3K4IA

Crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
202
Chain Sequence
FEYTPIAQSVLDECEHLDTASLSDALDSLGIDGGLPGIASQVPGTRCVGIAFTVQYQPVNYIDQVPSGSVIVSSNSGRHDCTVWGDIMTHFALANGIKGTVIDGVARDIDTVINCNYPLFSRGRFMQSAKNRTQLKAVQVPLVIDGITIQPGDLMVCDGSGCVVVPQQLAAEVVLRARAVEQTERRIIEAISSGSTLEQARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title CRYSTAL STRUCTURE OF uncharacterized protein PSPTO_3204 from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 58
structure length 202
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3k4iA01
1J3LA 1NXJA 3NOJA 1Q5XA 2YJTA 1VI4A 2PCNA 3C8OA 3K4IA 2YJVA
chains in the Genus database with same CATH superfamily
2OLSA 3TLEA 4OC0A 4COBA 2EZAA 2GP4A 2YJTA 4MCRA 4C9EA 4OC5A 1VBHA 3TLYA 1JDEA 2EZCA 3EZEA 5F1YA 4TJVA 1V6CA 3S9MA 5IB9A 3FEEA 2JBKA 3ICUA 4P45A 1JDBC 2XEFA 4LQGA 5FD8A 3I6SA 3TLZA 1NXJA 3T07A 2OOTA 4MI1A 1Z8LA 4CDJA 2XEIA 2YJVA 1C3OB 2CIJA 1Y9ZA 3I74A 4JYWA 4C8UA 4P4BA 2C6GA 3EZBA 4IIYA 4TWEA 3TLGA 2C6PA 1BXRB 3SR3A 3K9TA 1DIKA 4NGTA 1EZAA 4NGMA 4J0NA 4C8FA 4C8PA 4IIXA 2X0SA 4C9AA 3D7HA 3D7DA 2OR4A 3EZAA 3KRVA 3TLBA 3S9LA 1XF1A 4CDKA 5F5XA 4OC2A 1EZBA 1CE8B 3SJEA 3EIFA 2C5QA 3C8OA 3IIBA 2AUMA 4NGRA 4P4FA 1VBGA 2HI6A 4NGQA 5F09A 3T5MA 3TLAA 4C85A 4NGNA 2EK8A 2PCNA 4P4IA 5D29A 5JVLA 2FM4A 1C30B 5K99A 4C8TA 4P44A 4INJA 1Q5XA 2D0PA 1ZL0A 1NBWA 4C8AA 4CZ1A 4EYSA 1KBLA 1KEEB 4C9UA 4P4EA 1DE4C 2B0AA 4JVOA 4OC4A 2PVWA 3T0TA 4MCPA 2C6CA 1WVMA 2EK9A 3FF3A 1ZYMA 3S9NA 3TYXA 3BI1A 4COGA 4C8CA 4C9RA 2XEJA 4MCQA 3G23A 3D7FA 4P4JA 2R82A 4OMEA 4X3RA 4C9VA 4C99A 3IWWA 3KASA 4M8DA 4YN3A 2E28A 2JBJA 4KNGE 3VTAA 4H1HA 3NOJA 4C84A 5ELYA 1VI4A 2HROA 2PVVA 2D0OA 3BXMA 4TJXA 1A9XB 3GJZA 1M6VB 4JZ0A 3K4IA 3BI0A 4MCSA 3TLGB 3FECA 5F9MA 1T36B 1CX8A 2EZBA 3SJFA 3SJGA 1J3LA 3BHXA 4W9YA 4NGPA 5JYBA 2XEGA 3T05A 1KC7A 4OC3A 1R61A 2HWGA 4CO9A 1ZRSA 5IR2A 4E94A 3RBUA 1CS0B 4NGSA 4E5SA 3U1BA 2MP0A 3SJXA 3D7GA 2AUNA 4OC1A 4C86A 3FEDA 4MJXA 3TLCA 4P4DA 2DIKA 1GGOA
chains in the Genus database with same CATH topology
1J3LA 1NXJA 3NOJA 1Q5XA 2YJTA 1VI4A 2PCNA 3C8OA 3K4IA 2YJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3L A;  1NXJ A;  3NOJ A;  1Q5X A;  2YJT A;  1VI4 A;  2PCN A;  3C8O A;  3K4I A;  2YJV A; 
#chains in the Genus database with same CATH topology
 2OLS A;  3TLE A;  4OC0 A;  4COB A;  2EZA A;  2GP4 A;  2YJT A;  4MCR A;  4C9E A;  4OC5 A;  1VBH A;  3TLY A;  1JDE A;  2EZC A;  3EZE A;  5F1Y A;  4TJV A;  1V6C A;  3S9M A;  5IB9 A;  3FEE A;  2JBK A;  3ICU A;  4P45 A;  1JDB C;  2XEF A;  4LQG A;  5FD8 A;  3I6S A;  3TLZ A;  1NXJ A;  3T07 A;  2OOT A;  4MI1 A;  1Z8L A;  4CDJ A;  2XEI A;  2YJV A;  1C3O B;  2CIJ A;  1Y9Z A;  3I74 A;  4JYW A;  4C8U A;  4P4B A;  2C6G A;  3EZB A;  4IIY A;  4TWE A;  3TLG A;  2C6P A;  1BXR B;  3SR3 A;  3K9T A;  1DIK A;  4NGT A;  1EZA A;  4NGM A;  4J0N A;  4C8F A;  4C8P A;  4IIX A;  2X0S A;  4C9A A;  3D7H A;  3D7D A;  2OR4 A;  3EZA A;  3KRV A;  3TLB A;  3S9L A;  1XF1 A;  4CDK A;  5F5X A;  4OC2 A;  1EZB A;  1CE8 B;  3SJE A;  3EIF A;  2C5Q A;  3C8O A;  3IIB A;  2AUM A;  4NGR A;  4P4F A;  1VBG A;  2HI6 A;  4NGQ A;  5F09 A;  3T5M A;  3TLA A;  4C85 A;  4NGN A;  2EK8 A;  2PCN A;  4P4I A;  5D29 A;  5JVL A;  2FM4 A;  1C30 B;  5K99 A;  4C8T A;  4P44 A;  4INJ A;  1Q5X A;  2D0P A;  1ZL0 A;  1NBW A;  4C8A A;  4CZ1 A;  4EYS A;  1KBL A;  1KEE B;  4C9U A;  4P4E A;  1DE4 C;  2B0A A;  4JVO A;  4OC4 A;  2PVW A;  3T0T A;  4MCP A;  2C6C A;  1WVM A;  2EK9 A;  3FF3 A;  1ZYM A;  3S9N A;  3TYX A;  3BI1 A;  4COG A;  4C8C A;  4C9R A;  2XEJ A;  4MCQ A;  3G23 A;  3D7F A;  4P4J A;  2R82 A;  4OME A;  4X3R A;  4C9V A;  4C99 A;  3IWW A;  3KAS A;  4M8D A;  4YN3 A;  2E28 A;  2JBJ A;  4KNG E;  3VTA A;  4H1H A;  3NOJ A;  4C84 A;  5ELY A;  1VI4 A;  2HRO A;  2PVV A;  2D0O A;  3BXM A;  4TJX A;  1A9X B;  3GJZ A;  1M6V B;  4JZ0 A;  3K4I A;  3BI0 A;  4MCS A;  3TLG B;  3FEC A;  5F9M A;  1T36 B;  1CX8 A;  2EZB A;  3SJF A;  3SJG A;  1J3L A;  3BHX A;  4W9Y A;  4NGP A;  5JYB A;  2XEG A;  3T05 A;  1KC7 A;  4OC3 A;  1R61 A;  2HWG A;  4CO9 A;  1ZRS A;  5IR2 A;  4E94 A;  3RBU A;  1CS0 B;  4NGS A;  4E5S A;  3U1B A;  2MP0 A;  3SJX A;  3D7G A;  2AUN A;  4OC1 A;  4C86 A;  3FED A;  4MJX A;  3TLC A;  4P4D A;  2DIK A;  1GGO A; 
#chains in the Genus database with same CATH homology
 1J3L A;  1NXJ A;  3NOJ A;  1Q5X A;  2YJT A;  1VI4 A;  2PCN A;  3C8O A;  3K4I A;  2YJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...