3K5PA

Crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
405
structure length
400
Chain Sequence
SRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALDKADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGYGNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSKLITEAKLRKMKKGAFLINNARGSDVDLEALAKVLQEGHLAGAAIDVFPVEPASNGERFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFPQVQLPPRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEASDAVLQEIREIPGTIRARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of amino acid-binding ACT: D-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Oxidoreductase
molecule keywords D-3-phosphoglycerate dehydrogenase
total genus 139
structure length 400
sequence length 405
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k5pA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA01
1MG0A 3EUWA 3QW2A 1MX3A 1BTOA 3IS3A 3NRCA 4LMPA 5C7OO 2H9IA 1BG6A 1EDZA 4RPJA 3ZWNA 3WOHA 4YR9A 1E3WB 4EUEA 4MP8A 3AI1A 4II3A 2Y66A 1R4MA 3IUSA 1KETA 2NTJA 3BMQB 2DC1A 3JQCA 1CDOA 4WCFB 4O1MA 2VHXA 5KVQA 3FI9A 1G0OA 1HYEA 1PJQA 2C7GA 3CEAA 4YAGA 1MC4A 2Y93A 3L9XA 1V3UA 3DZGA 3O4RA 3MEQA 5U9CA 2VT2A 3AAWB 4OXKA 4NZ9A 5TS3A 4OQYA 2JFFA 2HMVA 4F6CA 2G17A 1NVGA 4JJIA 1VJ1A 1GQQA 4NK4A 4R51A 3PJGA 4S1VA 2Q50A 5IZCA 1XR3A 3HDJA 4PLWA 4HNHA 2W4QA 3JD0A 1UUFA 4CQMB 3RVDA 4BNZA 3DHEA 4IQGA 3WJAA 4YVFA 5TLSA 1LRJA 5L4LA 4GBJA 1KY4A 2QIOA 4WEOA 3E03A 5JY1A 3W8DA 3P5SA 2P91A 1YQDA 4L4SA 2YUTA 5HA5A 1PJTA 2ZJ1A 5AXAA 1YO6A 2HRZA 1A4IA 1JU9A 4RCVA 2BLLA 4GL4A 3L6DA 3LT4A 4LSWA 5KJCA 3V1UA 1T2DA 1V6AA 2GSDA 4DPKA 4ESOA 3TUJC 1U3WA 3NT4A 1GEGA 2B4RO 1N1EA 4QTZA 3WWZA 4JK3A 2GN8A 4B4WA 5L7YA 2Q2VA 4OM8A 3H5AA 4FFLA 5TGDA 5CEJA 2XAAA 1ID1A 4B7UA 3N0VA 4U0JA 3FCOA 1BVUA 5I9MA 1K5HA 3ANLA 5A04A 2X8LA 3Q11A 3UW1A 3QSGA 3E8XA 1ZK3A 2F1KA 4PGFA 5KKAA 4IS2A 1HE3A 3WGTA 1SZJG 1LJ8A 1WZIA 1KYQA 2YHIB 2DT5A 4DUPA 5C7LO 2P4QA 3I9LA 2EIHA 2B83A 4BO1A 1BMDA 4E0BA 3DOJA 5L7WA 2I3AA 2W8ZA 1DLIA 1Q2XA 5BNFA 4IINA 1T25A 4IMPA 3STHA 5JY6A 3TZQA 3JSAA 5H83A 1CQIA 3OQ1A 3ENKA 2C20A 1EUCA 3ENQA 5HS4A 1QR6A 1WAMA 3IAHA 4OKNA 5CEEA 1ZXLA 1UZMA 4BB6A 3QWFA 4P4LA 2JCXA 1A4UA 2PZMA 2BFMA 3JD3A 1GL3A 4TRJA 4BV9A 4B3JA 1HDXA 1VM6A 3HHPA 5B37A 5KJ1A 4NBRA 3VDQA 4D0RA 2DBRA 1IPFA 4ND2A 4BO4A 1O0SA 3LK7A 1QYVA 4HKTA 3UCFA 4KTVE 4YTEA 2PD4A 1YOVB 3ENVA 5IDQA 4LMRA 1XHLA 4TQGA 4Y6PA 4CM8A 2IEBA 2X9VA 4ZQBA 1RM5A 1BXGB 4F46A 4Z6KA 3INTA 3ITKA 4J4TA 1VSUA 1BWSA 5EMHA 3PWKA 4RLSA 3AU9A 2GASA 3WLEA 4XGIA 3TPCA 5CDGA 3QJ5A 4NQZA 4Z9XA 4XJSA 4CLRA 4UUOA 1O9BA 4FC6A 3UAGA 4PLYA 1Y8QB 1EVJA 1Q7CA 3LLVA 5KJEA 2ZATA 3Q2KA 3L0DA 4J3FA 1IZ0A 4KUGA 3P96A 4IPTA 4NG5A 4FGWA 4WK6A 3ZNPA 2GF2A 3FPLA 2E82A 5G2OA 3WDSA 5FFFA 1B7GO 1BRMA 3QWAA 4TRRA 3RWBA 3PZBA 4GGOA 4UEOA 3K9QO 2C0CA 3NDIA 4GX5A 3CEDA 4NHEA 1VL0A 3KYDA 3AOEA 4CM7A 4CM4B 5CG2A 4R9RA 4L73A 3NKLA 5THQA 3GUYA 1PJ4A 4A7PA 1E0DA 1QYDA 4MVJA 3GVXA 3U4HA 1V9LA 5A9SB 2X0IA 1D4FA 3WIDA 1QYXA 4M49A 3PIDA 2YFHA 1F06A 1R0LA 1NR1A 4XIYA 4GGPA 5L3ZA 3RKUA 5K6AC 4E2XA 1NVTA 4N5LA 2CUKA 2I99A 2PR2A 3AOEC 4TZTA 4CLEA 1Y7TA 4B4VA 1O95A 3OFGA 2I9SA 2RBEA 4LVUA 2DUUA 3BHJA 2V6GA 4BNIA 1UP7A 1EE9A 4LVCA 3HADA 1GZ4A 4NJOA 2GRAA 4HFRA 3COSA 1J6UA 3PYMA 1E92A 4JN6B 1BGVA 4A73A 1NAHA 4MIOA 3WYCA 3N58A 4FIZA 4DWVA 2RQKA 4XDYA 3WSVA 2OXIA 1QYCA 2BFPA 4PZDA 1F14A 5F21A 4EITA 1ZSNA 2B4QA 1PGPA 4RORA 4Z3DA 1YL7A 2FSVA 5DCWA 4Q3DA 1FK8A 4GQAA 4RVFA 1I33A 3AUUA 2VYND 4MVJE 1FF9A 1X1EA 3GEGA 3DBHA 1R15A 2A35A 2PGDA 1U8XX 3ETEA 4R1TA 1K89A 4U0KA 4I9UA 1DRWA 1JQBA 1HLPA 4PLGA 3GGPA 2GR9A 2P2SA 3I23A 5IS2A 1NQ5A 1S6YA 1A7AA 5BSEA 5CHEA 3GRKA 5HBRA 1OAAA 1DB3A 2WD7A 2IZ1A 3ZI0A 4E5MA 1U3UA 3S1TA 1QSGA 1W73A 5LC1A 4J4HA 3EW7A 1ENPA 1E3WA 3L77A 9LDTA 3K92A 5EINA 5FIIA 3AI2A 5G0SA 1HSZA 5MDHA 3VH2A 2SCUA 1OFGA 4QO7A 2X86A 1KEWA 4R68A 2PKRA 5JAMA 1T2EA 2ZTLA 1DFHA 3KSUA 1F8FA 3GRPA 3IIEA 4M87A 3RUFA 2CDQA 4OIMA 2YJZA 4NMLA 1Y9AA 2IXAA 5BNTA 1JN0A 5F1OA 4RPHA 2DKNA 1VKNA 2HLPA 1GV1A 3HDHA 4XZ3A 4WKGA 2Q1WA 4MDHA 2NU7A 3KETA 1E7YA 1MG5A 3AFMA 3KSDO 1PIWA 2VWHA 2X0JA 3E5MA 5JAZA 1GTMA 1VLLA 3LOUA 2YDXA 5T8KA 1UXGA 1PL7A 1NR7A 3MOIA 1EVZA 3ZV4A 4J0EA 3OJEA 2O48X 3BTOA 1P31A 1YBVA 3K73O 3INRA 1GPDG 1T2AA 4CR8A 1H9AA 2B37A 2GZ3A 2Q49A 4XKJA 2WWRA 4TRMA 4BO6A 1DIRA 2VHWA 3O9ZA 4BNLA 1LLUA 1DPGA 3I83A 1SO8A 3U7JA 3W4IA 2F1FA 2EEZA 4LSMA 3H5NA 1U7TA 2J3IA 3EYWA 1VJ0A 1H94A 4FFPA 3QWHA 4E5KA 5KOIA 3LC2O 4J6FA 3LC7O 3CZMA 4QT0A 2PH3A 3Q0EA 1B16A 2O4CA 3OJLA 5J23A 1TB4A 2YW9A 4KOAA 1IPEA 3AB4B 3ASVA 4EUHA 4YDRA 4DQVA 1N1GA 3DAGA 4MINA 4GI2A 3AB2B 1H5QA 3DMYA 5KTKA 2EP5A 2DFVA 4WLEA 1KVTA 1DO8A 4WGGA 3UICA 2GDZA 4UUMA 1GZ3A 1XGKA 4F3YA 3ULKA 3V2HA 3PVZA 4W4TA 4E13A 1LLCA 2B4TO 3SEFA 3JQ7B 4FFNA 4EJ0A 1J49A 2QZZA 2NLOA 3GFGA 3OIDA 4DVJA 4NJMA 2D8AA 2BGMA 3GVPA 5CAEA 2QRJA 3JQ9C 1J4AA 2GERA 1U8FO 2D5AA 1H6AA 3FSRA 4OGWA 4D3DA 1A9ZA 4A0SA 3DZBA 1PR3A 1J5PA 3K31A 3QVXA 2FOIA 3GUCA 4GX0A 2JJYA 2GLXA 4AJEA 3KTDA 5GMOA 4BNGA 2GCGA 4RPKA 4PFJA 2DBZA 3DBLB 1QLJA 3OEYA 4OYRA 5IFLA 1S7CA 3DHNA 5ICSA 4GO7X 1EE2A 5A05A 3WX0A 2HK9A 3VZRA 3M1LA 1R6DA 3S2IA 4I5FA 3TN7A 4AJNA 3W6ZA 2O3UA 4OOEA 4CMEA 4KDFA 4BKOA 3DZKA 2A9FA 3RUDA 3WGGA 2J3KA 1M6HA 4U5QA 1WXDA 1KVQA 1WDMA 2X1HA 2UVDA 3AUAA 4JNKA 3ZWAA 5KNLA 4JIGA 3WXBA 4INAA 3U4IA 5B4UA 3Q1LA 3VTFA 1X0VA 4BQRA 1DJQA 2X0NA 1HRDA 4NBVA 1PQWA 4CM8B 3DEYX 2JAHA 1WMAA 1KVUA 1N7HA 4RQUA 2ZTMA 5TNXA 3LF1A 1Q1NA 1PWZA 3RC9A 3E82A 4DYVA 1GYRA 2LDBA 3AW9A 2Q45A 2O3QA 2NQTA 1L1FA 2D0IA 3DZFA 3T4EA 1U2DA 1Y8QA 2AQ8A 1U3VA 2XPCA 1EVYA 2O3SA 3M6IA 2ZTVA 1PJ3A 3CH6A 2X6TA 5COAA 3A1NA 1MFZA 1AN9A 2V6BA 3EVNA 4BNNA 1JW9B 5A1TA 4W9NA 3ZU5A 1TA4A 4J7XA 5A03A 2VNSA 7ADHA 3KUXA 4DXHA 3O8QB 3QIVA 3TNLA 4CMCA 2D59A 1TT7A 1Y5RA 3GGOA 3WQRA 4MKRA 4EJ6A 3RJ9A 4FR5A 2WE8A 3ANNA 1EFLA 1V3TA 1WP4A 3KYDB 5DBIA 2ZCUA 4OH1A 2PK3A 3GZNA 2BH9A 2VYVA 1JWAB 3PI7A 1Z7EA 4W9NC 5DDIP 1W4ZA 3JQGB 4ZRNA 3O26A 1DXYA 1SB8A 5L51A 3G17A 1ARZA 1CIVA 3VPSA 4E6PA 2EWMA 3IL2A 3C24A 2EGHA 5ITWA 3I6QA 2NUAA 1C1DA 2AHRA 4R01A 3RC1A 3GC6A 2X9NA 2PNFA 2HJSA 2AE1A 2PZLA 4DTIA 1MXFA 1GDHA 1Q7BA 5DCUA 5BSGA 1Y81A 3CTMA 4D3SA 1HYGA 1RM3A 4J1TA 2YV1A 3GVIA 3PFWO 1D7OA 2POQX 3S1LA 3MJSA 2A92A 4MKZA 4AJ1A 1ULUA 4BKUA 1NHWA 4IDBA 4KQWA 3Q9NA 2IZ0A 1NP3A 1E3LA 4B8ZA 4E4YA 4GLOA 1T2CA 4OOFA 3N74A 2ILTA 2DT9A 2IXBA 4BNTA 5JCJD 3PRJA 2DQ4A 3TZ6A 2VTDA 3OICA 3H6KA 3JYNA 2I65A 4IQ8A 4HY3A 3RFXA 3X2EA 4AJ4A 4RZIA 3V2GA 5K0ZA 3GN2A 3D7LA 4UVIA 4YT8A 3H9UA 1T26A 2VUTA 1V35A 1M2WA 4MVJP 4N5NA 5EJ2A 2B5VA 1HDGO 2BFAA 3HNPA 5JO0A 2EGGA 1I01A 1HKUA 2TMDA 1GUFA 4EYEA 3FN4A 1Y8RA 3OQ6A 2O2SA 3OIGA 2O3JA 4CM3A 4LISA 3AY7A 3A28A 4BNXA 5JPIA 2HCTA 4KQXA 5ILOA 2V7PA 4YB8A 4A10A 2HMTA 4HFJA 2VRCD 4D41A 1YL6A 2DPGA 3A06A 1OZAA 3R3JA 1Z74A 4JJGA 3WNVA 4GAEA 3UH1A 4ALKA 1M6WA 1R0SA 4BNWA 1UDCA 4BMNA 5JDIA 3EAGA 3H3JA 3U3XA 1P1RA 4YAKA 3GDFA 4CQMD 1RKXA 3CUKA 3GDGA 1GYPA 4J2OA 4N54A 3JQ8B 3KWMA 1X1TA 4EEZA 1JAYA 1LDYA 5F1KA 5JFOA 5IZ4A 1ML3A 2P9GA 3JQBC 1Y8RB 4YJDA 4ZU3A 3DBRB 4AICA 3AFNA 5KVSA 4CV1A 5JJBA 1FMCA 2WEKA 3IXQA 1P77A 2DTXA 4FBGA 4C7KA 1DC4A 3W7BA 4CV0A 5T64A 1EFKA 3LT1A 4MOWA 5HRUA 3DC2A 1EK5A 1LLDA 1N8KA 1QG6A 4GX1A 5G4KA 1IZ9A 4YBZA 2GN4A 3JD2A 3LYLA 3ZCXA 3RKRA 3HDQA 5T57A 1E7QA 1UH5A 4QFDA 3VH1A 4FN4A 3MTJA 4GMKA 3HN7A 4K9DA 1BXZA 3OF2A 1F0YA 4KWIA 2DVMA 2GNAA 4OL9A 4RVSA 1WNTA 4DREA 4E33A 2P68A 3DWFA 5JC1A 3RUCA 3AM5A 1DIGA 1E5LA 4J90A 2NM0A 3K2BA 3PJFA 4A2CA 3ICPA 3F6YA 1SMKA 2UV8A 4LK3A 3WS7A 4WCDA 1NQAO 3GG2A 1ZUD1 1TEHA 4GPD1 4J9VA 2CDCA 1LK7A 4DIOA 2EKPA 3F1LA 5F3RA 1GD1O 1GZ6A 2EF1A 3UHAA 3BMCB 4WUVA 2JFGA 4O63O 3C85A 5L95A 1M66A 3CMMA 3QWBA 2CF6A 1ENYA 3D4PA 3OM9A 4LRTB 3TFQA 3UW3A 3WJ7A 4HWKA 2VHYA 4MPDA 2PKQO 2X58A 4G5HA 3ZHXA 1KEUA 1LSJA 1CWUA 1CYDA 1PZHA 3B70A 1KY5A 4NJMB 2AEFA 4GX2A 3NGLA 5KVCA 1LDMA 2O4UX 1V8BA 1PQUA 5I7FA 3QVSA 4I5DA 1B2LA 1EQUA 3GT0A 4J1QA 2PGLA 3I4FA 3OFFA 2G1UA 3CKYA 2FSSA 2P4HX 5G4LA 1KIFA 2B69A 2VUSA 1ZK4A 5A9SA 4Q3CA 1BHSA 4ALLA 4BNFA 2FHSA 1P45A 2J5QA 3PP8A 3ZHZA 4YJGB 1KERA 4WLOA 4DIBA 1EUZA 3NYWA 4CV2A 1HLDA 5CDYA 3BTUA 1XU9A 3VPGA 4XA8A 1RM0A 1HYHA 2Q4EA 4ILKA 1DC3A 4N18A 4D43A 4S3MA 4BNYA 3V2UA 5EESA 3KEQA 4EI2A 5F5LA 1E3IA 4DQXA 3BTSA 4PLTA 1AE1A 1ZMTA 5G0UA 2YZ7A 1H2HA 1LK5A 2Y67A 3OJ0A 3PQEA 2NVWA 4R41A 2CFCA 3W4KA 4QSMA 1ZJZA 2ZB4A 1X15A 2DM6A 2DTDA 3F5SA 3UUWA 1UJ4A 2Y99A 4NU5A 4GWKA 3RC2A 4P22A 4TMFA 5KWEA 2RIRA 5ES3A 3Q2IA 3PHJA 4OJNA 1DIBA 1E7RA 3BMQA 1NWHA 4BV8A 4EDFA 4IJVA 3PQDA 3TF5A 3LZ6A 1AHIA 3B6ZA 3TUZC 1WMBA 4OO3A 5AYVA 1YB4A 3FR7A 3RJ5A 3M2TA 5I9LA 4UVDA 2PD3A 1WW8A 4HUJA 3HFSA 4XR4A 2VRCA 3D4NA 4K6FA 3UVEA 4G81A 1IYZA 4WOJA 3H4VA 1JLLA 3GGGA 3PJDA 4E5YA 4X84A 3TSCA 3H65A 2ZKLA 5JMWA 4UVEA 4FQ8A 4CQMA 4CV3A 3A4VA 1PTJA 1IOLA 1MB4A 2NU6A 1HEUA 1LDBA 3KSZO 1O5IA 2OP0A 3HG7A 3IP1A 5A5FA 1UAYA 2CNBA 2EKQA 4R54A 1EK6A 1DIAA 1RWUA 1NPTO 4PG6A 3UKOA 1HE5A 3GK3A 4FD3A 1SC6A 4UEKA 1SOVA 2RE1A 4NBWA 1YGYA 1PS8A 4KP7A 3ZWOA 3RU9A 2HQ1A 1MC5A 4AFNA 3E6AA 2AQIA 4ID9A 1EVIA 5JYEA 2C82A 4OSOA 5DNAA 5EL0A 4XB1A 3A9WA 2R6JA 2VZ0A 1ADCA 3ASUA 1I2CA 4N5MA 2J0XA 3D5TA 4EUFA 3BIOA 1IUKA 2GN6A 1E7WA 2VWPA 4DMLA 3RASA 4CJXA 3AY3A 1BDMA 1KBZA 2C7VA 4J7UA 2Y1FA 4BKPA 2DLDA 3RROA 2Y1EA 2FPPA 4W6ZA 5C37A 1C3VA 1ISMA 2X23A 4DBZA 4OXNA 2DFDA 3S2EA 1NXQA 3TOZA 3WFIA 1YB1A 3AU8A 3KXDA 4WECA 4O0LA 3ZH2A 3KBOA 5CPBA 5DP1A 2W2KA 1NFRA 2G0TA 3BMNA 3IP3A 3V1YA 2ZYAA 2ZTUA 3GQVA 3PJEA 2PGJA 3RBVA 5I8WA 4Q3NA 5LDHA 3D5QA 3FF4A 2DBQA 4RGBA 1I3MA 3VAZA 4TKMA 2EHDA 3LDHA 2OBNA 4DC0A 2OUIA 3PTZA 2WMDA 2EG9A 4WCFC 2Q4BA 3RBZA 3VPXA 4IBOA 1XIVA 4LGVA 2Q46A 2YHIA 1PJBA 1UDBA 3AM4A 3GG9A 4AG3A 2EKLA 2F8MA 3OMLA 1HDRA 4XYEA 4CQLB 1GADO 3W6UA 4XEHA 1NM5A 3AK4A 2DAPA 3JQ8A 3VC7A 3KEOA 3MCVA 4YAEA 4Q3AA 4BO5A 1ZK1A 1U8SA 2A4KA 2PLAA 1P44A 1PS9A 3FPCA 1VC2A 2IZZA 3NTQA 3OIFA 5BSFA 2FZWA 2NSDA 4K6CA 1Y1PA 1SEPA 1DFGA 4OSPA 1UAGA 3S8MA 3UXYA 5JDIC 3K8ZA 2RCYA 1YDEA 3JTMA 1UXJA 5JC8A 5KCZA 3DTTA 2C29D 4BNMA 3RI3A 1NX6A 1P0CA 4CLRB 1HTBA 1PJSA 2YV3A 3AUSA 3OECA 1IHXA 2Q1SA 4IQ0A 3GY0A 3ZWPA 1CERA 2DPHA 4Y6SA 4IDFA 4PZEA 5GZ6A 3ZDFA 5B12A 4D46A 5GZ1A 1QMGA 2CVQA 1KC3A 4E2WA 3RUAA 1DSSG 5FWNA 4H16A 5HTOA 1CJCA 4TROA 3RFTA 3DFZA 1LU9A 4R1SA 1U2GA 1F12A 3DMTC 1Y5MA 1VJTA 2QRRA 3BYZA 1RPNA 4EW6A 1RM4A 3WGQA 3HFGA 2B35A 3OFHA 4GSLA 2ZIZA 4ROSA 5L4SA 4TWRA 3RD5A 2PH5A 3DB2A 1B8UA 2VYVD 3GNQA 3TL2A 4E2ZA 2V6FA 3NTOA 4RPLA 4W99A 1LA2A 2GPTA 2HUNA 2UAGA 3WICA 1CF2O 2I5PO 5DT9A 3TZKA 2ZB7A 3ZNOA 4FJ0A 3QVWA 4MVJD 2WM3A 1NQTA 1E6UA 2GUGA 4DIFA 1AUPA 2BGKA 2NNLD 3IBWA 3DQPA 3RSHA 1IULA 3U62A 1ISFA 1OC4A 1UZNA 1KEVA 1J0XO 2EXXA 1B3RA 4HFNA 4DC1A 1LKZA 3DBVO 4R9SA 2IYOA 2G82A 3QLJA 1MUUA 1ZCJA 2Y68A 1IL0A 2FR8A 4R5HA 3FWZA 2D4AA 1WPQA 1U3TA 4KUEA 1HWYA 3PFFA 3TWOA 5IN5A 5A06A 2Y1DA 4JROA 2HJRA 3ZWXA 5I7SA 1KS2A 1FDUA 4YJFB 5DOVA 2P9EA 4PLZA 4H15A 4RVHA 4ND5A 1LRLA 4Y8VA 1LRKA 4DLAA 4CL8A 3NRBA 1OOEA 2NACA 4MIYA 1XCBA 4MJLA 4LW8A 4M8SA 1HL3A 3GZNB 1HT0A 4E31A 3F47A 1NWCA 2QYTA 3JQGA 5JBIA 5TIIA 1N5DA 4WLFA 1NAIA 4W7IA 2GO1A 3HDYA 2X5OA 1ZH8A 3JQFC 4Q39A 4U8GA 1A9YA 2I66A 5H81A 3TRIA 2DU8A 3GN1A 1LUAA 1R4MB 5H82A 2EW8A 1DFIA 4YA6A 4XWYA 4OXYA 2EJWA 1KEPA 3HWRA 4BNVA 4D3FA 3MJ4A 5JS6A 1JKFA 3V1TC 1E3SA 1B3BA 4P4GA 4HP8A 3PIIA 3OBBA 4JQCA 5TT1A 2HSDA 2VN8A 3RCBA 1I10A 4AJ2A 1H6CA 3ZV6A 3FHLA 1MA0A 4B3IA 9LDBA 4YRDA 2JKVA 4FPXA 3JQEA 5L45A 1C1DB 3GFBA 1JVBA 1XA0A 3GPIA 5EQDA 1I3KA 4CMEC 4BHTA 2QG4A 3K30A 5B4TA 5BSHA 2CVOA 4KTTE 2O50A 4XQ9A 5IDYA 4BMVA 3LT0A 3QVTA 3RAJA 3G49A 3NT5A 3ZW9A 3ZHYA 3KYBA 3CINA 2CSUA 2NVUA 2E48A 3FBGA 1DAPA 3GA0A 3L07A 4IIVA 3OQBA 1LBEA 1NNUA 4JXKA 4YT4A 3OEWA 4M89A 3WWYA 2VWQA 1HZJA 1I3NA 1PZEA 2GYYA 3WTCA 2PKQP 4QX6A 1NBOA 4BO9A 2DTJA 3KV3O 3P2OA 5EERA 2PA3A 3FWNA 1P0FA 3BA1A 4PN3A 1ENOA 2Y0DA 4BO0A 4NK5A 1I3LA 3SJ7A 4CLOB 2FPIA 2ZK7A 2Q2QA 3JV7A 4YT2A 4IDCA 1QYWA 3I9OA 2O7QA 4K26A 1JWBB 4GSKA 1DHTA 2Q2WA 4IXTA 5L4NA 3VH4A 2TMGA 2C2XA 3KYCA 4XDZA 2NVUB 1G6KA 1ONNA 1P1HA 4CLDA 4XYLA 4GMGA 1XU7A 1Z45A 3B1FA 4BKQA 4RV9A 2R00C 4H7PA 2JD2A 1ZEJA 4NH4A 4BNHA 3EGOA 5CPFA 3HHEA 2O7SA 1DLJA 1H6BA 2PFGA 3GPDG 4CL3A 4W7HA 1D8AA 4MVJG 4Q3EA 2O3RA 1GFSA 3PHIA 4PCVA 3UCXA 1G1AA 2UDPA 3QWIA 1XQ1A 4WPGA 2BFOA 4BVAA 1LEHA 3MOGA 4IS3A 4L9RA 1ZVMA 1I36A 4UAGA 1ADGA 1PWXA 4BO3A 3EDMA 4RVDA 4MP6A 1I32A 4OMUA 3PYXA 3DR3A 1X13A 2F00A 3JQDA 1ISGA 3WR5A 1QV7A 2O2YA 2G76A 1X7DA 4ND4A 5G4KB 2X5KO 1IB6A 3F5QA 3VKUA 4E2YA 3BMOB 3QHAA 1PZGA 3GHYA 3L4SO 2EERA 5AXBA 1R0KA 4R4JA 3O03A 1MXHA 5EIOA 2YV2A 1OBFO 2W2LD 3DBRA 3U4CA 1I2ZA 2I9PA 5ER6A 5TJHA 2LVWA 4R1NA 3D0OA 2I76A 4PG7A 4BOYA 5TC4A 4W82A 3DHYA 3CPSA 3JQ7A 3DXFA 3EMKA 4WOKA 1Q7GA 3WGZA 1Z6ZA 2NTVA 4RL6A 5T67A 4YYZA 3B1KA 3MJCA 3GHHA 4MO2A 4XD2A 2Z1NA 4R3WA 4FW8A 2AXQA 3U09A 4TVOA 3DOCA 1LTHR 2X22A 4RF2A 2R2GA 4AJLA 3FNEA 3TZHA 3EZLA 1YWGO 4UEJA 1HSOA 2Q1TA 4ZQGA 3VVBA 4R69A 1X7GA 1GU7A 2HMWA 2ET6A 3HUDA 1XDWA 3GR6A 5G0WA 5I7VA 3D3WB 5IZCC 4J1NA 5BNIA 4PLVA 5TSDA 4J9UE 1ISHA 2P5YA 4XRRA 4O6VA 2JHFA 5A4DA 4NNJA 3V8BA 4E12A 1ZEMA 3SC4A 2X9GA 5IF3A 4K28A 3BHMA 4QFCA 2X4GA 1DC5A 2JCVA 1K0UA 5ENDA 4NU6A 4JBIA 1TI7A 1ZKMA 4WEQA 1DHRA 3PEFA 4M1QA 1D1SA 1NPDA 2WYVA 3OFEA 3BMCA 1H93A 2FR0A 4XB2A 5BR7A 1LNQA 3JYLA 4IDAA 3F1KA 2AEMA 1W8DA 5A3JA 2IYPA 5F5NA 2QX7A 3DHWC 1BW9B 5DN9A 5IT0A 1CETA 3U4DA 4RJTA 3H5RA 5ITVA 3ZZNA 4Z3KA 2Y0EA 2V6MA 3IJRA 1ZXBA 1NYTA 3ZNQA 1YKFA 4ZJUA 2HO5A 1N9GA 3BXXA 5EQFA 5EPOA 2WYWA 4N7RA 5L7TA 4MVJH 4MP3A 3O38A 4XR9A 5JYDA 1E3JA 1QV6A 5IJZA 5JXWA 3JQAA 1N2SA 3PHHA 4NDNE 3BTVA 3L4BA 2Z95A 4AVYA 4O59O 1OI7A 3DL2A 3VTZA 3ZWYA 5ENVA 2YDYA 4CLHA 1FJHA 1YE3A 4YAJA 1PJ2A 1LI4A 1TT5B 2WYUA 7MDHA 4I8XA 1WVGA 4YRBA 3L6EA 1GY8A 1MP0A 4P8RA 4JCOA 3GEDA 5U1PA 4YT5A 4CMIA 4WLVA 1LLQA 3ZW8A 2VUUA 2AA3A 1JA9A 3KO8A 1X14A 4O5OA 2VWGA 5GY7A 3INGA 4E30A 5IXYA 1SBYA 1YH3A 3I9KA 1LSOA 2OORA 5DOZA 3W1VA 2NADA 2IDZA 1HETA 1ORRA 3C7DB 3FTPA 4GVXA 2G5CA 3CE6A 4KZPA 2PZJA 1LX6A 4TKLA 4RVUA 2AW5A 1JKIA 5IN4A 3VZSA 3I4CA 3GEMA 3H2SA 2FN7A 3W8EA 1IE3A 4FCCA 2H6EA 1LSSA 2J5KA 2B5WA 4D42A 5TF4A 1T1SA 3FR8A 4L4XA 3D4OA 3WGHA 1HXHA 5K9ZA 2PTGA 4PIVA 2BRUA 3GMSA 1KVRA 1R12A 2RHCA 2VRBA 2CZCA 3M1AA 2H9ZA 1WLYA 4CMGA 1DIHA 4HV4A 4QEDA 4CUKA 3ZNNA 1U1IA 3RUEA 3KRTA 4FFOA 3T4XA 5JAIA 3WGOA 2Z1MA 1T24A 3KLMX 4BNJA 3AUTA 4D7AA 2AG5A 1OMOA 1DEHA 1YONA 1PX0A 2BD0A 3H9GA 5C7IO 1P3DA 2FRDA 1P1FA 1QORA 2Q99A 4I1IA 1UXKA 1VSVA 3UGKA 1C0IA 2W2LA 3U0BA 4ALMA 2X0RA 3DTYA 2PWZA 3JQ9A 4NPCA 1MLDA 3DZIA 1Y7PA 1LSUA 5CEFA 2OO5A 4ALJA 5CFZA 1F8GA 3MTGA 5HM8A 4F6LA 3WGIA 4WNIA 1ZO8A 1YQXA 4I08A 1E1NA 2XXJA 2WD7B 2OBYA 2NU9A 4Z0PA 2QMWA 4L8VA 3SBOA 2RH8A 4UVGA 2DBVO 1PGQA 1PS0A 3JYPA 3GVHA 3WBFA 4HADA 4A03A 1SEVA 1W0CA 3SLKA 5JNLA 1UP4A 3ANMA 2UYYA 4OQZA 1NVMB 3EY4A 1IY8A 1QRRA 3ADPA 2CDAA 4DYDA 4ZN6A 2NWQA 4KMSA 4UUNA 2PZKA 4IJKA 1JKJA 1U4OA 3OFSA 1R37A 3W8FA 1ZIDA 4BMSA 1C14A 3WMXA 3OA2A 5KIAA 1UJ5A 2ZB3A 1O89A 2Y05A 3K2EA 4L75A 1E1MA 4QUKA 2VZ9A 2X7HA 4IM7A 4MIEA 2QRLA 2W2KB 1K6XA 4Z9FA 4B8WA 3EHEA 2FPGA 3VHRA 4DL9A 1IHYA 3N7UA 2E37A 5CP8A 5A02A 3GOHA 2JHGA 1GCOA 1DBVO 4JP3A 8ADHA 3KYCB 1BXKA 1W6UA 2W90A 4I5GA 2FMUA 1PEDA 3C7AA 3LT2A 1K6JA 2YY7A 3B1JA 5KJ6A 1UZLA 4DA9A 1XTZA 1K3TA 3Q6IA 4BQPA 1PJLA 1FDVA 1UXHA 3WQQA 3D64A 5FI3A 3DZHA 2LQJA 1H2BA 1VL8A 4QQRA 3PK0A 5A3VA 3S2GA 4CM9A 4IDGA 2WTBA 3ABIA 4J7CA 4U6QA 1TLTA 3MWEB 2YFQA 4FC7A 4OHUA 3FNHA 3VZQA 3RUHA 1F17A 1XWFA 3EK2A 2AMFA 1LC3A 2HDHA 3ROQA 2Q1UA 4BB5A 4E5NA 2Z5LA 3C1OA 3FNGA 3V5NA 4ZQEA 1LQTA 3NTRA 2AE2A 3ONDA 1PZFA 3BZUA 1ZW1A 1N92A 3WYBA 3I9NA 2V65A 4L0QA 5JDCC 4GKVA 4HFMA 3TJRA 1GCUA 1HE2A 2FR1A 4K1LA 4ZGWA 3I9MA 3P7MA 4U6SA 5COQA 1AXGA 1Y9EA 2EV9A 4FDAA 3ITDA 3DHXA 5FEUA 2VCYA 1EZ4A 2QW8A 1GEEA 4IGFA 4PVDA 2EP7A 4WE3A 1A27A 4A27A 2VOJA 4Q9NA 4C7JA 5JDCA 1I2BA 2QSWA 4XX0A 4CM5A 1E1LA 1E5QA 4URFA 4B4OA 2BI8A 3ROPA 1ISJA 4JX8A 1HDOA 1P9LA 1TVEA 3FNFA 3VDRA 3MJVA 5AVOA 2YYYA 2Q3EA 2QZ9A 2ZJ0A 2O3TA 1JTVA 2OGUA 2QRKA 3DONA 4ONEA 1A71A 3IUPA 1PL8A 2E49A 3D3WA 4JLWA 5BT9A 4CR6A 4FOSA 3ETDA 1H9BA 3F9IA 1P33A 1XLTA 3WYEA 1I5RA 4M54A 2H63A 4J1SA 2OP1A 3ONEA 4YJGA 3EZYA 4XQCA 1YRLA 3MAHA 1ZNQO 3ON5A 4PLHA 2VQ3A 3G3EA 1E3EA 3ZN2A 3WTBA 1FDTA 5IT4A 3PWSA 4G2NA 5LCXA 2MDAA 1WZEA 1ZMOA 4MKXA 1FDWA 1WDKA 1O8BA 1D1TA 4XGKA 1O94A 1EEHA 2ZQZA 3HE3A 3ICCA 1P1IA 3CZRA 8LDHA 2FY8A 1L7DA 4AJPA 1BVRA 1YQGA 4I9HA 5CDSA 5A5EA 4CMBA 2C2YA 1P1JA 3UF0A 4BGEA 1I0ZA 4LCEA 2WJPA 4PG5A 4R5MA 4D0SA 5FF9A 2JOQA 3LU1A 3M2PA 4QXMA 4UREA 4J43A 3F46A 2JFHA 2NTNA 3G0OA 4X54A 2J3JA 2C5EA 3ST7A 1OC2A 1QLHA 1PGJA 5IG2A 1I8TA 1A5ZA 1Q0LA 1B14A 2QQ5A 2AQKA 4ALIA 3ZU3A 4OAQA 4E32A 4F45A 4IIUA 3H7AA 3VZPA 3TUIC 4GO5X 4WLUA 3OETA 4FJ1A 2C07A 3ZWCA 1UDAA 3FBTA 3R1IA 2CY0A 1H0KA 2PY6A 2ZB8A 3R3SA 2OHXA 1E7MA 1K2WA 3L4BC 4E21A 3JQBA 2GZ1A 3JQ6A 3KB6A 4ZVVA 1GUYA 2NQ8A 1HF3A 5ICMA 2EW2A 2JD0A 4EGFA 4YJHB 4RF4A 3O8QA 3OP4A 2NYIA 3SXPA 4CMIB 3KM0A 5DBFA 1A7KA 1M75A 3GZ4A 5DP2A 5L9AA 2B36A 4DMMA 4IO1A 5KVVA 5JW6A 3HN2A 4ZHSA 4LUBA 4HXYA 3I5MA 4XQEA 1U9JA 4XYGA 1QKIA 4M55A 1DDOA 1NPYA 1PGOA 3LSYA 1FDSA 3AWDA 2NVBA 4JGBA 3IOYA 3KZVA 1AXEA 1EQ2A 2BF7A 4AJHA 1Z82A 1E6EA 3OSUA 4DBVO 2O23A 2J6IA 3E18A 3BMNB 3Q9UA 3D1LA 4IMRA 1RWBA 3E1KA 1FXSA 2AEJA 3O1LA 3OBIA 1DC6A 1VL6A 3NX4A 1Y6JA 3GNSA 3WSWA 3IJPA 2D3TA 1RYDA 1MGOA 3ZGYA 4E5PA 5AQ1A 3F4LA 4CM9D 3S55A 2BGLA 4NFSA 4J16A 3AY6A 4C4OA 4PG4A 4J91A 3PHLA 4AJOA 4J4BA 1ONPA 5TX7A 2KO1A 4U7WA 5EN4A 2X5JO 4YQZA 1VPDA 4Z9YA 5A9TA 4A26A 1HE4A 1YXMA 3DZJA 4L74A 4CQLA 4BS9A 4BGIA 3C1AA 4PLCA 4E3ZA 1LXCA 2BKAA 4ZQHA 3MWBA 5CDUA 4CODB 4BO2A 4FS3A 1I24A 1DRUA 4IZHA 4EJMA 4IJWA 1ADBA 3CMCO 1NQOA 4XQGA 1ZSVA 3FTNA 4NR0A 3WMWA 1B8VA 3Q3CA 1DJNA 4BO7A 4D45A 4QO8A 4RLHA 1QXSA 3IKVA 4IXWA 2CMDA 2VYNA 3GVCA 3PPIA 3IKTA 4YCAA 4NIMA 2PV7A 3FRJA 1ZBQA 4JBHA 4RDHA 2HK8A 4GWGA 4DLBA 5DZSA 3IDSA 5JO9A 4HX5A 1M67A 2NV6A 3L7OA 3VPFA 4ZA2A 1X7HA 2A94A 1KC1A 4XYMA 4EZBA 4UUPA 2YQ5A 3QQPA 3PDUA 4WLNA 2IEDA 3BMOA 1D3AA 3C3XA 5JAQA 1ZJYA 1XYGA 3K6JA 3NGXA 3A14A 2PD6A 4DPLA 2IODA 3HZZA 2PC6A 3WFJA 4WNCA 1SAYA 2HMUA 3QRWA 1P74A 3OJFA 3WIEA 2VNAA 5IDWA 4R3NA 3SX2A 4FFRA 2Y1CA 4BO8A 3RIHA 3RQSA 3SLGA 1X0XA 4CMKA 3AI3A 2GZ2A 2GN9A 4CPDA 1LQUA 1VI2A 4BIIA 1U4SA 1GV0A 1UR5A 5DBGA 4A5OA 4CMAA 2VOEA 1BXGA 1GQ2A 4BGUA 4RF5A 5IAAA 3ENNA 5AOVA 2JCYA 4NBUA 5C5IA 4TVBA 1NTOA 1AGNA 4GH5A 3JD1A 2C5AA 5U4QA 1UJ6A 2XXBA 3LUYA 3ZHBA 1G0NA 3VVCA 4BGVA 1NFQA 1PGNA 3UOGA 2D2IA 2QYSA 3I6IA 1C0LA 1ULSA 3IQDB 3QY9A 2R00A 5LDGA 2UUOA 1T4BA 1ISIA 2B0JA 3MJTA 3DBLA 3LLSA 1B8PA 3GAZA 4HNGA 2GD1O 3U49A 2VHVA 4YJFA 4FJ2A 4WASA 1R16A 3KLPX 2JAPA 3HB4X 4J2HA 1GYQA 4I5EA 3EC7A 1O8CA 3K96A 3ENWA 4IGEA 2W98A 4YWJA 2WDZA 3VH3A 3TDKA 3PGJA 3QP9A 4Y6RA 4IY1A 4PRLA 3LF2A 3DO5A 4YQYA 3RU7A 3DFUA 1SOWA 4ITUA 5FYDA 3VOSA 2I67A 1ZZEA 3TQHA 5BQFA 5HWSA 1BW9A 3ORFA 1GPJA 1U28A 3HQ4O 4B3HA 3RFVA 3W4JA 3MJEA 4FGSA 5B1YA 1R66A 1U7HA 3SVTA 1VRWA 2WSBA 4PLPA 3SC6A 2HRBA 4BL5A 5TJ9A 1N9GB 3PWZA 5AXCA 4IDDA 3KHUA 2D1YA 4DRYA 4DPMA 2JD1A 3NEPX 2HK7A 3T7EA 3G79A 1DOHA 2C54A 4B79A 2XF8A 1EBFA 1U5CA 5C3MA 3PZRA 2VZ8A 2OOSA 4J0FA 2P5UA 5JE8A 2VHZA 1R4NB 5CG1A 3JYOA 1ONOA 1NASA 1ZFNA 3E5RA 5JLAA 4B7XA 4Z0HO 4GLLA 5CDTA 3L9WA 4Y9DA 4CMJA 2WE7A 3JCZA 1LDEA 3KOUA 1KVSA 1HZZA 1XELA 1VE9A 4JP2A 4WCFA 1XG5A 4FFMA 3I1JA 3PDJA 1GQYA 1YBMA 3HB5X 4XYBA 3ZWMA 2BMAA 3DOOA 3K5PA 3QVOA 3P19A 4YXFA 4P4NA 4XRGA 3ZWWA 4ZQFA 2FGCA 3GNTA 5TQVA 3GMDA 5DCYA 2JL1A 3HSKA 1LDNA 1R4NA 4KUHA 2LDXA 4BKRA 4NBTA 2I6TA 3AM3A 4Q3BA 4Y98A 4AJIA 3DAPA 5A9RA 1YL5A 3PXXA 3OJOA 1LC0A 3DBHB 4RF3A 2GGSA 2XOXA 3BAZA 3E9QA 3R0IA 3R6DA 4PLFA 4DGSA 2P9CA 2OMEA 3QA9A 5I9NA 1WDLA 3JQFA 5T5QA 3UN1A 3GAFA 2IE0A 1HDCA 4RDIA 3WG9A 3SJUA 3WLFA 3C8MA 1A72A 1JDJA 3E9NA 3PLRA 3AOGA 4H3VA 1XKQA 3PLNA 5F1PA 2RQMA 2WD8A 3I3OA 1GUZA 1ADFA 4CLOA 4EEXA 1LDGA 2VT3A 1ZK0A 2I3GA 4YJHA 4GVLA 4I9NA 1WWKA 2DTEA 1Q0QA 2H1SA 3PHGA 1QP8A 5HS6A 4MVJM 4AL4A 5JSFA 3P2YA 3D3EA 4PVCA 5KKCA 4CR7A 1Q0HA 4IJUA 2J3HA 3DAFA 4XGNA 3I9JA 1KOLA 3NJ4A 1YDWA 4CMHA 4BNKA 5JCJA 2RAFA 1O6ZA 3ZU4A 1N7GA 2HMSA 1XQ6A 1ZK2A 4RPGA 3ROKA 4R1UA 3WBBA 4DLLA 1EUDA 3LVFO 3NT2A 1NFFA 5ILGA 2BHLA 5L53A 1PL6A 1C0KA 4P38A 4YACA 2OL4A 2EJVA 4ZD6A 4EBFA 1CRWG 2DUWA 3ZV3A 1E6WA 3C7CB 3F4BA 3NAQA 2FZEA 4LRSB 1EBUA 2UUPA 1TXGA 3ROMA 1RJWA 3PYLA 4G65A 2Y0CA 5ER9A 4WJZA 1MV8A 5I8ZA 4LN1A 1UXIA 1YJ8A 3MZ0A 1SNYA 5L40A 3UFXA 3TZCA 1PSDA 3H2ZA 4DQUA 4NMHA 5FI5A 4Y67A 1GR0A 2HU2A 3E48A 4Z0TA 4BNUA 2NU8A 4XIJA 1YVEI 4HBGA 3L6OO 4TRNA 4AJJA 4FOOA 2JHEA 4D79A 3JYQA 4YAIA 1K6IA 3NJ8A 4AJKA 5COBA 4ND1A 1P1KA 3WQSB 4CM6A 2ZQYA 1T4DA 4BUCA 4PG8A 5JMPA 4M86A 3RC7A 3VPHA 3T7CA 3GF4A 4GMFA 4IUYA 4KWHA 4NFHA 3ETGA 3EVTA 3OA0A 4YPOA 5B4VA 2AG8A 5IXSA 5G0TA 1DRVA 2ZCVA 4YRAA 2AQHA 3TFOA 4ALNA 1YB5A 5JCXA 1C0PA 1YJQA 3KVOA 1T1RA 1SPXA 2ZYDA 5K6AA 1AHHA 1V3VA 4ND3A 4B7CA 4CM1A 4KDEA 4MVJI 2CF5A 1YOVA 2YHUA 2J5RA 1E1KA 3PQFA 3H3FA 3VKVA 4PWUA 1UJMA 4M8LA 2CD9A 4FB5A 3UCEA 3WGYA 1EDOA 3U9LA 1H6DA 2Y1OA 4IDEA 1ZSYA 1ENZA 5TRTA 1GAEO 2FWMX 2BELA 1XEAA 2ZYGA 4PZCA 3U5TA 1PR9A 3ONFA 3S2FA 4CUJA 1PJCA 2C59A 1T2FA 4QECA 1U5AA 5THKA 1HDZA 1RYEA 4XJTA 4CLXA 3F3SA 3H9EO 1JAXA 1UP6A 3G1UA 3RUIA 2E4AA 4CM4A 1MFPA 2OFPA 5G0VA 3E9MA 4RZHA 1E77A 4RO0A 5TT0A 1B15A 5T6BA 5KJFA 3ZV5A 3ZWVA 4UVHA 4YEDA 2RH4A 2CVZA 4TSKA 1VKOA 2VTEA 1PU2A 3GDOA 4IZIA 3H8VA 3H9JA 6ADHA 3JQAD 4MVJF 3QE3A 1KS9A 3CIFA 3MWDB 3IC5A 5DULA 3GH3A 1BDBA 3QV1A 3B20A 4J49A 2ZHOA 1NHGA 3OHSX 1YS4A 3HJAA 4GKBA 4D44A 5T41A 1HDYA 3GLQA 3JQAB 1JVSA 2Y1GA 3NDRA 3CSDA 4B4UA 2J0WA 2D5CA 1B0AA 2E6UX 3ADOA 1EMDA 3LC1O 3PGXA 5ADHA 3TOXA 1C1XA 5I7EA 3G1TA 4RQTA 3FD8A 3NUGA 1TT5A 1E7SA 3JD4A 4JJFA 4NI5A 3I52A 2RHRA 2OZPA 4UULA 2HAEA 5DF1A 3TL3A 1M76A 4L76A 3CXRA 5AXDA 4NFYA 3C1TA 3X2FA 3IMFA 1CQJA 1CEQA 1Z73A 3BHIA 3AJRA 2J8ZA 4LCJA 1YBAA 2FP4A 3LQFA 1I30A 4FSHA 4II2A 3RBXA 3WNQA 1PQPA 1Z7BA 1DAOA 3H9QA 3NDJA 3NV9A 1XSEA 3WB9A 2H5LA 2IRWA 1B26A 4XCVA 4CUZA 2CDBA 2HKIA 1SB9A 2YQ4A 1SCUA 1Z75A 4L4RA 1C1XB 5IDXA 3OH8A 2QMXA 1L7EA 1ZPVA 5GZ3A 2QHXA 1BSVA 2BI7A 4OKIA 5MGBA 4ZRMA 5T8KC 1V0JA 4TZKA 3ZWBA 1M0SA 3ZU2A 4JBGA 4PRKA 4RVGA 3DMTA 4ZICA 6LDHA 4R16A 3DDNA
chains in the Genus database with same CATH superfamily
3RIGA 3BJEA 4ALZA 2FW0A 1LNSA 4NZ7A 1NBEB 4S05A 3EYAA 4GDFA 1FL9A 1UDWA 1WKCA 2PUTA 1N88A 1G0OA 2Q9AA 1V3UA 4L8GA 3MEQA 1E9DA 4U02A 4KIFA 1FTCA 1WKJA 4A8WA 4Z86A 1YCGA 1PAEX 3CS3A 1NBEA 4QLAA 3L7DA 5HKLA 2JLQA 3P5SA 3GP9A 3T7SA 1VB5A 1PJTA 4WJBA 3BSFA 5AXAA 1HFEL 3E15A 3KYIB 4Z7QB 2BM0A 2J6UA 5CFOA 4V03A 3R74A 3OEHA 3QNMA 3GJ6A 5HKBA 2FSUA 4JI8J 2CPHA 3FCOA 5LYJA 1EM6A 1X8LA 1IJFA 1LJ8A 3ETMA 4LZWA 3GELA 2GJAA 2V8BA 2IYQA 2W8ZA 1N4DA 5CFQA 3ENQA 1V2HE 2AR9A 5EJGA 3EUAA 1U0JA 3B82A 4DE5A 4IHAA 5LBUA 2E4UA 2P9YA 1HDXA 2XADA 4CO5A 3CC7S 2I3DA 3OE7D 5BPFA 4HLUA 4NOLA 1YVUA 2HEIA 5C0OE 2R1TA 2J5XA 5E4YA 2UXBF 2O8BA 3AU9A 3MCAA 1PT6A 4EG3A 5HKKD 4REQA 4B9TA 3LL7A 3X1MA 2IH4A 3ONVA 5FPTA 5CXQA 4B9NA 2UVPB 4TX1A 4ZEXA 4ER5A 4FYPA 3CCFA 4CN8A 2YHSA 3K3PA 4NG5A 3VGSA 2GYWA 1B7GO 2L19A 2J7WA 5AR1A 3CJQA 3IBTA 2BL4A 3NHLA 4QTUB 4TLEA 3T1HJ 4OLHA 4UM7A 2ZI7A 1Q1QA 3VU3A 2C2MA 4P73A 1V9LA 2VPYA 3PIDA 1K5DA 2F43A 4JGGA 4IG4A 3VYVA 1VFJA 1SIZA 5DG8A 3LTOA 2VBGA 2VAMA 2EC0A 1UMBA 4LR8A 4ZVUB 3COWA 3GLIB 2DH9A 1EKRA 2ZJ6A 4Y30A 3QXCA 1H2WA 3FFXA 3ZHRA 2OC4A 3T0IA 1O9HA 3IMCA 3HK2A 3E3NA 4D9FA 1FF9A 2KL8A 3DBHA 3O3OB 4MV1A 1MJFA 3LCUA 4NCJA 3JQQA 3H90A 1TECE 5HBRA 2XG8A 1CY7A 3G8TA 2Q6KA 4MEAA 5HMXA 4RUCA 2OH2A 9LDTA 1WTCA 3HACA 4LRUA 3MCOA 1FYXA 4R68A 2R4QA 2J41A 1DFHA 3I3SR 1F8FA 2IDJA 4Q7EA 5ADVA 3KLBA 1F3LA 2RB4A 3RUFA 5A6SB 3CNQP 1A8SA 1YDMA 1QZTA 2YS7A 4EVSA 4WKGA 1NXVA 4EHHA 3DVAA 3KSDO 2X0JA 3LA6A 4JT8A 4ZT5A 1GTMA 3BK7A 4NX2A 4O4HF 4MWBA 2FPPB 4R05A 3WAKA 4GP7A 5CGZA 3P52A 1E9VA 3IEPA 4FF4A 2AG1A 1XCPA 4C7MA 1MBZA 3H20A 3VSCA 3DOFA 2JVOA 4LSMA 4B9EA 3PFIA 5LZ2A 3MUMP 2ZXUA 4ZOBA 2WQ6A 2PH3A 3LJKA 2ROPA 4UM5A 2JLFA 3G71S 2G7MC 4LJSA 4MINA 1DMSA 3DMYA 2C0PA 5TGZA 4OY3A 5E4FA 4DV2B 2I4NA 1CR0A 4MKIA 3VO1A 2FEMA 3ULKA 3G0HA 1FLVA 4EJ0A 3GFGA 1R5NA 1M0WA 5CAEA 3TD2A 4OG2A 3REOA 4PEOA 5DS7A 4WTOA 2FOXA 3GUCA 2WAMA 2GLXA 4RPKA 2AWOA 4D9CA 4OJTA 1EE2A 2HAIA 1DTTB 3MWDA 4BKOA 1NVFA 3S7ZA 3PA6A 4FGJA 2GJKA 1RPJA 4B31A 4ECAA 4HDHA 5CX1B 1USIA 4JUIA 4LVOA 1HD1A 2F90A 1KNZA 2LXNA 2AK3A 3E82A 2LDBA 3KT6A 1XTVA 4IEEA 4ZVPA 1D09A 7MHTA 4BJ3A 1Y8QA 1O1YA 4OX9Y 1EVYA 3NH9A 2BOPA 2BH2A 3OO1A 1IWAA 1MFZA 2QVGA 4J7XA 3ELWA 1TQHA 5CNMA 7ADHA 5GINE 5KTQA 1G1MA 2HC9A 2UZIR 2GJ4A 2F7VA 4IIGA 1Q8LA 2V8PA 1STOA 3FZNA 1J0BA 5LWQA 3HM2A 4QUDA 1SB8A 1D2GA 3A4NA 2W2PA 1G8GA 3CV3A 3IL2A 3TIGA 1GTEA 2NZWA 3L1HA 1T4CB 4QUJA 5FOXA 4MVWA 2QL5A 5IYZF 5ECYA 1G21E 2ZEJA 3ZHUA 4C8MA 1ULUA 1YJWS 1HYSA 4B0PA 1MAVA 2A7QA 2JGDB 5ED0A 4BMDA 1YR7A 4ASUA 3MUEA 1XB2A 1S1XA 3BJYA 4UTOA 4RW7B 2AZ4A 3PW2A 3EZFA 1I01A 2EPIA 3DLBA 4EYEA 1FTWA 4CM3A 4LXUA 3VNAA 5CBPB 3QUAA 1O0CA 1V4NA 2LWIA 4Q21A 1ODCA 5KFVA 4H59A 1ISPA 4UNPA 3I42A 4LDPA 2WJZB 1UDCA 3KWLA 3H3JA 1XTRA 4HQFA 1RKXA 2IUTA 5KSYA 3T8YA 3HXTA 1X1TA 2P2CB 4EEZA 5JFOA 3BT7A 4L7VA 1MEJA 2BCEA 4Y34A 2C4TA 3C98A 3RTAA 3KQYA 3JVIA 1MQSA 3LYLA 3ZCXA 1RP1A 2X13A 2V7UA 3U4QB 3HJFA 4DV0J 2E4ZA 1YS1X 1RPZA 3TG2A 4F67A 3LX8A 4TQ9A 3VAYA 3DU5A 5MN5A 5KFWA 1JFSA 4F3KA 4JVOA 2BYTA 2AOTB 2UV8A 5BMOA 3FKJA 2YMPA 1ADJA 4NLOA 2QMUB 2OHGA 1VQSA 4O4LA 4Z4IA 4ACAA 4M5LA 1M66A 4BU0A 5RUBA 3OM9A 4EKDA 2B2NA 4MPDA 1O5JA 1CWUA 3VVLA 3KEGA 5I7FA 3RC3A 2B21A 3TRKA 5CURA 5KFNA 2UUAJ 3RHFA 1NW3A 3AWIA 1OX4A 5AI6A 4AZTA 4DIBA 3GJRB 2AS0A 3WXMA 4CV2A 1JYSA 1J00A 2P4UA 2V8HA 1RM0A 1P2VA 2QZ8A 2PMEA 4N03A 2IBTA 1E3IA 4LE1A 2XYGB 1GVHA 2NN3C 2R6ZA 1G4AE 4GWKA 4PNPA 4ZKAA 2PUFA 3Q8SB 4MGHA 4F2WA 3PHJA 4DUYF 2VF5X 4RENA 4QIGA 3L95X 4JJ6A 2R8PA 3KJIA 1XP5A 3RR8A 3A3NA 4LJ4A 2E5LB 1XEZA 4WOJA 3L8HA 3GGGA 3H65A 3HP7A 1FFXB 3HPRA 3NU1A 4DSZA 1UCFA 5HF8A 4FEAA 4N3CA 1FNCA 1S4FA 2CNBA 3R6GB 2HLDD 1GGVA 3KJEA 1FU8A 2Z6UA 1JEYA 3L84A 4AFNA 3E6AA 3H87A 4LFAF 3ZGNA 4KGZA 1EZ1A 2ZJ8A 1SUEA 1IUKA 4KLZA 5I7WA 5KFYA 4KV8B 4CJXA 4RPCA 4TSRA 1BEEA 4DDMA 3TOZA 2DXFA 1Y37A 2DP4E 3AU8A 4UPVA 1CUJA 1RQ0A 2QR3A 2ZYAA 3LQ4A 1IY9A 1VZ2A 2PMZD 5EWJB 3IERA 3BJRA 4OF4A 1A04A 3VPXA 4WCFC 4WT7A 1KRXA 2H4HA 4TXLA 1JMVA 3T1HF 1LFAA 2OZVA 1DAKA 2XQFA 5F77A 4XEHA 4NCXA 3PQ3A 2A4KA 3ILYA 3FHJA 1XRRA 3BFJA 3D2WA 1MN6A 1KRPA 3O93A 2VBYA 3WLPA 4L3WA 4GLBA 2VVTA 2LXFA 4BNMA 4WE1A 1G4HA 3ZXXA 1E79A 3W2TA 2YV3A 2CT8A 4RJ2A 2O8CA 2QLXA 2I22A 3AR4A 4NE9A 4NLYA 1UVNA 1CUDA 1U7PA 2ZYUX 4HD8A 1LU9A 1PFKA 1SI9A 2RBKA 1YRBA 3DEFA 1XZKA 2REQA 2ZULA 2QTWB 2ZIZA 3HVWA 4G9GA 3RSZA 1NYLA 5DGCA 5TE9A 4YRRA 2GPTA 3WICA 1KU6A 2ZB7A 3SCKE 4X1IA 3RE1A 4LCBA 1K92A 1A5BB 1TVCA 1P9NA 4LRBA 4ECQA 4K9RA 4HB2A 4FDFA 3JASA 3QHPA 1ZCJA 2CXUA 3QPWA 1DKMA 1WPQA 3GCWP 1XBWA 3WA7A 2KB2A 1F5AA 3MCTA 2CQPA 4O4HA 4CIYA 4MIYA 2A7XA 4IR7A 2RUSA 2DGOA 1TK5A 5M5BA 2O1PA 3P9SA 3RJTA 3JWPA 4MGKR 3V4FA 3R7NB 3K8OE 2XGSA 1QS0A 3H5WA 2NZYA 4LUCA 3SYLA 1JKFA 1B3BA 5K14A 2XMZA 2SCUB 3PIIA 3I9ZA 4AJ2A 1IOZA 1MA0A 2BMEA 2BCJQ 4PX2A 1S76D 3QLHB 1JVBA 4EJSC 2G1PA 2CHEA 2JRCA 1PN3A 1IKWB 3ZHYA 1QGUA 2E48A 3GA0A 1V9CA 2V74B 5ED4A 4F8YA 4TXJA 3L4JA 1QF9A 1QCZA 1G8YA 3P2OA 4JT4A 2XHEA 4PGHA 5HFAA 4EW3A 1I3LA 2BZGA 3A1SA 4KAIA 4A8MP 3IUEA 1M2EA 1JMKC 2VBCA 3W5HA 1MPTA 1F7UA 1C9DB 1A2BA 4HLDA 1CG6A 2WVHA 4IXTA 3DKDA 1ONNA 1P1HA 1FDBA 1UDXA 2JD2A 2LXIA 2VEOA 4WH0A 4WACA 3W0LB 1WABA 1LEHA 4WESA 2I5JB 5AVSA 3WLTA 1RT6A 3M0EA 2F4VF 3LDFA 4ZYZA 4AL5A 4D74A 4PR0A 3KK0A 5FPKA 1YDLA 4ZEMA 2I6UA 2TMKA 3I9FA 2VODA 1WUTA 4EB3A 3U3JA 4MV3A 2MLXA 5A0FA 1MG7A 3WGZA 3B1KA 3FSEA 3U09A 3DOCA 4AJLA 2R2GA 3EZOA 4P74A 3RYCA 3RS2A 4DLVA 5GM1A 5G0WA 2E5HA 1ANKA 4E12A 1SVNA 3W8PA 1E6YA 1JT9A 1IEXA 1BNCA 5H80A 5JS1A 3PRVA 3X44A 3LIPA 1QLWA 4ML3A 3ESXA 3JZAA 1FRVA 3GT3A 2HIAA 4RU2A 4QT4A 2MIIA 3SCZA 3ACBA 5DN9A 5IASA 3C8ZA 1AQLA 2L9DA 3FLBA 3PKZA 4BYMA 4TV8A 2WYWA 4IHKA 3R6TA 4MRRA 2RARA 1MENA 2BW2A 1HGXA 1VJWA 5F7ZA 4O59O 2EL7A 5I4IA 5C8DA 1GY8A 5F8JA 3VYSB 3ZS8A 4WP3A 2PI5A 2I7DA 2P79A 2R8EA 3U60B 2IDZA 3FTPA 1IK6A 2QGNA 4EBDA 1YQEA 3PR5B 4RVUA 3UWSA 3VZSA 2J5KA 4LJ6A 2B5WA 2QA1A 5KYTA 3KEMA 4L4XA 2JFPA 1ZM9A 4PIVA 3MEGA 1P5FA 4WUTA 3BS9A 3HEBA 5B3KA 4CUKA 3QWPA 3T4XA 4JNCA 1M2GA 1SXGA 2IYRA 2J7KA 1UXKA 2MR5A 4C0HA 2X0RA 3OUUA 3QJGA 5BQPA 1USVA 2GYVA 1G2PA 5HM8A 5L46A 3VSEA 2IYTA 1MOPA 2WWHA 1MKYA 1FW6A 4PWDB 5J1EB 3O4JA 3PW4A 3GVHA 1D8YA 3UCZP 4OQFA 1V26A 3U13A 3JAKA 5EXXA 1S4MA 4DYDA 5HP4A 1QJCA 4H4DA 4AKIA 2ZPUA 4KRGA 3WMXA 2AFRA 3HJTA 2HHCA 3EFOA 4QYIB 5TR9A 3LW7A 4NBNA 4MW2A 5A02A 4BX8A 2BDTA 3UB2A 3QKWA 3ZGLA 1RTZA 2NO9A 4F6RB 3ZTTA 1HL7A 2VBFA 3GJ5A 1FTSA 1A3CA 4WKYA 3I2KA 1CR2A 1SH2A 2DKFA 3E05A 2QQGA 2HF9A 3UJDA 2R48A 1YK1A 3RAXA 2X7IA 3NTRA 3FBBA 4MUBA 2IPOB 3W5ZA 2V65A 4LF4F 1CIJA 1RA7A 3IGNA 4NZOA 4P0PB 3P7MA 2EV9A 3ITDA 3H0PA 3RRFA 1A27A 4DWJA 4Q9NA 3E2IA 3R7BA 4A2WA 5I3CA 4URFA 4JA2A 5KG6A 3PXBA 5AVOA 4L0CA 1JTVA 1CU1A 2EEPA 5I9SA 4ARZB 1Z08A 2B8EA 1GX6A 4FOSA 4UE3S 3WYNA 4HI2A 4XWKA 3QF7A 3FTDA 3K35A 4XQCA 2VQ3A 4KLNA 4DCVA 4RLEA 2YXDA 1NE2A 5M2PA 3LVBA 5TXGA 2KHZA 2KFYA 2ZQZA 3EGDA 2RJNA 5JALA 2PZGA 1W7AA 2CNOA 2XY5A 3LU1A 3UE2A 1H72C 2BFDB 4QXMA 3F46A 3G0OA 3MOZA 3RT1A 5IG2A 1PGJA 4L8LA 2QQ5A 4EHLA 5FLEX 5KFLA 4IIUA 3R1HA 4FMDF 3P5BP 1B4DA 1UBGA 5BRAA 3LO8A 3TAMA 5JS7A 4LTDA 1T3GA 4CFSA 4RV5A 4F04A 1DBRA 4WA8A 2MU1A 2PMWA 3FFTA 5JW6A 4ZHSA 4LUBA 1RTKA 1OAOC 1ZJ5A 3HX9A 5CA1F 4TLRA 5AM2A 3E01B 1VS3A 1ZVQA 3OSUA 5KFHA 1ZJ4A 3DMNA 4IMRA 2EW1A 2XUFA 3ZG6A 1YRTA 3IJPA 4ZPJA 3F4LA 4CM9D 5DSXA 5TX7A 4U7WA 1FYFA 2X5JO 3ZD6A 1PNRA 1ILEA 4A26A 3HCCA 5K0EA 2DFTA 1IQPA 4U3JA 5BSKA 2GAJA 3GD7A 4TGLA 3OURA 3FRJA 1ZBQA 4MVYA 5T4HA 5DZSA 3R0XA 4HX5A 2IYAA 2NU7B 1QHGA 3D4JA 2FPGB 3PFBA 4EO8A 5I7OA 1H05A 2VH5R 2QZSA 4JR1A 4U5XA 4Y0NA 1D3AA 1GXUA 3BOSA 3NGXA 5IM4F 4H77A 3M6XA 4AT1B 2OESA 5K1ZA 4QTTB 1A8IA 2IHZA 4OQQA 3W8RA 4ECSA 3GIRA 4FX5A 3WIEA 1KZHA 1LW6E 2Z56A 2GZ2A 2CNDA 4X7RA 3D6NB 1BDIA 5IC5A 2CJPA 3L8EA 1Z7YA 3O2QB 1JLCB 3GRRA 2P77A 3ZJYA 3FZYA 3QY9A 1G5PA 3B1YA 2AYMA 4B3TB 1LQ9A 2OPBA 2V0NA 2PBFA 4RDCA 3OESA 3GLVA 4U9RA 3CC2S 3SC2A 3G2MA 1SL0A 4HAOA 3LF2A 3DO5A 3RU7A 3E3LA 2AZTA 2KJVA 3V8EA 5BQFA 5K0CA 1DG9A 2XNKA 3SC6A 4OZNA 4DDKA 1P61B 2EW9A 1FESA 2PJZA 5CVVA 2BFFB 4I55F 1KI4A 3T7EA 3PZRA 4BJ5A 2ROQA 1REVB 2VZ8A 5JE8A 5GOTA 1RQRA 4PC6A 2A8YA 5JLAA 2IZ6A 1K4MA 4YN3B 5KT5A 2C96A 2NXEA 1PLJA 1EH5A 3RDPA 5AICA 4YB7A 3ADCA 4Q0BB 1Z5UA 4XRGA 4BWMA 3PA8A 4M46A 5GMDA 1R4NA 3C4VA 5DX0A 2BKVA 1R6YA 3LDAA 5FNVF 2K7ZA 5DGIA 4QYMA 1EP2B 3U19A 2VDMB 4O2RA 3CWJA 4TYNA 4A6XA 3D3EA 1WEKA 2J0SA 4AIRA 5CK4A 1B0UA 2GFHA 4GI5A 1P4HA 2QLFA 3BSOA 1O6ZA 5CXSA 1A77A 2PYDA 3KLIB 2HCFA 4LBPA 4R5PB 3KLGB 1NFFA 5L53A 2NGRA 3W1YC 2LR0A 2UUPA 4IFYB 2EBUA 2I6XA 1QHFA 3I87A 4G5FA 3HFVA 4DQUA 4ME6A 5FNVB 1VJQA 3QE2A 2ZZNA 1YVEI 4MQEA 1ZPDA 5DLPA 5FD8A 4ND1A 4PG8A 4IUYA 3P2EA 4A47A 2QT1A 5BWBA 4CEIB 1QF7A 1QIEA 4RSHA 1DURA 1M34B 3IAS6 1QDUA 3WGYA 3U9LA 3U5ZB 3EIWA 2QE5A 3MJFA 1X4GA 1PV1A 1RYEA 3WK5A 4LDQA 3RW9A 2DCLA 3I4HX 4LOAA 2E4AA 3E9MA 4NJEB 3KT8A 1T1EA 3KJNB 2BFWA 5I3PA 2R7VA 1CUGA 4A8JC 5DK6A 3JQAD 1E61A 3JTEA 4KIWA 4AF6A 2GM4A 1AB6A 3GH3A 1T94A 1TYEB 3LH2S 3WI7A 1D2MA 3BFKA 3AUYA 4ZV4A 4I3HA 1G20A 5AM3A 3U1NA 3OIUA 2ZIWB 1C1XA 3TZEA 3UQYS 5TDHA 1ECPA 3JD4A 2HAEA 2IYGA 1J5EB 4QR1A 3TI7A 1RT5B 2W2OP 1KQGB 3AJRA 3SEOA 3SS9X 1GSHA 2YQ4A 5LLDA 1SCUA 4P75A 2AZXA 1PQ4A 3FG9A 3ZWBA 1DCKA 1XA4A 1BXNA 1KQGA 1MG0A 5JLJA 3EUWA 1MX3A 1BJTA 3H7HB 1OLSA 2VR1A 2W8BB 3VBCA 5E3HA 4EUEA 4MP8A 4NYZA 1MQAA 4DV2J 1VQLS 3T3FA 3BB5A 4XM0A 5HF9A 3QAEA 5BW6B 4A8PA 5J2PA 3JAMA 2G17A 2IITA 1QAYA 5CA1B 2SKEA 3OAAD 1UUFA 3QVVA 5EXPA 1H3EA 5AJYA 1QQBA 2QIOA 4HBZA 5AXKA 4EPRA 4DSKA 1KJQA 2XVMA 3VR2D 3TUJC 4MK9A 2CXPA 4EF5A 3MRSA 2HFOA 4MWZA 2APJA 1VCMA 4UM8B 4B7UA 4MV8A 2PUWA 4O2BA 4LZOA 4USIA 1VDZA 4IS2A 4WNAA 4CKWA 1ZGBA 1WSBA 2XVXA 1RAJA 2CLOB 2H48B 3VDNB 2YXEA 4LECA 1O94D 1VGRA 1PBTA 2CJAA 1PR1A 1U6FA 1G66A 1VQKS 1TVRA 4V0LA 2JCXA 1WC0A 5C46F 2XJ4A 1BE0A 2XYPB 1TV6B 3S28A 4QW8A 1TFRA 1N8RT 1LI7A 3CVXA 3GP5A 4KTVE 2PD4A 1YOVB 3KZKA 3ICQB 2RH3A 1M1HA 4F0JA 1RM5A 2ZJQQ 3UCGA 1C8LA 3CNOA 4XIFA 3ZE6A 3WLEA 3GQBB 2QRZA 2C9OA 2ZS9A 4QYWA 1IIRA 2R4FA 5ALNA 3PRHA 5F98A 3HZRA 2Y1WA 3Q2KA 2CHVA 5DO2A 1PG2A 1RCUA 5F3TA 2PXCA 2FIUA 1WCWA 1QHEA 5EIBC 2MKYA 5HM6A 2DCUA 2C0CA 1A9XB 3AOEA 1UWBA 1EE1A 3FUTA 2GXSA 5I4MA 1MO6A 2QXYA 3OUZA 1Q5VA 1R0LA 1NR1A 2WTAA 5AW8A 1FFCA 4N5LA 3BBBA 1VB3A 1JEEA 3P45B 4LVUA 2DUUA 1ZAKA 3FTCA 4MUAA 3K94A 4CLYA 4JC8A 3RS7A 3FKSA 1Z16A 4RNOA 2RQKA 1OILA 4AKTA 3WSVA 1F14A 3Q41A 2H7CA 1I33A 2GC8A 3M9MB 3S70A 4P6QA 4EHJA 2Q62A 2GS9A 4CG2A 3T1NA 3WWDA 2XGOA 2PT6A 4IFIA 2VF2A 4FYXA 3I1IA 1JFLA 1M1GA 3WLHA 2SHKA 5ALFA 2IHUA 2CD7A 3JVUA 2HRYA 4Y28C 1KI8A 5BY2A 3EVEA 2HFUA 3K32A 1X3LA 4WXPA 3ZBTA 4GBGA 1QV9A 1JN0A 8OHMA 3HDHA 5KYXA 3O4FA 2YWWA 1C2PA 4R1PA 2H92A 1MG5A 3LS2A 4DLGA 1ONSA 1L4BA 1ZIPA 3U44B 3CCMS 2YMMA 4LFAB 1RRFA 2J85A 1DKPA 4TM8A 1U7LA 1W88A 1YJBA 4AW9A 3N9IA 4JI0J 3D9QX 5DK4A 1U5BB 1HPLA 3I83A 1SO8A 2DY0A 2IFTA 2GVZC 1T5BA 6GPBA 2ZUFA 1XKTA 1S77D 4I2PA 2C1ZA 4BBPA 2R1VA 3OIYA 2AKYA 1QB7A 3C19A 2BFEA 1HIYA 3MXOA 3K0FA 1GG5A 2X1LA 2ZWOA 2DECA 2Z6AA 2IRUA 2Q6OA 3V2HA 3PVZA 3ND9A 2WPDA 5C7PA 4D9HA 2ZOFA 4F7VA 3OQMA 5TY0A 3DT8A 3GVPA 3WB2A 3I5BA 4FUQA 2GB4A 2BJ1A 4DX5A 3KTDA 4K7JA 1MHPA 4ISCA 1NRWA 4F12A 3OOHA 1YRQA 3VZRA 4FD2A 3P2IA 3OPMA 4C1NA 1VHQA 1ZBDA 1WXDA 4JNKA 2G07A 4INAA 4P7JA 1N5TA 3DE1X 4BP1A 3E8MA 2O8EB 1CEXA 3VYUB 2PYIA 4DYVA 5HK8A 3WVNA 2CWDA 4JB0A 1U3VA 3LW8A 3K1TA 4DLTA 4R8SA 1PV4A 5DBEX 3GRAA 3KLEB 2QQEA 4YDXA 721PA 1S49A 1Z7GA 1WF2A 3AHHA 3OCVA 1TEVA 3A0UA 2NUTB 3KZCA 4E6PA 4HDKB 3OQNA 1RMTA 1C1DA 2R3SA 4ZZ1A 2PNFA 4EDHA 1RK8A 1J07A 1Q7BA 1ZTTA 1FFYA 3GVIA 3PFWO 3ZZ0A 3I01M 4ROTA 1K0TA 2POQX 2A2CA 3V55A 3RVKA 2H1WA 5EVJA 4BKUA 3Q9NA 2VPWA 2IZ0A 2MKKA 2QGFB 1ULZA 4DLEA 2ZE2A 3CISA 3NG8A 4TTSA 2BBOA 3F9RA 1T34A 5AJUA 3ECSA 2DPYA 2ZIFA 3PO5A 2B5VA 4EF4A 2HJHA 2ORVA 1YJTA 3PX6A 3N2KA 2IY8A 1JHYA 5REQA 1DAXA 2O2SA 1XYYA 3WV4A 2HCTA 1EA7A 2HMTA 1J0EA 5LVAA 4AULA 4ZOQI 3AJDA 3U1VA 2V2QA 2GETA 3JQ8B 4J0DA 3DRSB 4UZEA 1NSTA 4KWTA 3LUGA 4KSBA 3CF0A 4PM4A 4JL8A 4PRZA 2LFVA 5L1IA 2AN3A 2Q28A 2ATCA 6PFKA 3SNHA 1E7QA 3TVZA 3LH5A 2LQ8A 2BMBA 1WMFA 2JBWA 5LA6A 2EJUA 1QE3A 1CUCA 1A1SA 3P4YA 2XYRA 1CV2A 1FMLA 5BWOA 1VPLA 2C5SA 3GG2A 5BUCA 4DI6A 2OM2A 4J9VA 3KOYA 5DG9A 4DV5J 5LP6A 4UZCA 1OD6A 4RFVA 1O9GA 1U9IC 1O96A 2BOVA 4NDAA 3IEIA 3V81A 1PQUA 4ZVKA 2JC1A 1B2LA 3GT0A 1GVNB 2DBBA 2PMBA 4EHNA 2QRGA 3HXPA 2KHCA 4BNFA 4J94A 1L6IA 1QX4A 3HVIA 3DBIA 1HLDA 5HAOA 3QF4A 1HNZJ 4JBLA 1TEZA 3U4AA 1ISRA 4RXTA 3AILA 4RZQA 3OJ0A 1HLGA 4HO1X 3LKDA 4PF1A 1JDTA 1X15A 2RAVA 5FQOA 3HA7A 1QGED 3H6GA 1M8PA 2X1BA 1S1VB 2YNIB 3LY8A 4ZT4A 4LSGA 3KHSA 3KDPA 3O2JA 4Q9DA 3RYLA 3RJ5A 5CQGA 3BERA 2WK1A 3UVEA 2Z2LA 5IAEA 3PYEA 1Z0SA 3EB9A 5EZYF 4PNHA 3TVDA 4FQ8A 4JXZA 4EQ6A 1AGXA 3PCXA 4TQSA 2QF7A 3RVOA 5DHUA 4QCLA 2IS6A 1DIAA 4WNYA 1GKYA 4UUBA 1SOVA 3RNOA 3V8NA 1M6VA 2HQ1A 1WHYA 1YFKA 2HZ7A 3G6VA 2QVZX 1ADCA 4NLTA 1TA0A 1P91A 2VWPA 1MVOA 1UBHS 1SBQA 4P5PA 1R8HA 4BKPA 3RSGA 1MW9X 2DFDA 5AKKA 4L8FA 4MRVA 3JPWA 2PMFA 4O0LA 4MFBA 2W2KA 1R0BA 4LF6B 2ZTUA 4FZVA 4LYHA 5EGNA 2B7LA 2EHDA 3B52X 4IIJA 3CDBA 1IHUA 3R3ZA 1FFWA 3PFEA 1KHVA 3A3PA 3KEOA 2W01A 1M6EX 1CE8A 4N5IX 2OPRB 4C5CA 4TWBA 4RJIA 1E6YB 2ZBIA 3VQSA 1DFGA 2Y0BB 1ZI8A 1ZN7A 2ZJ5A 1CTQA 4JLVA 1SVOA 1YDEA 4AD6A 3K15A 1H8HA 2G88A 4MB2A 1OBVA 4LSZA 2JDID 1QCCA 2B8TA 3BEDA 2FF5A 1TKXB 3CE9A 3ZDFA 1F2TB 4PR6A 2CVQA 2HVIA 1N5SA 4EVQA 3BSAA 1IJEA 4MH8A 4EGAA 1RHUB 4KRYA 4R1SA 4PSDA 2IC5A 2CLFB 3EAFA 4Q4HA 3OX2A 3UTDA 4HVCA 4R8UB 4MWCA 1MOSA 1LX7A 3RC8A 1RXEA 2I5PO 1RA6A 4QWAA 3MECB 3NP5A 3IBWA 3RSHA 1CQJB 5DWQA 2C3YA 1WCXA 3I56S 1KAMA 2ZSBA 5IU6A 3BJZA 3F6RA 1VECA 4LFBB 4MSUA 1RPTA 3ISZA 4PLZA 4Y2IA 3PHBE 1LRLA 4DV7J 3ECAA 1EKSA 1DLOA 1RYZA 3IP9A 1F4LA 2QYTA 2WSSA 3JQGA 3I5XA 4WLFA 1CS4A 2C22A 1ZH8A 3UT6A 2JJ2D 3TRIA 5J5CA 3Q2OA 2WVJA 4RD4A 3VFDA 5JYCA 4XWYA 4WK2B 4BNVA 3JWHA 2R79A 5JS6A 4MVXA 1I4TD 4EJSA 3F8WA 1TQ6A 1T5TA 2BVZA 1CS0B 1NP6A 2REOA 4FKMA 1L7VC 3ZDXB 3UK0A 3RBAA 2BGNA 3T5BA 1CJKB 5FJIA 2QL9A 4ZAGA 5B4TA 2DHQA 3TAHA 3HP4A 2NT3A 3A1VA 4IDHA 4BY9E 4YRLA 1PZEA 2GYYA 5LZ7A 3SWWA 3D1JA 3FYUB 1ENOA 4BO0A 4O4JB 3OXFA 2D6FA 1MMDA 4Y2UA 3LXRA 3ESDA 2L41A 2BMDA 3FGPA 3VH4A 1DI0A 2DR9A 2TMGA 2WTUA 2CRLA 3CJ4A 3WHIA 3B1FA 3C6MA 1Z0IA 2AN9A 2NTEA 4A15A 5EI5A 3THVA 4X65J 2HQCA 4RUHA 3RHSA 4GKJF 2W2PP 4V0RA 4F8JA 4K2AA 5HZMA 3QHAA 1Z56C 2EERA 2WHRA 1G4UR 5KTOA 2RSQA 4WVFA 2XNCA 2ZVSA 3PRBA 5I7AA 2I76A 1T9XA 5CT8A 3HUUA 3CPSA 4X65F 1HNXB 3PIRA 5EUCA 1RHMB 1WULS 3EZLA 2WIGA 1SV5B 4GKKJ 2OD2A 2ET6A 2P6RA 1HYQA 4IVRA 1DJ0A 3C5EA 1I7PA 4B80A 4MRSA 5LU8A 3R5FA 4JBIA 4M0CA 2O5DA 2NLWA 1NPDA 3UCUP 3F49S 1MAHA 1VBYA 3AC0A 3F1KA 1F60B 1ZX1A 4LF4B 1OLXB 5IT0A 1Z4IA 1W2HA 3QIDA 5KOJB 3ZTRA 4X4VA 4WI1A 1T9WA 4OHMA 4BLSA 4ZJUA 5ETPA 3EXG1 2HQGA 3O38A 1BJRE 4JLUA 3FTQA 3IUNA 2XWJI 2VBIA 3D1OA 3KJQB 1F2DA 5IVDA 4MJKA 3D6UA 3PO4A 4ED5A 3EVDA 2MHCA 4K8RA 4CMIA 4M0KA 2AA3A 1KDTA 5JS8A 1M1XB 5H9EK 2K2WA 3I9KA 4NYIQ 1IUPA 1NTRA 2PZJA 3GEMA 2B9VA 3F2IA 4BPBA 1Y98A 3IFSA 4B85A 3H4MA 4JB8B 3CCZA 4HL9A 1BKSB 1YB7A 1JALA 3M1AA 4CFYA 3KTAB 5IM0A 3A2LA 3SQDA 2CKDA 4QEDA 2GBLC 4FFBA 4GYKA 4O4JF 3UMMA 3SOZA 3AF6A 5ALIA 4D4LA 2Z1MA 2XY6A 2HFZA 2AUNA 2H7YA 4KQCA 3B3AA 4K5QA 1HR0J 4C5BA 2C4NA 4ALMA 5ITSA 3JQ9A 3ZH9B 4PW0A 1TKZA 1UA1A 2GO7A 2MT9A 1GAJA 2R42A 5AOBA 1E1NA 2QUKA 1NF8A 4UVGA 1K86A 1PS0A 1JLFB 1HH4A 1E60A 3ANMA 1R0ZA 4ZN6A 1X4DA 3Q2SC 5KZMB 1VMKA 3GROA 2OG2A 1O89A 5LQKA 1FEHA 1YZNA 2RGEA 1BYUA 1IHYA 1SVKA 1QQAA 2QA5A 1W6UA 3UZUA 1T9TA 3BGWA 4G4IA 2Q8QA 1Y7IA 1K6JA 4KR2A 3O8LA 2W83A 1JFRA 3CLRD 4C8LA 4U6QA 5ALMA 2KFNA 5BMVA 1CB0A 2AMFA 2A6PA 2Q1UA 4EZIA 3C1OA 1R0AB 1Y1TA 1F9AA 4LOLA 2F5GA 4ZQEA 1PZFA 2N82B 4L02A 3L8ZA 1EP1B 2FR1A 2YY5A 5KFEA 4UMFA 5IC4A 3RB8A 3DF9A 5G1PA 4LJ9A 1RHRB 3ZLJA 4K4ZA 4WE3A 1ODTC 3AY0A 3DE5X 1TIBA 4JX8A 2QI9F 4IOCQ 2R7OA 3PBKA 2O8BB 1SN7A 3SC3A 4DR7J 3QU5A 3HFKA 4X92A 5FBVB 4CU5A 3HVUA 2OQIA 1I5RA 1OWXA 3TTYA 2UUWA 2QMHA 1F60A 4HWPA 4JI2B 2LBPA 2ISQA 3KV1A 1W2BR 3HR7A 3HE3A 2FEXA 2EX1A 1KYWA 3CF5Q 2WJPA 1W44A 1KAOA 1V5WA 1LWXA 4J43A 2JFHA 3QX9A 3ZXYA 1KR2A 3M2VB 2P9HA 4OAQA 1MOQA 5JWOA 1G4CA 4FXOA 3H7AA 3D3KA 2F9LA 3VZPA 5K8MA 2FW6A 4W63A 3A6FA 3GFPA 3ZWCA 3SYNA 2D13A 4EY6A 2ZB8A 3EXEB 1H0HB 2D9PA 1E4EA 1S0MA 2BZ2A 3FBWA 3T5CA 4AAYA 1S7HA 4PX3A 3DJFA 4JP5A 3M3DA 3ETLA 1CDEA 4OX7A 4HXYA 4X4SA 4XWTA 1FJGF 1M0TA 1NGSA 1DDOA 3K4PA 3SF8B 3LSYA 4KGXA 3L2OB 4HX9A 4ZCLA 1YBFA 3ZZUA 4JEIA 3PXDA 4FPRA 2XB4A 3R75A 3D9BA 5C1BA 1Y6JA 5CB0A 2EKDA 4NFSA 5JSKA 2XC9A 3DSRA 1VC6A 5EWGA 4AJOA 5IF9A 4FYXB 1WUIS 1RLUA 2I1LA 3OTGA 1FC0A 1V1RA 3NVMB 5DTJA 1GQSA 3B7PA 3WKEA 5AI8A 3UHJA 4D8VA 3PRDA 4KW7A 3WO0A 5JR3A 1MT3A 4C0OC 3W5VA 2J0UA 1GXTA 4JB2A 3MMNA 5LIPA 4NZ0A 4WFJA 4PHFA 3PX7A 1XDUA 4AJ9A 3L7CA 1RQ7A 1HOXA 3OJXA 3LCCA 2IKQA 4WLNA 5AUOB 4N47A 4QOGA 2ZSUA 1XVUA 3NANA 4U9HS 1H3FA 4DSIA 2I6WA 1CBKA 5E4TA 3UUGA 4W1SA 3TMYA 2AU0A 4PS1A 1OROA 4NCBA 4OQNA 4PAMA 4NJEA 3PFGA 4IILA 3O2SB 1BQNB 4G0OA 2KT5A 1GWNA 4N41A 5DBGA 4XLZA 1NTOA 1E2PA 1D5WA 2BW7A 4FNOA 3SV4A 4RMGA 5CDFA 1P29A 2AFHB 1G0NA 1V8FA 2ZIXB 4CO2A 2B4AA 1T4BA 1ISIA 3MLAA 3IR6A 1ZGZA 3FIJA 5AK6A 4ENTA 4HNGA 5A6WA 4LFAJ 2HDWA 3Q3HA 2M8DB 1QMPA 4Z1OA 4FKBA 2VNJA 4NLUA 2WDZA 3ZZTA 3BM5A 4YQYA 3MTDA 5J2TA 2ZJYA 2XRZA 3TQHA 2HK6A 2YZGA 3FUXA 2QY6A 2W6CX 2RCNA 3FPJA 5FPHA 1SCUB 3FCCA 5KQSA 4K5RA 2D1YA 1UZDA 1XDGA 5JJKA 1R8XA 3QFTA 1FNBA 2XZPA 3X3UA 3N86A 1X6VA 4C0JA 2Q1LA 2FUCA 4MMOA 2VIIA 3GB9A 3NBYC 2JIBA 4DS3A 3PC7A 1BROA 2GVZB 4C87A 4PO8A 3PDJA 1CSEE 4F4FA 4BP9A 3SDEA 3BD7A 1OZGA 5KVAA 3NALA 3U7QB 2K5UA 4BKRA 4L5CA 3HKWA 3R0IA 3E9QA 2W6JD 3CJKB 4ARVA 1R50A 2OV1A 2VJDA 3JQFA 1JDJA 1XMOB 5B3AA 1TTPB 3WBZA 2FAXA 3OPNA 3ZQ4A 3MPUA 4G1CA 1V9OA 4NYIR 3VYRB 4BAGA 5DZ7A 4E22A 1KORA 1SH3A 4IKOA 1NN1A 5DLEA 3GH1A 3NJ4A 2PL1A 2PWPA 1G9SA 4EKGA 5E1OA 1KMMA 4LBZA 1N3LA 4RX1A 1PFVA 3X1WA 2J48A 2WIDA 1YQHA 3O91A 1GFWA 3LVFO 1UPXA 3GJQB 2H1LA 2R7WA 2FZEA 2HDNB 3O8RA 3AHFA 5I6DA 2ENWA 5A8KB 1IM5A 4WX2B 1FA9A 3V8VA 3JWJA 3FDJA 2VDLB 3G9TA 4D0GA 4AJKA 1Y6GA 4CTKA 1ZQ9A 1OZHA 3C7TA 3FKQA 3OZDA 2H65B 4NOJA 3W60A 3OM8A 2R6DA 3D8HA 5EHQA 3SS7X 4YASA 4EA7A 4M5JA 3LALA 5HBMB 1SPXA 4G4JA 1YTYA 4F3MA 4MVJI 3MB8A 5FUXA 5KNBD 3EXCX 3VKVA 2HHSA 5AJTA 1H6DA 4IDEA 1PUJA 3G2XA 5AM1A 5AP9A 5THXA 2HWWA 3LY7A 5EUBA 1ZESA 3U6KA 1XXHB 3ZXIA 4O4RA 3WJ1A 4GVBA 2UXCF 1L3IA 3ZX4A 5LXTF 1WHTB 1TF7A 1QIGA 2KYZA 2GN0A 4CKCB 1U25A 1P8AA 4JLMA 2BGTA 4U7UD 3MWYW 1M7GA 5BYSA 5EHZA 3N6XA 3PI6A 1L7BA 2H8GA 1IKYA 2UU9F 3I04M 2XYVA 4EFNA 3BXPA 2QG6A 1C3OB 1SA0B 1Y1SA 2YKMB 2KYRA 3KP1A 1RKBA 1FDDA