3K4IA

Crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
202
Chain Sequence
FEYTPIAQSVLDECEHLDTASLSDALDSLGIDGGLPGIASQVPGTRCVGIAFTVQYQPVNYIDQVPSGSVIVSSNSGRHDCTVWGDIMTHFALANGIKGTVIDGVARDIDTVINCNYPLFSRGRFMQSAKNRTQLKAVQVPLVIDGITIQPGDLMVCDGSGCVVVPQQLAAEVVLRARAVEQTERRIIEAISSGSTLEQARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title CRYSTAL STRUCTURE OF uncharacterized protein PSPTO_3204 from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 58
structure length 202
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03737 RraA-like Aldolase/RraA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.40 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Ribonuclease E inhibitor RraA/RraA-like 3k4iA01
1NXJA 2YJTA 1VI4A 1Q5XA 3NOJA 1J3LA 2YJVA 3K4IA 2PCNA 3C8OA
chains in the Genus database with same CATH superfamily
4C85A 3TLYA 1JDEA 5FD8A 3TLBA 3S9NA 2AUNA 4X3RA 3BI0A 2AUMA 3D7GA 2OOTA 4P4BA 1NXJA 4TJVA 2C5QA 3SJFA 3NOJA 1DE4C 2YJVA 4H1HA 1EZAA 1KBLA 4MCSA 3EZBA 3K4IA 2YJTA 5F9MA 4J0NA 4C84A 1A9XB 3FF3A 2EZCA 3S9LA 1CE8B 4JZ0A 4OC0A 5F1YA 4C8AA 4MCRA 1V6CA 3TLCA 4CDKA 3G23A 4MI1A 3EIFA 3K9TA 2JBKA 2EZBA 2R82A 1C3OB 2EK8A 1R61A 1VBHA 4MJXA 5ELYA 1Q5XA 4KNGE 4C86A 4OC2A 4LQGA 2OR4A 4P4JA 1CX8A 3IIBA 1NBWA 4INJA 3BI1A 4NGNA 4C8UA 3VTAA 4MCPA 3TYXA 1C30B 5JVLA 4NGMA 5F5XA 5IR2A 3IWWA 4IIXA 3SJXA 5K99A 2X0SA 4COBA 2C6PA 4W9YA 4C8TA 3KASA 4C9VA 1T36B 2EZAA 4OMEA 1ZL0A 3TLGB 1GGOA 3D7DA 1KC7A 2XEGA 4NGPA 3TLEA 4P44A 4JYWA 3D7FA 4OC1A 4C9RA 4NGRA 4IIYA 3C8OA 1ZYMA 4OC3A 2XEIA 3T05A 4C99A 2DIKA 3ICUA 1VBGA 4P45A 2XEFA 1XF1A 4E94A 5IB9A 2FM4A 2XEJA 3D7HA 4COGA 3TLGA 3EZAA 1ZRSA 3FEEA 1WVMA 2D0OA 2PVWA 3U1BA 4OC4A 4P4FA 3S9MA 2PCNA 4C9AA 2HWGA 2JBJA 3FEDA 2HROA 4P4IA 4NGTA 4CDJA 4EYSA 5F09A 2OLSA 1EZBA 3T0TA 2C6CA 4CZ1A 1M6VB 4YN3A 1VI4A 4P4DA 1KEEB 4OC5A 3TLZA 4C8FA 2B0AA 3FECA 4C9UA 4P4EA 4TJXA 3SJGA 1J3LA 1JDBC 4JVOA 1Z8LA 4E5SA 4M8DA 1DIKA 4TWEA 1BXRB 2PVVA 4C8CA 4CO9A 3I6SA 2D0PA 4MCQA 3BXMA 4C9EA 3BHXA 4NGSA 1CS0B 4NGQA 3SR3A 1Y9ZA 2E28A 2HI6A 2EK9A 2C6GA 3RBUA 2MP0A 2CIJA 5D29A 3SJEA 3GJZA 3TLAA 5JYBA 3KRVA 3T5MA 3EZEA 4C8PA 2GP4A 3I74A 3T07A
chains in the Genus database with same CATH topology
1NXJA 2YJTA 1VI4A 1Q5XA 3NOJA 1J3LA 2YJVA 3K4IA 2PCNA 3C8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXJ A;  2YJT A;  1VI4 A;  1Q5X A;  3NOJ A;  1J3L A;  2YJV A;  3K4I A;  2PCN A;  3C8O A; 
#chains in the Genus database with same CATH topology
 4C85 A;  3TLY A;  1JDE A;  5FD8 A;  3TLB A;  3S9N A;  2AUN A;  4X3R A;  3BI0 A;  2AUM A;  3D7G A;  2OOT A;  4P4B A;  1NXJ A;  4TJV A;  2C5Q A;  3SJF A;  3NOJ A;  1DE4 C;  2YJV A;  4H1H A;  1EZA A;  1KBL A;  4MCS A;  3EZB A;  3K4I A;  2YJT A;  5F9M A;  4J0N A;  4C84 A;  1A9X B;  3FF3 A;  2EZC A;  3S9L A;  1CE8 B;  4JZ0 A;  4OC0 A;  5F1Y A;  4C8A A;  4MCR A;  1V6C A;  3TLC A;  4CDK A;  3G23 A;  4MI1 A;  3EIF A;  3K9T A;  2JBK A;  2EZB A;  2R82 A;  1C3O B;  2EK8 A;  1R61 A;  1VBH A;  4MJX A;  5ELY A;  1Q5X A;  4KNG E;  4C86 A;  4OC2 A;  4LQG A;  2OR4 A;  4P4J A;  1CX8 A;  3IIB A;  1NBW A;  4INJ A;  3BI1 A;  4NGN A;  4C8U A;  3VTA A;  4MCP A;  3TYX A;  1C30 B;  5JVL A;  4NGM A;  5F5X A;  5IR2 A;  3IWW A;  4IIX A;  3SJX A;  5K99 A;  2X0S A;  4COB A;  2C6P A;  4W9Y A;  4C8T A;  3KAS A;  4C9V A;  1T36 B;  2EZA A;  4OME A;  1ZL0 A;  3TLG B;  1GGO A;  3D7D A;  1KC7 A;  2XEG A;  4NGP A;  3TLE A;  4P44 A;  4JYW A;  3D7F A;  4OC1 A;  4C9R A;  4NGR A;  4IIY A;  3C8O A;  1ZYM A;  4OC3 A;  2XEI A;  3T05 A;  4C99 A;  2DIK A;  3ICU A;  1VBG A;  4P45 A;  2XEF A;  1XF1 A;  4E94 A;  5IB9 A;  2FM4 A;  2XEJ A;  3D7H A;  4COG A;  3TLG A;  3EZA A;  1ZRS A;  3FEE A;  1WVM A;  2D0O A;  2PVW A;  3U1B A;  4OC4 A;  4P4F A;  3S9M A;  2PCN A;  4C9A A;  2HWG A;  2JBJ A;  3FED A;  2HRO A;  4P4I A;  4NGT A;  4CDJ A;  4EYS A;  5F09 A;  2OLS A;  1EZB A;  3T0T A;  2C6C A;  4CZ1 A;  1M6V B;  4YN3 A;  1VI4 A;  4P4D A;  1KEE B;  4OC5 A;  3TLZ A;  4C8F A;  2B0A A;  3FEC A;  4C9U A;  4P4E A;  4TJX A;  3SJG A;  1J3L A;  1JDB C;  4JVO A;  1Z8L A;  4E5S A;  4M8D A;  1DIK A;  4TWE A;  1BXR B;  2PVV A;  4C8C A;  4CO9 A;  3I6S A;  2D0P A;  4MCQ A;  3BXM A;  4C9E A;  3BHX A;  4NGS A;  1CS0 B;  4NGQ A;  3SR3 A;  1Y9Z A;  2E28 A;  2HI6 A;  2EK9 A;  2C6G A;  3RBU A;  2MP0 A;  2CIJ A;  5D29 A;  3SJE A;  3GJZ A;  3TLA A;  5JYB A;  3KRV A;  3T5M A;  3EZE A;  4C8P A;  2GP4 A;  3I74 A;  3T07 A; 
#chains in the Genus database with same CATH homology
 1NXJ A;  2YJT A;  1VI4 A;  1Q5X A;  3NOJ A;  1J3L A;  2YJV A;  3K4I A;  2PCN A;  3C8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...