3K5PA

Crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
405
structure length
400
Chain Sequence
SRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALDKADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGYGNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSKLITEAKLRKMKKGAFLINNARGSDVDLEALAKVLQEGHLAGAAIDVFPVEPASNGERFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFPQVQLPPRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEASDAVLQEIREIPGTIRARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of amino acid-binding ACT: D-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Oxidoreductase
molecule keywords D-3-phosphoglycerate dehydrogenase
total genus 139
structure length 400
sequence length 405
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k5pA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA01
2Y0DA 5EN4A 4E31A 1PTJA 4JBIA 2D5AA 4XEHA 3NRBA 3PWZA 3RC7A 5DOZA 3GG9A 2BMAA 1DIRA 1E7RA 1NXQA 3DHYA 3DXFA 3UF0A 2W4QA 4OSOA 4TRRA 1MV8A 1I2BA 3V8BA 3M2PA 2VZ8A 1PS9A 2F00A 2CY0A 4UVIA 1CETA 4RF2A 1YB5A 3PFFA 5TT0A 3N7UA 4IIVA 5KCZA 2YDXA 2R00A 5FIIA 2O3QA 2VUTA 3EHEA 4RV9A 4U5QA 5U4QA 4YJHA 5KJEA 3PJEA 3IQDB 2AW5A 1IOLA 4WCDA 2BELA 1V3TA 1XELA 2EGGA 3W4KA 3GZ4A 1YDEA 1ZZEA 4AJ1A 4BNXA 4J7CA 3WS7A 1DIHA 1PQWA 4TRMA 1E1NA 1X7DA 3EVNA 3O9ZA 4HNGA 4BNVA 3VPFA 4IO1A 1Y7TA 3LT2A 2O3UA 1W73A 2YJZA 4DVJA 2P5YA 3N74A 4P38A 1NPDA 4HADA 3SC6A 2F1FA 1XQ1A 1ZK0A 1LDNA 1ZBQA 1K5HA 5CDGA 3DTTA 1NWCA 3I9OA 5H82A 3ZU5A 1D3AA 4L75A 3ZW8A 4E2WA 3E6AA 4GX2A 4DWVA 4TRJA 5EJ2A 4XGKA 2G17A 4L74A 3W7BA 2HO5A 3GGOA 3PHGA 2RBEA 3TWOA 3R3JA 1SNYA 4NH4A 4OAQA 4FQ8A 3FBGA 2D2IA 4GAEA 1Y9EA 3AFMA 3ANLA 3RVDA 2O3RA 3IJPA 2Y1FA 2CMDA 2ZTMA 3AY6A 1YBMA 5G2OA 4WLVA 3SC4A 2PD6A 3AY3A 3JQ8A 4RVFA 3EGOA 2J5KA 1P9LA 2RH4A 2DQ4A 2PKQP 3WIEA 1XWFA 2WM3A 3IP3A 4W9NA 1IUKA 4CLHA 3GK3A 3AK4A 4B3JA 4DTIA 4IQ0A 4XA8A 3PZBA 1WMBA 3NKLA 3OHSX 4OYRA 1FMCA 3NJ8A 3A14A 3WWZA 3JQDA 2OHXA 2C59A 2ZJ1A 1TT7A 3F1KA 4RGBA 5BNFA 2VZ0A 2DTEA 4HP8A 1CIVA 3PK0A 1E0DA 4KDEA 3ZU2A 5F1OA 5GMOA 3MJSA 1PJCA 3U49A 4Y67A 4O1MA 6LDHA 4M55A 5A5EA 4GGPA 1GR0A 3MOIA 4WGGA 1O8CA 2W8ZA 4ZJUA 4O6VA 3KM0A 4BO6A 1C0LA 1WNTA 2PZKA 5LCXA 4D3SA 4CMIB 1NASA 4B3HA 4M1QA 1U4SA 3UN1A 4EEXA 2C5EA 1XG5A 3DBHB 4FGWA 3HB5X 3AJRA 2GUGA 1A4UA 4D41A 5JXWA 4MVJD 4NBTA 3GHHA 3VH3A 4BNYA 1Z73A 1TT5A 5EPOA 4BGVA 4Y6SA 3DZIA 1Z7BA 2FPGA 4NMHA 3U4CA 5IF3A 1U9JA 2OO5A 4D3DA 4PRLA 3OFHA 4ZN6A 4M49A 4YT2A 2Q4BA 3LF1A 4JGBA 5DP2A 1C1DA 3JQ8B 5JLAA 4PLPA 4GI2A 1HE5A 5JDCC 4IJKA 1ZSVA 3C3XA 4B4UA 1VKOA 2A9FA 5CDUA 2ZB4A 1JLLA 4KTTE 3OJFA 3AW9A 4OH1A 5L3ZA 3TN7A 1X1EA 2UUPA 4N5LA 5T41A 4X84A 2X7HA 3QRWA 4OOEA 4CLDA 4OMUA 1UZLA 3DZFA 4NZ9A 1D8AA 3T7EA 4M8SA 2BRUA 1EVYA 4KDFA 1C1XA 1G0NA 2C5AA 4ND3A 3DBVO 2H1SA 4RDHA 1R4NB 1J4AA 2Q2VA 5A4DA 1HDYA 4ND4A 2PR2A 5L51A 2XXJA 4Q3CA 1PEDA 4B7CA 2ZHOA 5GY7A 3H9QA 3E9MA 3RD5A 3ZI0A 4NJOA 4AJ2A 4BNWA 2V6BA 1KS2A 1GZ4A 1XEAA 3F47A 4BNHA 3UOGA 4I8XA 3WYCA 2PFGA 4DRYA 3RIHA 3DBRA 4E5NA 2ZTLA 3O38A 4HBGA 2FPPA 4FFMA 4TVOA 4DL9A 4I9UA 2NWQA 1FDWA 2C7VA 2VUSA 1Q1NA 3ZV6A 5BQFA 3HDYA 4IJVA 2JL1A 4WUVA 1YB4A 2PWZA 3ITDA 2B37A 4LK3A 1GCUA 4H16A 1V8BA 4I5EA 1QYXA 3CZMA 3U09A 1QV6A 3BHJA 5F3RA 5L7WA 3LK7A 4LRTB 1EFLA 5BT9A 5CDSA 3DZJA 3F4BA 2PNFA 4AJOA 3DONA 3G3EA 2G82A 2HDHA 3MJVA 5JDIA 3IKTA 3VHRA 3DMTA 4GX1A 4G5HA 5JYDA 3H3JA 1PJQA 2JOQA 1ZJYA 1CJCA 4XRRA 4YAGA 3L4BC 3UAGA 4QSMA 5JCJA 2HK7A 4G2NA 3WG9A 3C7DB 4YXFA 4CMEC 3LT0A 3D4PA 5L4LA 1YQGA 3QY9A 4KUEA 1ZSNA 2R2GA 5EL0A 4G81A 3I6QA 2VTDA 1IE3A 3PTZA 1SCUA 4BO8A 1I2ZA 5DBIA 1ISFA 2VOJA 3VPGA 2NADA 4D3FA 2PGJA 4GVLA 5JBIA 1NTOA 1ZFNA 3D3EA 1WWKA 3AI1A 3OM9A 4PG8A 4IQ8A 2AQHA 3GA0A 4PRKA 1R4MA 4QO8A 3C85A 3SEFA 3ZWOA 1ZNQO 2FMUA 3H4VA 3PYMA 4OOFA 3C1AA 3RJ9A 1DDOA 1LLQA 1WW8A 2FZEA 3JD3A 5JW6A 2HKIA 3DB2A 2VYND 3IAHA 4PFJA 1EFKA 4R3WA 3JQCA 3V1TC 4BNMA 3HFSA 3V1UA 4FOSA 2FWMX 4CUZA 3WGQA 4Y98A 1LQUA 4N5NA 1VSUA 1L7EA 4XR4A 5JMWA 1UJ6A 1DC4A 4P4NA 1KS9A 3DHWC 1LSJA 1DEHA 3CE6A 1LRJA 1EDOA 4E13A 2FY8A 3IJRA 4TWRA 4PN3A 3INRA 4Y6PA 1XHLA 1SOWA 4EUFA 2VHXA 4J1TA 1H6AA 2I65A 1RM3A 2IZ0A 2GF2A 4B3IA 3N0VA 1SB8A 1M67A 1QG6A 2A4KA 3RUCA 3VOSA 1QLHA 1I32A 3E48A 3UFXA 2X22A 2YV2A 1GZ3A 3I1JA 4NIMA 4R51A 3OF2A 3S2FA 1DPGA 1T2DA 2EEZA 1PZFA 3RFXA 1E6UA 2BLLA 1RM0A 4FW8A 1LDBA 4CM1A 4NU5A 5HBRA 3DZBA 3KTDA 1IY8A 3B1FA 1A9ZA 5FI5A 1P33A 2DU8A 3GDOA 3TOXA 4WKGA 4MINA 1QYWA 4RF3A 5TRTA 2AG8A 2FP4A 3AUAA 4IJWA 5C7LO 5I7FA 5AOVA 4YT4A 3FI9A 2Q99A 3ZDFA 4ALJA 4N18A 2HMSA 2JD1A 4KUGA 3F5QA 5U1PA 2PKQO 4ZQBA 3JQ7B 3FR8A 4AJPA 4B79A 5BR7A 2HCTA 3KV3O 1HE4A 4RVHA 2AHRA 4XQGA 3GEGA 4BNUA 1SMKA 5TNXA 3G0OA 3GPIA 4MKXA 4BO0A 5A03A 1QV7A 4RQUA 4CM4B 1AHIA 3L6OO 3Q2IA 3U4DA 4NBVA 2B4RO 3M1AA 4D79A 3Q0EA 5A06A 4FJ2A 1F0YA 2ZATA 1GCOA 3CTMA 3DOCA 4CLOB 4MKZA 5DZSA 2FPIA 3K96A 3RFVA 3E9QA 3GN2A 3WOHA 3ZWWA 1T24A 1WZEA 2PD3A 5FI3A 4QT0A 2Z5LA 3GGGA 3ICCA 5ITVA 3WICA 1YS4A 4BS9A 4J1QA 3SJ7A 2B36A 3GR6A 1I5RA 2W2KA 5HRUA 1JKFA 3EMKA 5IJZA 2X8LA 4FJ0A 5F1KA 1GPDG 3OFEA 1AXEA 2EG9A 3EY4A 4PG4A 4TRNA 5KIAA 5IN4A 3TZCA 5MGBA 5TLSA 1UDBA 1E3EA 3B1KA 1FXSA 4FCCA 4DIBA 1E3LA 1O5IA 5F5NA 3DC2A 1C14A 1HF3A 3MJ4A 3QSGA 5AXDA 2Z1MA 1VPDA 1UAGA 1KERA 1RYEA 3RC2A 2E4AA 1CRWG 3JD0A 3TSCA 4CMCA 1GUZA 3E5MA 2Z1NA 4P4GA 2NU9A 2EXXA 3NGXA 5A9SA 4MVJM 4CR8A 1N92A 3WR5A 4R4JA 4EGFA 4PLTA 4EDFA 2MDAA 4HFRA 4NJMA 1PS8A 1VJTA 2V7PA 4ZD6A 5BNTA 1K6JA 3I3OA 1M6WA 1JAXA 4J9VA 1LC0A 1BDBA 4YRAA 4NFSA 1CEQA 4R9RA 1H6BA 1U8XX 1B0AA 2Y1GA 1O8BA 4IBOA 3ORFA 4LSWA 3JQEA 1Y7PA 1YVEI 4K26A 1BWSA 4PLVA 3K8ZA 5A9RA 1BHSA 1KYQA 3V2GA 4BKUA 1N2SA 3EUWA 1WDLA 4GLLA 1UJMA 2Q46A 3RAJA 2RQKA 2GYYA 3IOYA 4YRBA 5JAMA 1EK5A 3NDIA 2ZB7A 1KIFA 3IS3A 4BV8A 1PJBA 4FFNA 3BMNB 2AEJA 2NQ8A 1GQYA 1T2FA 1H5QA 3OIFA 5G0VA 3EK2A 1SB9A 4KWIA 3WQRA 2QMXA 4RO0A 2VHYA 2WYWA 2NACA 1NHGA 4RVUA 1LC3A 4TMFA 4IDAA 1DIAA 1O0SA 4JJFA 4DLBA 1WLYA 4L9RA 3BHIA 2BD0A 4WK6A 3Q2KA 4NMLA 4L4XA 1PJ2A 1VJ0A 3BMCB 5KJ6A 3AM5A 1TEHA 1JQBA 3E03A 3INTA 1LK5A 3MJEA 4Q9NA 2YYYA 7MDHA 1ENYA 1O6ZA 2Y1OA 1P1RA 2C2YA 2XXBA 1AE1A 3K92A 1X0XA 1PJ4A 2D4AA 1ZXLA 1GD1O 1NHWA 4K9DA 4J90A 3K2BA 1EQUA 1PR3A 1PJSA 4OGWA 4R54A 3OFSA 4AG3A 4DLAA 2VQ3A 3DZHA 3JQFA 1KEPA 3O03A 4EZBA 5KJCA 4WEOA 4IXTA 3GMDA 4U8GA 4PWUA 1VKNA 2UYYA 3RU9A 1ZK3A 3HG7A 1IB6A 4MP6A 2CDQA 2FZWA 3TDKA 3JYQA 3LVFO 5ADHA 2I3GA 2OBYA 5JE8A 2EKPA 3JQGA 5H81A 1KVRA 1BDMA 4IQGA 1ENZA 5LC1A 1PGNA 2X5JO 4J7UA 3V5NA 3VDRA 1R6DA 3NUGA 1HLDA 3U62A 5B1YA 3TZQA 2PTGA 1YONA 3ANNA 3GVCA 4NU6A 3RUIA 3OSUA 2JCXA 1AGNA 4J3FA 3QW2A 3NT5A 4CQMA 5EIOA 4BKRA 3BXXA 4IZIA 4TVBA 2O2SA 4U6SA 4PZDA 4CMGA 1ZW1A 4CQLA 3SVTA 4M54A 4E3ZA 4NI5A 4A10A 3Q3CA 2H6EA 4PZEA 1RM5A 3H9UA 1U3VA 1KEUA 1P0CA 2NVBA 4MVJA 4FC7A 3WDSA 1ISHA 2OZPA 4TZTA 4ND1A 4DXHA 4CUJA 1EBFA 1E7YA 3WJ7A 5F21A 3AI3A 3BZUA 4HNHA 2C82A 2J3IA 3CH6A 4DQVA 2IEBA 2XOXA 4BNFA 4KUHA 1SOVA 2FGCA 1XSEA 4E6PA 3JV7A 1PSDA 4BNKA 2VRCD 4CL3A 2EP5A 1RJWA 5CEEA 1UZMA 3GVPA 3LLSA 2HRZA 2UUOA 3C8MA 3K6JA 3K73O 5KOIA 2VNAA 2BKAA 4MDHA 1H2HA 4J49A 5HWSA 2AQIA 5G4LA 2JCYA 3JQFC 2OORA 4PLGA 4BNIA 4DMMA 3QVOA 1DRWA 4DPLA 4A27A 1LDEA 3RC9A 2B0JA 3UXYA 2EGHA 2Y68A 1M75A 3OH8A 1T4BA 1E7WA 5FEUA 1WPQA 3GNQA 3KSUA 1YE3A 3ZCXA 2DVMA 3KZVA 1VC2A 4AJKA 4ZGWA 4Q3DA 1ZCJA 5L53A 3E18A 2JFHA 1X15A 4RDIA 4RL6A 4WE3A 1Z74A 4U0KA 3WIDA 5CEJA 1CYDA 2X1HA 3S55A 4A2CA 1FDVA 4WECA 3GEDA 3UVEA 4B8ZA 1ZJZA 3H5AA 2ZCUA 3CIFA 4JX8A 2RIRA 2Y67A 4HUJA 5HS4A 4BGIA 2VYVD 1M66A 1UXHA 5CG2A 1PL8A 1N9GB 4ZQHA 5TS3A 4CLOA 3AUTA 3NAQA 1ZPVA 5JS6A 3BMNA 2B69A 1YDWA 4Z3KA 3B70A 4WLUA 1I36A 3VKUA 3GG2A 4WLNA 4WLEA 1LA2A 4PGFA 2J0WA 4BIIA 3ZNNA 4UULA 4R5MA 3PQFA 2AEMA 4WASA 4J4HA 2J0XA 1F14A 2JAPA 3HN7A 2AQKA 3LOUA 3I9NA 1WAMA 1LDYA 1JVSA 3I4FA 3ONEA 4URFA 4IGEA 3UCEA 5IAAA 5DDIP 2V6FA 3QVTA 4YAJA 5IDWA 2Y1DA 2DFDA 4JROA 4BKOA 5GZ1A 3INGA 5IT0A 1VRWA 3ZGYA 1ISMA 5I9NA 4UUOA 2O7SA 1PL7A 2VN8A 3F5SA 4D45A 2GLXA 3TZHA 5A9SB 1TXGA 5T6BA 4W6ZA 3FD8A 4IGFA 3ZU3A 2Y0CA 1LNQA 3VZSA 3QWAA 4I9NA 1PZGA 3O1LA 2QIOA 2HUNA 2GASA 3HDHA 3KXDA 5HA5A 2YFQA 5T57A 1ZVMA 1E6WA 5IT4A 3R0IA 4IJUA 5JDIC 4YPOA 4PLHA 4CM9D 2DM6A 4YRDA 5L95A 1E3IA 2X86A 4JLWA 3VVCA 4TKLA 3IL2A 4Z3DA 4BB6A 1X13A 2WSBA 3OBIA 1H94A 3STHA 2BGLA 1DFIA 3GHYA 3IP1A 3ICPA 4GGOA 4YJGA 3TFOA 1GDHA 4GX0A 3D5TA 4CMKA 1NPYA 1RWUA 4Y6RA 1B16A 1E7SA 3WB9A 2JD2A 1Y6JA 3OFGA 2IRWA 3K30A 3MEQA 3VC7A 4MKRA 5A02A 2J5QA 3FSRA 5IDYA 4B4VA 5CDYA 1E3SA 4XDZA 1QKIA 1ONOA 4LCJA 4LUBA 1HZJA 4GLOA 1HE3A 4MIEA 2LQJA 4IPTA 2Y0EA 1UUFA 4L4RA 5JC1A 1WP4A 3AOEA 3E5RA 5COAA 5T5QA 3FHLA 1KEWA 3UH1A 1NM5A 1Y5RA 3H5NA 2BGKA 3JQ7A 6ADHA 4A5OA 1UP4A 3GUCA 4UUMA 3TJRA 2NVWA 1U28A 4MVJF 2AEFA 1XTZA 3O26A 4CM5A 2EIHA 4ZQFA 3TFQA 4E5MA 4FFOA 1UR5A 4NHEA 4R1NA 2FSSA 4B8WA 1P0FA 1LSSA 3JYPA 3GY0A 1B14A 3DQPA 3H9JA 4CM3A 3HE3A 4OO3A 4AJLA 4MP3A 3PLRA 4YJGB 5DN9A 4CLXA 3F9IA 4AJJA 4BQRA 1EZ4A 5JJBA 1N7HA 1A72A 3OICA 4INAA 4W7IA 4BHTA 2VWGA 4H15A 1U3UA 3D5QA 4R5HA 3CZRA 4FIZA 1PGOA 5L7YA 3FPCA 2BFPA 4EBFA 4YDRA 5AQ1A 5IZ4A 1LQTA 2C20A 1EE9A 4ND2A 1X14A 2CUKA 4HFMA 2EW8A 1U3WA 3AUUA 2VYVA 1P1FA 2O3JA 4FBGA 2Q2QA 4PZCA 1QR6A 1Q7CA 4IMRA 5JNLA 5A3JA 3KSZO 1UXIA 2B35A 2ZJ0A 4A26A 1GQ2A 5JCJD 2NVUA 3DMYA 3O8QB 5K9ZA 1ZMOA 4YBZA 3S1TA 4FR5A 3C1OA 3ASVA 5ILGA 4QECA 4J6FA 5IXYA 3PYXA 2O4CA 1UXKA 1Y8RB 2YHIA 4GBJA 4NBUA 1A4IA 3S8MA 5FYDA 1I33A 3FNEA 3TRIA 1NQ5A 5DP1A 1ZEJA 1HTBA 3MJTA 4J0FA 4OJNA 4XGIA 1T1SA 1KY5A 3MCVA 8LDHA 1U1IA 4RPKA 1PU2A 3RUHA 2IE0A 2NTVA 3BTSA 1GFSA 3L4SO 3A4VA 5F5LA 2B4TO 3GH3A 3PP8A 1J0XO 2GPTA 3DTYA 4R69A 4E30A 2H5LA 4UEKA 1PWXA 4TROA 5TT1A 1LRKA 5L45A 3GEMA 1AN9A 1UDCA 1QYCA 3HUDA 4QXMA 4XB1A 1MFZA 3KYDB 3WJAA 1K0UA 4EI2A 1UAYA 4LVUA 1PIWA 1PJTA 1U7HA 4WOKA 4R68A 1ZXBA 1UXJA 3W1VA 1TB4A 2FRDA 4GPD1 4OXYA 1OMOA 4RLHA 5I9LA 1GTMA 1NAHA 5I8ZA 3BMOA 1Q2XA 2VWHA 2H9IA 4GH5A 1PWZA 1P1KA 3ITKA 3P96A 2AA3A 3CUKA 2RHCA 2ZB8A 1I3NA 4ROSA 1IZ9A 2X9NA 3GN1A 4IDEA 1QXSA 4I1IA 1OBFO 4I08A 3ZWPA 3KBOA 1BXZA 2XF8A 3DWFA 4MIYA 4FSHA 1XYGA 1OC2A 1K6IA 1VM6A 1MXFA 1HDOA 5THKA 4TQGA 3BIOA 2B4QA 3WQSB 4ITUA 4HFNA 4CV2A 4BNJA 1LLDA 3I23A 3PJFA 2E48A 1H6DA 4CODB 1B3RA 4XX0A 1QORA 1C1XB 4W99A 3IXQA 5T8KC 1MGOA 4PG5A 1EVJA 1IYZA 3BAZA 3PIIA 4EW6A 2FR1A 3AB2B 1PQUA 1R12A 3JQAD 3UCXA 2IDZA 2G0TA 2VHZA 3GDGA 3U7JA 1JVBA 1HYGA 1P1HA 2BH9A 4O5OA 5A04A 2GZ1A 3TUZC 2WE7A 2YW9A 2I67A 3GUYA 3DL2A 1SEPA 3GQVA 2VNSA 1GADO 3JTMA 2JKVA 2D8AA 2J5RA 3GOHA 1EUCA 5AYVA 1BXGA 4AJNA 4DYDA 1LX6A 2FSVA 3EC7A 4GVXA 4J7XA 3HHEA 1U7TA 3RQSA 1Y8RA 2YHIB 3OFFA 1WDMA 3MTGA 2EP7A 4HFJA 4AJEA 3FNFA 1ISIA 2YFHA 3P2YA 2TMDA 3L9XA 2SCUA 1NR1A 2GSDA 2J3HA 1LRLA 1E3JA 3RBXA 1PX0A 5IZCC 3GDFA 1I30A 3M6IA 4DBVO 3F46A 5DCUA 4ZQGA 3ZWXA 4BKQA 1I2CA 5C5IA 3GFBA 4J1SA 1G6KA 2Q50A 5ITWA 2GERA 3FR7A 1DXYA 5ER9A 3TNLA 4QFDA 3H7AA 3QJ5A 2BHLA 1WVGA 2HJSA 3CMMA 5TSDA 3CPSA 5TX7A 4DA9A 1GUYA 5L4NA 3WQQA 2WDZA 5CPBA 4FB5A 1A5ZA 3OECA 1DIGA 1JN0A 1R15A 3H65A 3ZV5A 2AE2A 3GRPA 1UZNA 3MJCA 4QEDA 2OP1A 4RORA 3L6EA 3PI7A 3L0DA 1LXCA 2P4HX 5JMPA 1HYHA 2NUAA 5T64A 3ZW9A 7ADHA 4GMKA 4NBRA 2YQ5A 1D4FA 4YJFB 3GFGA 5EERA 5MDHA 3G79A 3EAGA 4DBZA 1Y8QA 5KNLA 5K6AC 4MO2A 3MTJA 5U9CA 1XKQA 3EW7A 3IIEA 1LBEA 2BGMA 3PXXA 4AVYA 2NNLD 1DJNA 4GSLA 1YGYA 4FS3A 4JNKA 4B4WA 1DHRA 1ZK1A 1PZHA 3OA2A 4AJIA 2QSWA 1EVIA 5JDCA 3F3SA 2OMEA 1JA9A 1BXGB 1I01A 3I9JA 2DBVO 2JFFA 4JJIA 1V0JA 3BTUA 2PZJA 3AFNA 3AWDA 3BTVA 3GT0A 3KEOA 2X5OA 5KVCA 1Q7BA 5IZCA 3U3XA 4XJTA 2BI8A 2VRBA 1W6UA 2JJYA 4G65A 3PHLA 4JP2A 5B12A 2NYIA 3GZNA 1C1DB 4IIUA 1MX3A 4EUHA 1U4OA 3LDHA 2P9CA 3AI2A 5COQA 1HWYA 4LMPA 1D1SA 4F6CA 4YAKA 3EYWA 3H9GA 4OKIA 1N9GA 5CAEA 5G0WA 2PC6A 2X58A 2J6IA 2X0RA 3DAFA 1YJ8A 1Z7EA 2EKQA 4FDAA 2CNBA 3Q11A 4IDBA 3LSYA 1CQJA 4K6FA 3Q6IA 1DFGA 1KVTA 2QYTA 2C29D 4FN4A 3PHIA 4UUNA 4JXKA 4L4SA 3RSHA 4LRSB 1K89A 2QHXA 1T2CA 3RUEA 1S7CA 4YR9A 5TGDA 2NU6A 2QRLA 5CP8A 1TI7A 2X0IA 4NR0A 3UCFA 4U7WA 5T67A 3DAGA 3H2SA 1EQ2A 4BO1A 4Y8VA 4DYVA 1QLJA 4PLZA 5I7VA 2EW2A 1B8UA 3U4HA 3WGHA 2PD4A 3GC6A 3UKOA 4FFPA 4LCEA 3WGTA 4GKBA 1NP3A 2DC1A 3FWNA 3SJUA 3ENKA 3AB4B 2R6JA 1D1TA 1GYRA 1ML3A 5AXBA 3W8DA 3L4BA 3D64A 4ND5A 4ZHSA 3HN2A 1WXDA 4O59O 2JHEA 3R6DA 2VOEA 1LEHA 4BUCA 3KOUA 4HV4A 2GN9A 5I8WA 4XJSA 3ROPA 4IINA 3JYLA 1VSVA 4MVJG 3H3FA 4CLRA 1NNUA 4ID9A 2RCYA 4L76A 4WLOA 2PZLA 2EV9A 4C7JA 3GVIA 4RPJA 1HYEA 2IYPA 2PY6A 3FPLA 4CMHA 1U8FO 1XGKA 1R4MB 1WDKA 3QLJA 4XKJA 3U0BA 3SBOA 1ZO8A 3S2IA 1BW9B 4K1LA 5L7TA 2GCGA 2W90A 3G49A 3PVZA 2Q49A 4NG5A 2JD0A 3ADOA 3PEFA 4R3NA 3S2EA 3ZWAA 4BGUA 4D7AA 4BNGA 5IS2A 3UICA 1P3DA 3MAHA 4PLCA 1ULSA 2VTEA 4XYGA 2B5VA 3F6YA 3FNHA 3NRCA 2GO1A 2DTXA 1A9YA 3W8FA 5B4UA 3GNSA 1N1GA 3DZKA 3JQ9A 4L73A 3PHJA 2F8MA 1B3BA 4A03A 2G76A 3ZU4A 1V6AA 4JBHA 2NLOA 1LK7A 3Q9UA 4YVFA 1B8VA 3DBLB 4Q3BA 1I8TA 3OQ1A 5KVSA 2HSDA 1HL3A 3PIDA 4YQZA 1KVQA 2O48X 4RPGA 1ADFA 1A27A 4M89A 3ZWCA 1XA0A 1DC3A 1N1EA 3W6ZA 1YRLA 2V6MA 4E4YA 9LDBA 3WLEA 1PJLA 3GMSA 1E5LA 3DBRB 4J2HA 4Z9FA 3Q9NA 4EJMA 1BGVA 3UGKA 1Z45A 1TA4A 3VZQA 4RPLA 3I5MA 2BFMA 2W2LA 2OXIA 4XR9A 4DGSA 3HJAA 2C7GA 4DUPA 3I83A 4E0BA 4NDNE 4OL9A 4UVGA 1Y8QB 1I10A 4CM8B 3ZHYA 3RWBA 3WMWA 2WE8A 3EVTA 2GRAA 4XWYA 5JCXA 4YT5A 4Q3EA 3JSAA 1CQIA 4YTEA 2P91A 3ZZNA 1SPXA 1YL6A 2D1YA 1TVEA 1NFQA 2DBZA 2X9GA 3C7CB 3LF2A 2RAFA 4P22A 3RFTA 1HDRA 3HDQA 2AQ8A 3MWEB 3JYOA 1X7GA 1HLPA 2E37A 5KVVA 2X6TA 4CM4A 2O50A 2PH3A 2OFPA 2QZZA 2HJRA 4F3YA 1Y5MA 1BSVA 2IODA 2I9SA 1B15A 3O4RA 1ZK4A 4H7PA 1P45A 4OIMA 1BW9A 4PVCA 4LMRA 3QVWA 3AM4A 2HMWA 2IXBA 3OA0A 4Q39A 2QRJA 4KWHA 4UVDA 2ZQZA 5TF4A 4D46A 1IHYA 1BVUA 2I5PO 4ALMA 2GN4A 4JJGA 1MG5A 1UP6A 3AU8A 4JIGA 4R9SA 3P7MA 1F17A 5BSGA 1YOVB 2Y05A 5G4KA 2ZTVA 2YY7A 3KYCA 3PHHA 1VLLA 3DBHA 2GZ3A 4J9UE 1TLTA 2NQTA 3RBZA 1WMAA 1YL5A 3PQDA 4LISA 4DREA 3BHMA 1D7OA 1T26A 2Q3EA 3KVOA 3TUIC 1ADGA 2UVDA 3I6IA 1U5CA 3KB6A 1IZ0A 2X9VA 5HM8A 4LVCA 4IUYA 1SBYA 3UW1A 1XDWA 4CM9A 1Z75A 1LLCA 1FK8A 4IMPA 5G0SA 2VCYA 1UDAA 3NGLA 5JPIA 4II3A 2Z95A 1OC4A 4M8LA 4JN6B 5H83A 4E12A 1RPNA 4DMLA 3U5TA 5I7EA 2CFCA 3VH1A 4MVJH 1R0LA 5B4VA 4WNIA 3GVHA 2EWMA 1MXHA 2F1KA 5F1PA 1ZMTA 4BNNA 4BO5A 4UAGA 2WWRA 4B7UA 2VUUA 4BO9A 4NJMB 1NPTO 1YQXA 3EZYA 1YKFA 5B4TA 1GEGA 3B1JA 5IN5A 2O7QA 1I3LA 2W2LD 3DZGA 4RCVA 3HSKA 5KJ1A 1YBAA 2AXQA 1DC6A 3A28A 3P19A 4XQ9A 1F8GA 1EEHA 4QX6A 3TQHA 1NFRA 4I5DA 2D0IA 4QTZA 3GZNB 2AMFA 4JCOA 1XCBA 3ZWYA 3PGXA 3JQAB 4GWGA 2Q2WA 3BYZA 4IY1A 2DPHA 4M86A 4GX5A 1UXGA 1H9AA 1P74A 3ENNA 2HU2A 5KKAA 1UJ4A 1ORRA 2ZB3A 3QV1A 4KTVE 3HFGA 3MWBA 3JQBA 1YOVA 5G4KB 3WSWA 4XIJA 4XZ3A 4W7HA 3KLPX 4E5KA 5IG2A 2J8ZA 3TUJC 2QG4A 3W6UA 1JAYA 1HT0A 3CINA 4X54A 3LU1A 2W2KB 1G1AA 3ZNQA 1U3TA 4GO7X 2IZ1A 4BO4A 3ONFA 1KVSA 3FN4A 1RYDA 4A73A 5FWNA 5JAIA 5KKCA 3D4OA 4ZU3A 2IEDA 3KYCB 3KSDO 3KUXA 3WMXA 3OQ6A 1BRMA 4L8VA 1T2AA 4CV0A 2A35A 1UJ5A 4EEZA 4ZQEA 3WYBA 4BL5A 3RC1A 2Y1EA 1V3UA 1XLTA 3QVSA 5A05A 3WLFA 4F46A 3QWIA 2J3JA 5COBA 4AJHA 1R0SA 3VPXA 1E5QA 3PQEA 4FOOA 2CDCA 4A0SA 2ZKLA 4UVHA 3CEDA 2Q1SA 3DFUA 2CVQA 2BI7A 3X2EA 4BKPA 2OGUA 4XYLA 2DTDA 2V65A 1HSZA 2G1UA 3I9LA 1QMGA 4E2YA 5THQA 1P1IA 2HLPA 4FC6A 2DFVA 3HNPA 3TL2A 4GKVA 3V2HA 4YAIA 4RZIA 4WCFB 4I5FA 3LYLA 1HEUA 3OBBA 3SX2A 4BNLA 5L4SA 1E7QA 3ZN2A 1R66A 4BNZA 4E33A 2H9ZA 5DOVA 2YV1A 2QW8A 1W8DA 1Q0QA 1T4DA 5AXCA 3FWZA 1GY8A 1NVGA 3TOZA 4YB8A 2YHUA 4CQLB 1C0KA 2NTJA 3DOOA 4HXYA 4MJLA 2R00C 3G1UA 5ENDA 3WFJA 2POQX 1E6EA 2ILTA 3QP9A 3UUWA 5C7IO 2GN6A 4N54A 4BV9A 5BSHA 4NK4A 4Q3NA 4Q3AA 1YBVA 2TMGA 4GO5X 3DHNA 1DJQA 1MB4A 2UAGA 2QYSA 3MWDB 4U0JA 2Y66A 2DTJA 4J0EA 2YZ7A 1DRUA 2NTNA 3LC1O 3RI3A 5LDHA 3PWKA 1EVZA 1P44A 2BFAA 4OSPA 2PKRA 3RCBA 3V2UA 3WBBA 3QWFA 4XGNA 1VI2A 5FF9A 4ALNA 4CJXA 3I9MA 3BMCA 4EJ0A 3JD4A 1JKIA 5CEFA 4TZKA 2EHDA 3ENQA 3IKVA 4WCFA 1F06A 3DBLA 3Q1LA 1RKXA 2JFGA 4F45A 2LDBA 1HDZA 3CMCO 5ICMA 4N7RA 1CWUA 4PLFA 3QE3A 4MP8A 2BFOA 1ZIDA 2WEKA 3K31A 3EZLA 4XB2A 1C0IA 1V35A 5CHEA 2P5UA 4IDFA 5ICSA 4IZHA 3S2GA 1SC6A 5DBFA 2QRKA 3LT4A 5AVOA 3JQ9C 3VPSA 5ES3A 2X0JA 1GEEA 1NQTA 3WGGA 1P1JA 3VZPA 4RLSA 3PFWO 4CLRB 3WSVA 3RKUA 3VVBA 4YT8A 5LDGA 3K2EA 1SAYA 2HK8A 4OQYA 1R16A 3KHUA 1E1KA 3D1LA 5EINA 2AE1A 2GD1O 2OOSA 3JD2A 3H9EO 4IDGA 2PV7A 1MLDA 4FJ1A 3RBVA 3PDUA 4ZRMA 4E2XA 4MOWA 1VL6A 3AOGA 4RVGA 4YWJA 3NT2A 1M6HA 1IPFA 1HSOA 1MA0A 1KY4A 1B8PA 2VYNA 1RWBA 2XAAA 3WTCA 5DF1A 5A5FA 4BO3A 1DB3A 4PLYA 2PGLA 1U2GA 1IULA 4IDCA 2ZTUA 4OM8A 3PRJA 2PK3A 1ARZA 1LDMA 1P31A 3DFZA 1EBUA 3ULKA 4MVJP 5FFFA 1OFGA 3IUPA 4PG6A 2EJVA 3GVXA 4XRGA 1DLIA 2H63A 3OETA 1PGQA 4AJ4A 3NDRA 1ISGA 4HKTA 4IM7A 4HX5A 4DQXA 3ADPA 3OJLA 4Z0TA 2I9PA 4YACA 2CD9A 1HZZA 1QRRA 1LLUA 1S6YA 1ZK2A 1DC5A 5TIIA 2NM0A 2VHWA 2CVOA 2EJWA 3VH4A 3BTOA 1AHHA 4RVDA 4UREA 2E6UX 3AM3A 4L0QA 5JO9A 2I99A 2WD8A 4CR7A 4OXKA 3ZHXA 1GL3A 1AUPA 1DLJA 3RROA 2ZYAA 4WOJA 1IPEA 4CPDA 1YWGO 5KWEA 1ZEMA 3D3WB 1A71A 1DBVO 1IHXA 1V3VA 4HWKA 2CVZA 3CEAA 4K6CA 3NT4A 2C54A 3PWSA 3WFIA 2DKNA 4WLFA 4Z9YA 3NX4A 4FD3A 4XQEA 1BXKA 1JTVA 3GGPA 4GMFA 3OEYA 3WYEA 3WWYA 5IXSA 5L40A 1BVRA 4Z0PA 4BNTA 3L6DA 4YA6A 1P77A 3GLQA 3ONDA 4CM7A 4Z6KA 1JWBB 4QFCA 1R4NA 3A9WA 1IL0A 4AFNA 3JCZA 4E5YA 5I7SA 1XU7A 1GYPA 3SXPA 3WTBA 4XD2A 1DAOA 4DPKA 1GU7A 5JO0A 4IS2A 1DOHA 4AL4A 4CV1A 3QVXA 1MC5A 2Q1UA 3PDJA 1U5AA 3C1TA 1DAPA 5T8KA 1X1TA 1HETA 4D44A 4D43A 2VWPA 5EESA 3T4EA 4UEJA 3ZV3A 2CSUA 2NVUB 3AY7A 1CF2O 3GAZA 1K3TA 4IXWA 4BVAA 5ENVA 1BG6A 3DHEA 2WYUA 1NVTA 5DULA 2JHGA 4JP3A 2O2YA 4RVSA 2X23A 1QYDA 2ZQYA 3G17A 4NK5A 2D59A 1NBOA 3HZZA 3WXBA 3QWHA 4BO7A 2G5CA 4TKMA 1XR3A 2JAHA 4KMSA 4MIOA 1M0SA 1LI4A 1OOEA 3MZ0A 3LLVA 1JWAB 1ZH8A 3BMQA 4RF5A 2CZCA 2YQ4A 1YH3A 1KOLA 1VL0A 1OAAA 4RQTA 3VAZA 1GUFA 3HQ4O 3KLMX 5HS6A 2FR8A 3ST7A 1QP8A 1F8FA 2JHFA 3OJEA 3IBWA 2P2SA 3VH2A 4E2ZA 5CDTA 3GNTA 3H5RA 2X5KO 3BA1A 1EK6A 3KRTA 3QQPA 3N58A 4KP7A 2VHVA 3VZRA 2HRBA 1PS0A 4YJDA 4II2A 1Q7GA 2ZCVA 4E32A 1E1MA 1K2WA 4YYZA 3DDNA 2WMDA 3HHPA 1E3WA 1FDUA 1T2EA 1LJ8A 3F4LA 3D4NA 3WBFA 2P68A 3JQGB 2EERA 1DSSG 3S1LA 1YJQA 4GL4A 1LSUA 3TPCA 3ETEA 1NQOA 4I5GA 4DIFA 4OHUA 4R1TA 4QQRA 4WJZA 4BMNA 5KJFA 1EMDA 3D7LA 3LC2O 3PPIA 3KO8A 1CERA 3K9QO 1G0OA 1JU9A 4NFHA 2XPCA 4J43A 5CFZA 4XYBA 1KC1A 1XIVA 3FRJA 3P5SA 1C0PA 4Z9XA 3AU9A 3ROMA 1O95A 5I9MA 2RE1A 2KO1A 2Q1WA 3IDSA 5GZ6A 4LN1A 3KYBA 1MC4A 2GZ2A 4PG7A 2JCVA 1H9BA 2PLAA 2Y99A 5TQVA 4W4TA 2LDXA 4CLEA 4XCVA 3UW3A 3DOJA 3AAWB 5JFOA 4D42A 4R1UA 1Z82A 4FFRA 3VTZA 2WD7A 2CF5A 2O3TA 1H0KA 3DO5A 4CV3A 4PVDA 3PJGA 1NVMB 1YB1A 5TC4A 1Y1PA 3EDMA 1JKJA 4O63O 5TJHA 2YV3A 2RH8A 4DC0A 4YEDA 3NV9A 5C7OO 2HAEA 2I6TA 2IXAA 3K5PA 1HRDA 1O9BA 4J1NA 4KQXA 3G1TA 4GSKA 4D0RA 1LKZA 4A7PA 1T1RA 2GN8A 2WTBA 4R41A 4YJHB 3ETGA 1J49A 2PH5A 5JAQA 2Q45A 3FTNA 4S3MA 1HDCA 4C4OA 1ZUD1 5DBGA 2EF1A 5DCYA 1E3WB 3BMOB 2DUWA 1I24A 3FF4A 3AUSA 3H2ZA 2QRRA 3L9WA 4WCFC 5K0ZA 3TF5A 2A92A 2VRCA 2A94A 1GYQA 1Z6ZA 3ON5A 5CPFA 4UUPA 1HDXA 4YQYA 4CMJA 2OUIA 3GPDG 4BQPA 2C07A 3SLGA 2Q4EA 1R37A 2QMWA 1SO8A 4NFYA 3JYNA 2IZZA 3E9NA 3ABIA 3HADA 1LSOA 3NEPX 2DBQA 1DHTA 3B6ZA 1PGPA 1ONNA 1M76A 1I3MA 3FTPA 5DNAA 2HMVA 3TL3A 2D5CA 3HWRA 1MP0A 2GNAA 2O4UX 1FDSA 3OMLA 1N7GA 3H8VA 3MOGA 4IS3A 1VL8A 1EDZA 4KQWA 3VTFA 4R01A 4WEQA 1E92A 4CR6A 5C37A 2RQMA 3KETA 3WNVA 4YCAA 4GMGA 3ZWVA 3C7AA 3ANMA 1RM4A 1VJ1A 3L77A 3L7OA 3WNQA 2PGDA 3OIDA 1ID1A 2DLDA 2CDAA 1EE2A 1B7GO 2FHSA 5A1TA 4OQZA 5EQFA 5KVQA 4EJ6A 3ENVA 4RPHA 1NWHA 2BF7A 2I3AA 1FF9A 2IYOA 1R0KA 4YAEA 2CDBA 3OQBA 3WGZA 3KYDA 3QA9A 5JY6A 2DAPA 3M2TA 4P8RA 1K6XA 3GF4A 4CM6A 2ZK7A 1QYVA 3NDJA 2WJPA 3NTOA 1OI7A 2NU7A 4BOYA 1I3KA 2VZ9A 3NYWA 2E49A 3OP4A 3W8EA 3ROQA 3AOEC 5BNIA 9LDTA 4XDYA 3RUDA 1H2BA 4B4OA 1TT5B 2DUUA 4XYMA 3WX0A 1ADCA 1DIBA 2RHRA 3CSDA 1HKUA 1KC3A 3D3WA 2C2XA 4OKNA 4ILKA 1ENPA 4I9HA 2P9GA 5DT9A 1B2LA 1KVUA 1AXGA 4J91A 1V9LA 3NTRA 4XYEA 3T7CA 5C3MA 2ZYDA 5G0UA 1KETA 3LC7O 3ZHZA 1GZ6A 4U6QA 1I0ZA 4ALKA 4CM8A 1Y9AA 1EUZA 3PLNA 3CKYA 3TZKA 2UV8A 3SLKA 3L07A 4HY3A 5IDXA 1UP7A 5AXAA 1SZJG 3WGIA 1ADBA 2UDPA 3QIVA 3ZV4A 1XU9A 2OL4A 4EYEA 4ZRNA 4NNJA 2LVWA 4KZPA 1E1LA 4CMIA 1ZKMA 4DPMA 1ENOA 1EUDA 2YUTA 2P4QA 3WGYA 4CL8A 3PJDA 4W9NC 3JD1A 4EUEA 3RJ5A 4JQCA 4PIVA 3ASUA 4H3VA 4GQAA 4C7KA 4S1VA 3OJ0A 4BGEA 3A06A 5GZ3A 4CQMB 4KOAA 1JDJA 1SEVA 5TJ9A 2B83A 3D0OA 2DBRA 3ZNOA 1H93A 1N5DA 4IDDA 3T4XA 3JQAA 2CF6A 4BMVA 4ZICA 4ZVVA 4TSKA 3U9LA 2HQ1A 1N8KA 3I52A 3E8XA 4CMAA 1DO8A 1NR7A 1WZIA 4LW8A 4XQCA 3LUYA 2EKLA 2PZMA 1NQAO 1LUAA 1PZEA 2HMUA 2DPGA 2GR9A 2PA3A 3DHXA 3I9KA 3ZH2A 5EQDA 3RASA 1PQPA 4CUKA 2HMTA 4DQUA 2NSDA 2Y1CA 1J5PA 1HDGO 4ALIA 1HE2A 4J4TA 1MG0A 3GAFA 4BMSA 1VE9A 3LT1A 1E7MA 3OEWA 3IUSA 2I66A 1Q0HA 5ER6A 4E5PA 2J3KA 2QZ9A 2OBNA 1L7DA 2V6GA 3UHAA 1X7HA 2B5WA 3COSA 3WGOA 3ZWNA 5KTKA 1DRVA 1O89A 2X0NA 1FJHA 2FOIA 2QQ5A 4Z0HO 4Y9DA 4EITA 4WNCA 3X2FA 3E82A 4ONEA 3GRKA 3W4JA 1MFPA 4B7XA 2FN7A 3B20A 4BO2A 5IDQA 4W82A 4LGVA 4ZA2A 1GQQA 2NV6A 4MVJI 2AG5A 2FR0A 3KWMA 4P4LA 4PCVA 3RKRA 4NPCA 3PYLA 3ETDA 3NTQA 4O0LA 3LQFA 5G0TA 5A9TA 1ONPA 3LZ6A 3R1IA 4R1SA 4WPGA 4UEOA 1L1FA 3DR3A 4RJTA 1GPJA 2OP0A 3HB4X 4DLLA 3PGJA 2C0CA 1Y81A 4QUKA 5DCWA 3QHAA 4J16A 5EMHA 8ADHA 3U4IA 5JYEA 1PJ3A 1O94A 2X4GA 3HDJA 5JAZA 3V1YA 2VT3A 2WD7B 4E21A 1NFFA 2GDZA 3NJ4A 3VPHA 4CQMD 3C24A 1UH5A 3ZNPA 1ISJA 1HXHA 3ROKA 3ZHBA 4R16A 4FFLA 4BB5A 3F1LA 4F6LA 1LDGA 4AICA 1ULUA 1A7KA 1J6UA 1NX6A 1ZSYA 3RU7A 1OZAA 4JK3A 4UVEA 1GV1A 4DC1A 2O3SA 5JSFA 4J4BA 2HK9A 2DT5A 4DIOA 4D0SA 3ZWBA 1FDTA 3W4IA 4FPXA 1NYTA 3JQ6A 5J23A 1MUUA 1PR9A 3IMFA 1KBZA 1U8SA 4LSMA 4QO7A 5L9AA 4K28A 1W4ZA 3DAPA 2GGSA 5B37A 4J2OA 4NBWA 1W0CA 3ENWA 3I4CA 1LU9A 1A7AA 3ZWMA 2P9EA 3VDQA 3TZ6A 1GV0A 1F12A 4MPDA 4N5MA 1PL6A 3FBTA 2NU8A 5CG1A 1NAIA 1JW9B 2ZIZA 5IFLA 5A3VA 1C3VA 4M87A 2E82A 1Q0LA 3IC5A 2I76A 3JQBC 5HTOA 3FCOA 1BMDA 4PLWA 3DEYX 1BTOA 3QWBA 4CMEA 1M2WA 2ZYGA 5BSEA 4RF4A 1PGJA 3RUAA 1B26A 3RUFA 5K6AA 3OIGA 2DT9A 1GAEO 1H6CA 4GWKA 2YDYA 1YL7A 1E77A 3OJOA 3H6KA 4RZHA 2O23A 3O8QA 3PZRA 2W98A 2VWQA 2Y93A 1YQDA 5JY1A 3BMQB 1LTHR 1T25A 3DMTC 2QX7A 1U2DA 4YJFA 3P2OA 3M1LA 4ESOA 1YXMA 4CMBA 5BSFA 1QSGA 1YO6A 2Q1TA 4MVJE 5ILOA 4ALLA 5JC8A 4OXNA 1CDOA 1KEVA 2ET6A 2WYVA 3A1NA 3E1KA 1XQ6A 3CXRA 4JBGA 3FNGA 1DFHA 2D3TA 3KEQA 3R3SA 3VKVA 4XIYA 2VT2A 4NQZA 1X0VA 4FGSA
chains in the Genus database with same CATH superfamily
1YVDA 2E1CA 1JFRA 4O4HB 4P4UA 3SX0A 3RB4A 1SA0A 3T8YA 4V1Ak 4OQFA 4ECZA 4ZDJA 2VG5A 5HP1A 3O3NB 4JODA 2WI8A 2CY0A 1YB5A 4AXBA 3SYKA 5TT0A 4JYAB 2ZT8A 2IX3A 1JFTA 2FE4A 2R4TA 3EASA 2BQRA 4QAJA 1H3FA 3I28A 3TXXA 1IOLA 4I14A 3OG9A 2WAAA 1JIXA 1ZCAA 2DJIA 2ZREA 4WKCA 4TRMA 3VR5H 1E1NA 1X7DA 3N7AA 5B0CA 1Y7TA 4BPBA 1XAGA 2CUTA 4W4MA 5A3RA 2XMVA 4BLOA 2GBLA 1GNQA 2F1FA 1HUQA 4X64B 3DTTA 5H82A 4Z2XA 3TX2A 1AFJA 3DE1X 1IWBB 1ZU5A 3I61A 1T15A 4L51A 4C7OA 2FQQA 4LI3X 2G17A 5JD3A 2BR5A 1HI0P 3AFMA 3DLKB 2FK7A 4HC4A 1AXRA 2NZ4A 2ZTMA 1TL7C 5G2OA 2BGRA 4RW4B 3PKMA 2XZPA 1BE1A 4J3JA 4W9NA 1IN8A 2QAGB 4E94A 2LE0A 1HKHA 1IR0A 1ODTC 3IS9B 2DTEA 3ZG6A 4AK9A 2J0VA 3BG5A 3Q7SA 4GZ5A 4EY8A 1M2VA 1Q16B 4FN5A 4JFRA 4KOEC 1IOVA 1WNTA 4D3SA 1NDLA 3K9FC 2H7YA 2WHRA 1RT5B 3WLNA 1F6WA 2UVUA 2G9UA 3IJ5A 2D7DA 2GUGA 1O0CA 4ZAGA 4GMXA 2ZPAA 3QGPA 2FCRA 3MM8A 3WLJA 1Z7BA 3LBHA 3MOJB 2GETA 3BF4A 4GI2A 3T41A 4ZVOB 1UC4B 1EWVA 3OJFA 3AW9A 3HVHA 2XUKA 4WI1A 4TZ0A 4X84A 4MW4A 4YYEA 4CLDA 2KVQE 3MJRA 2IFXA 1WG4A 4OYMA 1UMJA 1JJ4A 4JB3A 4LHVA 5J5AA 4GKKF 3H9QA 1PI3A 3R5JA 3UOGA 4NZYA 3WYCA 3FBBA 1EVLA 3BE5A 4MS1B 2NUAB 2H4JA 2XB9A 2JFKA 1U2RA 1OXVA 2RRAA 2WSYB 2PWZA 3N8IA 1GCUA 2V4MA 1V8BA 4JI1F 3JAMY 1L1RA 2Q1XA 5L7WA 1H9CA 3MAAB 3QU5A 4EX6A 1K9SA 1WP9A 3RK4A 3DZJA 3H2GA 3ZJVA 3IFEA 2R7XA 2YRXA 4GX1A 2VPTA 5JYDA 2NT4A 5LLSA 3HXPA 4HEJA 1Y3IA 2MY8A 1SCUA 3GCZA 1K5GA 4PWWA 1NJFA 3OPYI 5D5QA 3AQOA 3BH0A 2HLHA 4CEIA 5JW6A 1W47A 2HKIA 4TKVA 4PFJA 2BE9B 2H7XA 2ZVPX 4B9SA 1VHWA 4LQ4A 3PBKA 4LBWA 5G1NA 5K0NA 5A7FA 3PW2A 3CLUD 4KKVA 3TNFA 3T5KA 1KY3A 3L0BA 2V1UA 1TUBB 4I2PB 4XDCA 1ZDMA 1ZQ9A 4KR0A 4RUKA 2J3QA 1QG6A 4L6IA 4QFBA 3UFXA 1JG7A 4IJ6A 1I2DA 7REQB 4Y6GB 1RWPA 3PR1A 1RTTA 1NBHA 2Z04A 4JVMA 1FFXA 3THOA 1BAPA 4DCTA 2ERXA 2G8NA 1ECBA 4WTYA 3QE9Y 4HTFB 2I8EA 2E4ZA 4ALJA 1VL5A 1KY2A 3L0IB 2OWDA 3KV3O 2APOA 3WE7A 3GEGA 2QWXA 1UBGA 4BO0A 4X97A 5LT5A 4BVHA 3M1AA 3DOCA 4EPTA 2IGTA 4IQFA 3ICCA 1P4JA 1S4EA 3FOFC 2JL9A 2Z83A 4P73A 3NCRA 2A6MA 3OFKA 3OFEA 5H70A 4GLJA 5DSXA 3NXSA 2W2PP 4EJSA 3T7RA 3LALA 2F43B 3OJXA 2AI2A 1KIAA 1ZI6A 4QATA 3AH8A 3W06A 3C2QA 3WR5A 3BA6A 1QM5A 3FQKA 1N3YA 3LUPA 4KRYA 5DLFA 4ZDIA 4QIVA 1H2ZA 1U8XX 3LUGA 4A46A 2V0GA 1WKKA 1Y7PA 4RPIA 4RIHA 4Z8XA 3EUWA 1KFSA 1WDLA 4FHCA 2HWTA 1SUEA 3NEJA 3TLYA 5IYZB 1FP2A 1N0UA 2E1AA 4DSUA 2WJIA 5I4IA 4KWIA 5HKLA 3VPAA 3KUCA 1JI0A 3NP9A 4HO1X 5ANRB 3WA7A 1FPQA 2PX4A 4RIEA 3THYA 4JI2F 1IRIA 4A2QA 3KWFA 5KDDA 1B6TA 3ANXA 3K92A 1U2GC 2WKPA 3EJMA 4DSLA 4FZ5A 1KEPA 3WP0A 4HLQB 1C4KA 3EDOA 3JYQA 5FADA 4NONA 1PGNA 1C4WA 2BEWA 2N4DA 2JGEA 1PT6A 3NT5A 5BR8F 1OFUX 3ABZA 3KV1A 3SVTA 4RJVA 4WAUA 4WXMA 1I6WA 1ISHA 4DXHA 2J9YB 4KPYA 4PFSA 5F21A 1EKXA 2WP8J 3LAMA 1CK4A 1J9EA 1H4QA 1UZMA 1VQ1A 1XERA 3AVOA 2OMLA 2WT9A 2QM7A 2WWVD 4MCIA 1EWQA 1Z2EA 1D9DA 1JXAA 1BD3A 3IO3A 1DZ5A 2O8VA 3TM5A 5LXRA 5FUWA 4JJAA 3BBFA 2CQGA 3LHKA 2A58A 3NCHA 5L39A 1Y5NB 5KT6A 3DW1X 4RCYA 2ZD1B 3KQWA 1NW6A 1UDXA 7FDRA 2KFYA 2PT5A 4LNHA 1ZPVA 5HJEA 2QUHA 2X5XA 3B54A 3VFDA 2MSKA 2XULA 3R6LB 3V6DB 4BIIA 3L95X 3LO5A 4DM7A 3QU7A 1A69A 1B0ZA 1W88A 3IQIX 3OOWA 4G4SO 4L7QA 2O2HA 2Y1DA 4G63A 1VRWA 3KDSE 5I9NA 2VN8A 3FCYA 1TXGA 1E2PA 3EZ5A 4OQEA 3CJ8A 2Y0BB 1C1BB 2YMMA 3NWEA 5F9LA 3RC3A 2VF7A 4BVBA 3V9AA 4LJAA 4PGGA 1BJTA 3EPRA 1IN7A 2QROA 1IZYA 3POTB 2PE5A 3FCEA 3PFHA 2IJGX 2ECFA 5HK4A 2CNKB 2NXJA 4KMMA 3FSRA 1G21A 1SKAA 3W9IA 4A0HA 2OCBA 3U02A 5FRDA 3KL2A 4HLCA 3UK6A 3AOEA 3RW6A 2B3TA 1TCCA 3MECA 3DWEX 1EK2A 3W5XA 2AEFA 4PQUA 2XUFA 1V5GA 1WZ2A 4RKRA 3RK0A 3RC8A 1VQSA 1SIOA 5ERYA 2FVXA 3CZ9A 3O8CA 2K1RB 1VB5A 3IVRA 2QTGA 4AJLA 1AK2A 1NOJA 5JJBA 4MW2A 5IVKA 3OT1A 2Q6KA 4TGLA 2RIPA 3T5AA 5IZ4A 1MC8A 1T4MA 1TIBA 5DXFA 2ZJ0A 3KJGA 3RARA 5K9ZA 1P5RA 2NYRA 4L16A 5AM3A 4TVSA 2J0QA 5JSZB 1PYDA 5DHUA 1M5PC 4A91A 4H59A 4JQSA 1KY5A 2ADOA 4W9RA 1G8YA 3IAXA 1K8XB 3ET6B 2AJ2A 1U1IA 2PQMA 3S68A 4HQ6A 4F3CA 2FZLA 4EY7A 4E30A 3AKYA 5L45A 1JSZA 3EZOA 4EI2A 1PJTA 1ORWA 1BCSB 1ACLA 5EWGA 4OXYA 5FR2A 5IWAJ 3K09C 4QYRA 2Z43A 3VKHA 2FVPA 1JAHA 1P1KA 2ODEA 3DZCA 4QLBA 10MHA 1K92A 3AP1A 3ZD7A 1Z2AA 3JASA 1RBLA 4ERXA 4ZEVA 3OZGA 3KFXA 3IVXA 3GQBB 1Z4NA 2QDKA 2WSLA 1YLXA 2QA5A 1UC5B 2C4MA 1A95A 2HF7A 3M6LA 2NZCA 1H6DA 2G08A 3ZC4A 5AM4A 1FP6A 4ECUA 3QHQA 3TPFA 1OLSA 5ETKA 1REVA 3BAZA 2W6MA 3PIIA 3M32B 1OVGA 4KU4A 1U9ZA 3PVCA 4AO7A 1HYGA 3HL4A 2AOUA 2YW9A 3GQVA 1O5TA 4PY2A 4RMHA 3WI7A 2CXRA 4UPVA 2HRCA 2IVMA 3HFZB 5IFMA 2ZRPA 2WV9A 4WP9A 1F9HA 5DFAA 1I2CA 3OP1A 3U60B 1BY9A 3UV3A 3H7AA 4DCGA 4CDIA 2MHNA 5JS7A 5JALA 1WC3A 1S8FA 6CHYA 1S3GA 1H2RS 4Y9UA 1N6QB 3ETOA 4AQYF 4B3SJ 1HYHA 2MZRA 5J2NA 4IEEA 4CEJA 2YQ5A 4K7QA 3QBTA 1O95C 3O93A 3T0IA 3HWSA 3C8UA 2GD2A 4WY8A 4HT3B 2KL8A 4B4WA 1PZHA 3IEIA 4AJIA 3EUNA 3NOVA 5I5GA 2WMNB 4GZ6A 4BVFA 1BXGB 3LDUA 4G9BA 2G0JA 3AWDA 1NJIT 2FX5A 4ECEA 4F1JA 4G65A 5M2QA 3MCUA 3QPAA 1JIIA 5F12A 4BZWA 5ECDA 1KI7A 1D1SA 2YQ3A 3HR4A 2J6IA 1R0YA 2B4YA 4O23A 3LSYA 2P40A 2CPEA 2G25A 2QHXA 5CBKA 1A4RA 4YR9A 4AU1A 1HTTA 2WJWA 3HGQA 2XYHB 4ZP6A 4WYLA 2CNWD 1Z8NA 4XTRA 3B8EA 1EESA 4FFPA 2DC1A 1K06A 5CB6A 4EB0A 1GYRA 1QJHA 5DHTA 3OX4A 1QGYA 1LEHA 3OPQA 2QAIA 4HV4A 3NLCA 2N3ZA 3B9QA 4DG9A 1T0IA 3CJKA 4TV9F 4ZA1A 2HIQA 1ATIA 1WDKA 4DR4B 5BPFA 3QY0A 2O8DA 4G0YA 1G5HA 1E5DA 2OB2A 4PLCA 4V0NA 3OM8A 2H5JB 3I4LA 4K05A 2GO1A 3P45A 4CKWB 3GELA 3PFGA 4GI5A 4H7JA 3ISJA 2BKUA 5K6RA 1I8TA 2Q79A 2O48X 3CRRA 1A27A 4P4SA 4I69A 1DTWB 1Y3CE 3FYDA 2ZYRA 4KG7A 3O94A 2PRKA 1WD7A 2C98A 4RIIA 3USZA 1J8QA 3VZQA 3E70C 1P62B 1DEKA 1MA3A 3ZQ4A 1NYQA 2HZAA 3U40A 2MR5A 2OEMA 1CD5A 3A25A 4HYQA 2DWPA 4YT5A 2V8DA 1B0TA 4W98A 5G4DA 2IHZA 2Y8YA 1MWYA 1SH7A 3TARA 3FSJX 4YMIA 3BWVA 5KVVA 1KEKA 4F3YA 1BSVA 2XLKA 4GXQA 1FRJA 2C97A 2XRFA 3MFYA 4JJGA 3AU8A 3I01M 4G1QB 1PIEA 3FKSD 4JL8A 3C4JA 1D7OA 4P74A 4INPA 3D4JA 5AW8A 1Z75A 1N5TA 2BGWA 3I31A 2E5LB 3Q7QA 1ESCA 1NGSA 1RPNA 3DA8A 4M7RA 3T34A 4OFBA 1F20A 3KJNA 4QUDA 2O0MA 4LFBB 3DQQA 2VUUA 1GX6A 2ORIA 3EZYA 4ZANA 2IPOB 5TMPA 5IN5A 4ZMRA 3VI3B 1EEHA 2VA2A 5DLYA 3DOKB 5SICE 3BORA 3GZNB 5I48A 2QR3A 1OYVA 2Y3YA 5KKAA 1F1BA 3R74A 5HG0A 4WN9A 4HRVA 1G1AA 2CJFA 1U1DA 5M2PA 4OJ1A 1M54A 5JAIA 3GMIA 4I7FA 5CYMB 3TR0A 3WYBA 2HNAA 1M7HA 3ACBA 3DO8A 3K5OA 4BKPA 2HPZA 4TWBA 1QMGA 3T5PA 2DFVA 4YAIA 2FFRA 3VGTA 1Z3IX 3LYLA 2X13A 4YMUA 1RRVA 1R66A 3T15A 1T4DA 4YN3A 5JMNA 1C0KA 4QWMA 1SXJC 3KUUA 3PKJA 3DMDA 2DK2A 5LOQA 2R00C 1RT3A 1KVJA 2DPJA 5BSHA 1MB4A 1SXJE 1DAMA 1BH2A 2NTNA 3FDZB 2BFAA 2XE7A 4LJYA 2AKWB 3RCBA 4F2WA 1WCYA 1WACA 3IKLA 1YVUA 4PHTA 4M5HA 3IKVA 4YB6A 3OUTA 3DBLA 3UJPA 1E6KA 5CHEA 2P5UA 1CTQA 1C7JA 1RK8A 2R5WA 1Q5YA 3VU8A 4IKOA 1GZUA 1XMSA 4JQZA 5EP2A 3VPSA 5EJ6A 2FC9A 2ZIEA 4EKYA 5HSGA 4CLRB 4QR2A 5KAPA 1CR1A 1E1KA 3QX7A 2B4UA 4FJ1A 3SF8B 4LFBJ 1M6HA 1MA0A 4MQ5A 1P5FA 2GTPA 4YUZA 1FVFA 1TLFA 5DF1A 2R2UA 3B85A 3HPQA 3WLPA 3BERA 2B4PA 2GXUA 1LDMA 3KG1A 4N3BA 2WLTA 1Z6XA 1WUJS 5TY0A 1HRKA 2I9PA 4XARA 2NM0A 3VH4A 5F78A 1U49A 3COPA 3OQNA 2QBYA 1IHXA 4B5KA 4B1FA 1DPFA 1MROA 1JTVA 1HFEL 2QPTA 4P0TA 4XUCA 1ZL0A 3JCZA 3LGHA 1FJGF 4M76B 4BCBA 4IS2A 5DU2A 3RS7A 1MHTA 1U9CA 2UZAA 1G8HA 2WU8A 1NVTA 3GXOA 5KYKA 4F60A 1QYDA 4NRTA 3R24A 1D0SA 1VGVA 1C3XA 1F9EB 3OZTA 2PN1A 1L6RA 4LAFA 3HJRA 1LOUA 5HS6A 2Z57A 1T4GA 4OGFA 3TQQA 4DIUA 4AE5A 2RRNA 1Q7GA 1Y4ZB 4FI3F 4I4TB 3SYZA 3NVAA 3ANYB 3QT5A 1J99A 2AG1A 3QSYA 3GGDA 5AW2A 3LC2O 1XVUA 1CERA 1USWA 2ZWMA 3W66A 3KJEA 4YMWA 3ROMA 3WOVA 1KTIA 1IUPA 4UCFA 2OCPA 1VZ3A 4ER6A 2J31A 1QF6A 3UW3A 4LF8F 4QCLA 4TUYA 4R1UA 3NVKI 4PC2A 2WD7A 3PDIA 3D8TA 3EDMA 5IFKA 3HBMA 1KOHA 2NUPB 1NXIA 4KQXA 4OV6A 2CW5A 5KYWB 4MA0A 1IR2A 4B83A 2JIPA 3HJGA 5I9IA 1IBCA 2QRZA 3AHJA 4N0DA 4DG1B 3GPDG 1MX5A 2FGOA 2GTHA 4C2MA 4GXRA 2CLLB 3F6EX 3RSGA 1EZZB 3SZOA 5JECA 2XSJA 1L4UA 2GNAA 3EPGA 4WEQA 4CR6A 5D51S 4LC1A 2CFTA 3H6HA 2V2ZA 1M2KA 4NBKA 3ESAA 3IQWA 1JIQA 2OA0A 1M33A 1UBTS 1ZOTA 5K8VA 3QWPA 3JWPA 2DAPA 4FMBB 3NDJA 2R3VA 4UOGA 3BDIA 4RW6B 3DTVA 2CJXA 3TQFA 4FHDA 4C76A 3FY4A 2H1VA 4KKOB 3R0VA 2FWPA 5ALUA 1TT5B 2H59A 1YFZA 3GB0A 1SXIA 4M9CA 1V9LA 3A8KA 3BPSP 5G0UA 2QK4A 5CW2A 1BLUA 3L8CA 3WGIA 3IM9A 2ERRA 4QPJC 5AJHA 2Q9UA 3TA2A 2CQIA 4DPMA 1GKIA 4EPYA 1KO7A 2OELA 4NPHA 3QAEA 2ZRNA 3KHTA 1SEVA 1E1RD 3U6KA 4XUEA 1PDVA 2ZRCA 3BEOA 2YWEA 4TSKA 4PZ0A 4DV1F 1UK6A 5J58A 3I52A 1NR7A 4NULA 1LUAA 2DPGA 5EQDA 1RPJA 3DRSA 5IM5A 3IEUA 5TPZD 4ALIA 4N8NA 5AW1A 2N46A 2DGWA 1T03A 4JI8J 1VI6A 4MGIR 1JQAA 4QUEA 1B73A 3PG9A 1L7DA 3BK7A 2IIVA 1UQRA 5B7GA 5L1LA 3SQDA 1X8LA 3T9BA 1W85B 2MIIA 3FOZA 2O1PA 1G2PA 5CURA 2MZQA 3KWMA 3V4ZA 3JQPA 1SVMA 4D9NA 3NMUF 1RQPA 5CGZA 1YAHA 4UEOA 2RE8A 4PX5A 1YMQA 3NHZA 3OJWA 1U11A 4I2QA 3DLLQ 2A9QA 1NFFA 3IUMA 2DHHA 4A0FA 4BDTA 5I42A 4JHLA 1CQIB 3A2MA 5ELLA 1BWPA 3AD9C 3OCJA 4IR9A 4N6NA 4OYOA 4WFYA 3CQ9A 1S2NA 3FPJA 1D4AA 2EJTA 2VAXA 5B37A 4G1MB 3HFKA 2P35A 5B57C 5A3VA 1UWBA 2E82A 4YV2A 2I76A 3FCOA 1OUMA 3R9XA 2YDYA 4RBUA 4TKUA 3QX3A 3PZRA 2ID8A 3DWGA 2ZRGA 3EIEA 4BMCA 1T25A 3GO4A 4ZYXA 1U2DA 1AUVA 1O95D 2CVFA 3ZUGA 4MVJE 2Y1LB 4FCVA 1CQNA 3K59A 4ZPJA 1T94A 4MV8A 1DFHA 2OVFA 1M2JA 5CFOA 4IO9Q 2PRIA 2Y0DA 3HVAA 3GRFA 1THZA 2RDDA 1SJ9A 2LXIA 4RZSA 6GPBA 4GQBA 1YFKA 1FJGB 1SKSA 4WJBA 4HJRA 1WU7A 4UM7A 4CH0S 2AKAB 2MZJA 1S2DA 2I8AA 4B9UA 2RD5C 2HGNA 3L02A 3K8YA 1MU0A 1LPPA 1ZZEA 2G5PA 1J07A 1FNNA 3NHYA 3NBUA 2WM8A 2X3DA 5JZBA 1NXVA 3G6WA 1HEYA 3K17A 2V50A 2M8HA 3H59A 2EZ8A 1WRBA 1G63A 3X44A 1JR4A 4KX5A 2DR2A 1EXNA 5IAGA 4KKXB 1YQHA 3ANLA 4OY3A 3U4QB 3NBFA 2O6HA 3JQ8A 4MWCA 5KYGA 3H5LA 2CJQA 1WC0A 1O54A 3W1WA 3PZBA 2IMWP 3GU0A 1XTJA 2B7CB 1A2BA 4PRFA 2ZKIA 5A7HA 3AZQA 3J7AC 3AODA 3RQIA 2C59A 3MUOA 1XJ0A 3ZS9A 3G9XA 3A6EA 1N4LA 1HARA 3AC0A 1F4VA 4LC9A 1NBME 4YK7A 1EM8A 1MH9A 5EIBC 5LSRA 1G5RA 4NPOA 3I2JA 1D7AA 3W5JA 2ZBFA 4BO6A 2BVZA 2NQ2C 3AJRA 3EIFA 1D6MA 1W4CA 1QE5A 2BOPA 1Z73A 1TT5A 1U2CA 3I53A 1DE0A 4EFDA 1GAQA 3QITA 1ODFA 1RTKA 2AKEA 4CFSA 4N0EA 2QS9A 4ROTA 1KDPA 4HLBA 1TRKA 2HNKA 4KE6A 4FEGA 4UKDA 3RG8A 3GV0A 4IILA 3RIEA 3WC2A 1QYRA 4M8SA 3DNCA 5KFAA 5AJTA 4ZKAA 1JLAA 2DR3A 2BEVB 2F3PA 3MYRA 4ZXPA 3GIRA 4CZ2A 4N1AA 4GXTA 1OMSA 4L5CA 4DR1B 3UVJB 4FYVA 5LZ2A 3O38A 2FPPA 3C7TA 1UEUA 2ADMA 1T5LA 2EVZA 3PPWA 4HR7A 2LWIA 4WUVA 3CZMA 5KB3A 4EEKA 2AJTA 1L3TA 4ICIA 4QRDA 1ZD2P 1BYIA 4X1OA 2DGXA 2VJPA 9MHTA 3WX8A 5JZVA 1HBJA 4NENA 1LWNA 1PJQA 5C5CA 3QEJA 3L4BC 2IA5A 1BN6A 3NNSA 3LCRA 4G81A 1A5SB 4EIWA 5BYJA 4DA6A 2XRMA 4GVLA 1ZMXA 3D3EA 3D2CA 1PWYE 4JASB 3KDNA 3F6CA 2WD9A 3JD3A 5D4OA 4DR7B 2UXBJ 2NZXA 3IRVA 1XWLA 3V1TC 3HFSA 3WGQA 3B1ZA 4DA4A 4D56A 3T3DA 1JEYA 3FYUC 2OD6A 2ZJPQ 3TSYA 1QLHA 1I32A 1ZU4A 2JCSA 1ZBDA 4CKBA 1RHQB 4HTAA 1T2DA 2ZJ2A 4PAGA 2GKOA 5AOAA 1KAGA 1AZSA 3OKFA 4IIEA 2D1TA 2W2NA 4IJWA 4YT4A 1TVKA 5E6SA 4ZQBA 3CIOA 4RVHA 2H5EA 4Y0FA 1UPUA 3MCWA 5K8NA 3PVSA 4A8KA 3Q0EA 1CQZA 5G0RA 2K7ZA 3HKCA 5ALVA 1JECA 1WTCA 3WICA 2WOMA 1BX1A 2H1LA 5BXIA 4YPFA 1UKAA 1TL7A 5AE1A 4Q3OA 4BAUA 4NCAA 2R7MA 3EY4A 2VHUA 3AO0B 1OQ3A 1Z8HA 1U2ZA 5LYJB 5CCXA 5J2PA 1O5IA 3IEVA 5KYNA 2FK8A 3TSCA 4KGZB 3E5MA 2BM9A 2VL1A 3IWXA 4G36A 4ZD6A 3KB2A 5BNTA 1G9XA 1BDBA 1NUHA 2G70A 1BMTA 5JISA 4JHXA 2A1TR 1RCFA 4LSWA 2QSZA 2ID7A 1YVEI 3PT5A 1E6MA 2HQGA 1Q92A 4LOJA 2X1BA 2CJAA 5JV5A 2GYYA 4W1QA 3STTA 4D4MA 5CNMA 2ZB7A 4ZRDA 2QP4A 1T9GR 3FOAA 3UM9A 3B4MA 2BKXA 1C7ZA 5LWQA 5IUJC 1IN4A 5ETQA 5P8WA 1H73A 2X0FA 1M6EX 3QQ5A 3TTTA 1JQBA 1JBQA 2W9BB 3ACDA 4TTAA 3INTA 5JU6A 1JG1A 3OLQA 1RBZA 2E1MC 4LF4B 3FPGA 2F59A 3ZCSA 4L78A 1T1IA 4EA9A 3K2BA 3O0TA 4Q6BA 5A6WA 3RVNA 5T4EA 2JH9A 3RU9A 3QT6A 4F92B 3IWLA 2CDQA 2L69A 3WNBA 2OBYA 5E9JA 1BDMA 1TECE 4LYAA 3NUGA 5JQGF 3U16A 5B1YA 3UGJA 2ZU6A 4WXPA 1IKXB 5DLDA 5KFRA 3UPFA 4M7PA 4E3ZA 3DM2B 1RT2A 1IG0A 3QMVA 4QT4A 1XF1A 1XRMA 2Z6UA 3SQXA 5EJ7A 2VJAA 3CH6A 4FQ5A 3O8DA 1P6UA 3AA9A 3A3KA 4U9RA 3LQRA 6NULA 5KTSA 4TT3D 5CEEA 1JQLB 2HWXA 3PXCX 1FFWB 4HQ0A 4MDHA 4J49A 1QBKC 2L9NA 2HMAA 2B0JA 2EGHA 2CXXA 3FBFA 4UQGA 3C3EA 2AFIA 2H4XA 3NOQA 3NS7B 2NIPA 1CYDA 5BV0A 4O1HA 5ALYA 3LW5C 2XWYA 3B6EA 4Q5IA 3KAQA 2WVCA 2ZDOA 2B69A 4DDWA 4WLUA 4C4WA 5HUJA 2J0WA 3NWBA 3BXZA 1WG5A 4I3FA 4WASA 2GAJA 1A9OA 3UC5A 4Q00A 2PYZA 2RD2A 3KIPA 2OORC 4YAJA 1UFWA 1QFMA 1XQVA 3TIFA 2B4VA 3THPA 2VG6A 2CLIB 2GLXA 3IPXA 5DG7A 3DDZX 2O9JA 3BCSA 5BV1A 4MPJA 1G5QA 3CR7A 2GARA 4LRXA 3HJNA 2CNOA 3Q2SC 3MEGB 1SIWB 1ZNWA 1F60B 2HC9A 3IALA 1EB0A 3PE6A 4GX0A 1D6NA 2GQ2A 4J0GA 3JTEA 3FPAA 5CHCB 4W90B 5ALEA 5IDYA 2CYAA 2QE6A 1E3SA 1YRYE 1NOKA 3D8SA 4B81A 3HBNA 1U7XA 3H5NA 5CUQA 4ID5A 2A0FB 5FOWA 1PKEA 3KQOA 4OHOA 2HRQA 4CM5A 3R5TA 4E5MA 1W5SA 3AV3A 1SL1A 3IUYA 2PLFA 1V37A 1RJGA 1N7HA 2X2EA 3PXUA 1I2MA 4KAAA 1QQAA 2VBZA 4JSTA 1Q8LA 4Y2IA 4EBFA 2Y8WA 3UDCA 1XCMA 2VJMA 3IGNA 4IDNA 4HGZA 1XJCA 2C94A 4EG7A 4X85A 2NVUA 3S1TA 4V3BA 3GG0A 5E1OA 3EGZA 3T3NA 2V7BA 3T35A 3I0RA 3MJFA 4Q7LA 4MROA 3MJTA 2K06A 2HZCA 1LI7A 2ZG6A 2AGQA 1Y1QA 1NCLA 4MR8A 3TSAA 4WPAA 3DTYA 3FTDA 2L18A 5LU9A 5F8NA 1GDDA 4YASA 4MRRA 4R68A 3R9IA 3MURP 2KVIA 2RKIA 2DWOA 4FNOA 4TMTA 3K9HA 4OU4A 5I9LA 2B2XA 2C3UA 4YRCA 2AI1A 2XAUA 4K1XA 3AVQA 4MJ7A 1QXSA 4I1IA 4HVTA 2ZIUB 1YJVA 4CW7A 3PPYA 2XDWA 1U94A 2F17A 3VTAA 1WXWA 3EPIA 2ZDGA 4KYVA 5IMBA 1C3EA 1B6GA 1QHXA 3VR1A 4ECWA 2NQPA 3L4EA 2DNYA 5LMUB 3PW0A 1PQUA 1SVKA 3NHSA 1ZBTA 2HHTA 4P2BA 4FZJA 4TV9A 5HO4A 4I1YA 5CT4A 1UBKS 3GUYA 2I34A 4HYTA 4OJYA 2X3UA 3FHCB 5CW1A 5LMCA 3EC7A 1VQMS 3QVJA 1SHTX 4YB7A 2HKEA 3JQKA 1KKHA 3I0NA 2Q3CA 4L4YA 4I3HA 4AJEA 3DDIA 4N5DA 3E27A 1F7UA 2B5JB 4MR7A 4B9NA 5J1PA 2AK2A 2XUOA 3F46A 3G2PA 3GJRA 3TNLA 1U09A 3TRJA 4KVAA 4TOIA 5AXLA 3DMFA 1KH1A 4UM9D 1VIAA 1UZNA 2ES4A 3BQMB 2VSOA 4N0QA 3IP9A 4I8DA 1JYEA 4ZVQB 4DU7A 5GMEA 1USKA 2BGMA 1JLMA 4AVYA 2NNLD 4LBIA 3OWXA 4FS3A 3IQGX 4I36A 1P7CA 2C5SA 1KSFX 1OLXB 2HDNB 1CY2A 2VJCA 2B1GA 3B9RA 2AHOB 2XTJP 2Y8EA 1B4SA 3V4SA 5H0IA 4JEHA 1EYZA 4B6PA 2JZ5A 5K3FA 1JX6A 1JIUA 2JATA 3IP6A 3LP6A 2JBAA 1YJ8A 2GJ4A 1ETUA 1F2TA 5LL6P 1U28C 1IZ7A 1K89A 2NOAA 2WT4A 4OSEA 4QC2A 2FW9A 5IW8A 3SDBA 2WTNA 3NHBA 1MAHA 1OKKD 4R0EA 3C6QA 1E60A 1DV2A 1KK0A 2PD4A 2R6JA 2DXFA 4N03A 3JPWA 3R6DA 4OKSA 1NMQA 2O5VA 2BCJQ 3DC7A 3DHVA 3E3NA 4MW7A 4FOLA 3GVIA 4AY2A 5I4BA 4XKJA 1ZITA 4K1LA 5F8LA 2Z58A 1SKYE 4UDOA 2LW7A 4FLEA 2JC0A 3VXKA 4XVHA 2QTBA 1YJCA 5KBYA 3VJRA 4NC9A 3FNHA 3CRQA 2PEYA 1M5VC 1V6AA 4J1TC 2ZH5A 5IF9A 1EXMA 3QOWA 2BEFA 1KVQA 1XTQA 3AP3A 2OPQB 4FR2A 3W6ZA 4BLRA 3LZDA 2ZDPA 2EI5A 1U3DA 2Y1RI 3DBRB 3I01A 4M5NA 4FEEA 3OPVA 3HJAA 2C7GA 4DMHA 4E03A 2A0XA 4BQFA 1TZBA 1D04A 4TLEA 2O07A 3ZHYA 1EIWA 3OSZA 1CQIA 2G63A 1RU3A 3DE5X 3M34A 1T9AA 1HDRA 3SMZA 1VJ5A 1OY8A 3B89A 1GCIA 1EX1A 1U45A 4H7PA 4V0QA 1BW9A 3KZNA 4DQKA 5IUKC 3E3XA 4IVRA 5GQSA 1VCOA 1L8AA 3D4LA 3KYIB 1KQGA 4NKRA 1QQ7A 3KXPA 4U7DA 1DTQB 3R0XA 1JHZA 2CYCA 4OI4A 1DDIA 1IQUA 2JK0A 3IMCA 2O8NA 1IZ0A 4IUYA 3QF7A 1YJUA 1NMXA 4ZITA 5EP3A 5IKOA 2J0UB 4P2SA 3BGOS 2H65B 3DVSX 5H83A 5TPWA 4A8YA 5FCDA 1KR4A 3MEEB 2XTNA 1FRXA 3DGFC 2XE8A 4RIFA 1S59A 3LTOA 2X9QA 3ZTSA 1CUBA 4FZ3A 3F3YA 3LCMA 2ZRLA 3L7LA 2MTLA 3AETA 1U8WA 1RWVB 2JVIA 3C3CA 4F5EA 1DCTA 5I3UB 2O6LA 2DPHA 4PX2A 2J3DA 2HU2A 1UJ4A 5BW4A 1FRFS 2B4OA 2EFOA 4DV6B 2V2VA 1G2IA 4X4NA 4ZMSA 4Q4HA 2VHJA 4RUBA 1W5BA 4NARA 4RGVA 3IB6A 3ME5A 4DMFA 4CV0A 1UJ5A 3BSNA 2R8IA 4JI3F 4L4UA 5HANA 4XAQA 3X2EA 2R7RA 1ZP6A 4EQ6A 2DRIA 3DMPA 4TYPA 5THQA 5E7OB 1X19A 2CQPA 4P10A 3OTOF 3ADBA 2CCGA 1CR6A 2H51A 5A8KA 4BNZA 1DO0A 3PR3A 3LGMA 4D25A 2J8AA 1CJTB 4ZVOA 2F63A 4C9DA 4OP2A 5LYYA 4XFKA 2X19A 4MJLA 4IRKA 2ZLBA 1V39A 5EYPB 1WHWA 3RG2A 1YBVA 4U0JA 1DTEA 5A4JA 3PA6A 5CT6A 1NT4A 4JITA 1RT5A 1P44A 4LECA 5D6OA 1T3GA 4ZJYA 1K1QA 1JLGB 2WSFC 3QNUA 1F06A 3T1TA 3L7DA 5AVJA 1NSTA 4PAWA 2XLBA 1KRWA 3QWUA 1C0IA 5ICSA 4A4DA 1XALA 2BTQB 1JMVA 2UZ4A 4OG2A 5AVOA 1SKWA 4W8HA 3ZXWA 3TQIA 4O4JF 2XB4A 2XMJA 3D1LA 2ZUWA 3H9EO 2PV7A 5AIBA 3K05A 1X7YB 4F0JA 3UMYA 1IPFA 3S1AA 2VJVA 2IMOA 2VXOA 3M8RA 4YIKA 2VP3A 3GV8B 2XSZD 5EUCA 4F67A 2IYVA 5CDFA 3L4JA 3EPJA 4OM8A 5DV9A 2ZH6A 1A8PA 5JCZA 1PGQA 1RAEA 3K5MA 3GCXA 4FS8A 1NNLA 4IYJA 2E6UX 5EWJA 3KQTA 2F43A 4OYAA 5IC4B 2X1LA 4DL7A 3QE4A 2QMZA 5C2GA 4DV4F 1DBVO 1BXKA 1JIKA 4QDZA 5HEKA 1R74A 3GLQA 4YRQA 4A8MP 3B3JA 1R4NA 5HPYB 3SXPA 1XA4A 3OCWA 1JRLA 1QDEA 3UN3A 3ZV3A 4WE1A 3DKPA 1XR7A 1MH1A 5KOWA 4JLPA 2EC0A 2UP1A 5BVHA 2QTRA 3HMKA 4TMYA 1YNSA 3VU0A 2L9DA 3A9VA 3I6BA 1QP8A 4JI1J 3D8RA 5D7BA 4NQRA 3BCRA 1QB8A 3A4TA 4PM4A 5F1YA 1LW7A 4P0PB 4GRSA 4GP7A 4KO3S 3LBYA 4Q4DA 1DSSG 3F98A 3FB1A 1NIJA 4GL4A 4M6WA 1Z63A 1V3SA 5IX8A 5FO1A 4LF4J 2FW1A 4MKBA 3D7LA 3P8BB 1G0OA 2XPCA 4BVEA 5IBRA 3P5SA 4Z9XA 4D26A 3AQPA 3IDSA 1N36B 2O05A 3KYBA 5HLFA 2PLAA 3ORYA 3E84A 3WLTA 2GEFA 5CA0B 3KLOA 2OYCA 3JPYA 2ZT5A 3FGVA 3AEYA 2O3TA 3DO5A 1JKJA 2RH8A 1EM6A 5C7OO 2HEKA 1U24A 2HQCA 4HDMB 1WCXA 1QP0A 1XD2B 4R41A 2GAFA 2PWPA 2QT0A 1SCUB 4G2TA 1E3WB 3FF4A 4ZLLA 2QRRA 3L9WA 3TQCA 1PAEX 3H5YA 2A94A 4UDYX 3H9CA 5DJBA 2OUIA 2E66A 1SO8A 4JFAA 3E9NA 4K2AA 4B08A 4GR9A 3RSLA 2IZ6A 2RJ3A 2J3MA 1SBHA 2HRRA 2EC2A 1N7GA 1NM5C 4F04B 4DRXB 1JP7A 3DULA 5HJ2A 3S5UA 2MKSA 5D1HA 1H1LA 5KFWA 3C7AA 4BNDB 2Z9BA 1KQFA 4LZZA 3LHSA 1ID1A 1V1RA 3OL9A 3M2TA 5DO2A 3GF4A 2ZK7A 4Q1AA 1SHKA 4JI6B 2QRMA 4WNYA 2VZ9A 1KEEB 2JI7A 5KTNA 2A0FA 1ADCA 2UXCB 2JLRA 2FJBB 4NX9A 3G2QA 3SSSA 1JDBC 1KJWA 2E9SA 3LC7O 2C1XA 3RLFA 1TVMA 4MKVA 3TZKA 1U26A 1A9XA 1H38A 4PCUA 2FZ5A 1W96A 4KVFA 4GEKA 1XTUA 4JLVA 1DBSA 2YUTA 3WGYA 3TG2A 5BWLA 1RKIA 2AFHB 5IAKA 3X1JA 2VHTA 1BKDR 5HDBB 1S1VB 4B6RA 3UXEA 2H1HA 2YH0A 1H93A 4MLPA 4HNQA 3C3YA 3LMKA 5L3VA 3VALA 3N7TA 1FRMA 1YS9A 2XQIA 1U04A 3UOWA 1EK1A 3DHXA 1PQPA 4A6DA 4ZCIA 3GFVA 4USVA 4DMRA 4YRKA 1SURA 4RLEA 3S28A 3HCWA 2QZ9A 1KYTA 3BH7B 2G13A 3V4VB 3QNWB 3HLYA 4EITA 3HYCA 5HBMB 3KFWX 3E82A 3MMSA 3F6RA 4KODA 4MT1A 3PYLA 2IYYA 3T4UA 3OZDA 5KCMA 2CL6X 5BR8J 1L1FA 4OA8A 4CTOA 2VP5A 1AK9A 2W9XA 4A6EA 1LBHA 4UU8A 5EZYA 4F6LA 5JG7A 3ZK8A 4IV0A 4IH5A 4QUJA 5AKZA 1N5OX 1VYVA 4KFBA 3ZWBA 2O1EA 1QIKA 1IR1A 3NIFB 4B3SB 2DR9A 1U8SA 2WB1D 1F3FA 2QD1A 2ADFA 5JYBA 1LU9A 5IYZF 3JTNA 3DGPB 3I56S 3WL6A 3N28A 4DARA 5BSEA 5AJUA 4JA2A 2OZKA 3SHTA 5BP7A 1Z3CA 1KAOA 4RZHA 4OB6A 2VWQA 1YR6A 5AFSA 4ZAVA 1RE0A 1NP6A 5TE9A 2DHQA 4B82A 3ZK7A 2O1WA 5JC8A 2DKFA 2ET6A 3TLXA 3CXRA 1GAWA 2AF6A 2YVUA 4C8OA 2ACWA 5EN4A 5D01A 1MQ9A 1U8CB 4G6VB 3NS5A 3DHYA 4Q4AA 3QENA 4ELVA 3SZRA 3PW4A 1KJIA 3PFFA 5HM6A 2PJRA 3GUVA 1IVZA 3M9WA 1T6ZA 3H2BA 4FFSA 2WV7A 2FKNA 4JMPA 2ZH2A 1BD6A 4PNPA 2EGGA 5DHSA 1SXLA 1BN7A 4JB0A 4MIKA 2GMWA 4DB2A 4FQ7A 4LJRA 3ZBQA 1VRCA 1R0BG 2ZZKA 3GP5A 2ACYA 3IEMA 2Q3JA 2HVEA 2JLQA 1E9BA 4I1TA 3O9MA 4WKYA 3IJPA 4ASUD 4B33A 3OFJA 1GCGA 2V5VA 1KZGB 3DKRA 2DPXA 4OIFA 3TLGB 2JFNA 3OJUA 3R1HA 3RYFA