VA 1W3LA 4Q0XL 4K3JL 4HQQL 2IAMB 5FUZL 3SUTA 3LIZL 3OZ9L 4HUVA 5DUPH 1FLRL 3A6CH 2WB5A 3C5ZA 4PJ7A 1VFBA 1BQHA 4PSPA 5DUML 5D9PA 1UJ3C 1IGJB 1QVOB 3PF2A 4GW5A 1T4KA 4HJ0C 4AD1A 1H3WM 4NQVA 1HL8A 5I15H 4XC1H 1BZ7A 4PREB 1J88A 4WW2C 1JYXA 3UJIL 2XACC 2DLGA 4DUWA 5GGTA 1E56A 5DJ6A 2UUDK 1A6ZA 1VEMA 3L5JA 4OLUH 2AOSA 3QCTH 4WI6A 15C8L 4CDHA 3VIJA 3UTTD 1FIEA 3WFCH 4AEIH 3C7EA 4YQXL 1YN6A 4TYUA 4Q7NA 3RIKA 5H37G 2ZUVA 5I24A 2DM4A 1FVEB 3GIVA 3REWB 4R2GC 3UDWC 1J1XL 2LTQB 1A0QL 1MCNA 1ORSB 2IG2L 32C2A 3CBWA 1W9SA 2PO6A 5EPMA 6TAAA 3CX2A 1S9XB 3V6ZA 2YN3A 5C6TL 2QF8A 1NQ6A 3TO4C 3WN5A 4PTUA 1ZHLA 3BUYA 4Z2JA 2BSSB 2VIRA 3CVHH 4XNQA 4OZIF 1IEHA 3DWTA 3KHQA 3T8XA 3MRGB 4KQ4L 2GEEA 2QL1A 4HOZA 4P8UA 4Z2IA 4X4ME 3PGDA 4W6YB 1JCKA 2LS6A 4NQCB 1FGNL 3PWLA 1NH6A 1C90A 4P3CL 2AP2A 2HH0H 5SWQA 3LRGA 5HYJB 3OXRB 4YPGB 4PGCA 3BH9A 1LK3L 4XBGB 1RIUH 2IMMA 4P23C 4AENA 2B5IB 2ED7A 4F3FB 5DWUH 2NY2C 3H42L 1G1CA 4MNGA 1JNEA 4PJIB 2UWEA 4RAVA 3PIQB 1Z5LA 4OLYH 2VLKA 3BAKA 3INUH 1OPGL 3AU1A 2G5BA 4QRTB 4NRZA 3SCUA 3JWOH 1IM9D 1EOMA 4ODVH 1UG9A 3UTQB 2VAAB 4GRLD 1DBMH 5D7SH 3T8XB 2ZNXA 3HR5A 4U6YB 4X4MA 1UD5A 1MCOL 3VXOB 2XGIA 4AW7A 1E73M 5E00B 1OT2A 4I3RL 5DR5H 2QQLH 3HPLB 3KHOA 2QQQA 3QIWC 1MFEL 3ARED 4LLDA 4S1RH 3VDCA 4GKLA 3QZWA 1N5AA 4NN5C 5EOCL 2NX5D 1L7QA 3PUIA 4K07A 3IAQA 4RGND 5D70L 1UD2A 1HKJA 2Q8BH 3BPLC 4JFEA 3GO1L 5D1ZD 1CE1L 5EO1A 4LVNC 4MNGE 1YNLL 3OJDA 3P77B 4P2YA 1HJVA 2UWEE 1IEBB 4L4TA 2IGFH 2AXHA 2X4OB 4U1SB 3MMUA 1CZ1A 5TDPB 1RQ5A 1GGYA 3L2LA 3RFZC 3GMNA 1JDCA 4LCWD 5HHNB 4H88L 1JHTA 5FGBC 1RZJH 2X09A 1RIHL 1I75A 2QQNH 3EUUA 1CDJA 2DWEA 1KJMB 4QX0A 1KOAA 4YHNB 4NO2A 3ACHA 2A73B 1XGTB 4OUEA 1MCBA 1OGAB 3LMYA 1EEUA 3A67H 3LPPA 3SJVD 5I8CB 4HLJA 3RKPA 4Z2HA 4QLJA 1ZA3B 3QIBC 3TTQA 1MRFH 3MV7A 3QR2A 1UR0A 5JBFA 5MENB 3VDHA 3MOQA 3FT2A 3ARZA 1QFUH 4PJ8D 3S35H 3IXAB 1RVFH 3VXMB 4D3CL 5A8PA 1XCTB 5ESVA 3CDGB 4POZD 2JIXD 1WLHA 4L4TE 2FBJH 1BFVL 4HK3N 2FLRT 1LG2A 1JP5A 3AIUA 3FQXB 4Z95L 5MERA 5AEAA 1CZVA 3NQHA 3NCBB 2PYEE 1L0PA 5BMFH 4HIXL 2G9HB 4FQ2H 5CP3H 4JL2A 4WUUE 3BLKA 5HHOB 2P47B 2XKSA 4LU5H 4PRWA 2HRPL 1JMXA 4GAJH 1UM6H 3GSOB 5JW5A 1UJ3A 2OS7A 5E08H 1IQDC 4X0VA 2PTTB 4HV8B 4OIIL 5FK9A 1M7IA 1KTLA 2EYRA 3MV7E 5EUOB 5CEXB 4JFYB 1NDGA 3DVNB 4FZ8H 3RTQB 2XWEA 4HUUA 3QXAA 5T1LD 1H0DB 1JWSB 1QNZL 4HFUH 1HXYB 1CDIA 1UQYA 1ZJBA 4ZY9A 4RDQG 4X6FA 4F37K 4MB1A 4G6AC 1TVBA 5F6HJ 1KJ3L 1OGSA 2WABA 3BZFB 5E2WL 2PYEA 3MUHL 5GIRA 4RL3A 4PG9A 4BZ1H 4BK4A 3TIDA 4QTHA 3SBWC 5DA0B 4CKQA 4JZOB 5DK3A 1M7DA 4LSRH 1EO8L 2V2WB 4L3CA 5CJXC 5CD3B 3GSNH 4KI5F 5EU6D 4GQ9H 1ZVHA 2G3JA 1QFUL 2HJLB 4ZPTB 1MY5A 4PSRA 3T65A 1F58H 1QLRA 2YL6A 1GQLA 2MPAL 5E4EB 1GHFH 4KUZL 5TE4H 3IU3A 3RZWA 1KENH 5F6IB 2AJZB 5IB2A 1C8XA 3WD0A 4L3EE 4HG4K 4NWUL 3DRQB 5CEZE 1I9EA 1H8OA 2R2HB 2A9NL 1YEFH 2UYLA 4B53A 4L8SC 4P49A 4JLRA 5AD0B 5C0RH 4K3JH 1UZ6F 4EQ2A 1KB3A 1TTFA 3AVEA 2VRAA 4P7OA 4KJQC 2XHNA 4OIIH 3BESR 4E42A 5JHLH 5I8OH 3EZ8A 2DQCH 4KAQH 5EFIA 4LKCA 4QPWA 3F6IA 4YBLC 3WJJA 3VXUB 1DSFH 2Q8BL 2WQ8A 4XHJC 4MLSA 4D2NA 4FQ1L 4ODBD 1W2KT 2R0LH 4LLVA 3NACL 1G9NL 3VFSA 1FAKT 4UFKA 4DOHB 3ULUE 3NBNA 4QF1A 1NUGA 3GSXA 4OZIA 5DJ8A 4JRYD 1QTYT 4ISVB 3D5OF 4LMQE 4LSSL 2DLIA 4ONGL 5C08B 4CUAA 3QBTB 4XMPH 1OD8A 2G9HA 2XWBA 2HLFD 4JO1L 5DTFA 1W3HA 1S9XA 1NBVL 2FX9H 4HG4J 3NMEA 2WO1A 4H20H 1CU4L 1FJ1B 4U05A 5K9OB 1O0VA 1HH9B 1ZA6A 1TJGL 1IAIM 3V6OA 1JXJA 4PP2B 4QWWD 3GI9H 3F7VA 5K9JL 5E09A 1KXTA 5J1XA 2CLZA 4OIAA 3N12A 4HUXA 2EDFA 1VRXA 1EO8H 2V2TA 1E40A 3O4OB 4R3SB 2VDNH 4LIQE 4OZIE 5A6KA 1ONQB 2G2RB 4NCC2 3GSUA 4HC1H 1UXSA 4WHYH 5JLZB 4JO4H 4JFOA 1CE6B 4G9DA 4XPAH 2X4SB 1KIPB 4ZYKA 5F3BA 4YNYA 5BV7H 4F7CB 5F9JA 5C0FA 2VSDA 4JG1L 3WBEA 4N5ED 2NY6D 2RBLA 3KGRA 1FG2B 3UEQA 5KVMC 2IALA 1RH9A 5ALCH 2EEBA 1SM3H 2Z92A 1G9NH 3RIFF 3ZDZF 5EBMB 3R8QA 2MWCA 5I79A 3KR3L 4JFPA 5CIPH 4XMLL 4LBEB 1O7VA 3L3JB 4NM8H 1A6UH 3IDGA 3DVGA 3FMGH 3TOPA 1MCEA 5I8OL 3NIFE 4UDUA 1P7KA 3TM6A 3JXSA 2XPGB 4N0FA 2DYPD 4JN2B 4YX2H 4C56D 4EI5A 1K6AA 1K6QL 4JFUA 2QSTA 3U7WL 5L6YH 5LGHH 4LSPH 3JWNC 4RGOL 5GRYA 4O2EA 3A3HA 4FABL 5E8DH 3SDXE 2XSAA 1QI2A 1EFXB 1VADB 2NTFB 3QUYD 2DDXA 3BT2L 4ZUVA 2V38A 2GSIA 4OGYL 2MPAH 3CD4A 4PTXA 2HFEA 3IS1X 3P4NB 1T1YA 1KCLA 2Z8RA 4M03A 4JZNB 4NKOB 4YH6A 4ZXBB 3NJXA 1MFBH 1E55A 1P1ZB 3HRZA 4F58H 3H0TB 4PJHE 3SDAC 2WUHA 1A4JB 3ARTA 3LMJH 3JTTA 2E3VA 3DVGB 1F3RB 3AM8A 3B9KB 2DN7A 3CSGA 4Y1AB 2JIEA 3WQ4A 3WNOA 3SGEH 1N6QL 2XKNA 2QQKL 3W27A 4OF5A 4YBQC 4PGBB 1MJUH 5A8NA 2VLJB 5JNYA 5D1QC 1T1WB 5KZ6A 3T2NL 5AZEH 1SEBA 3NFSH 2DQFA 3JTSA 5E5MA 3I75B 4MDIA 3CFKB 1AQDA 1HOCB 3MX0A 3MRJA 4R7DA 5IMOA 5FGBA 5C6PB 4E5XA 5IB5A 4U1GC 2BVDA 3QEUB 3O41B 5FCSH 3JUZA 1S3KH 2O5XH 4PJ5B 3MRKB 4XVTH 1H5BC 3DSFH 4N1CA 2BK8A 1I9JL 3SDXF 1B90A 1MQKL 1OGAD 2P5EB 1DBKH 5DGRA 4KUCD 3KWWB 2ZXDA 5E0CA 3HR6A 4MD0B 4XP5H 3FQWB 4HLZH 5FK9B 4HJJH 4Y4KA 5GXBB 2JEQA 4ACZA 3ROLA 1GPOL 5EU3A 3TYFA 5GS1A 3WMSA 3ALWA 5MEND 3RGVB 1JD7A 4N1HB 4AZHA 3AHZA 5IJKA 3EO1A 4D8PB 5FYKH 1ZHBA 2W9LA 3TO4A 3FFCB 3WN5C 5JORB 3P73B 4CD5A 5MI0C 1ZLSH 5CP7A 1N0XH 1E6PA 3MLXL 4LOUD 1ZLWK 4XXCA 3GKWH 4PD4J 1JD9A 2PYEB 3M45A 1JRHI 4OUUA 1WT5A 5IDIA 4OGXH 2XVPA 5KSVB 4W5ZA 4WKFA 3A6OA 1KGYA 2YXMA 3ZTJH 2V2XB 5JMOA 3U7BA 3CIQA 5JXIA 2VL5B 1LO0L 5A6AA 2IF7A 5ICYA 3L4ZA 4XXCC 5J57B 3LS5L 3C6LD 4D9RE 2DJSA 2IBZX 3ORJA 1Q9WB 4M48L 1F6AB 4XC3H 3V8OA 1SVZA 3VXRA 1KXVC 3MXVL 1N6QH 1E6NA 2YIHA 4CD6A 3SCMB 3VXPA 2VH5H 5EZLA 1W0NA 4PV8A 4KJWD 4B5EA 2ADIA 3WF2A 2Y6SC 2EIDA 3MLTA 1CDBA 1Q1JH 3QEHB 4GS7B 5IKCA 4J4PA 3G04B 5C0EB 4YK4B 5LAXA 1RZIA 4WFGE 4A4AA 2ORBH 5H35B 3FO2A 1RUPH 4U7MA 3TO4B 2W9EL 1WK0A 3FXYA 4AMKL 2ITDB 4H8WC 3IFNH 4GI8A 1ZGLP 1S7VB 3TYGH 3EOBB 4JE4B 2W92A 1CQYA 5A2KH 1T22A 1QBBA 1YMMA 1G0DA 3SCMD 2E9LA 3SDYH 5A2JH 1E5JA 3GO1H 2L7JA 2EDEA 3X14A 3EYOA 5ERWB 1KQYA 2BRRL 4U1KA 4URIA 4MA8H 3VXRE 1KFAL 2X70B 3JUGA 1JGDB 3FT3B 2DM2A 1XR9B 5E8OA 2GTWA 4YDJA 1KJVA 2WBJA 3IDNA 2G3NA 1R3KA 3RL2B 2ITCA 1HIZA 1O7SA 3QUMH 1TCRA 4JM4L 7FABL 2D4FA 3GHEL 3N0PB 1UWEL 3I2CL 1DYOA 1P6FA 2R2BA 1J1OH 2XN9E 3H7LA 3WFHA 2W66A 4YGVA 3VG9B 4U0RC 4FNLL 4N9OB 2HN7A 2EPOA 2X7LB 3O45A 4KY1H 3LSOA 4HGKC 2MFNA 4R7DB 4NQDB 2P48B 3LPFA 5GGVH 5E8PB 8CGTA 4JHOA 1CD1B 1S9VB 1KJ2H 1FZMB 1OARL 1UH4A 3L3HB 2DQEL 1BYBA 1PQZB 4BXSV 3MA9H 5DD5L 3QDJA 5T1MA 5FYLL 2PQSA 2FATH 2J4WH 4RGNE 3X17A 5C7GA 2Z4FA 1BVKB 2Q3AA 5J8OA 3QHNA 5E8NB 2LTQC 1H3PH 1NCCL 4O2FB 3IJYB 3TCLA 5CEZD 5E2TH 5FHAL 2DICA 2UZIL 3UYRL 1FVCB 4WK9A 3O8XA 4F7MA 3LEIA 2C9AA 3FQUB 5CP7B 4GLRI 5KVGH 5LBSH 5HYJD 2HISA 3QO1A 2QHRL 2NY0B 2ZCLH 3RY6C 3IANA 3QRGH 4I3GA 3WFCL 3GBEA 5T3XD 4RE4A 4X8JB 1E6ZA 4MNHA 3CUHA 1AJ7H 5F96L 4X5XB 5EFFA 1A6WL 1IGTB 5BXFA 1W3JA 1CD9B 1T3FA 1EX0A 3LS4H 3G6AB 3MV8A 4WW2B 5C09E 3UCRA 2Z92B 1Q0YH 2FX8L 2WWCA 2CYGA 3CMOH 4XBPB 3FQNA 2VUOA 5ABGA 5I1EL 3Q1SH 3N1AA 3T1FB 3UEZA 5BJTB 4ZPTA 5FIEA 3L3JA 5J11C 2WYSA 3WHE0 1NQBA 2WQRA 3I3EA 4UINH 2A6IA 3OAYK 4L3EB 3GI8H 4YHLH 1VERA 3ILPB 4AT6A 3GGLA 43CAB 3V7MA 5HY9B 1A9BA 4LYPA 1FSKB 3FZUD 4UT7H 2IUZA 4CMHB 1OAXH 2AW2A 4JRXB 4DEPC 4QX3A 4NN5B 1U3HA 1GHFL 1JV5A 1XCXA 4YHZH 2DT2A 3AB0C 5DURB 1U8KA 2JJSC 3MLVH 3PGFH 1XF4B 5FDWB 3PGCB 1W1YA 4AIZA 5I1CH 1KB5B 3MV8E 4L4TB 1BM3L 1RULL 3I3DA 4JZOA 3K2UL 1KENL 4O9HH 5C71A 1WFUA 2FLBT 1CGUA 4XPHL 5F1KC 1JBJA 1LHZA 2Y64A 4B50A 4N42A 2Q86A 4EAMA 1N64L 4J8RA 4W68A 2R8SH 1HJSA 3WD1A 4XH2A 3E6HA 4M8VA 3PZIA 5J0BA 4PUDA 3KYKL 1IFHL 3PHQA 3UTTE 2DIBA 4GXPA 2JB6A 2P4AB 5LA2A 1H09A 2ZOKB 3BEVA 2QSCL 1AI1H 4KGLA 5D1XC 4IIQB 1NAKH 4LFHD 4ODUB 1TR1A 5B38B 4Z9KB 3U4EA 3I97A 4NQVB 4I77L 2V3EA 3VE0B 2ICWJ 6FABL 2HT3D 4A6YH 1BLNB 3CIVA 2ZCLL 4UQ9A 5M3WA 4H8HA 2Y23A 2AAAA 5TGBB 4UIKL 5DT7A 1EBPA 4K68A 1OP5H 5BO1H 4DGVH 1FH5L 1IC5H 2VDOH 2HP4A 4LGRB 5GJSH 1UA6L 3TC9A 1CD8A 1AVAA 1U6AH 2BVQB 1MW0A 3UBXA 4GG6F 4OFYA 3JVGA 3AXXA 1T2JA 4X6CB 1INEL 4AJ0A 2VWEC 4WEBH 2RV9A 5CJXA 4L8BB 4HX1A 4OQTH 3UTTA 5MEPA 5C0JB 1VPOH 1ZT1B 1IE5A 5KAQG 2J3SA 1JPSH 3BSHA 4M5YL 2DWDA 4Z18A 4A45A 1U8NB 2VCBA 3P9WB 4TVSa 1JNJA 4I3RH 3STBA 1YMHA 1MCFA 2J6EA 1JNHA 3FOLA 5C07A 4AEEA 3TBYA 1S5IH 3VFNA 4U2ZA 4EI6A 2J1VA 2RGLA 3ZKXB 1XD1A 4UMGA 3T3MF 4N8CH 3CQOA 3SDCC 4M81A 5T1KB 5DMGD 1D5XA 1IJ9A 3WE6A 2BSTA 2GCYB 3BZ4A 1NGZB 1L7IH 5CP3A 4QLKA 5FKYA 1W0YT 2VXVH 3RWDB 2LVCA 2ADIB 4JJ5A 3R0NA 2CKBL 2B0SH 4DK3A 1OB0A 4A3YA 1ZT4B 5HDBF 4X0KB 1CDUA 2Y7QB 4R97C 4XMLH 3BJ91 4F57L 1XF2B 3U9PH 4U5IA 4N68A 4E8DA 3BGFC 1QLFA 2ZG3A 4OFIA 3VXSD 5TH2B 2DYPA 5E1HB 1IM3B 4LPUA 5C0BA 3RWHA 5DC9B 5M5DA 2BNJA 3UZQA 3E8UL 4AD4A 1BREA 3S2CA 3WFDL 4X83A 1LK2A 4G5ZL 4HWBH 3AY4C 4PJ8B 5GRVL 3HR5B 1SY6L 2X4TA 2OYKA 4Q22A 4PR5B 3VKKA 1A0QH 3IKCB 2DJ4A 4FQ2L 4S1QL 4HPOL 4F66A 1MCHA 3HNVL 3MNWA 1QUNA 5E1AB 5JXGA 1XD0A 4OLZH 3JSSA 3AY4A 1Q4NX 4N9GB 5I76B 1UM6L 3C5SB 2W1NA 3GSQB 3QIBA 4QHKJ 2J7BA 1PGRB 4LDOB 5CWSA 2Z4QB 1IEAB 5BZWB 1ZGLM 3H3BC 2OLDA 1WC7A 2HN7B 5IM7B 1G7QA 4QGTA 2ZJSH 3NPZB 3U7YH 3GRWH 1AFVH 1MFCL 2Y6SD 3O6LL 4LNRA 1A3LH 2WKLA 3MTRA 3VGEA 5E9DA 1WFTA 4HWBA 3U0PA 2CBIA 4JDVB 5DVKA 2E7CA 2X89D 3RVXD 2BVOA 2YSSA 4C56B 2ZCKH 3TJEL 3UBXB 3QNYB 2XI9A 4P7NA 3O6AA 4XMPL 4PJFB 2KUTA 3TWCH 1BYDA 2ZUQB 2CIPA 1G6RL 4R4BB 4G6KL 3B8SA 4H88H 1VB9A 1KEML 2DQGL 4JVUA 4NHUA 1P6WA 4FS0A 4HGWA 3QIUD 5EIYB 1S7QB 2DMCA 5EZIH 2WZPD 5JQHC 2JEPA 2NW0A 6FABH 5C8JA 5CGYD 1EMTL 5CJ5A 4JM2C 3E2HC 1FFPB 5J1SC 3P0GB 4ZZ8A 3PWPA 1YECH 5IGXL 3CSPA 5E9DE 2WWKO 4DGVL 5DO8A 7TAAA 5HD8C 3OLGA 2EYTB 2F53B 4OZGA 1CLOH 5IBLD 1F11B 3FO0H 3MRPA 5BXFB 1DLHB 5E5UB 4M29A 3WKML 5J13C 4P57B 4RWHA 1KLGB 2D0GA 4MCYB 2V17L 3JV4B 3RWGA 3MJ6A 4D71A 5D9OA 2CUMA 1A4KA 4LSQL 4DEVA 2XG9A 1XIWC 4MSWB 4D94A 5GS2H 1TVDA 4W4ZA 3KPLA 4WWKA 1P4LB 3SQOL 4GAJL 1WISA 3Q6FB 4HUNB 3WF0A 5E5RB 5A3ID 4FTVD 3OXSA 4K94L 3GH5A 4OZFB 1UZ6E 4QHMB 1DANU 1LGVA 3KJ4B 2G5RA 4L0PA 2CETA 1RJYB 3B2VH 3PDDA 1ZHBB 1BEYL 2NY3B 1HYSC 5BXPA 1LK2B 5LWYL 1WWCA 1JWMB 1VEOA 1I9IH 3QJHB 2CBVA 5AUMB 1C8YA 5CJOL 5HGHA 2AV1B 2Y5TB 1PDKA 3MXWH 3BD5A 4H1LH 4FLQA 4K3EL 1NFDB 1RZJL 5D93B 5E0FA 1EEQA 4DM1A 2X4UB 5IEKA 1PPIA 2YZ8A 5HHPB 2EKJA 3U0TA 5GGRB 2AEQH 3WNMA 2IAMD 4QDRA 3UJJH 3OGVA 4KQ4H 1KC5L 4NCC1 4JKLA 5B4XA 3F5LA 1K9FA 3MLUL 1OP3H 2Y6LA 3CZKA 5F7DA 2PWEA 4UUJB 4BKLB 4IRJC 4BSVB 4XRCA 2XQYK 4CDGC 1S7WA 2NNAA 5FXCH 3MBXH 2AJXL 3I02B 4TSBH 1G9NC 5AYBA 3ZKND 1C5CH 1U3JA 2V9QA 5DI8A 4MA7L 3VI3F 2SEBA 3HFML 1RZ8B 5I75C 4N0UE 4MGSA 1ERNA 2D3LA 3AJ7A 3DLQR 4RAUA 5CUSL 5FHBH 5EJ1B 3S98A 5IXEA 1MQ8A 4TUKL 1FH8A 3ZHLA 1QACA 5B21A 1FNSH 2ZP0T 1A7NH 2DTMH 4WI7A 4KDTA 5GGVY 4DUXA 3CMJA 3MLYH 5GRJL 3HCVA 3CZUA 2BNRB 2VDRH 5CMAB 4HX1B 5MEPB 3UTTB 4C55A 5TQ2H 1MJ8H 1J8KA 1FFNB 2V7HB 3MRNA 4G6JH 4PJGA 1RJZB 4P46C 1G01A 1RZ7H 1Z9MA 3QEQE 1JK8B 3QH3A 5G04L 3NDYA 5HPCA 3O9WB 3WS6C 4OI8A 1NARA 2QBWA 3T77B 3MV7D 3U36B 4HCRH 3T2OA 3TFKD 1TJHH 3UJTH 1KIRA 2R1WB 3ZE0F 4PBXA 2Q7YB 5CYYA 1W1VA 5F9OL 1E4WL 1NDMA 3ARWA 4IOIA 2R7EB 2WKGA 3KWXA 1OAKH 3QQ3A 5ICZA 2H2PD 3DURA 1TG7A 1XGRA 1BZQK 3OAZH 2VXQL 1UZ8A 2IQ9H 3BYTA 4Z77B 4NT6A 4P8VA 1WCBB 3C6LB 2Z31C 1RIVL 3VWKC 2PCPB 1A6WH 4OQTA 1DSFL 5KN5A 1WTGT 2PWDA 3GMLB 3EOTH 1ZT4A 3RDTB 1B4JL 4XXDA 1A7QH 1WSST 4XHQA 2AJSL 3BSZL 1JPGA 3AS2A 1BGXH 1JWUB 4XWGH 3MO1B 1GU3A 3N9GH 4PJXB 4PEEA 3QJFB 3G04A 4DTGL 2P43B 3O9NA 4XX1E 3K46A 3WH5A 4JANA 3K80A 2E6PA 3MV8D 3WD4A 1EJOL 1TUXA 4MVBC 5GNYA 5I1LB 2EE9A 3ROOB 1TMCB 2BCKB 1M71B 3BE1L 4KROD 3NAAH 1RK0A 5INDB 5SV3A 2P8MB 2XRAL 1E71M 1CD0A 4AL8L 4QRQB 4ODWA 3WNLA 2ZWZA 2HAZA 4X5WB 3MJ7B 5T5NG 1K12A 3UO1H 4M7JH 4WGVB 1YEHL 1ACZA 1DDHA 5ABHA 2XZQH 1N26A 4XNUL 5BJTA 5BRZD 1A6TA 4KK6D 2XZAH 4DWSC 2HT4D 3UBXG 5GGSY 2J8FA 4W7WA 3IIIA 3RL2A 2XFRA 1FPTH 8A3HA 2OZ4L 2X1WL 3ARFB 1XH2A 4KU1A 5FUZH 4OV5B 2YD8A 5FA4B 2DCJA 3WLBB 5F9OH 5H8DA 2K7QA 4L8DA 4QXGH 4I4WB 4Y4HB 1IGJA 4KK8D 4DZ8A 1HWGB 4O2EB 1B0RA 3GHEH 3D39A 1KTKE 2H3NA 1AGCA 4D9LH 1VADA 3ARDB 4AG4L 1F90L 5TPWH 3V7AE 3WFZA 4NQCE 3BPOB 4QRSA 2ZG2A 2VLLB 4I8DA 3SQOH 4RWYL 1RHHA 3STZA 2YD7A 2FX7H 2W0KA 1RJCA 2Y72A 1TJGH 4RFOH 4PJGF 4MX7A 5T3XE 1V0NA 1PX8A 5GGQH 1CIYA 3PTQA 1R8LA 4RGNC 1LNUA 1EQPA 1N2RA 3IETB 4OCRH 4UV7H 5T1LA 4ELME 3QHOA 3BGAA 4WEUD 1BVKA 5DJ0B 4UFHA 2Z31B 1DWIM 2A2QT 2XSBA 2XTJB 4F9LC 2G60H 3H9YA 4J28A 2GTZB 2HT3C 4UAOB 5EZOH 1A9EB 4FA8A 3QDMD 4R26L 4WHCA 5GJTL 3N1MC 5HVFB 3ARDA 1TZIB 4PJIE 3VE0A 1HVQA 3IFNL 1H8SA 3BAWA 3GMPB 2C26A 5GZNC 4WLCA 2AXGB 1HQ4B 4W8BA 5AYIA 2AQ3A 4HZAA 4ZUUB 2A6KB 2ADGA 1XAUA 1LO0H 2DJUA 2J47A 3FB6A 1R3JA 4U3AA 1JI1A 3D9AL 4M8QB 1VJSA 2HMIC 4O51B 2HVJB 3U1SH 2D4DA 5TJWK 4ELMA 1B3VA 3O6MH 5T1LB 3BE1H 4HCRL 3M6DA 3MXVH 2FB4H 3ROLB 5C0DA 4HJGB 1NEZA 3C8HA 3D2UB 4NSBA 2BVEA 5DJYA 2PR4H 2DLEA 3QQ4A 2NY5C 4Y2DD 2AK1L 5I16B 5M95B 2VMDA 5IT2H 1ZEAL 1MCPL 4JKPH 4OT1L 2Z1SA 3ZT6A 3FB7B 1I1AC 3U6RB 2PYFB 3VDBA 3DMMD 1UUQA 4PJIA 4R6UA 3LEXB 2VE6B 3VWJA 5I71B 2EC8A 4ZAKB 3LRHA 1UMIA 2R29H 2WLYA 4YR6B 4QRRB 3NZ8A 4JZJA 1DQQB 4MJIB 3KJ6H 5I0ZA 2FO4A 2X05A 4EANA 1CQKA 3BP6A 4PRNB 1E15A 4W87A 1BG9A 3VWJC 3OKYA 4W4OA 3NCFB 4ELMB 4H1LA 5HVHC 2CK0L 3EMZA 1MQKH 2JB5H 2HFGL 2V7NB 2Q86B 1UT9A 1VGKB 1MH5A 2DQJL 4DWSB 2FYYA 4NZUL 2E6QA 1QLFB 2VLRA 1BQSA 4UBDD 3TT1H 4W86A 4H26A 1ZB5A 3NSMA 4O02H 1VA9A 1S5HA 1MFNA 2E6JA 4X6DB 2Y07L 3ESVF 4JPKL 1EA9C 2O26U 2E27L 4YUEL 5SX5H 3SOBL 2K1MA 1N0LA 1NFIB 3LN4B 4QX2A 2WUCL 4LPVA 1UZ1A 1IGMH 5C09D 4XPAL 3VNZA 3QDME 4PGDA 4JFQB 3CH8A 3L4VA 3DNKA 5TFSL 3SKJE 1R24B 4LLYB 4DK6A 1YNTB 1ZV5A 2GSGA 3MQIA 4PRIE 5CS7A 2J8UE 3QWRD 1CL7H 2QBXA 2Z31D 3HFMH 1X1NA 4WKAA 5D9SA 3TA3D 2HLEA 4L1HA 1A9EA 3EOAA 2HT2D 1MLCA 5HVWA 4QXWA 2DSKA 3R06B 2DSZA 3OKLB 2KZ1B 1MRFL 3CDCA 2V72A 4WU5A 1P4IH 3OXRA 2A6JB 2ARJB 4DVRH 2AXGA 4K55A 1P2CB 3C6SB 5DA4A 3LE0A 5DFVD 1NSNL 4W81A 4PG9B 1MHEA 2X40A 1KIQB 1QRND 3MU7A 2WINA 1OSPH 1K6QH 4MNGB 3S8WA 2ERJC 2PXYC 3RNKA 5I1IL 2I9TA 1T80A 2C9KA 4GINA 3AUVA 1LO5A 5IQ7H 2AKRA 1QPKA 4BH8B 4LVOB 2PCPA 4M1CC 1G84A 3CX5K 3NH7H 3D2UD 1ITXA 1CR9H 1OAQL 1YEJH 1I8IB 3VIGA 3RWDA 2Z91B 3KL0A 1PW3A 1IAOB 3LQAH 1BVNP 2XZCL 3QB7C 5JOPE 1CFSB 5DZOA 5D7IA 4B7LA 5CHNB 1PAMA 2YLAA 3QIWB 2N7AA 2PETA 2H32B 4GG6B 1FP5A 2DBJA 3CKHA 1ZGLB 1U8MB 5E70A 3L5XH 5J9PB 5JIKA 2CKNA 3F6LA 4F80A 4MOAA 1D6EB 1T0MB 3QNXB 1HSAA 1O5DT 4MA3B 4D6JA 1KUMA 3DX8B 1A4KB 2F53D 4GXVH 5INCA 2FX9L 3RJXA 3ZYZA 1OTUC 3MLSL 4H8WL 2Y9RT 5GGUB 4FQHA 2GK0B 2DWEB 2NXZC 35C8H 5EU4A 3T65B 1L7IL 1ZOXA 3MJ8B 5E2WH 3HZMB 4YEFA 3D3VD 2APFA 5IVXE 2ADJA 2VZPA 2ICEA 4M5YH 4GQRA 1CT8B 4UUJA 4PJBA 4FQXB 4G7VL 4M1DH 2OK0H 2E40A 3TTOA 1OP3K 1FZOB 4BH7A 2V9TA 4MXQD 1NAMA 4MDPA 4F8XA 3JWDH 3PL6A 3QJHA 1D7PM 1NCWL 4HXAL 4UQCA 2A1WL 2EDTA 1NMCB 3NCOA 3RILA 2PO6D 2OI9C 3MZGB 1GCYA 1KBGL 3MLRL 1D6EA 1DTUA 2XYCA 5DR5L 1U95B 5M17A 1XF5B 3E8UH 4B3KA 5B4MD 1RUKH 3QG6A 4Y4FB 3HCVB 1XRVA 3TIEA 4K9EL 3TJEH 2XWJB 1DLFH 4P0DA 1JDAA 3BP4B 2MOVA 5JW5B 3ZYIA 1JNLH 2Y36L 3X3GL 5B3NA 2DT3A 4Y16B 1EBAA 3GMMA 2J6EH 5ELIA 3TZVC 3D85A 3EJYC 1U0QA 2WZIA 4WFHD 5EPMB 5ESQA 5DTFB 1LDPH 1LF1A 2HVKA 3MLWL 4CJ0A 2SEBB 4YE4L 4V2XA 1W0WA 1S46A 5IVXF 3GH4A 3WQWA 3IF1B 4ZUUA 5IOPB 1BAFL 4X7FC 4PJ5D 1OT1A 1J11A 4CL7A 1QSEB 4H20L 5FF6A 3S6TA 3QI9D 4Q9BA 4UQ2B 4XZBA 4PF1A 5IMLA 5SWSA 5EBLA 5L88L 2D0FA 1I1RA 1CFQA 2BHZA 4OLXH 1X6NA 4YFLF 1AY1H 4XP4L 1AR2A 4HBQA 4F33A 3JV6B 2VR5A 4LLQB 4UCFA 1FDLH 4LSSH 3DARA 2J8UB 3RGVD 1V3LA 1RD6A 3BSGA 5D7IB 3UC0L 1Z0MA 1ONQA 1GVYA 3CDZB 3I2KA 4MQXC 3TO2A 4MO3M 4URTB 5A2IH 5IFPA 3QOKA 4EUPB 1KR1A 1EOKA 4NJ9L 1V3JA 4XZWA 3SGKA 2B1HH 3UTSB 1I7TB 4OJYA 3HC4H 4XAWH 1JGLL 3I2IA 2ICWA 4N0UB 4R90H 1RV6X 1RUAL 1KQZA 3KPOB 5F97E 2J7FA 4X6DE 2GFBA 2W38A 1UY2A 3D3VA 3NUKA 4P7RA 4Q97A 2F8OA 1A7OH 4LSUH 4OJFH 1LEIA 1RU9H 1DLCA 5KS9B 1GUVA 4P4RA 5GRXG 1J8HA 1YPZF 1S7SB 2CXKA 2D7OA 4KDTC 5DLML 4ZTPH 4AZGA 2Q87A 4S0TD 4DVRL 2DD8L 1KG0B 2PNDA 3GMLA 1QPPA 2H2SC 5I1HH 4LPXA 5IMMB 4GI6A 1WCGA 1PYWB 2NY7L 3HAEB 2CERA 1RZKC 1G7JA 4YDVA 4TUOB 1NCAL 5DFVC 3GM8A 4N0YL 4YGAB 1KN2H 2B7DT 4JGJA 4TTDD 1BAFH 4GZEA 2D23A 5IBTH 1GHRA 3KPMB 4P4KB 2E5EA 2A0LD 4X6DA 2EJ1A 5EMYA 3QDGA 3QPXH 5DRXA 3GGWA 5I1JH 4QXUH 4JZJC 1S7WB 2AEPH 2NNAB 3B9VA 3WH9A 3O2VH 2OL3H 1M71A 1MJJB 1U2HA 1NM9A 2XWJA 4K71C 1IC5L 1OP9A 4JHWH 3CAFA 1NCBL 3O2LA 1JFHA 1E6QM 4M43L 5F1OB 3W53A 4WJ5B 2BOCA 3D48R 1J5OH 2XIBA 4WEMB 5T3XH 2EXWD 3TNMA 4M5ZL 1I7ZB 2BNRA 5D70H 3MUZ1 2QQMA 4X9BA 5E8DL 2VRKA 3L5XL 3BC9A 4E41A 5IWLA 2ZSVA 3FT4A 5IESH 1F3JB 3VFVA 3H9SD 2CDPA 4Z2LA 4WUUD 4BSWA 5CEZH 3QDGE 5DEGA 4HG6B 1VCAA 1YHTA 2DIAA 5DRZB 5F7WC 1KIPA 2PYED 4ZYKB 1MQQA 1T83C 3ARGC 5D5MF 1TENA 4OLUL 4WTWA 5EU6E 4L4VD 1J84A 4R4BA 3RIAK 5FV1L 1R3JB 1MFDH 2IH1B 4QCIA 1FG2A 2FECI 3QZWG 3FB5A 2QQLL 4XGZB 3DTXB 5HHMB 1MI5B 5E56A 3VCLB 1OGTB 3RJDA 5DD1L 1HE7A 1A6AA 4G6FB 3T2NH 4TUJB 2X2YA 3F5WB 3JUYA 4G9FE 4GSDH 3RVUD 4X5LA 1UXWB 2AEIT 3FB7A 2QR0B 2UY2A 2R56L 4I3SH 4KZDH 5DEGB 4QYOA 1MFCH 3O6LH 5FO8A 5I1CL 1OAYL 5JBDA 3NVQA 1FV1B 1SHMA 4CVZB 1ZE3C 5JUVA 5FCUL 1ZEAH 5EU6A 5CJ8A 2OYLA 3UETA 5TF1L 2LVEA 3ULVC 4HSQA 4WU7A 1ZS8A 3F58L 4GT7A 1FLRH 2CHNA 5D1QA 4ZNEE 5KJRH 4Y2OA 1TLKA 3PWUB 4HPHA 3ZSSA 5HGDA 2WUBH 1A7PL 5BRZB 3WS3B 1HKIA 1IGYB 1LDPL 4ATWA 1MHHA 3AOFA 3QUXC 3EBVA 3SUSA 2RR3A 3GGWB 1PMHX 2JIXA 2AJSH 5HGAB 4ORGA 4J3UA 1B2WH 2IJ0C 4Z0XA 5JHDB 3O3BB 2O9PA 5JHDE 1IV8A 4OFDA 5HGGS 3SDYL 3AM8C 1T4KB 1NFIA 3LN4A 1UQSA 1D9KC 4AC1X 4R5EA 4L9DA 3FAWA 4UDTA 3DROB 4DKEH 5EN2B 3PZTA 2EPKX 1S7TA 5KW9H 5IB5B 1T1ZA 1E4IA 2BNQA 2W3JA 4GS7C 1IC4H 2E4TA 4LCWE 2A83A 1LMKA 3ULUC 1IT0A 3C8KA 2X4PA 1AXTL 3IJSB 2FHBA 3KPTA 4DEQA 3C8DA 1JXKA 4BSWB 1I3VA 4LPTA 4UFJA 2QSQA 1DUZA 3HMWL 5EFDA 1D6VL 4S0SD 3MKKA 4KRNA 4D8PA 3TH4T 5I5RA 5D6DA 4NO3A 4XP6L 4X5XA 5D8JL 5JHDA 2CDFB 5DEFA 1CFNB 2WHMA 4DWHA 1KBBA 4NFCA 1S9WA 3QFJA 1LE9B 2I25N 3H0TA 1K8DA 2Z1KA 1YUHB 4K7FA 5F9AC 1YNKL 1QVBA 5IB4B 3O3UN 4JRWA 5DS8B 3GMPA 5DHYA 3WXWH 4H25A 3LQMA 5D6DC 3WXVL 4I2XA 4PS4L 4PGJA 2RB8A 4CNIA 4W84A 2DBLL 4LCWA 4FXGA 3IJYA 3HE6B 2E7BA 1I7UA 1FFNA 2V7HA 4NN7C 1UXXX 2IAND 4U1NA 1QI3A 3MYJA 5EZLB 3ARRA 5E94A 4TVPH 2OM5A 4FLSA 1NEZB 4NQXA 4U1GB 5C0EA 3SKMB 1U3HB 4GKNB 2ICWB 3X3FL 1I9JH 5CBEA 3HE6D 3QFJE 4HIJB 2VDML 1LE9A 4JREB 3VH8G 2OSXA 2IANA 3SY0B 3MRCA 1U8LB 3OHXA 5ALCL 4WKHA 2QLYA 5E08L 4JAWA 2VUYA 1UZ8B 3ZL4L 1KYOJ 5DT1H 5EC1B 1GZPA 3WHXB 4OOZA 3OKKB 1NGYB 2PWGA 1X4ZA 3BN3B 4HKBB 1HJXA 3WNPA 4WV1B 3O2WL 2GTWB 4YDJB 2W1QA 2BFGA 4IPNB 4HF5H 5ECJE 2ZE0A 4TTDC 4M93B 5F88B 1QYGL 1TQBB 4LASH 2ZEWA 1QRKA 3HUJF 4M61A 3MOBH 4P5MB 4S1DC 2NY6B 4LCUB 4AY0A 1DFBH 2D24A 5TF1H 5F1IA 5F8RC 2R4SL 4YHKH 4GRWH 3MMWA 4HMEA 1HNGA 1MNUH 2WK2A 3VINA 4L9LB 1XCWA 3POCA 4Z8FL 4IMLB 4L8CA 4HIJA 4KKBC 4XCCL 4YZFF 5FDWA 3CMOL 5EN2A 5K9QG 2LABA 2IANE 3BIBX 4P9MH 3U79A 3ELAT 5INDA 2KH2B 5FYLE 5EG6C 3GKZA 1GJUA 1RURL 2Z8VC 3DSFL 5JTWA 3CXDL 5FIPA 1HZHH 2RJMA 1U58A 1IAMA 2UV3A 5GS2D 4TTUA 1T7WA 2EIEA 2YD2A 3DYMA 4Z0BH 3S35L 2GJ6A 5IJVA 1G0CA 4X6CA 3TIEB 1KLFA 2BOCB 3VMPA 2WO3A 5SWQB 3TFKC 4KV5F 4JFZL 5HI3D 3OAUH 3PABB 3QHFH 2V5RA 3W4RA 1V7MH 3X14B 4HC1A 4PMNA 2CRYA 1KCVL 1IAKB 2H3NB 4K9EH 1B9ZA 4F57H 4S1SH 5E5MB 3CFDA 3F58H 4DN4H 3SDAB 5IW1B 4HIHA 1B6DA 1SM3L 4MNHB 2DQCL 3KXFB 3HZKB 3C6SA 3LHPH 1BIIA 4NQSB 1OAKL 4NC1C 5HPMB 4TXEA 4Y4KC 2FECL 4MX7B 1Z32X 4L29A 5KEZA 3VI3E 5F7YC 4P46B 1E4LA 1NWUA 5CJOH 2F8XC 4LPLA 3RTQD 2FSEB 4Y4FA 3FQWA 5E94B 5L0QC 2OQJA 2FWOB 4LARL 4PJBF 5ALBL 5IHZA 5IBUB 4XP4H 3CPLA 2JDAA 3B2VL 3QEQB 4LHUB 2VAJA 2VXUL 5EDXA 5C3LD 1GNYA 4QLLA 4J3TA 1JJUA 3G5ZB 4PTMA 5I78A 5D5ME 4Y88A 1FNLA 1LLOA 2VC2L 4J2XA 1H15A 5HYJE 2OTPA 3S36X 1QFWL 3NCCB 3WF4A 3WDIA 4GAGH 3C6LC 1FP8A 3LEKA 1NC4D 1K4DA 4Y19A 3BJLA 5EU6B 4Y5YC 5I18H 3VIMA 4HUKB 1X7QA 1CGXA 3NCJH 1UZ0A 3C9NA 5DVLA 2VXSH 3N06B 3QHZL 2FJFB 1MELA 2WHLA 1PKOA 4NKDB 3KL5A 4QTHB 3BPNB 4PJAF 3WHE1 1P69B 4HH9A 5HHMD 1HSAB 4NDMB 3H3PL 1Q94A 5BS0E 2XN9B 4F33B 5C2UB 3JV6A 3SKJH 3S37H 3TBWB 5D72L 3C5SA 3DUSB 3ZYJA 3O3AB 1E27A 3G6MA 4Z7UB 4DGYH 4U1MA 2Z4QA 1F3DJ 3IVKA 1XR8B 3EMCA 2RCSL 4TUOA 3PTKA 1OBAA 3EO9L 2N56A 4RFNC 5D93C 2DEPA 1YEGH 1X5AA 4OZHA 3NFSL 2E31A 2GKIA 4I5BB 1R87A 5C0CA 2DSVA 1I1AA 2CH8A 4JO2L 4A6YA 4Z7UE 5MERB 3KPRB 4LVHC 4Y19E 1YECL 5DRXB 4AEIL 5IGXH 4NIKB 4A44A 3DUUB 2O5ZH 3FO9B 1XCQA 4P5KB 3P0YH 1CBVH 4KRMB 5I1JL 5L8JB 4XPHH 1XGPB 3EYFB 4POYA 4P59L 2E8ZA 3BQUA 4ZFOL 3KNBB 4PJHB 4MNJA 3W82A 1J0HA 4M02A 3M8OL 4ZOCA 4JHWL 5T3ZD 3L3KB 4OQ1A 4RNRB 4JO1H 3MLZL 1PYWA 3HAEA 4Y5VC 5HHVH 3ARDC 3PP4L 5KSAC 1OY3B 4OZHE 3GBNL 1VIWA 1VSCA 4ZQKB 4BQBA 1G9ML 4Q9CA 3BH9B 4LHQB 4MTVA 4WI8A 3LQAL 2WDBA 4I18A 3TN0D 1YYML 2D1ZA 4FXLA 2RAMA 1DE4A 5DHVA 3AAZA 3QWOB 3NFNB 1QFWI 1JYVA 1XCQB 4NP4H 4P5KA 3ZM8A 2IXUA 2B1AH 4HOWA 4MADA 2OQJB 1R24A 3CFJB 3L3IB 4AISA 5ITBH 3RTQC 3JZ7A 3GDBA 3BZDA 4QRUA 2YD1A 4N8VA 4UQ2A 4Y4KD 3SE4A 1MPAL 1U8IA 3O3EA 4CCDA 3BO8B 5DQJB 1U8JB 4TUFA 3IFLL 4LIQH 1V02E 4MXQC 1EUTA 5HDQH 4ELKB 2Y2WA 3SKJL 4M1CD 1N5AB 2EH8L 1ZT7A 4Z2KA 4LRIC 4JY6B 1XF2A 1T6VN 2AJYL 3VFWA 3GSUB 3BH8A 3KPSA 4FG6D 3VXNB 3PWNB 4YQXH 5DUBA 1KCSH 4AZ8A 1KEMH 2CLRB 1E0XA 2CDGA 4JCLA 5JOFA 3GNML 3APGA 3RKDD 3QO0B 2J1EA 1MFAL 4YE4H 3ALPA 3O3AA 4NBYB 2BJMH 4ZAKC 4FQQA 2IPTH 2NZ9C 2P7TA 5DQDH 1GMMA 3WJJC 4RE2A 3U7WH 3UTZB 4E41D 3HI5L 4XHJD 1YQVH 2WZEA 3X12A 2ATPA 1FYTA 3T0ED 1JGUH 3G6DH 4AD3A 4TUJA 1AXSA 1V02A 5SV4A 3BT2H 3VFMA 2YUZA 3UX9B 1UXWA 3IDYB 1OPGH 4YHIB 2QKIA 1S5IL 1ZVSB 1G0XA 4MJ4A 4P2QA 1U8HA 1RZ7L 3BEWA 1BLIA 4JFSA 2YD3A 3VX1A 2A3EA 1NCAH 2E9BA 5F8QC 2ZUWA 3HUJB 5D8ZA 1DBJL 4Y16D 5BO1L 3KPMA 3NIFF 3DETC 1A22B 4ZOEA 2KKQA 3MLYL 4HPYH 5GRJH 4L4OA 3BMWA 1DQTA 4LKCB 1UWQA 3EO9H 1HDMB 1VEPA 3UR7A 3VGBA 3AS3A 3WDQA 2HLFC 1K4CA 4HBCH 2A6DB 3GSVA 4NQEA 4HUXB 1N82A 4WCYL 1AGBA 2K3TA 2FGLA 4V1DB 2L0DA 1NC4B 1UWTA 2YFZA 3V5KA 3WFDH 2VC9A 1UXSB 4POUB 4OF8A 1ISYA 5EIIB 3U57A 5C0AD 1T89A 3BRDA 4AM0A 3GH7A 2WWKT 43C9A 2ED9A 2GHWB 4NZTL 2O93L 2BRRH 2E7LC 3PXHA 3KYMA 2GVYA 5C0FB 4RGNB 2BZDA 4PGBA 2BMKB 5T33H 4LCCA 1W72A 1DL7L 1XGTA 1U95A 4PB0L 1CLVA 4U0QB 2AEWA 2VH5L 1GOQA 4N0RA 2BVYA 4XP9L 3FOMA 1ZHKA 2TAAA 1KB9J 3EYVB 1YQVL 5ITFA 4DKDC 5F70A 1JF6A 4CNIB 1ZHNB 1M7DB 4X6BB 1KWGA 2A6DA 4NQEE 1HSBA 1M53A 5EO9B 3W81A 2V5SA 3A6BH 4XBEH 4XUYA 3DC0A 3O2DL 4EN3D 1GJIA 3K3QA 3KPRD 4HCRA 2GYSA 4OGXL 4Y16A 2PBGA 3MRRA 5FM8A 2IPKA 4NZDA 3RA7L 4AENB 2I07A 5DFTA 3PN8A 2P8PA 3PL6C 2XZAL 4X80H 4GG8A 3W9EA 4JJHA 1I3UA 5JOFB 4KKBD 4QRTA 5DFWH 2UYLB 4R2GB 1U8LA 2JCCE 3HE6C 4I3SL 4NZRH 3STLA 1FV1A 1OCWH 4XNXH 1I9RL 3E6FB 5EIVA 2YJQA 1EZVY 3F7YA 4L3AA 3SDCB 5C07D 3X12B 1R0AL 2J62A 1GOIA 1A5FH 4ZPVA 4P2RA 3VA2C 2WMHA 1IKFH 1G7HB 1QBAA 1FCCA 4UBDC 5DJXA 5HHPA 1TZ7A 1XFPA 1UM5L 1G5AA 4ET7A 5KSBB 5J13B 3BMVA 1FE8L 3I2JA 5JW4R 1MCQA 3C60D 3CFCL 4A2MA 5JPNA 4I77H 4NYLA 1CICD 4D1JA 2X4NA 2O5YL 4M56A 5F7UA 2DI8A 5LWYH 3AIQA 4S2SA 1ZU8A 3ULUD 2QQLA 1FO0B 4EN3C 4P2OC 1MXDA 4FMVA 5F1NB 3WN6A 4KKAD 3IFPB 3VXME 3OZPA 2DKMA 2XY2A 5EO1B 1BX2A 1FO0L 2F2HA 5L9DL 1EAPA 1IGML 1W99A 3THCA 4IISA 4OTXH 4WW1B 5KS9A 4M8UA 4K94H 1SJVA 3P4NA 3HI1A 3ZTNH 4WVRA 4X7SH 3OGCA 4ZNCD 4KK8C 2F19L 3OKKA 1JUFA 4P2RE 3VG9C 5SX5K 3U4BL 1DUYB 1OAZL 4KRUA 3MRQB 1FG9C 1QRNE 4M43H 4QCFA 2XZQL 3D25A 3SE8H 5A94A 4OIBA 1GAFL 3P9MB 3SCNA 3IRZA 5GGSB 5C0AB 5ACZA 5KZCD 4U1LA 4FK9A 3RZCC 2UY6A 3NH7L 3G5YA 5FYJL 4FFWC 4IBLT 3OKEA 2X4RB 4JFZH 3VXMA 1UYZA 4YDKL 3CFKA 4IDLA 3VFRB 2VL5A 5I1IH 5KS9E 2X4QB 2AGJH 5FGCE 5IEHB 4PRID 4NI3A 1RUMH 4PJDB 1FIGH 3B8YA 3NA9H 3X11A 2EZ0C 2X0HA 1S7UA 3L3HA 5DDHA 2C3VA 3HG1D 4PRHB 5EORL 3L4UA 3PZUA 3FN3A 3LKOA 1FRGL 4GRLC 4Z76A 2DMKA 1NBQA 2EQDA 4JFDE 1LO3H 5DHYB 4Y5YA 4ZSOA 4GPNA 3FQRB 4OCRL 4UV7L 1WBXA 3ARGD 4BELD 4BDVB 4Q9QL 4NO0D 1WB0A 1R0AH 5L2KD 3UNPA 1ZTXH 3DIFA 5DC4B 1D9KD 3VFVB 1P84K 1D5MA 3AREC 3LH2L 4F15C 5B38G 2F54E 5IROC 3MRPB 1BD2B 4MNKA 3VMNA 1WQVT 5A8QA 2ESVB 4FQXC 2NY5L 4PP2A 1TVBB 3HG1A 5TQ2L 1RAMA 3WIJA 1ZANH 4OZ4B 2AV7A 3BKCL 1AGDB 5FCUH 1BPVA 3TCXA 1G7HA 3OJMB 1KPRB 3WYRA 2W9XA 1PFCA 3N17A 1PG7W 4ZSOE 5IFHH 4MWFA 3IYLW 1T7VA 1N3NA 5LKNA 1QPXA 3VOCA 2BXYA 2IPUK 1MAMH 3QQ4B 2W9DL 4JHZA 5B8CA 4DGIL 2W0FB 3LCYA 3FO2B 4HIIA 2EC9T 3QWRA 2VDLL 2ZCHL 4TRPH 3UBXI 3QQ3B 5ICZB 4ETYA 3VG0L 4CD8A 3ARQA 2XKNB 3MUGB 5DJDB 5FO8B 5C8BB 1C08A 2DB8A 4L8DB 4NUGL 2Y5TA 3C5ZC 3AS1A 2FGWH 2YDRA 2RCSH 1J01A 1E6OH 4NJAH 2H2SD 3M07A 1INEH 1F4AA 2MCPL 1E4KA 4XXDB 1A3QA 3VWKD 3L95B 4PQQA 3ME0A 5CIPB 1WTLA 1HWHB 3IDXL 3KNBA 2J1SA 3DHMA 4XNYH 1Q94B 1KFWA 3K4ZA 1ISVA 4LVOC 3E1F1 4WUKL 1AD9B 3GBDA 1WWBX 1MWAL 5IVXB 1P7HL 5DJ8B 2OKXA 1QSZA 2I26N 5A2LH 1FPTL 1EEYA 2WUBL 1WIOA 5JDJA 2R9HC 1C7TA 3INUL 4RMRA 2LU3A 2GK2A 2H9GB 1BG4A 1XNTA 3BEVB 4PJAA 4NKIL 3V4VL 4FZEH 5TDPA 2XQYG 3B3IB 2KBGA 2M2DA 4KI5D 2VLJD 3UAJD 1JRHL 2G4FA 3ZKMD 1HI6A 4JKMA 3H2WA 1JL8A 5ANME 3K8LA 2Z93B 5D7IF 3S88L 2LU4A 4NWUH 1JPSL 3QQNA 2R56H 4EIGB 3TBVA 3OR7B 5JA9A 4XNQB 4W70A 1WDQA 1SYTA 2Z8SA 4X9HA 4JHAH 1OGAA 2GJ6D 3ECBA 3OWEA 1LJYA 2BBAA 5D2NE 5DT1L 5T33L 3BKCH 5HOSA 3H3KA 3OKDA 5JNYB 1R7OA 1D5MB 2W65B 4ZD3H 4XWGL 4YBQD 3MLSH 1C5BL 2VLKD 3KVQA 3QEHA 3ILQC 3N9KA 4NQTA 2QADC 5IHZB 5C0NC 2WMJA 1HILA 1RHHB 3STZB 1MLBB 2NY6C 3GIZH 3LKRB 4UT6L 5BOZG 4HOXA 1GQIA 3EZJB 5EORH 1GGUA 1ZBVA 3KPSB 1QQDB 1UY4A 2Y25A 3O6FD 2DQDH 1TPXC 1GZQA 4HZ6A 1KPRA 3QSKB 1V03A 1B30A 3VGHA 4MS8C 5HDQL 1R3LA 4HJJL 2PTVA 1IT9H 3V0WL 1CLXA 4MD5B 1FQ9C 5A16B 4WI5A 5DXWA 5DLMH 4LCYA 5D2NA 2RFXB 1MJ7H 2BP3A 4IRJA 3CXDH 1QKZH 4MYWB 4FF5A 1M7IB 3PHQB 2BNUA 2DPEA 1X9QA 4MJ6B 3D1MC 4YDKH 2XA8H 1EIBA 4PYGA 3Q6GH 1BQHB 1KV3A 4LFHG 4JG1H 4MCZA 4U1JA 5ABEA 4Q0XH 3WMBA 4ODTL 3G6DL 4JB9H 2BFVH 4JKWA 2VMCA 4C83A 1FO0A 1SJXA 4C56E 3QPXL 3QXDB 1V3IA 1A8JH 5ENWA 4LSVH 4OIFA 4JDZB 3NAAL 3LIZH 1WAAE 5M94B 1BFNA 4G7YH 3GEWB 3BDYH 2NTFA 3GK8H 1WO2A 4GIAA 3MLWH 2AK4B 3L6FB 1XIWD 1DDHB 4KFZC 1P7QD 2ICWI 4HEME 4DVBB 3SDAD 1EO7A 4RN5A 3NSNA 5A8MA 3WFEH 4H1LG 3N18A 1H0GA 4XPFL 3EYUH 1GVIA 5C92A 1TZGH 1DVFC 3T04D 1H9VA 3AMGA 1C7SA 2BY1A 3T0DA 2XG5A 1J12A 3CUGA 4L9LA 1YY8B 1LL7A 1RI8A 1RUQH 3TH3T 2X8RA 5E9DB 4KRPC 5MP6L 4ZXBC 5EZIL 5KVGL 3FQXA 3SE3C 4UFMA 5HYFA 1GGIL 4CGTA 4R0LB 3CH9A 4JFHE 4PJ7F 3HZYB 4JFFA 5BZDA 1V3KA 1FORH 2ZUMA 1T5WB 2YPLE 4PS4H 2I9TB 5CFHA 1CXEA 3SGJC 4YHML 1W9XA 1FBIH 3FY1A 1LO5B 2FHCA 1LL4A 3PQYE 3WNKA 4Z95H 2XVLA 3RWJA 4QXTA 3X13B 1D7FA 4YPGA 3N1GC 3SDDB 5FB8B 4N0CC 2ZXBA 1A3HA 3GSXB 4OZIB 4NUJB 4FFYL 5DPNA 5D4YA 1CD1A 2P45B 1IQDA 4CVWA 4GKZB 1KIUA 2VSCA 4X6EB 4KZDL 2NY4D 4M6NH 2VI0A 1I8LA 3VXUD 1HNYA 5T3ZH 1CYGA 5EU7E 4GZIA 4EDXB 4XB3A 1FN4A 5MHSE 5I2IA 2VAAA 3CC5A 3H42H 2XIIA 2HTKD 4JFFE 4B0MM 1KELH 1VACB 2E0PA 2EICA 2NR6D 4G80B 5CILL 5JIPA 2A74B 5HYEA 1KJ3H 3VW3H 2PXYB 2NY3D 1URLA 4JY4A 5I1AB 3QEGL 1P2CA 5I8EB 1QFWM 2XTJE 4K8RD 1MCDA 4RAHA 2OXHA 2XWTA 3SHSA 2P24A 1WC7B 3CLEL 5IM7A 1UMHA 1OCWL 1UA3A 5EZOL 1NBVH 1OLZA 4JFOB 2JJTA 5HHQA 1YY9D 4NKMA 1FNEA 3EIFA 4HUWB 4UAPA 2FJHB 3F7RA 2G8ZA 3LEGA 3PBGA 2B4CL 2FD6L 5FUOH 1CT8A 3W39B 2PXYD 4JO2H 4TN9A 1GQPA 4XAWL 3C9NB 2OJZH 3RPIA 3CLFL 4MXWH 3H6JA 1I1YB 1QRNB 2Z91A 2VITB 1D3CA 2VDNL 3QIBD 4JFVA 2B20A 1N7ML 1M01A 5I8CA 3QIUB 3U46A 5JW3L 3SCTA 3GSQA 4AYSA 2UY4A 4LPYA 25C8H 5JMOC 4RFEB 3ZO0A 1TCMA 4JFXA 3QUZC 3A22A 4KJQD 5JW4N 1H3VA 4QRPD 1Z3GL 1ISZA 3R1GH 4V1DA 1F5WA 1NSNH 5JO5B 3ZDYE 1QFOA 4KZEL 5GSVB 1G9MH 2NTSP 3S7GA 4YHLL 3LEVL 5D71H 3W0WD 2CKBA 2A3BA 5FKPB 4K2UH 5BROA 1E0VA 5TD4A 3SEPA 3GHBH 5HYSA 3CDFA 3MANA 1FVDB 4CUBA 3K7UA 4NFDA 4AG4A 4KMLB 4G6AD 4Q2ZB 2CR6A 4JQVA 5J12B 2YPVH 1IGIH 1BJ1J 2HKHL 4ORZC 3FTGB 3QIUA 1C12B 1VGEH 5B4NA 4PJ9C 1OB1B 4HGMA 2X5PA 1MEXH 3KG5A 2JELL 1T03H 4U6XA 2CCRA 2XY1A 3BW9B 1UVQB 1H0DA 4O2FA 3TCLB 3NCEB 1MOEA 4GMSL 2V9RA 2P8LA 4U1LB 4V1DE 3I2CH 1JTOA 5D7LA 2PW1B 1OQXA 4I18B 1ZLUH 1H3TA 2Y6HA 5DF0A 5MEOB 3HPJA 2A1WH 2BY3A 2DQFB 1AE6H 2DQUL 1U91B 1LEGA 4FXKA 4FZ8L 5IVZB 3Q5YA 3VNYA 4YC2C 3W24A 5ADPH 1BYCA 2FL5B 4DCQA 3CFJA 2V2WA 4PGCB 1GQKA 3QGVA 3SUWA 3RJYA 1NLBH 4I0PD 2X1XR 4FQLH 2NXYC 4MD0A 4P9ML 3V4PH 1ND0A 3MACL 1I1FB 4X99A 4F7PB 4EBQH 5AYUH 1KBKA 4UQEA 3ARFC 5J6HB 4Z77A 1INQA 3VGFA 1OF3A 1FNEB 4PJ7E 3OKMA 1ROWA 2C1OA 3GSNL 5F3HB 1IQWL 4Z7WF 3BZEB 3KPNA 3RDTA 1D5IH 1W0WB 2VKWA 5D7LE 1GYAA 4KJYB 3V5DB 2F5AH 1B1YA 3BVNB 1JPTL 2IQAA 3QHTC 2MSPA 4OQTL 5C0BD 4GBXB 1JWUA 2NX5E 3MCLL 3C7OA 1K9TA 2E7HA 4JFED 5FO7A 2V5TA 4Z0XB 3FCTA 1A3RH 1GGBH 5FFLA 5IFTA 3MLZH 4M7JL 2VITA 4UFIA 4EOWL 3KS0H 4GW5B 3CHDA 3IK2A 2Q8AL 4GW1A 3Q6GL 1AGDA 1A2YA 1VFUA 2AV7B 1DBAH 1CFVH 4J8RB 2P8MA 3WSQH 5F7MC 4V27A 1ND0B 4QRQA 3WCYA 1YYLL 2VR9A 4UOZA 1IM3A 2OMBA 5I19H 5LQBH 4JR9H 4NM4L 3GXFA 3II1A 1OLLA 4HWUA 3SGDI 3AIEA 2OR8A 4MVBD 4N90E 1EEYB 1R5VA 1MQRA 4G6ML 4ISVA 2EYSA 4QOKB 4WTXA 2RGSA 3OTTA 4FMKA 2NX5A 2X4TB 4XURA 3PL6B 4Y16C 4G8GA 1YPZA 5GGQL 1UYWH 5IHRA 1HKKA 2NY2B 4Z7WE 1ZXQA 4RZCA 4YDIL 3UTSD 1I8MB 2XQXA 1Q9LB 3WXWL 3KPQA 2CDEB 5BVJA 4LMQI 1MYRA 5TDNB 1S7RB 5E2VH 3UPRB 5ISZD 1OIFA 2AK4D 4JY5H 5KBNC 1AY1L 2BSSA 2VIRB 3HZVA 3BXWA 1P7QB 3MBWA 3VPLA 4PRAB 3AHVA 1XMWA 3RMEA 1TCRB 5IYYA 4PUBH 4OCXH 3NCJL 4O9HL 2F58H 3BPNC 3NYDA 2PW1A 5EOTA 4UAOC 3NRUA 3WY1A 3NGBC 3S34L 3EJJX 3MJGX 3IXTA 4L8SB 3ZJKA 2NW2A 3SGKC 1MFVA 2MHAA 3PQYB 2VC2H 5ISZB 1YPZE 1FORL 1E4XL 4EI6B 4F7CA 1CLCA 1UC6A 4Z7WA 3U0WL 5AC5A 2F8VA 2P44B 4EJ1C 3WQ6A 4P08A 4OUUB 1CK0H 1DQML 3B5GA 2ZIDA 3SKNB 5EO0A 3UP1A 1UB6A 2AV1A 2ILLA 4ODSL 4PJCF 1V3HA 5DURD 5C6TH 5C0IA 1MFAH 2FGZA 4RMQA 4J7RA 3RNQA 5DC0A 2C1PB 1RUML 4PIRF 3LQZA 1Q0XL 1UKPA 1NCTA 2CR3A 2VXTL 2EYTA 2F53A 4OZGB 4F7MB 3GTNA 3RO8A 4HKZB 3ARFA 4R0LC 3QDJD 1A7RL 5TH2A 1B4RA 3WS3A 3F2ZA 4R4FH 2Q8XA 3C09C 1A6UL 2W5FA 3U30B 3DPBA 1FL5A 3T0EC 1PLGL 4LPCA 3UMTA 1X44A 1T04B 4I9WE 2VZTA 4FQCL 3CNKA 3DX7A 4FQIL 4E4PA 2E26A 3SURA 1RYYA 3TN0C 4PLOB 3BAIA 2VDLH 4HIEB 4ALAL 3KLHD 3EO0B 2GJRA 1AKJA 2WZ8A 1KCRL 3CZFB 4JZJB 1U58B 4EK7A 4GMSH 3B5HA 1Q6DA 5ACLA 5FD0A 1EPFA 1DP0A 4JO3L 1H6YA 3FN0L 5D2NB 1KG0A 4OKVA 2LV4A 1JGDA 3FT3A 1DANT 3GRWA 3KDMB 3MRLB 3QCVH 5D5MB 3MSDA 3C5ZB 5CSBA 1NGQL 2VMFA 1G7QB 5HY9A 1ODAA 5D7JB 4GUPA 3KYOB 4IRSD 2VWEE 3TZVD 1WZKA 2E27H 5D7KD 1L0XA 2EH7H 4APQB 4YAQA 4K8RH 4Q9QH 5JOEA 2ENSA 4G6FD 3ULUF 2D3VA 2VDRL 4C59B 1T21A 2WVUA 3AS0A 3CFEB 5KSAA 4J4PC 1G6RA 1T0NA 2MQ0A 3QDHA 5JW3H 3IAGC 3HJEA 1U8PB 1PBGA 4IDJH 2O9RA 4KMTH 4PPTA 4O5LH 1AH1A 3KXFD 3HHRB 3O8XD 2Y5EA 2H8PA 3LEYH 4XCYB 5FYJE 5ABFB 1XV8A 1YZZA 1A1OA 4NZRL 4GWJA 4OZHF 1Y6NR 4KK9D 2Y24A 4BSVA 5CINL 5E99L 2XNAB 4WO4D 2IBBA 2NLJB 4XP1L 1UJ3B 4KRTA 3I6KA 5GGSA 3KYOA 1BJ8A 2P8LB 5EBWB 3TN0B 4EQ3A 3FQUA 5IB3A 1QSFE 1UR4A 3FN9A 4G8IB 4MA7H 5C9KA 7CGTA 2J7EA 1F11A 1P84J 5CSUA 2AEQL 3R0MA 4U6HA 5HXMA 3QXWA 3PZQA 4XUQA 2W91A 1FFPA 3OKEB 2NMSA 3CFEA 5KSAB 1CFVL 1UYQA 4ODXA 3H8NA 2R39A 2V2XA 5FYJH 3HLAA 4DQOL 5DSCB 4PJEF 2EDKA 3SIMA 1DBBL 2EIZB 3LY6A 4JR9L 4MSWA 4NM4H 3MRGA 3RM9A 1V0KA 2WNGA 1C16B 3CH1B 3S34H 4E0RA 3W2DH 1GIGL 2Q3ZA 3JV4A 1R7AA 2G2RA 3GUTB 1CDYA 5LXGL 1O6IA 3EMQA 2XUCA 3LPOA 4PMXA 3FB8B 3ARPA 5GS3A 4XPTL 2F19H 3VFOA 1XSIA 3F65A 4IMKC 4LCYB 5LAXB 3CZ8A 2Y06H 4XBGA 3UESA 3RVXC 2XWTB 2B31A 1UWWA 3POHA 1PKQA 1QSFA 5HGBB 1KELL 1NEZG 1F02I 4L3EA 1FE8H 5C6WH 3CU1A 3VFTB 3OXSB 1CWVA 3D87B 5ESAA 1T20B 2R4RH 1IGFL 2GDVA 1DVFA 4IHOA 1SJEB 2DQIL 1H15B 3O4LD 2QPUA 3B4NA 1NUKA 1JNNL 1FL6B 3GXIA 4WO4C 1B3YA 1GNXA 5B8CC 2G41A 2RHEA 2ZEZA 1OQOA 4RGOH 3QIWA 2R2HA 4U1KB 5I2IB 1W72L 5EJZB 1DQLL 1U8MA 2J7CA 1P7KB 3UAJC 1AGEB 2I60H 2YC1B 4D9RD 3KDMA 1MREH 5DYOB 1DN0B 4YZFE 5ICXA 5HYSG 3L2MA 3PWUA 1JNLL 1JZ4A 2ITCB 4R7NA 4LLDB 4XCFH 3HPLA 1HHKA 4O5LL 3WFHB 3C2AH 2FR4A 4IOFC 4X4ZA 4IRSB 4Q58C 3JWDL 1PKQE 4NC0B 4P2OB 1MLCB 2IQ9L 1QSFB 3BHBA 4JN1L 1R5VB 3O0RL 1BFSA 2IANB 3SY0A 1P53A 1UD4A 1S7XA 2VYRE 1MW1A 2NXZB 4K3EH 4EDWL 1YC7A 1H0IA 1LL6A 4GWIA 3ULVE 2BY2A 1FL6A 3J8F7 5GSVA 4NKOA