3K5PA

Crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
405
structure length
400
Chain Sequence
SRDRINVLLLEGISQTAVEYFKSSGYTNVTHLPKALDKADLIKAISSAHIIGIRSRTQLTEEIFAAANRLIAVGCFSVGTNQVELKAARKRGIPVFNAPFSNTRSVAELVIGEIIMLMRRIFPRSVSAHAGGWEKTAIGSREVRGKTLGIVGYGNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLKTSDVVSLHVPSKLITEAKLRKMKKGAFLINNARGSDVDLEALAKVLQEGHLAGAAIDVFPVEPASNGERFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFPQVQLPPRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVGEASDAVLQEIREIPGTIRARLLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of amino acid-binding ACT: D-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from Brucella melitensis
rcsb
source organism Brucella melitensis biovar abortus
molecule tags Oxidoreductase
molecule keywords D-3-phosphoglycerate dehydrogenase
total genus 139
structure length 400
sequence length 405
ec nomenclature ec 1.1.1.95: Phosphoglycerate dehydrogenase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k5pA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3k5pA01
3DR3A 4WEQA 2Q1UA 2V7PA 3GUCA 3OIFA 2NVUB 5KVSA 2H6EA 4WASA 4BB6A 4ZQHA 1B3BA 5ICMA 1K2WA 3KZVA 2BF7A 3U9LA 1MC5A 5U9CA 1LDYA 3GDOA 4IDFA 2E4AA 3SJUA 1EE2A 4N18A 3DZJA 2O2YA 1VJ0A 2A92A 4XYEA 4W82A 2DKNA 2TMDA 5TX7A 4XB1A 3WSWA 2VQ3A 1JU9A 3WQRA 9LDBA 1PTJA 3JQBA 1N9GB 3PZBA 4CMAA 4ZVVA 4CMCA 2BGMA 2BH9A 2EXXA 2GR9A 3RC2A 4OXYA 4TRNA 1VM6A 1NWCA 2PGDA 3W4KA 1QYVA 3CKYA 4QTZA 1Z74A 1ZPVA 4DWVA 2WDZA 4FFPA 4J0EA 4I08A 2B83A 4KP7A 4XQEA 5FI3A 3S1LA 3EVTA 3ADOA 4FFRA 4EJ6A 1I01A 3ZU3A 3LT4A 3NDRA 1NNUA 4KWHA 1KVUA 3AY7A 3PTZA 5I9LA 4KZPA 2EHDA 2R00C 1W6UA 4D7AA 3INGA 4X84A 5EQFA 4CM3A 3ZV6A 5A1TA 3JD3A 1PX0A 4R9RA 3MEQA 4DBZA 1HYGA 4JJIA 1KY4A 1SMKA 1WP4A 1LI4A 1GUFA 4WLVA 5JO0A 4Q3CA 1B16A 1NAHA 2PV7A 1T2DA 1ZJZA 4KOAA 3OM9A 4DYDA 4IQGA 1EMDA 1HE4A 3ZGYA 4CV2A 2GN8A 3JQDA 5B4TA 1Z73A 5JO9A 1BXKA 4GX1A 5DCYA 3I83A 1PJTA 2AMFA 2FZEA 4CLHA 1Y5MA 3NEPX 5B37A 1ADBA 3PI7A 1BGVA 1PJ3A 2ZB3A 1AE1A 5JPIA 5KKCA 2YY7A 4R68A 3NRCA 4XCVA 5ADHA 1ZKMA 1HYHA 2J6IA 3EW7A 1TI7A 1YB5A 2AQKA 2YHUA 1U8FO 1E1MA 3QVSA 4MVJF 1GQ2A 3WJAA 4RF4A 4BNYA 1DOHA 1Y7TA 2QHXA 2Z95A 3IJPA 4CR6A 2HK7A 5EQDA 5IT0A 2VUSA 1XYGA 3NJ4A 1BRMA 1JN0A 1PR9A 3ST7A 1O0SA 3BYZA 1IULA 1DEHA 2ZCVA 2FGCA 3ZNOA 2UV8A 1WNTA 1MG0A 4IJVA 5JS6A 1HDZA 1FDUA 5FYDA 2IRWA 2PD3A 6ADHA 3KLPX 3IKVA 1N7HA 1UDBA 4GSLA 3FD8A 3GZNB 1JAYA 3E9QA 3K92A 1WLYA 4FJ1A 1O95A 2AQ8A 4JBGA 4OMUA 4BUCA 4QQRA 3HJAA 2Q99A 3ZU5A 4MDHA 4LCJA 3PHLA 4E30A 2X9GA 2CY0A 5CG1A 2ZQYA 1HE5A 3DBHA 5AYVA 1EK5A 1E3JA 1VJTA 3D0OA 4B8ZA 3WG9A 1UP7A 2NNLD 3DZIA 4P4GA 1GPDG 5B12A 1QYDA 5FEUA 2Q50A 3DTTA 2ZTMA 4E13A 3ONFA 1HTBA 1P74A 2Y1EA 4W9NC 4ALJA 1K5HA 3PHHA 2WEKA 1SZJG 5DP1A 1Q7GA 3D4OA 3VKVA 3PEFA 1MX3A 4KUEA 3VH4A 1I2ZA 2IZ0A 3ZWPA 5BT9A 1LQUA 3WGQA 8LDHA 2HK8A 2NVUA 1PL7A 1UJ5A 3PVZA 5CG2A 2Q2QA 4IIUA 5F5LA 1LLQA 2FR0A 3TOZA 1R37A 2PKQO 3HADA 3RI3A 4CL3A 3OHSX 4R16A 2Q45A 5KWEA 2O2SA 4BNLA 1RKXA 4PGFA 4NBRA 3TDKA 3V5NA 4DQUA 1E1NA 1WZIA 4RJTA 1VKOA 2VNSA 2CF6A 4AFNA 1N5DA 4JNKA 3SXPA 4AJOA 3TZ6A 3PDJA 1SB9A 1DHTA 5TGDA 4CQMD 1DIHA 1N8KA 3GEGA 3VAZA 3AY3A 3IP1A 3ROQA 2G1UA 3VH1A 1NQAO 1UXKA 2PNFA 4FR5A 2X6TA 3I6IA 4UREA 4CM9D 1ADFA 1LC0A 1GL3A 1QLJA 2AEFA 4Q9NA 4D3DA 3JYNA 3I6QA 4ALKA 3FRJA 3LSYA 2FSSA 4URFA 3SEFA 4CR7A 3HZZA 4JROA 1W73A 1EZ4A 2P5YA 5DCWA 4BOYA 1PWXA 2CD9A 4P38A 3ROKA 4J6FA 2D3TA 3HN7A 2NLOA 2Q1TA 3H9UA 3MJSA 4L4RA 4LCEA 4MKZA 1E1LA 2WYVA 3OJOA 2P9CA 3TN7A 4PZEA 4AJNA 1ULUA 1V8BA 5I7FA 2QG4A 3DMTC 3NDJA 2V6MA 2FZWA 2PD4A 1WMAA 2UUPA 3ZH2A 1R4MA 1GEEA 3KHUA 2QRKA 1BXZA 4J1SA 5CEFA 3JQCA 5J23A 2B5WA 1PQUA 2DTXA 1CETA 2HMTA 2YFHA 1DLIA 2VYVA 3PK0A 3ZU4A 2H1SA 1TT5A 2NU8A 1ZSYA 3VTZA 4DBVO 3DFUA 4I5DA 3GT0A 3S8MA 3SC4A 1N92A 1ZH8A 1F0YA 1RJWA 4TRMA 4II3A 4BO3A 2JAPA 4I5EA 4YQZA 4RVHA 2PY6A 4UEOA 4YJHA 3Q9NA 3D3WA 3DBLA 5JYEA 4FDAA 4WK6A 2E49A 3WBFA 3CH6A 1PJCA 4JN6B 1NR7A 3HDQA 2LDBA 1RWUA 2I9PA 1MB4A 4PG8A 4IXTA 5LDHA 2YJZA 4WOKA 3UUWA 1A4IA 2BGLA 5CFZA 3FNHA 4FGWA 3CZMA 3AM3A 3DOCA 4KQXA 4B4OA 2NQ8A 4DL9A 3ENVA 3DBRB 5IDXA 2A4KA 2DUWA 4JLWA 3GN2A 1SNYA 3C7DB 2NWQA 4NU6A 3WYEA 2VTDA 3C1OA 1GZ4A 3ENKA 3I1JA 4KMSA 4PLGA 3ZV5A 4CM9A 1IPFA 1P45A 4IDCA 3P2YA 2C7GA 4RQTA 5A02A 2QRRA 4CMEA 5A9SB 1O8CA 1R4NA 2FR1A 4OL9A 3JQBC 3UHAA 3M2PA 3ZZNA 3PQDA 3Q9UA 2IXAA 1IYZA 3TF5A 1QSGA 3Q11A 3UCEA 2RQMA 5ENVA 1MLDA 2JCXA 3WJ7A 3S2EA 3ICCA 3G79A 3H5NA 5T8KC 1I2BA 4EJ0A 2ZKLA 5KTKA 1ZBQA 4J3FA 1ISIA 2ZB7A 3MJ4A 3RUEA 4YR9A 2V6GA 1HSZA 3CXRA 5DOVA 4BNJA 1NQOA 2KO1A 3KEQA 3GZ4A 5JXWA 1NFRA 4AJEA 3JQGB 5H82A 4D0SA 5IN4A 3LT2A 3IJRA 2EV9A 3ZHXA 2WJPA 1PQPA 3PLNA 3C24A 2CDAA 3H5AA 1X1TA 4K6CA 5A9RA 2XPCA 3R0IA 3RBXA 3U62A 1WXDA 3B6ZA 1YB4A 2DQ4A 2Y1CA 5EESA 4RVFA 5JE8A 3OJFA 3FR7A 1KYQA 1K6XA 4GQAA 5G0UA 4CLDA 3ITKA 3RWBA 1DIRA 1Q1NA 3LF1A 2OBNA 1ZNQO 2C7VA 3MWDB 3O1LA 1O6ZA 4A5OA 3FN4A 1GFSA 5L7WA 2VWHA 1T4DA 2Y05A 1Q2XA 4XEHA 2AG5A 1PSDA 3GG9A 1UH5A 2OP1A 3M1LA 4CQMA 2UAGA 5C5IA 4L4SA 2JL1A 1KS9A 1UXHA 1U7HA 1KEVA 2W8ZA 1R15A 2JCYA 1LLDA 3K8ZA 1TB4A 3P2OA 1I3MA 3KYCA 3PGXA 4RGBA 4BKUA 3JQFC 4BO6A 1F06A 1MFZA 4IJWA 1Q0QA 2EP7A 3FWNA 4OO3A 1W4ZA 4YVFA 4MVJM 1I8TA 1BVUA 3UCFA 3ZWAA 3TL3A 3LF2A 1UDAA 3BMOB 3I9LA 3TZHA 4YT5A 2X9NA 2UYYA 1R0LA 2UUOA 1H6DA 3KB6A 1GR0A 2DU8A 4GAEA 3GVXA 3KUXA 4QT0A 4Y6PA 2HAEA 1HDXA 1QYWA 4FPXA 5I9MA 1C1DA 5H83A 5IDYA 4BNTA 4ID9A 5C7IO 2HRBA 4XYGA 3P96A 4FSHA 4AJIA 3UICA 4CM8A 4Z9XA 3FCOA 2H9ZA 2CMDA 3C85A 1PGQA 1EDZA 1FK8A 4F6CA 4CMIA 4BO4A 1E3LA 2C0CA 3C1AA 1BDBA 1EVYA 1WMBA 1X7GA 4YYZA 1HETA 1C0LA 4OGWA 3RUHA 4AJKA 3EC7A 3MJEA 4J1TA 2EJWA 1WVGA 2HSDA 4XRRA 1IY8A 1HF3A 3QSGA 1U28A 4ND4A 4ND2A 2DC1A 3ENWA 3RUAA 4YRDA 5KCZA 3JYLA 1EVJA 1U9JA 1ISHA 2DLDA 2Q4EA 4WNCA 4BNFA 3OQBA 4E0BA 3HFSA 3ONEA 3GGGA 1FXSA 1I5RA 4MIOA 4DIFA 3OETA 5LDGA 4A0SA 4A10A 1C0KA 2BD0A 3Q2IA 3KYBA 3DMTA 4D45A 1IUKA 4NBVA 4BNVA 2BKAA 1WDMA 3ZHYA 3F5QA 1E77A 5JDIC 2WD8A 4JQCA 1Y6JA 4CLOB 4D44A 2H63A 1H6AA 3MJCA 3GDFA 3DL2A 3ANLA 4YT4A 4CUJA 4EITA 4N7RA 4ESOA 3WIDA 3U4HA 4L8VA 4TROA 4DVJA 3QVWA 1O5IA 1CF2O 1PJLA 4BO7A 1ENZA 1ZK3A 2ZHOA 4IS2A 3RKUA 4D79A 3H4VA 1ZO8A 3JV7A 1DC5A 4HFRA 5T8KA 2J5RA 5EL0A 2FOIA 1LK7A 4LSMA 1T24A 1GADO 2J5KA 2ZB8A 4BKQA 3GVCA 5TC4A 1V3TA 3L6OO 4BO1A 1F12A 4ND1A 3LC7O 2Y67A 4R9SA 2ZB4A 3ETDA 1OBFO 4DLBA 5L7YA 1LK5A 2PZKA 2EW8A 1CQIA 3SJ7A 4CLOA 3BMNB 4JJFA 3SX2A 1DPGA 4E33A 1XR3A 3LLSA 3I4FA 3GEDA 4PG6A 2RBEA 5TT1A 3FPCA 1U4OA 3L6DA 1CYDA 4RPJA 3F9IA 4GLOA 1AUPA 1MC4A 1EE9A 3G1UA 1ZEJA 2DBZA 3JD4A 3O03A 4MINA 2RQKA 1VE9A 3I4CA 3OIGA 4W4TA 5JAMA 3C1TA 1U1IA 4NZ9A 3ADPA 2D59A 4RVDA 1GDHA 4NNJA 2POQX 1RM4A 3RIHA 2HU2A 4G81A 5KJFA 1R12A 1XG5A 3LLVA 5T64A 4TSKA 3W8EA 4M8LA 2O7SA 4DTIA 2DT9A 4EYEA 1ONNA 4WCFC 2HMVA 4NK5A 5ITVA 3R6DA 1DRUA 3OA0A 5DCUA 3BHJA 1ADCA 4OHUA 2O3TA 1DC3A 3ABIA 3V2HA 1U7TA 3H6KA 4BO5A 4DLAA 3H3FA 1Y9AA 1PGJA 3WLFA 2HUNA 4CQMB 3INTA 3MJVA 3T7CA 3G0OA 3NDIA 4O63O 1YJQA 1XSEA 4IQ0A 1K0UA 3W8FA 1UP4A 2CSUA 1YVEI 3ZWWA 1BWSA 4YJDA 3HDJA 2H9IA 4DQXA 4AJJA 4HBGA 4PN3A 5LC1A 3JQAA 3VKUA 4C7JA 3O9ZA 2PH3A 1XU7A 3D5QA 1GYPA 3CE6A 4NFYA 3JQ9A 4CMGA 2UDPA 1LX6A 5BR7A 1DIGA 4WCFB 4PLWA 4PVCA 2VT2A 4NJMB 4XX0A 1UAYA 3RJ9A 4BKPA 4OOEA 4YAGA 3TUZC 2D5CA 4I9NA 1C1DB 2Z1NA 3FTNA 2J0WA 1H0KA 4C7KA 4ZQEA 2EG9A 3W1VA 4GWGA 2AHRA 4FCCA 3KM0A 5F1PA 2OFPA 3PJFA 9LDTA 4IMPA 3GAFA 4OYRA 1B0AA 3RFTA 4DQVA 3WNQA 3DTYA 5I8WA 1YOVA 4IZIA 1LBEA 3NGXA 3INRA 2YFQA 5L3ZA 2OXIA 5JAZA 2JFHA 3LVFO 4GVXA 3LU1A 4D41A 3EVNA 2NQTA 3OECA 3X2FA 3AOEC 4EDFA 2Y1OA 3QWAA 1NP3A 2YV1A 4E5MA 2GZ3A 3GQVA 3NT2A 5T6BA 2C82A 3QY9A 5DOZA 1XELA 2AQIA 1B14A 4D0RA 1HSOA 3EUWA 3BTVA 3F5SA 3U4DA 1C1XB 3JQFA 3ZCXA 4R4JA 2B37A 2O3JA 3NTQA 1K3TA 3BMCB 2YZ7A 4EUFA 2WSBA 3I3OA 1B8UA 4Y98A 4YXFA 4NU5A 3PFFA 4PLZA 1VPDA 2IE0A 1U3WA 2EGHA 2P4HX 3HG7A 3KEOA 4U0KA 4O6VA 1UUFA 3H9JA 1H5QA 4IJKA 1C0IA 2G17A 1SBYA 1SEVA 3OICA 3PXXA 4J1NA 4JBHA 1OFGA 2PZJA 5EMHA 1HDRA 4FFMA 1XU9A 4CUZA 3OFGA 5LCXA 5TLSA 4KDFA 2O3RA 1EVZA 1LSSA 3EMKA 4UEJA 5HBRA 1JWBB 4PG4A 3GEMA 4IO1A 3DOJA 2C07A 2PKQP 3LYLA 3RU9A 1Y8RA 2ET6A 4Q39A 1YQXA 3UAGA 3DDNA 2GPTA 3ZW9A 1RPNA 4CPDA 4B4VA 1MXFA 2W2LA 3MWEB 3AUUA 3VOSA 4Y67A 3K5PA 3HN2A 2JHGA 4E3ZA 4BVAA 2G76A 3GRKA 2QMWA 3NT4A 3RC7A 4B7XA 3AI1A 1H9AA 3CMCO 3VH2A 3U49A 4OAQA 1MXHA 4WPGA 4BNMA 1H6BA 3GH3A 3MOIA 1PU2A 3WFJA 2FSVA 1JTVA 1DRVA 1P1IA 3KSUA 1M6WA 2NACA 4O5OA 3UN1A 3BMQA 2Y99A 2JD0A 5IXYA 2PC6A 2PGJA 4EJMA 3AB2B 3OEWA 1PZGA 4XGIA 1EBFA 4WUVA 5T5QA 4ND3A 2PKRA 3DWFA 3FBGA 3QIVA 4E32A 1ADGA 3ZWMA 3LQFA 3PRJA 3N74A 2JHFA 2FPIA 4II2A 2QX7A 4BNXA 5ILGA 4WJZA 2OMEA 3AW9A 4QSMA 4CQLB 3GOHA 1P9LA 2X0IA 3ASUA 5TJ9A 4DMLA 2NM0A 4XKJA 1ISMA 1BVRA 4YQYA 1V35A 1YJ8A 3UOGA 4MKRA 4NR0A 3BTOA 1LNQA 3GA0A 2VOJA 4DIBA 2C59A 5C3MA 4GO7X 3VZQA 4BB5A 4ZQGA 3IBWA 1IZ0A 2QIOA 4J7XA 4ZQFA 3H9GA 1JKFA 2V6BA 4G2NA 4WLEA 4YT2A 3OF2A 5IZCC 5JY6A 4D46A 1J5PA 5THKA 1VRWA 3GAZA 4FFNA 4TZKA 2P91A 4L74A 3GPIA 2XOXA 1E7WA 3RC1A 1QG6A 3V2GA 4DPLA 1K6JA 3PWKA 1GY8A 4XIJA 4UULA 1D7OA 2BLLA 3WMWA 1FDTA 4UVHA 4LN1A 4PFJA 3TUJC 4I1IA 3AUAA 4AJPA 2W2KA 4LMRA 3LZ6A 2AE2A 4L75A 2CVOA 3RBZA 1PJ4A 5L51A 4J2HA 1ONPA 2ZTUA 1Y7PA 3HQ4O 1D3AA 4JCOA 3UH1A 1VL6A 4M87A 4W99A 3LT1A 2X8LA 4BMSA 2G0TA 1AXEA 3DB2A 4CMHA 3OFFA 2NYIA 5GMOA 1GZ6A 1XA0A 5KVCA 2CNBA 4B3IA 3KLMX 4IUYA 5K0ZA 3O4RA 3OBBA 2PFGA 1R16A 1DHRA 2EW2A 3GVPA 3I23A 3QWFA 4LSWA 1D4FA 2VRCD 3CINA 5DT9A 1NXQA 3AM4A 3BMCA 4XB2A 1YBAA 3T7EA 3WMXA 1O94A 4XDZA 2VYVD 3PWSA 1HXHA 4N5MA 3ZWVA 1IB6A 1JQBA 3FHLA 3FSRA 4HNGA 5A9TA 3D5TA 1PL6A 1TA4A 1UAGA 4AICA 3L7OA 4R3NA 1OC2A 3AU9A 1MP0A 4YA6A 2DTJA 1T2EA 3K9QO 3H65A 3I9KA 4AL4A 3DZHA 4J9UE 3SLGA 3QV1A 4PLYA 1KC1A 1DRWA 3OQ1A 4F45A 4CMEC 2BFAA 2VNAA 4ITUA 4E21A 1Y8RB 1YL5A 1ISGA 1MFPA 3HHEA 5ES3A 3P19A 5CAEA 4NFHA 1YQDA 4RVGA 2YQ5A 5I8ZA 4FC7A 1M75A 4MOWA 5A3JA 4BS9A 1WAMA 4DRYA 4G5HA 1Y8QA 3ZWCA 1U3TA 3EZLA 2X7HA 5DZSA 5K9ZA 2FP4A 1X7HA 4KUHA 1BMDA 2J3KA 1QYXA 2GZ1A 3D3EA 3O26A 4B4UA 2YHIA 2A9FA 1I30A 1E5LA 4Z9FA 2QSWA 1DJNA 1P1HA 4NBTA 1H93A 3NJ8A 2X0RA 3QVTA 4J2OA 4L76A 4BNWA 3D7LA 3ROMA 1TVEA 1QXSA 2DUUA 1ZIDA 4MKXA 1Y5RA 4JIGA 4LK3A 4Y6RA 3UCXA 3AJRA 4W7IA 4YJGB 5KJ6A 4J7UA 2LQJA 1MUUA 4LGVA 1HEUA 1CDOA 4QFCA 1YONA 1FMCA 1Y1PA 3NV9A 3AAWB 3RUDA 5COAA 4YDRA 4ZRMA 5C37A 4PLHA 1SC6A 4M86A 4CR8A 5L45A 1ZW1A 1JDJA 1ZJYA 5JJBA 2PR2A 3TFQA 5L4SA 3MTJA 4HY3A 2WD7B 3B1KA 4PG7A 6LDHA 4F46A 2FN7A 4WEOA 1H2BA 5EIOA 5MGBA 3VPSA 4DMMA 1LC3A 4ZU3A 5IN5A 3OJEA 4HX5A 3U7JA 3L9XA 4WLUA 3TWOA 2F1KA 1U8XX 1YDEA 1VLLA 2GN6A 4CMIB 3GGPA 3OH8A 5AXCA 4ZRNA 3S2FA 4E2ZA 4KWIA 5GY7A 4I5FA 3HUDA 5CDGA 3ETEA 1PZEA 1M2WA 2JCVA 3LK7A 2ILTA 3KWMA 1T2FA 1M76A 1S6YA 2F00A 4PRLA 4C4OA 5HRUA 5G4KB 4HFJA 4BNZA 1F17A 2O4CA 2X58A 3PIIA 1K6IA 2B0JA 3C3XA 4XQGA 1GEGA 1E3WB 3W8DA 1HLPA 4A73A 2W2KB 1GPJA 2I67A 1LRKA 3GMDA 4MVJI 2BI8A 4Q3DA 5TIIA 2C29D 1AHHA 4OXKA 2QYTA 1BSVA 1C3VA 3QVXA 5A3VA 4GL4A 3ZI0A 3MOGA 4IQ8A 4WLFA 3RJ5A 3T4EA 1LJ8A 2DT5A 5KKAA 3PQEA 1DAPA 1J6UA 3Q6IA 5A06A 2OL4A 2X0NA 4X54A 4E5NA 3OFEA 2CDCA 4XQCA 5I7SA 4RLHA 4GMFA 4HUJA 1UJ4A 1BHSA 4H7PA 5ER6A 4NJOA 3VC7A 3WWYA 1JVBA 2PLAA 1P3DA 4MVJD 4RVUA 1DC4A 4BKRA 4OIMA 4E5KA 3JD2A 4RPHA 1XQ1A 1BXGB 1KETA 2Y1DA 2A35A 4E2WA 5I7VA 1NX6A 2FR8A 3MCVA 5G2OA 2PWZA 4EW6A 1OZAA 4BMNA 2P9GA 1DLJA 1I36A 4M55A 3G17A 3QLJA 2D8AA 4E6PA 4PLVA 3JQEA 3F3SA 4CLEA 4NMLA 4OH1A 1XWFA 2OP0A 2WTBA 3F1LA 3RROA 4IINA 3EZYA 2F8MA 3BA1A 5EERA 1QRRA 1NPTO 2DAPA 4MO2A 2EF1A 2B4RO 2NADA 5EJ2A 3OQ6A 3HE3A 3IUPA 1PJSA 3C8MA 4QUKA 3TNLA 1NQ5A 1VI2A 5BNTA 1B15A 2VHXA 4TKLA 3PHGA 4TZTA 5JAQA 3ZWOA 1LDEA 5DBIA 2FPPA 1ZVMA 1ZMOA 4NK4A 3E9NA 3P5SA 4RZIA 2C5AA 4N54A 2JKVA 2QRJA 1LLCA 1Y8QB 2BGKA 1TT5B 5AVOA 3CZRA 4ZICA 4YAKA 1UDCA 2X5KO 1KEPA 1U5AA 2QZZA 1P77A 4ALIA 4RVSA 1U3UA 4BNUA 3RFVA 1T1SA 1D8AA 5FFFA 1A9ZA 4RLSA 3NTOA 4YRAA 4HXYA 4J43A 4ZQBA 4YWJA 2VRCA 3TRIA 2IYPA 4OQZA 1IL0A 2Y1GA 3JQ8A 1NFQA 4MVJA 2P9EA 3RFXA 4CM5A 4DGSA 3AM5A 1B3RA 5C7LO 4U7WA 1KERA 2NTJA 4CODB 4Z3KA 1HZZA 1GQQA 3COSA 1ZSNA 4HKTA 3STHA 3WGZA 1NFFA 1VC2A 3GUYA 4BGIA 3GHHA 4UVGA 4CMKA 1TXGA 2FMUA 1OAAA 5MDHA 3BIOA 3WDSA 3LOUA 1P0FA 3PQFA 1OI7A 3ORFA 5COQA 3KBOA 4TRRA 1DIBA 2RH4A 3IQDB 1OOEA 2GN9A 1DJQA 4D3FA 1RYDA 2GD1O 1TLTA 3R3JA 2JFFA 5A5FA 3UXYA 1RM5A 3IP3A 2GLXA 2Y68A 4BKOA 4XDYA 2Q2WA 1KOLA 4YEDA 4BV8A 5ILOA 2B35A 1Q7CA 4LRSB 4IXWA 1N1EA 2Q46A 5DN9A 1ID1A 2Q1WA 4IDDA 3ZWBA 1EBUA 5FWNA 1PGPA 5G4KA 3D4PA 2R2GA 1JLLA 3IMFA 3ZHZA 5HA5A 4RL6A 1HZJA 5JC8A 1PS0A 3PFWO 4EEZA 1E3WA 1CIVA 1ZMTA 3U5TA 1HDCA 1C1XA 1GV1A 3NAQA 4RQUA 4PLCA 3ZV4A 2PK3A 4N5LA 1CEQA 5CEEA 1YB1A 3G3EA 5KJ1A 2NV6A 1NWHA 2VRBA 2Q4BA 4FOSA 3L4SO 3PJDA 2PD6A 3K2EA 2YUTA 1ML3A 2Y66A 4QECA 1YDWA 3RUFA 4DYVA 5JYDA 1ZK2A 3L4BC 3PIDA 1NPYA 1L7EA 1LKZA 3CMMA 1UZNA 2VHZA 4I5GA 5JW6A 2WE8A 3EYWA 1Y9EA 4EGFA 3RSHA 4J91A 4FFLA 3BTSA 4HFNA 4B79A 2VUTA 1KY5A 4R1TA 5JBIA 3DAGA 3PHJA 4MIEA 1XEAA 2QQ5A 1YL7A 3A1NA 1V3VA 5JCJA 1SOWA 4MJLA 3GC6A 3IC5A 5BSHA 1O8BA 2W4QA 3IS3A 3ZWXA 5ENDA 1PIWA 1SOVA 5IG2A 3HB4X 4IMRA 1EUZA 1UXJA 3ROPA 3E48A 4WLOA 3TOXA 3UW1A 1U8SA 3PWZA 4U5QA 2I5PO 1A5ZA 3LDHA 5CP8A 5DNAA 4J0FA 5AOVA 4MP8A 2GRAA 1O89A 1PWZA 1XCBA 4QXMA 1G1AA 2R6JA 4EBFA 2G82A 4CLRB 3DHWC 4OKIA 1ZK0A 1E3SA 2ZATA 3BMQB 3V1TC 1Z7BA 5K6AA 3EDMA 3KYDA 3TUIC 1U3VA 5IXSA 3QA9A 1O9BA 4U8GA 2NTVA 5GZ1A 2GCGA 5G4LA 3V2UA 5CPBA 4R01A 1CQJA 3ZWYA 4NMHA 2GF2A 3AUTA 5KJCA 3SVTA 3K6JA 4K28A 3L77A 4ROSA 3D1LA 1ENPA 1ORRA 2VTEA 3WYBA 4D43A 4ZN6A 3QWBA 2RHRA 1PS9A 2ZTVA 3M1AA 1T26A 1SEPA 4IGEA 2X4GA 1HYEA 4BNGA 3E82A 2GNAA 5CHEA 2BFMA 1UZMA 1ZZEA 1E6UA 4CV3A 3GZNA 1YE3A 4RDHA 3A9WA 5TJHA 1JWAB 2Q3EA 3DBVO 4XYBA 2B4TO 4BNKA 4MVJP 4RPLA 2VWPA 3NKLA 5JCJD 1AGNA 5A03A 2Q2VA 3AOGA 4KTVE 2Y1FA 3JQ7A 3VZRA 2CDQA 4AJ4A 4E12A 3L0DA 1GYRA 1CJCA 2HKIA 1FDVA 3DBHB 4FJ0A 1I2CA 1A9YA 3B1JA 3VTFA 4ALLA 1ZK1A 4XYLA 5CDSA 2Q49A 3DZGA 1AXGA 2HMSA 3KXDA 1LA2A 2V65A 5AXAA 2NUAA 2VYNA 2I3AA 2QMXA 3ZDFA 3AUSA 1ZEMA 2V6FA 5KJEA 5JMPA 3DBRA 2C54A 5A9SA 1A72A 1EVIA 3PJGA 1J0XO 2YDXA 4LVCA 3RVDA 1VJ1A 4TQGA 4B8WA 3VZSA 3FI9A 1ZFNA 4CM6A 3GGOA 3VDRA 5F1OA 1KIFA 3KO8A 3W6UA 3AWDA 3U4IA 1PGNA 3OSUA 1GUYA 1B8PA 4YCAA 3BMNA 3DHXA 4M54A 3UFXA 3VPXA 3DAFA 4RO0A 5GZ6A 3E9MA 1E92A 3R3SA 4IGFA 4K1LA 5HM8A 1IZ9A 4ALMA 1HRDA 4CLXA 3B1FA 4BQRA 1WW8A 4JJGA 3DHNA 3K31A 1DBVO 3VVCA 4M49A 3ZNQA 5I9NA 3DO5A 5AXBA 2C5EA 2D2IA 3FTPA 3OJLA 4TVBA 3L6EA 1MG5A 4UUOA 1Z75A 2OOSA 1PR3A 2FY8A 2WWRA 5CEJA 1T2AA 4HNHA 1IPEA 3RKRA 3S2IA 4YACA 1CRWG 4GMKA 3O8QB 5DF1A 2CVQA 1UJMA 1ZK4A 3H7AA 4UAGA 1DXYA 3DONA 4OOFA 5BSGA 2AW5A 2PZMA 3MJTA 1SO8A 3AI3A 2BHLA 4RF3A 1E7MA 5ICSA 4R54A 3DHYA 4E2YA 1ULSA 1JKIA 2DVMA 1T25A 2I3GA 3QW2A 4XA8A 2D4AA 4LW8A 1M6HA 3OP4A 1NBOA 1PZFA 3GVIA 4LVUA 2C20A 3EK2A 4TWRA 4Y9DA 1EDOA 3U4CA 3W4IA 4B7UA 5T41A 3NYWA 3WS7A 3FNFA 5L4LA 1E1KA 1HDYA 2DTDA 4B3HA 4UVEA 2ZYGA 4J4TA 4BV9A 4BGEA 4ZD6A 3GN1A 4CLRA 1YL6A 4RCVA 3WICA 3JQAD 3I52A 3E1KA 4GSKA 1ENYA 3E5RA 1NHGA 3OFHA 1WDKA 3I9OA 4WKGA 5IDWA 3MTGA 2X0JA 1VL8A 3I9JA 1GCOA 5G0SA 1LXCA 1Q0LA 3LT0A 2D1YA 3IOYA 4GO5X 3RASA 4U6SA 1HDGO 2RIRA 4UUPA 3TZCA 1DC6A 4JBIA 1S7CA 2IEBA 1E7RA 5KVVA 5TT0A 2O50A 3EY4A 2I76A 1YBVA 3JYPA 1H2HA 4RV9A 3UW3A 3Q3CA 4CV1A 3S1TA 1IOLA 1G6KA 3JQ9C 4UUMA 4YPOA 5TS3A 2J3HA 3IIEA 1UP6A 3IL2A 3H9EO 2B69A 3A4VA 1HL3A 5I7EA 5A5EA 4R69A 4LMPA 4DC1A 3F46A 4RDIA 5JSFA 1JKJA 3WFIA 3ZW8A 4KUGA 5G0WA 1JVSA 4EEXA 4GMGA 4WLNA 1I3NA 2EERA 3D4NA 4XYMA 5HWSA 3VPFA 4PIVA 3FBTA 1A27A 3F4BA 4XGKA 1V9LA 3DC2A 2VHWA 4JXKA 4KQWA 2B4QA 3JQGA 2VWGA 2W98A 2ZYAA 3DHEA 2C2XA 5TNXA 3ZNNA 3EHEA 4MIYA 1F8GA 1KS2A 1XDWA 3EAGA 2WYWA 3JYOA 1WWKA 5U4QA 4PZCA 1L1FA 4EUEA 3OBIA 3GNTA 3WXBA 1NASA 2Y0CA 1WPQA 5B1YA 1M66A 1P0CA 4XRGA 4BMVA 1L7DA 3WIEA 1I33A 3WQSB 5DP2A 4I8XA 2EEZA 3H9QA 5ER9A 2GO1A 3L9WA 2Y0DA 5L40A 1LRJA 1SAYA 2B36A 3HHPA 4GX0A 3AI2A 4KTTE 1F14A 1UXGA 2I99A 1KBZA 3GFGA 4L0QA 3VZPA 5A05A 1BTOA 2CUKA 3ULKA 2PZLA 1D1TA 4H15A 2O3UA 2PA3A 4L4XA 1UJ6A 2JHEA 4NPCA 1BG6A 5ITWA 3GPDG 1MV8A 3PZRA 4BIIA 4BL5A 4DA9A 5FIIA 1RM3A 3ZNPA 1BXGA 1DSSG 3WYCA 5BNFA 1AHIA 5CDUA 4HFMA 4E5PA 1PQWA 4A2CA 2GASA 5CDTA 3I5MA 2VZ9A 2WMDA 2A94A 3W6ZA 4ZJUA 1B26A 4A27A 4J4HA 2E48A 4EI2A 2I9SA 3L07A 2E6UX 3BAZA 3AU8A 2HDHA 2VHYA 2QRLA 4M8SA 1E7YA 1KVRA 3QWHA 2CF5A 4YAEA 2SCUA 4U0JA 2GN4A 1QLHA 2VHVA 1Q0HA 1VSUA 2NSDA 1MGOA 4HV4A 2X5JO 1H6CA 1XKQA 2VOEA 3JTMA 1FJHA 1ENOA 1A7AA 1EEHA 2HRZA 1JA9A 4PWUA 4O1MA 3C7CB 5F21A 3KSZO 3ASVA 5FI5A 3DZKA 3U3XA 4R5MA 2ZIZA 3WB9A 4R1SA 2ZCUA 4IZHA 1EUDA 1LTHR 3HB5X 4L9RA 2JD1A 3OIDA 1X14A 1LDMA 3ENQA 2O3QA 4Z0HO 3ZV3A 1TEHA 4ALNA 1U4SA 2VN8A 2ZJ1A 3AK4A 3LC1O 2YV3A 3ZN2A 1LSUA 4BO0A 4CM4A 1DAOA 4FJ2A 4XR4A 1PS8A 1GQYA 2BI7A 3ANMA 1XIVA 2HO5A 2OHXA 3UF0A 3KTDA 1R4MB 3VPHA 3E03A 5F1KA 3IUSA 1DDOA 1ISJA 4IS3A 5BQFA 1MA0A 4XIYA 2PGLA 3QHAA 2JJYA 4B4WA 3JD0A 4MVJH 4Q3NA 5HTOA 4BNHA 3JCZA 2NVBA 3AB4B 4NQZA 3A28A 2EKQA 1A71A 2JFGA 4W7HA 3H3JA 2YYYA 3S2GA 1E7SA 1NVMB 3GVHA 4QX6A 4YAJA 3VH3A 1BW9B 2Y0EA 4WGGA 1QR6A 1GAEO 1IHXA 4RF2A 2P5UA 4QO7A 3OA2A 3CEDA 3ANNA 4PLTA 1JW9B 4AJHA 3ZHBA 1BDMA 4MVJG 4AG3A 1LLUA 3WX0A 2Z1MA 1YOVB 3DZBA 4LUBA 1DB3A 1X15A 4CM7A 5JC1A 1LDGA 4J1QA 4BNNA 3HWRA 4M89A 5F3RA 1I0ZA 4YTEA 3DQPA 1R0SA 2EGGA 4XGNA 4K6FA 3QRWA 3W7BA 1M0SA 1TT7A 1Y81A 3C7AA 4JX8A 2FRDA 3WBBA 1YWGO 3F4LA 4XZ3A 1EQUA 1X0XA 3M2TA 5IFLA 1LSJA 2D0IA 3P7MA 3BZUA 1HT0A 4FB5A 4AJ1A 2E37A 2X1HA 3BHIA 2NU9A 2J3IA 2GERA 1I24A 4O59O 2QW8A 3HNPA 2HMWA 1I32A 2NVWA 3KV3O 2LDXA 2GSDA 5TQVA 1DFHA 1EUCA 2NU6A 2TMGA 1IE3A 4IM7A 3ZWNA 1RM0A 1EK6A 1GZ3A 1HE2A 2GDZA 2CDBA 4W6ZA 5HS6A 3WOHA 3FNEA 2O7QA 7MDHA 3X2EA 2VCYA 4XD2A 3PP8A 3GF4A 2BMAA 5IZCA 1E6EA 1J4AA 2XF8A 3WGOA 4E2XA 3E6AA 3HDHA 3KRTA 2YHIB 2LVWA 3DFZA 4DC0A 4P8RA 3NRBA 3ETGA 1ARZA 4AVYA 2B5VA 1XGKA 3EGOA 2HK9A 2I66A 4HP8A 3BXXA 4MVJE 4PRKA 5COBA 2ZTLA 1LEHA 4EZBA 3F47A 1CERA 2AE1A 4TMFA 3GMSA 5JCXA 2P68A 2GUGA 4R51A 3GG2A 1ZCJA 3JQAB 4FGSA 4YJGA 3WGHA 4J7CA 2CVZA 3WR5A 4JGBA 3VVBA 2FHSA 3U09A 1E7QA 3NX4A 2VT3A 3PJEA 1NPDA 2OORA 4YB8A 4IDGA 2X5OA 3RC9A 4B3JA 5GZ3A 3TFOA 8ADHA 4NJMA 1P1FA 3KYCB 5AQ1A 1E3EA 1ZSVA 4IBOA 3RQSA 1GUZA 3E18A 4BGUA 2ZQZA 3TPCA 1P31A 4IDBA 5T57A 1ONOA 4FOOA 3R1IA 4LRTB 1M67A 3GY0A 4CV0A 3H5RA 1P1JA 4QEDA 3WSVA 4BHTA 4S3MA 4TKMA 1UZLA 3GFBA 1NYTA 4IIVA 1T4BA 3QQPA 2O23A 4QFDA 3F6YA 5EN4A 4RORA 5HS4A 5G0VA 3WTCA 4DPKA 1GV0A 3H8VA 1LDBA 4DUPA 4Z3DA 2JD2A 2AQHA 2DBQA 2OZPA 4OM8A 4OSOA 4J49A 4R41A 5DDIP 3QJ5A 1N1GA 1KC3A 1ZUD1 2BELA 4M1QA 4XJSA 4D42A 2J8ZA 3FF4A 4NG5A 3K2BA 5DULA 1P1KA 3SC6A 2Z5LA 1GCUA 2O48X 4PLPA 3B70A 4JP3A 4FN4A 1KVSA 3NTRA 3FWZA 1P44A 4NBUA 4RF5A 2NU7A 3D64A 5TRTA 1LUAA 2RE1A 1LU9A 4ONEA 4DXHA 5T67A 1B8VA 1NM5A 2FWMX 3CSDA 3KVOA 3NUGA 4H16A 4RPKA 3PYMA 1KEWA 3MAHA 1VL0A 4BO9A 3CPSA 7ADHA 3JQ7B 4YAIA 1W8DA 4CMBA 2DFVA 2BRUA 4XQ9A 4PZDA 3ZU2A 1I10A 3DZFA 3E8XA 3QE3A 1SPXA 1C14A 2I65A 5KNLA 1BW9A 4ND5A 5U1PA 1YS4A 1E0DA 4IDAA 1I3LA 4NH4A 4XJTA 4BNIA 3JSAA 4GLLA 2GYYA 4BO2A 4GPD1 4ZGWA 5BSEA 4N5NA 2AA3A 4OJNA 1YKFA 1YBMA 1VSVA 1DFGA 4RZHA 2I6TA 3RD5A 2DM6A 4DPMA 4FIZA 4GKVA 4XR9A 1YXMA 2WE7A 3V8BA 1QMGA 4INAA 3TQHA 4CM1A 3F1KA 3ON5A 4HWKA 4R5HA 1J49A 1A4UA 3TL2A 4Z0TA 4YBZA 2D5AA 4NDNE 1QV7A 1XLTA 4E5YA 2ZK7A 3PYXA 4PCVA 5G0TA 3TZKA 1X13A 4ZHSA 1P1RA 5JDCA 3QWIA 3V1UA 4YRBA 1U2GA 4B7CA 4NHEA 5DBFA 4UVIA 2W2LD 4WE3A 2IDZA 3PDUA 4Q3BA 3RUIA 3H2ZA 3AOEA 2PTGA 2OBYA 4A26A 5CDYA 1NHWA 2F1FA 1HWYA 3Q1LA 4FW8A 3IKTA 1F8FA 2DPHA 5BNIA 5B4UA 5JDIA 3N58A 4PG5A 3AY6A 4L73A 3N7UA 5C7OO 3KETA 2HJRA 4R1UA 2AEMA 4ILKA 4PLFA 3WGIA 1HLDA 1T2CA 4J16A 3JYQA 1Z7EA 3LUYA 2AEJA 1E3IA 3K96A 4FS3A 4S1VA 5JY1A 1FDWA 1RYEA 2RHCA 4K26A 2EP5A 1B7GO 1QV6A 3O8QA 3CTMA 1GYQA 1IHYA 1LRLA 4FFOA 4WOJA 5EINA 4A03A 4F6LA 2YV2A 3HFGA 2X22A 4QO8A 4JP2A 5IJZA 2HLPA 2JAHA 4GGPA 1XHLA 2W90A 1NAIA 3Q0EA 4FBGA 3GR6A 1QORA 4A7PA 4GH5A 3MWBA 1SCUA 3TZQA 1ZXBA 4UUNA 2X9VA 2AG8A 1DO8A 5L4NA 4O0LA 1FF9A 3PYLA 3JQ6A 2OO5A 2EKLA 3GHYA 2ZYDA 1GU7A 2AXQA 2HCTA 4WECA 4F3YA 4UVDA 1C0PA 5BSFA 1NVTA 4TVOA 3H2SA 4BQPA 4YJHB 1X7DA 2XXJA 2OGUA 3D3WB 3DBLB 5IAAA 4J4BA 5KOIA 1ISFA 1KVQA 1UXIA 1AN9A 5JNLA 3AFMA 5L7TA 5L95A 2HMUA 1LQTA 4DREA 4XWYA 3M6IA 4YT8A 3LC2O 4AJ2A 3FPLA 2VZ8A 3WGYA 5A4DA 2O3SA 4KDEA 3RBVA 3VHRA 1B2LA 1N7GA 4ZA2A 2O4UX 4FQ8A 4Q3EA 2XAAA 4Q3AA 4MP6A 5AXDA 4I9UA 1NTOA 4E31A 3DOOA 3U0BA 3W4JA 3WQQA 5TF4A 2G5CA 4YJFB 1RWBA 3BHMA 1Z45A 4WCFA 5EPOA 3MZ0A 1R4NB 3UKOA 1E6WA 1VKNA 4Z9YA 5CPFA 3WGTA 1WDLA 3T4XA 3UVEA 1FDSA 1HE3A 2IXBA 3Q2KA 1Z82A 4J9VA 3OEYA 2OUIA 4IDEA 4BGVA 1PJBA 1E5QA 2CZCA 3OFSA 4J90A 1DFIA 1KEUA 1ZXLA 3HSKA 1XQ6A 3I9NA 3CUKA 5FF9A 3IXQA 4CJXA 1OMOA 1GD1O 1T1RA 3CEAA 2J0XA 2BFOA 4RPGA 1NR1A 5H81A 2DBVO 3GLQA 2HJSA 2PH5A 1Z6ZA 1PJQA 4IY1A 3JD1A 5IS2A 5IF3A 4NI5A 2J5QA 3E5MA 2R00A 4HADA 3RAJA 4TRJA 3WLEA 1R66A 1N9GA 5JDCC 5KVQA 3K30A 1D1SA 1LDNA 2DBRA 4GWKA 3N0VA 3L4BA 3CIFA 3GK3A 3KOUA 1EQ2A 1I3KA 2X86A 3GRPA 2RH8A 3ONDA 4GVLA 2VZ0A 2QYSA 3G1TA 4GX2A 4UEKA 2P4QA 2H5LA 3K73O 3RUCA 3FR8A 1QKIA 3DEYX 2RAFA 2IODA 1V0JA 4OSPA 5JFOA 3SLKA 2VWQA 3G49A 3GNQA 1JAXA 1G0OA 4CMJA 3A14A 2EJVA 4IPTA 5THQA 3BTUA 3SBOA 3WWZA 4GKBA 3WGGA 4NFSA 4IJUA 5TSDA 3ENNA 2C2YA 2YW9A 3PGJA 4I9HA 2IEDA 5JLAA 3QP9A 4R3WA 3BMOA 3DXFA 2BFPA 3KYDB 4P4LA 2DTEA 1X1EA 5B4VA 1QYCA 4EUHA 1NVGA 4MPDA 1HKUA 1P33A 2YDYA 3I9MA 2IZZA 3HDYA 1W0CA 5F5NA 2IZ1A 2RCYA 1EFLA 4LISA 4NBWA 3ITDA 2EWMA 1XTZA 4GBJA 4Z6KA 1QP8A 4Y6SA 2WM3A 4OXNA 4P22A 1SB8A 3NGLA 5L9AA 3S55A 4CM8B 2QZ9A 2XXBA 2ZJ0A 4PVDA 3DMYA 3O38A 3RU7A 2VUUA 2WD7A 2GZ2A 4K9DA 1EFKA 1NQTA 2J3JA 1LSOA 1UR5A 3PPIA 2FPGA 3RCBA 1N2SA 5JMWA 2CFCA 3V1YA 2NTNA 3PHIA 2P2SA 1U5CA 2MDAA 3KSDO 1V3UA 2Q1SA 3NT5A 4JK3A 4OQYA 5K6AC 4CQLA 1Q7BA 1PEDA 3QVOA 3WTBA 3ICPA 2Y93A 4FC6A 2YQ4A 4DLLA 1YGYA 1KVTA 3A06A 3B20A 3IAHA 4GX5A 3TJRA 1YH3A 5DBGA 1PJ2A 3VDQA 4CM4B 5IT4A 3WNVA 1DIAA 4OKNA 2JOQA 4GI2A 4Z0PA 4FD3A 3VPGA 4E4YA 4D3SA 3JQ8B 3OJ0A 1H94A 3AFNA 1CWUA 1PL8A 2GGSA 4MP3A 4Y8VA 2DPGA 3PLRA 1U2DA 5JAIA 4CL8A 1R6DA 2DFDA 1V6AA 3GDGA 5IZ4A 4G65A 1YO6A 4H3VA 3FNGA 5A04A 2E82A 2VYND 3DAPA 1GTMA 3TSCA 4YJFA 3UGKA 1G0NA 1PZHA 1WZEA 3OMLA 1PGOA 1R0KA 3IDSA 1YQGA 1K89A 4NIMA 1X0VA 4WCDA 4WNIA 5IDQA 4DIOA 1YRLA 4R1NA 2EIHA 3GNSA 5L53A 5KIAA 1HDOA 2X23A 4CUKA 2HQ1A 4AJLA 4U6QA 4W9NA 1H9BA 1OC4A 2UVDA 4GGOA 4BO8A 2EKPA 2IYOA 2WYUA 4P4NA 1A7KA
chains in the Genus database with same CATH superfamily
1WG8A 4B3SF 2Q1UA 5KVSA 3ZTSA 3ZJ5A 1PC4A 3GV8B 1H3NA 2N0SA 4QHSA 3DULA 2BGJA 5K45A 5BVGA 1PHPA 2BGMA 3LLUA 4D56A 3I96A 2GS9A 2W2TA 1Q8BA 3K15A 4C04A 4ZHRA 4FFPA 5CVTA 3MM7A 5ETNA 4I08A 1XPOA 2FZLA 5JVHQ 1KVUA 1HWKA 3ZWQA 2LFVA 3GRUA 4R9RA 5K0JA 4LBHA 4X65B 1VMEA 2XDQB 4BN5A 1EMDA 2YS7A 4FONA 4GX1A 1WTFA 3KMQA 2FZEA 4DT1A 4BECA 2GVNA 3L7MA 1RABB 1U8FO 1V6HA 3CJTA 2Z95A 3DUWA 2H07A 2HK7A 5EQDA 2VUSA 821PA 2A1BA 1YJBA 4MR7B 2F4NA 5BP7A 3ELYA 1K7FB 2QE7A 2Y0BA 4O23A 1G55A 1P3Y1 1SCIA 4PZZA 4I7EA 1FJGJ 1YVRA 2OCXA 2ZZKA 1DKOA 3DYIA 2HFOA 2IMWP 4B73A 3E9QA 3IUYA 2GF9A 4M0UA 2A6MA 1LS1A 2X51A 3V2IA 4U7JA 1WHTA 1QBKC 3M8RA 2V8HA 4DV1B 1TR0A 3BZQA 3EJMA 3D6JA 3D0OA 4G84A 2IBTA 4PPYA 3DE1X 4KQJA 1XPRA 1HTBA 3FHTA 1K6EA 4DV6J 3RVNA 3BSFA 3U39A 5BT9A 3DD1A 2R1TA 4HVAA 1VJCA 1S9EB 3C87A 4USHA 3CJ2A 4R16A 1Y9JA 3ICWA 3ILJA 4PXCA 5K0NA 2WLTA 2WHEA 2REOA 1I14A 1L7QA 2BIFA 3KQQA 3PDJA 4QLAA 5LP6C 4MIKA 3RKSA 1Y42X 2R8RA 3EBPA 3C3EA 4IOMA 5E3PA 3VZDA 4C78A 2P3LA 2AIRB 4XWTA 4JEIA 4MV9A 5A71A 4IP0A 4BOYA 5FHQA 3OLYA 4OFWA 3MM6B 2VDPB 3BN7A 3KSAC 4XFDA 2UUPA 1R4MA 3O8NA 5JZBA 1V9OA 2OOKA 4OBXA 2IL1A 1ODSA 1CETA 4ECRA 2H1SA 4ZANA 4USVA 4I5DA 3GT0A 4EPTA 1DX9A 4TRMA 4I5EA 1KQPA 1W36C 1XVUA 4KODA 4FU0A 1PWYE 4PG8A 1Z6YA 5EJ9A 4WOKA 3BF4A 3FVYA 4ZVSB 2GX6A 1VBFA 3GN2A 1LW2B 1N7JA 3EA4A 1IPFA 2I1LA 4RQTA 1DQYA 5A02A 3G2PA 6REQB 3M6WA 2BUAA 2NZ2A 5T4FA 1VB3A 1D9FA 1KK3A 5FBRB 1KYTA 4D9FA 1TFYA 3GJ0A 1C4OA 5KYWA 5F7ZA 3GZ4A 3WBJA 2UYCA 1NFRA 1AXRA 4HT3B 3BKXA 3LT2A 2EFHB 4DX7A 3SQMA 3CZ4A 5EZQA 2G72A 4RM2A 2HLTA 4GQAA 2YBVA 4ERDA 3RWBA 5HE9A 1FTQA 1D5WA 5G1NA 4HSEA 2OHGA 2C7VA 3Q98A 5E4TA 2CFSA 5K0LA 2WQZA 3E8SA 3OZBA 4TLRA 1KOOA 2GAJA 4EY6A 3IR7B 3PGVA 1HQUB 3QV2A 3NXSA 4L4ZA 4HRYA 2ZWIA 4MVJM 2Q7XA 1JQ5A 1TTHB 3MS4A 2MKCA 1KSJA 4CKCA 4WFXA 4N48A 4IIGA 2YRFA 1GR0A 1HQYE 2VLBA 3HUTA 4KL8S 4KV9A 2HAEA 4BE7B 5A7HA 1E1QD 1T95A 5LJIA 4XLTA 3PHEA 4FSHA 4DI6A 1F3FA 2BMBA 2LXIA 4KYZA 4Z7YA 3EA0A 2YOGA 2NZYA 4R8SA 2K4MA 3IB6A 1X7GA 4DL5A 1PT6A 4FDMA 2GD2A 5B58T 1GDTA 1B0VA 2DC1A 1A6LA 4PY2A 1FRJA 4UOHA 3G96A 2VZEA 5G3YA 1S9GB 4E0BA 3OZSA 2XSZD 3HRHA 1XZBA 4A0SA 4WN3A 1TZJA 2XW6A 3TP2A 4AZ0A 5DLGA 5G02A 3F5QA 2D2XA 1QUEA 4JVSB 4RW6A 3MUFA 1PEYA 2Q3HA 4YT4A 5H80A 1UKVY 1RT6B 5ED0A 1U1OA 1ENZA 2B1QA 2RI6A 3BKWA 4CTMA 4MARA 3EVDA 4C8NA 4QEZA 3ETDA 4RV5A 1T9CA 4K03A 2M1ZA 2XHWA 3ZO7A 3UFXB 3EEBA 2IUSA 2BBOA 2JCSA 3TQTA 1QGZA 3MLEA 1MC4A 2RGCA 4O5AA 3Q0TA 1I4WA 4DR1B 3VR2D 3L1HA 3DP9A 3PXGA 4HDRB 4MUHA 1KO7A 3TXAA 4ETXA 4PGHA 2HUNA 4CO0A 2V5UA 1TIBA 1UADA 5FOWA 1HYSB 3HGQA 3AQIA 3HDJA 4DQXA 1G20E 5CBPA 3CIOA 4AYBD 3GCXP 2IDLA 5KFZA 2FG7C 4LRBA 5L3QB 3IN5A 1TAHA 3OHPA 4X93A 1QG4A 4KR0A 2CJQA 4G0ZA 4OHXA 2NMVA 2CL0X 3I72A 3FTNA 1H0KA 1P2BA 4H3KB 4GWGA 4YMSA 4DIUA 1A7GE 2QM3A 1PJZA 2ZH9A 5ERXA 4TL8A 4DBQA 4K46A 1DQ8A 2MZSA 4UCFA 2UZAA 2GZ3A 2JF0A 2O14A 4MROA 1GDDA 3D2AA 2I7XA 1RZVA 3IQEA 4G8DA 3N0TA 2R7VA 2F3SA 2C2KA 3CVOA 1M5RA 2AS0A 4AY4A 2OKCA 2CJXA 4FBMA 1SBYA 4LJ7A 4OP3A 2HAIA 5BR8F 1EVZA 4U9IS 3TMYA 1IVZA 4DLRA 4ZITA 1Y8RA 2ET6A 3ADKA 4Z9BA 4DR6B 4EUNA 2BVZA 3H2JA 3CG0A 3VOSA 1YRBA 3H5YA 3PA6A 3S2UA 1X39A 3EZGA 2I1WA 5CW1A 2J7PD 4IFVA 1GTL1 2PUBA 3I8OA 4ZIVA 2Y99A 2YVSA 4HQ6A 3AB2B 4ETWA 3DHVA 1EBFA 3PTLA 2O8VA 1SU6A 2X3DA 4Z7JA 2IKQA 2Q5JA 4QYIA 4IDNA 4QNNA 4MI1A 1BQ4A 5C3MA 5K6TA 5E6SA 1YR3A 4R0EA 5JY6A 3DKKA 2RJZA 1R88A 2YQ1A 3GLIE 2XA2A 2D1QA 2C2DA 4HI0E 2HK6A 2OV4A 1YMQA 3H5XA 4AN0A 2GESA 1HNWJ 4BJ5A 1IXRC 1JXVA 1U2SA 1V11A 1ULAA 3DB2A 2NYIA 5REQA 3KLMX 2R8GA 5H3CA 1USVA 3I5CA 2NTEA 1C3LA 4NEHB 4IMJB 1B8OA 1YQUA 3U02A 3UAWA 4OYXA 1UAGA 1ID8A 5C81A 4HNVA 1OC2A 3T99A 2VOPA 1XAHA 5NLLA 4B6EA 1V8PA 1RTTA 1NU8A 2BTQB 4IZ6A 5IWAB 1LBQA 2VNAA 4PZUA 1YITS 5CCEA 2XNKA 4BFUA 2FJUA 1XMIA 2P1ZA 1FSSA 3GJ5A 1FI4A 1Z2LA 5D1NA 3C1UA 3R3VA 1XZGA 2C5GA 2QY6A 3I2HA 1X7HA 4HI2A 3I37X 2CVIA 3KQWA 1EB8A 4ANFA 1FVSA 4KR6A 3NJ8A 1N2OA 2VIIA 3IRVA 4FBTA 5C42B 5BYKA 1ZWLA 4F1WA 2O8EA 1VQOS 3AHDA 4DCSA 1Z4LA 1RMTA 3NYIA 4DR5B 5DJ5A 5DYNA 1BEZA 1FYXA 4M86A 1QO0A 2LR0A 1G9XA 5MGBA 4DDKA 1CNFA 3W8RA 3UPUA 4CG1A 3TWOA 1SBQA 2PUTA 3T61A 4I50A 2GN6A 5KOJB 1UDWA 4ZRNA 4IH4A 2HWKA 1RFGE 4EJSB 3R27A 2FJ0A 1NBEA 2ZWVA 2FUKA 1O9GA 4A4DA 4OJYA 3TTUA 5JBQA 2VSYA 2WOMB 3PV8A 4P52A 1CY8A 3TXXA 5LFAA 5A3VA 3RVRA 5FJ4A 4DV0J 2Q3PA 3EGXA 1RT5A 2H4YB 2OL4A 1PG0A 1E9AA 1ZHHA 3ZNUA 4B33A 1BD6A 3GAMA 4U7UK 2Q3BA 4MVJD 4KO4S 1D4AA 4BKRA 1BDJA 3DCNA 1BXGB 3TLGA 2JPDA 4TYYA 3PUHA 4PYRA 3SXUB 2FZVA 4E22A 2JBWA 5DGHA 1OZAA 4M55A 4AS2A 2ZBCA 2GHVC 4Q12A 1SUPA 3ONVA 3Q7TA 5HROB 2RONA 1GGFA 1XTTA 5GAEI 1AGYA 4UFOA 2GCPA 5C1OA 5ETVA 4B6GA 3AJ9A 3THTA 5BSWA 2B2XA 1EJ6A 3M3PA 2J6CA 2VUIB 5EZ6B 1M5PC 4YAKA 1NBIA 4MGYR 3JY6A 1KEPA 1E94E 1I3OB 4G1BA 2WWWA 3VM6A 1RWQA 1PDOA 2Z8ZA 4FOLA 5JS7A 1CUDA 3CZPA 4KH0A 4OQFA 4C0LA 1CJUA 4V39A 4V24A 5EWJA 3LOUA 3KQUA 1S0UA 3KBOA 3C2QA 1OOEA 2CFOA 4LF6B 2JFFA 2GLXA 2Y68A 4W5RA 1ZD1A 4LRSB 2BI4A 3R5TA 1NZDA 2OO5C 2Q46A 4ID5B 1EBUA 2P90A 2R2GA 5BPHA 5JC8A 2AZ1A 1WOSA 4EEZA 4H4KC 4HDNB 3O4IA 4NYJR 5K1ZA 1XRJA 3BFXA 2BE7A 3KT6A 3LH2S 3Q23A 1TOAA 3LXXA 3T3EA 3B1WA 5L6LB 3DQZA 2PD6A 4QR2A 1QSYA 2YUTA 1ML3A 1XCMA 5ELXA 4LXTA 1YDWA 5CUQA 2QO3A 3BF7A 2CNKB 4I5GA 3EYWA 1Y9EA 2UZ3A 1NA5A 4J91A 3ODPA 3U6BA 2UYOA 4KI0A 2HEKA 4LF4J 2QZJA 5JCJA 4I9GA 1M34A 3IS3A 5DW3A 1PJAA 1IRIA 5CZVA 1SOVA 1G6BA 3CRVA 2ROQA 2YWKA 1RMQA 3BG5A 1ONSA 1S1UA 4MV1A 3U3RA 2C22A 3EDCA 1HNXJ 4FDLA 4J9QA 5E2IA 3D7NA 2WSCC 4D6PA 3I9V1 2AV5A 1SXPA 1T8YA 2QJOA 3MMAA 4J03A 3L7PA 3R4CA 5CLIA 5JISA 5LSAA 2R5NA 4C14A 1X5PA 5C31A 2F4VF 5J1NA 3SCZA 1Z26A 2RHRA 2RSQA 2FGJA 2D2FA 1RT3A 4GOOD 3ZTWA 2C4HA 2Q5OA 1I2AA 3M89A 4F2WA 3G2HA 3MAGA 5F76A 2C7PA 3W5XA 2GXUA 2BH2A 4IICA 5C8DA 1E0SA 4DR5F 1SVLA 4M5IA 3KK0A 3T3FA 3AUSA 3PXEA 4ZC8A 1Y4SA 3EZ2A 4NS1A 1POWA 1CZHA 4IG9A 3DLTA 4B8WA 2YDXA 1ZA1B 3BX1A 2WA1A 2JC3A 4ZO8A 4YRQA 2GIQA 1D6MA 1VKZA 1GUYA 3UXEA 1CBUA 1E92A 1K1EA 2UYQA 3BD8A 2QKYA 1RQRA 1Q84A 2OZVA 4C4RA 3CZCA 5HK9A 4MGEA 3OJLA 3BGOS 3MM8A 5AVXA 4HNHA 3KB1A 5DTEA 5BNWA 3O8QB 3L6UA 5DK4A 4RKWA 3ZLTA 2CVQA 4KFTA 2XSJB 4L6V3 1FX4A 1OXKB 5H3HA 1JLAA 3VZHA 1H9CA 4RF3A 2GZSA 1XTUA 2I3GA 2D4AA 1KJIA 1NBOA 1XYVA 4MS3B 4Y9DA 5T41A 3UA4A 3D1OA 5L4LA 2DTDA 5JV5A 2O1XA 3ZCRA 4RYLA 3SQWA 1IJEB 4G24A 1N2CE 2QRVA 2IM2A 5AKYA 3UJNA 2HIAA 3H3XA 3EEQA 3SF0A 4BRSA 1T9XA 2MCFA 2QL5B 2IYEA 2R0QC 5AW4A 2Q6IA 4FVMA 1IM6A 4FYXA 4UJ5A 1K7SN 3ZGLA 2M6SA 3OE1A 2MSCB 3DM9B 1ZR2A 5DSXA 3GD7A 1PO6A 3EGWB 3JR7A 4HRAA 3VMMA 3GB9A 3EZ6A 3ZXXA 4PO3X 3COJA 2PN6A 5BUSA 4W9MC 1ZCBA 4ENRA 3ELUA 2IM3A 1P0CA 2XD9A 5JPDA 1DQ9A 1EM6A 4NCGA 3AGQA 2FVPA 4N7TA 2ZIAA 3HHPA 1E89A 4K0KJ 3I87A 1FKPA 2ZSKA 1BA3A 1UJ6A 1MNEA 2BRLA 3PFOA 1QM9A 3UV6A 4BVLA 1QQAA 2XB2A 1RFLA 1Q17A 4U5XA 3Q1KA 3AESA 2XUPA 2QI9C 4JUDX 2H9AA 2BJ7A 4A27A 3IOMA 4IKEA 4QU0A 2FC9A 1MMFB 1Q0HA 1G8JA 3OO1A 2JNWA 1Y5LB 3FUXA 3C7CB 3WB9A 3O1IC 1AKMA 4KGXA 1LTHR 1Z88A 4L9RA 2NN3C 1HMVB 3ENQA 4QIEA 3TW8A 3C46A 2QTRA 1X3LA 4JLOA 3BMXA 2MR6A 2HO5A 4B9UA 1I9GA 3A6JA 1E1DA 3M3HA 3QO9B 3R5CA 1TZBA 2QLWA 3X43A 1W35A 4ZYZA 3HVWA 3AB4B 1DU4A 3M8ZA 3CNOA 3H3JA 3I2JA 5EJ8A 1QIFA 3DTVD 1SCBA 3KLIA 2AT1A 5GMKa 4OHVA 1YOVB 3TB4A 3TBFA 3K35A 1IIBA 1T2UA 1FRXA 2QMUB 1B1AA 1KL7A 1Y81A 2HI0A 1V43A 2Q5IA 3WBBA 2ZBRA 4AL6A 2QFJA 3AO0B 1YS6A 4FLEA 2GERA 1R3UA 4Z2XA 2PLNA 4BU0A 2NNWB 5BO5A 4HDSA 2CDBA 3ZZRA 5CHCB 3BSSA 4LKOA 2D5BA 4H4DA 5K3FB 3E6AA 4FE3A 1E5VA 3SV4A 2K2QB 5LKAA 1L5NA 1XGKA 4DV1F 4QU6A 3W3AH 4DN0A 2Z0MA 2AE1A 3E7FA 3GMSA 5F9NA 3ICLA 2P68A 3BB4A 1FOEB 1ZBTA 2IYSA 1QIJA 1VPVA 3V81B 4IDGA 3DO8A 1ZSVA 2R7AA 1M67A 1KZHA 1CZRA 4BHTA 2BY4A 1JILA 2R25B 2YJTD 4XFJA 1NIPA 4RORA 2P6MA 5HS4A 1KWMA 3GJSA 4DUPA 5FOSA 4REOA 5AJ3J 3A6KA 2DBQA 4HZGA 4DCJB 3FF4A 2KBFA 1VBMA 3NTRA 1I1OA 5SYMA 2HHSA 4H16A 4D0NA 2ERRA 1AO3A 2VUHB 1NNLA 3E8XA 1GKLA 3K9BA 1ZHFA 4HWTA 5HQJA 3QVMA 1JJ7A 2XCUA 5L3SB 4JX9A 1YKFA 2V2ZA 1O77A 3CB4A 3E70C 4JC4A 4ZHSA 4BEBA 5DYWA 4DY4A 2ZIGA 4CNQA 1BJRE 1Z6AA 2B30A 1B73A 4N01A 5CDYA 2F1FA 1X4HA 2O06A 1KEEB 3HVTB 5JDIA 4CTOA 4R1UA 4FOPA 2IC5A 3AIOA 4DWOA 1CRLA 3PKMA 3T12A 1D2CA 3Q0EA 3MWBA 5K8NA 1ZXBA 2V7BA 3N28A 4IIXA 3WIUA 1V1MB 4JLSA 4RHFA 3FPKA 5BSFA 3MCMA 3FZNA 4OX9B 2BX6A 5IAAA 5ALDA 2PGAA 5L95A 2KFNA 4GBGA 2ONJA 3R2CJ 3DGVA 3DQQA 2NXNA 4DJ5X 2ACMA 2BJ3A 4Q3EA 2V55B 1LW2A 4XLLA 1LH0A 1Z45A 3VO1A 3MZ0A 4CEJB 2V6JA 4Z53A 4HH0A 1SQEA 3I1YA 3EXFA 4FYIA 2IXBA 2DY1A 2FMFA 4YFVA 3AEKB 2QN7A 3PGKA 4RPGA 4IWXA 2GBPA 2VFAA 1Z0FA 3IEKA 2NSBA 3QUAA 4XUEA 2QUIA 5AP9A 1KC8T 1KFCB 4X1IA 3E5MA 1TTQB 5CM2Z 4OAOA 2F6RA 3FCVA 5D3ZA 4P2BA 3LGAA 5LQDA 3L8MA 1TP7A 4NG4A 5C25B 2X86A 3UDEA 2QYSA 5A8KB 5D4PA 2H5LA 3KB8A 1L4GA 2WSFC 2RAFA 3QOFA 2W8LA 1MVOA 3G49A 1IY9A 1NVEA 1UT8A 4CO3A 2H1WA 3VYSB 4D9NA 2YJ3A 5FBZA 2QVXX 1N5YB 4XVQA 1S02A 4FHDA 3QP9A 2ZS9A 2QTHA 4IKPA 1X1AA 4PINA 4DL4A 4DW8A 5F5NA 2H7XA 3NNAA 4CVNA 4NBWA 3UNGC 3OOYA 3HJNA 3FCHA 5L9AA 4AKHA 1VQ4S 4GLJA 4PCQA 2OAQ1 3KKFA 3UVJA 1RQLA 2Q6OA 4RKQA 3AKZA 1BKSB 1V3UA 4BEVA 1W46A 3MECA 4GXRA 3R9XA 2H2FA 2H1CA 2OPBA 4QOGA 3WZLA 4DFMA 2O2IA 2E7WA 1DIAA 4OKNA 5M2QA 1QCZA 1CWUA 2G25A 1NK8A 1DX4A 2AOUA 3W66A 1E9DA 1NK5A 3Q9LA 3D6FB 2PKWA 4H3VA 2RHWA 2EIXA 2DCLA 4I4TB 3VVLA 4MRPA 1SH0A 1WSDA 4RMNA 2V4JB 3STVA 4R1NA 3QJYA 4DRZA 1FD2A 3AHFA 2HFSA 1Z4IA 2VQFB 4YONB 1HPZB 1SUEA 4LV5B 1H5UA 1JH9A 2PUGA 4M7PA 4FHCA 4QYZK 5AKXA 4H3HB 5TX7A 4KN8A 1KYIA 3K53A 2VBFA 2DR2A 1ACLA 1Z47A 5CT6A 3IH5A 2XXAB 4MQ4A 1CJTA 2EL7A 4G37A 3CC4S 5B2ZA 3WGKA 3OPKA 1N6QB 3UWDA 4GOMD 5CD9A 2O8CB 5LBIA 3M8WA 3WLAA 4BLRA 4LF9F 4DQSA 1NMQA 1M7GA 1VPTA 1WP4A 2ST1A 2R65A 2WF6A 1E58A 1S1UB 4ZRDA 2DJIA 3ZXUB 4GI1A 1V4VA 1F0NA 2ZULA 4NLXA 3WNDA 1AE1A 1G20A 3M1IA 1K1SA 4IJ5A 3I61A 1E1MA 1SBNE 3QTBA 3V1MA 4OP1A 3F3YA 1T8PA 3AR8A 1WNTA 4JT9A 1J5OB 2VJVA 3IVAA 5CFQA 5C24B 4KW7A 2VP9A 4JKYA 3SSMA 1LLFA 1NU4A 4FX2A 1WLYA 3HWX1 1WHVA 2DJWA 1S9FA 1J06A 2PZFA 4GC6A 3P45B 4DANA 1H1DA 3TX6A 2NNLD 2ID8A 4B34A 4JU9A 1NF8A 4NXNB 2V98A 4CG3A 2X4LA 3ZV7A 1L4HA 1MTZA 2YIDA 4B35A 4TMVA 1H74A 5DM60 3MZIA 2IQ5A 2ZIWB 1GXUA 2QSFA 1PWEA 3V5NA 4Q00A 3UK7A 2HVIA 3TZ6A 4J0CA 3QJGA 4R5PA 2AEFA 4DV7B 1S6UA 5G1OA 4KACA 3LSYA 3GX1A 3M2UB 3VZBA 2C4WA 1QTIA 1N5VA 4E1AA 1AKQA 4DDFA 2F8EX 4XUCA 1EX9A 3HU5A 4Q1DA 2F64A 2LQ9A 4J9PA 1JG6A 1Y00A 4IRKA 1C3EA 3J7AC 4DQDA 2XDQA 3VTZA 1SZCA 4ACBA 4KBFA 1N92A 1DEOA 5AXLA 5JYEA 5GM1A 5KYXA 2JRCA 1R0AB 1PJCA 1RWUA 4A8KA 5K8LA 2VQEF 2CLMB 3ICEA 4W1PA 5HRCA 1G1XA 3CWJA 5CVJA 2NQ8A 2ATCB 3L2OB 4F4CA 1BKDR 4KMSA 1X7XB 1N8TA 4BCCA 2J87A 3G79A 2ZKLA 3AHPA 1ZBQA 3D8HA 1AMOA 4OFZA 1NYQA 3GLFA 1KR2A 3HY4A 1Z0UA 4F84A 2MSNA 4OPMA 3QUBA 3RBXA 5IEJA 3HULA 1NKVA 4C1NA 2ZPTX 1TYCA 1OX4B 4BQFA 3A05A 3R0JA 2AG5A 3QRPA 1XALA 3GG9A 5GV8A 1UH5A 3M1LA 5IWAF 4D9GA 1KEVA 1OE0A 3R7BA 5C4IA 3QX7A 3IUMA 2DFLA 8OHMA 3QZ8A 1UDAA 3BMOB 2LPMA 1S1MA 3BHNA 2HEGA 2V2KA 1FVXA 4GW3A 2O8BB 2AEEA 3N2YA 1EFPB 1XLUA 4GRSA 3IAS9 3UICA 5LA6F 3NNHA 5JQWA 4LF7J 4WPAA 2EJWA 1WVGA 5EXEA 3ZDCA 1FPMA 5J43A 1WTAA 3HFSA 1XD2B 2LA4A 2K1RA 1Z07A 3I6PA 3USES 2ISSD 4C76A 1ZH6A 4H4MA 2W7AA 1VISA 2B3TA 1MO6A 2L42A 2PUWA 1OO0B 4EITA 2KL8A 3QTTA 4TROA 2LD4A 4MV7A 4PHHA 3A3KA 4L72B 1MROA 4C8KA 1V3TA 2FMIA 4WW0A 4BO1A 2ZB4A 3HJBA 4LIWA 2Q2OA 5GADU 4E33A 3LLSA 4OHRA 2UUAB 4JJ7A 3IQXA 4F2DA 2FPLA 4V0ME 3RUBL 1RE1B 3W6PA 5JASA 5JUWA 1JYFA 3IKMB 3TMKA 1XK7A 2VJAA 2YX7A 4CG0A 3QIPA 1L4UA 1DC3A 3TTWA 4AWXA 4ARZA 2XTZA 1N57A 4KHZA 1VRUB 3MJVA 3NDIA 2E1PA 2NUTA 1A8IA 2PRJA 1REVB 4YJDA 4LSNB 1TTHA 2E9RX 5FTKA 4ZHQA 1NJ2A 5BR7A 2RK4A 1D0EA 2HPVA 5JVDB 4EYHB 1CC1S 3VBEA 4ZPCA 2VT2A 4NJMB 1PT7A 3T52A 1M5OC 2E1CA 2LZ0A 1SXIA 1FDOA 1C1DB 3EIXA 4YAOA 2P9BA 3W1VA 4DA7A 2HF8A 1LBEA 2RGGA 4LY6A 4QL3A 3FMOB 3MWYW 3LU1A 3P1JA 4I6GA 2G5PA 3D2CA 4C2MA 5IU6A 4UOZA 1C1XB 3JQFA 2CNLA 3SIPB 5JSZA 1DTWA 2J0SA 3LX6A 3I3OA 2IIHA 3HXOA 1VPDA 2IGTA 1U3WA 2VQSA 3S2ZA 3L4KA 3KEOA 4U0KA 1FQKA 4Z49A 2BMVA 2G17A 4JBHA 1LNZA 2IA0A 3SNHA 3AQ4A 2O3RA 1DLOB 4PG4A 3WL8A 1ZNWA 3W62A 4P33A 2LP4A 4N6OA 3DDNA 3ZW9A 1LBIA 1DBWA 1L8LA 2XV1A 4HQ0A 3T5GA 3DOKA 1CW2B 4NLLA 1GFWA 1NVVR 1GKKA 1NW4A 4TY8A 4QWAA 4BNMA 1H6BA 2W9BB 4ZAXA 3F74A 2XTNA 3WFJA 4DCTA 2GS8A 2MKSA 3R6GB 2XTAA 2Y1LB 2BANA 1NOIA 3G9UA 3LBHA 2D7CA 3KSUA 4EA9A 2ACWA 2C2RA 1KOJA 2II6A 1MN6A 1SRRA 3I4PA 2YWBA 1PZGA 1X1CA 1AUVA 2IHNA 4BLGA 3H19A 2BSQA 3O4JA 2DH5A 1YZKA 2XCOA 1SKYE 4HMPA 5K8TA 3M6FA 2NM0A 4P9NA 3KZOA 1UOQA 4HLQB 1AMUA 2G1HA 1EM8A 5J2MB 5D0GA 3H75A 4EHLA 2DNYA 4UEQA 4TZKA 2VK1A 5LQNA 3MLAA 2R3VA 1SKSA 1GY8A 4UULA 4E2FB 4LN1A 3CD6S 1GPBA 1KONA 3LHFA 2CVOA 4QT4A 3HMJG 1I13A 1UF9A 1V5FA 1IFXA 3LBIA 4NENA 2BQRA 3IQGX 2YKOA 3OFFA 3PNOA 4TN5A 4KSEB 3BJMA 2ZG6A 3DVSX 3DGFC 4QXAA 4K0KB 1GJRA 1MENA 3AEKA 2GM3A 2V0GA 1RWPB 2XQIA 3UPDA 4DV5B 2JIOA 4OYAA 1NVVQ 1XNGA 4AICA 3U6KA 1KK2A 2QI9F 1W5SA 4M0CA 2AG0A 2VG5A 3PEVA 2X5NA 3ZE7A 4CLSA 2I6XA 1F5AA 3FNNA 1YWXA 1BWVA 2CLHB 2LYVA 2WT9A 4ZVPA 1VMAA 4TQ9A 1MO4A 1S8NA 3VKFA 1A0OA 2X7HA 5DZSA 1T1IA 1SUDA 2P6NA 1TQ6A 3WMRA 1F0PA 1TA0A 4ZEMA 3TQEA 5FPQA 4MIBA 1JSZA 1II8B 3QVTA 4L76A 3MB5A 3JASB 3HWSA 4I1TA 4QM7A 5AESA 3M9NB 3E2PA 4OI0A 3EVFA 5U47A 4Y6RA 1WJ9A 4LSZB 3NHPA 1MUUA 3TK1A 1M2HA 2J85A 1YONA 2I3ZA 5D8HB 4JV5J 1OXTA 1VMDA 2GFQA 4MMYB 4YDRA 5AOCA 2F62A 4KO8A 3AZQA 3TFQA 5EIOA 1V4NA 4Q43A 1TW3A 3HBMA 1YDEA 1NH7A 1KFSA 1JQJC 2Q1YA 3V1KA 3VGSA 3CLRC 4O4HA 3B7GA 1T2FA 4Z1OA 2GPBA 3C48A 4IX9A 1ODLA 4TMYA 2NOAA 1GXSB 5ALUA 3TYTA 5GAGI 3WHIA 1HLPA 4A73A 3FGPA 3HJCA 3H8JA 2ECQA 2EVZA 4WTOB 1M8JA 2AD5A 1GPMA 3B51X 1JAZA 1LJ8A 3ZZPA 3E3MA 3FOWA 3DFKA 3RLIA 1TKXA 4HATA 4UNQA 1OLOA 4X54A 5F4BA 2IEYA 1VQ9S 5ETLA 4UU7A 4BRUA 3PVCA 1K3FA 3C3MA 1SUIA 1DC4A 2C4KA 3OF3A 1JHRA 1QIGA 4DSTA 1NX6A 4XFKA 1EHWA 2PWZA 1XYYA 1S3IA 3OOJA 3LE8A 1ZRHA 3B4DA 1P7ZA 1TL7C 3JQEA 1OFVA 3B38A 1LV8A 2XECA 2VCEA 4P36A 2QL6A 2B9WA 4MKFA 1UL3A 4RNCA 3CEPB 2DAPA 4LJYA 1NQ5A 2BGIA 2ANCA 4FDVA 4ZA1A 5F8LA 3FUVA 4MUYA 4F06A 5K01A 3CZRA 3H8WA 4QXRA 1ETHA 2YASA 5IKXA 2PHZA 3TQRA 3URKA 1QJHA 2Z9BA 1E79A 3DE5X 3JQ8A 2GZRA 1R3DA 1YZNA 4UQGA 4OHPA 4U7WA 4H7JA 3AHEA 3T9EA 4JI8J 1HZZA 4H7KA 3FY4A 3STHA 4V3CA 3NMUF 2JIZD 4KV8A 3RSCA 2C1XA 5THWA 3TNDA 1N6RA 1TU0A 4Z8YA 3O31A 5A5FA 3HS3A 2NZXA 3UT5A 1T6BY 621PA 1UEJA 1KOLA 1TE2A 3KU1A 1FKOB 2OCYC 2AX3A 1BKYA 2HWUA 4L02A 4UBOA 3D4PA 1PS0A 1QU3A 2XODA 2I2BA 2IZOA 3KVVA 4OHMA 5CEEA 2WKPA 2NV6A 5LQAA 4BNDB 4X3PA 1PR5A 1EZ1A 1Q3HA 3DWEX 3L4BC 4DLXA 4PX9A 5ICEA 1ZN2A 1BROA 2QQ5A 5EXTA 2ZH6A 3GNLA 2J4FA 2C03A 2QTAA 2BFDA 1YVUA 1A5ZA 2L41A 3V8EA 4OI6A 5AUOB 5KFVA 1B0TA 1PWZA 3OTQA 1V47A 1DTSA 2H8KA 4JI1B 2R6JA 3UO8B 4PRFA 3H2HA 2CRLA 4OMFG 1I94B 3LO5A 3EDYA 1VLVA 3EDMA 1W1UA 3TUIC 5IRCD 4R01A 4WHMA 3A6PC 4AN4A 5JEEA 4UM9D 4R0VA 3I0SA 3UNXA 3ADBA 1HWJA 4ZLJA 2F4FA 2X4GA 3BXEA 2IZ7A 4O4GB 1JWAB 3DBVO 4XYBA 4ICLA 1X4BA 2XYHA 3L4JA 3OESA 5HBMB 2WNIA 3NP9A 1EWYA 4RW6B 5B1DA 4JLDA 2ZBPA 2ERCA 2WWFA 2BN4A 3TRFA 1VKRA 2A1UA 3WLHA 3S81A 3Q5GA 3NLCA 5KNBH 2YKMA 1RI4A 3HX9A 3KTOA 4MQ5A 1EP9A 3X1XA 3ZVKA 2KLBA 1OVGA 4L5AA 3D02A 3WV4A 3D8RA 3TWZA 3IC1A 2J33A 3W6UA 4QIWD 1U8AA 2WV7A 1XHEA 2GT1A 4RK0A 3R3HA 4HXGA 3OEHA 4ZK7M 3T3HA 5LIRA 1WW8A 3BJEA 4HN4B 1KJWA 4LECA 1STOA 2BHTA 1CVJA 3GP8A 1EJ7L 4DB4A 3DZ8A 1K92A 2IH5A 3U80A 4NLPA 1LPPA 2WHPA 4QTUB 2N46A 2VTBB 1RAHB 1N6PA 4ILLA 1N5QA 1KKLA 4Q3KA 3ZZMA 4LW8A 1I7SB 1KAHA 2CWKA 1RC0A 3EXEA 2J9CA 2YVUA 3IODA 3HVJA 4I2PA 4O2BA 3AXTA 3LBYA 4EHBA 1Q5YA 3T5HA 1VHLA 2VDMB 2B21A 3A6HA 4HPJB 4FYYB 4Q44A 4A6PA 1J9GA 1H4TA 4RCYA 2DLNA 1DUVG 1Q0LA 3F7TA 5EWGA 2WG1A 1GQSA 1S7CA 4LCBA 3UHOA 1Q8IA 1SC9A 4MKIA 2WZ1A 1L7MA 2ZR9A 3NBUA 5DLDA 3BN3A 3H9EO 3L09A 4G4JA 3WFIA 3PNSA 3TOQA 3WK7A 4C6TA 1XEXB 3D4NA 5HQ8A 3QU9A 3H8YA 1VBXA 1GQRA 4C8LA 1ODIA 3ZZUA 3JQGA 2O0LA 2VWGA 3BEGB 2W98A 3DHEA 3I4LA 5PNTA 1XDWA 5IX8A 2PS1A 4M88A 3FMWA 4PZCA 1L1FA 4P08A 2DY0A 5B1YA 3PR1A 1P4RA 1KHWA 2CBXA 2JIBA 3QEMA 3J7AN 2R8HA 2NXUA 2BCJQ 2IJNA 4L0QA 2G1DA 2CUKA 4O1IA 5AW8A 2O3UA 3V97A 5FA6A 1RLUA 4HJRA 1YQEA 5FLXY 3IP8A 1Z4UA 3R7NB 2FUG9 1L5UA 1RTIA 3AF5A 4C4AA 4QWMA 4QRDA 3CRQA 4IRXA 3W6ZA 3HU3A 3W5DA 1NKEA 3AU8A 4M8SA 1E7YA 2SCUA 4JVOA 5JT1A 2NT4A 4HV4A 3GIIA 3JTMA 3DR5A 3U3XA 1CP3A 3QFFA 4R1SA 1I2DA 3KJHA 1QO9A 3AHGA 1ULBA 2C4UA 3VZCA 4O0NA 1H85A 3QKUA 4LC0A 2M1XA 1RLOA 3MOSA 2W6JD 1FCJA 4S12A 4HAYA 4PEOA 3QF7A 3FMGA 2XKKA 4PZ0A 4KQ2A 4DGQA 4BEWA 5LQCA 4OYYA 1R6TA 5CJPA 1IHXA 4PYNA 1ADYA 5DQHA 1BDMA 8GPBA 4MAAA 4X1KB 3VUEA 3IEUA 4KXWA 2IFTA 1NH8A 4CM7A 4LJLA 4KQFA 2XF2A 4Q4DA 2MKKA 5C46F 1E4EA 3DQPA 5J2TA 3LXUX 3G7UA 3O3LA 2GLTA 3BHIA 1I24A 3QG1A 1NRKA 1Z8NA 1REGX 3ZWNA 2XVXA 5EIAA 4RGQA 2BKPA 1OVMA 3WOHA 2DSNA 1WUKS 1ZGJA 2O7QA 5ICFA 1KJQA 3G85A 1M2VA 4P34A 5PGMA 1X1RA 1QRSA 4LKRA 3DFZA 5INTA 1S6QB 2B5VA 3D1QA 2QTFA 3ANTA 1P27B 2KXHA 4K3VA 5JMOA 1FYFA 5C42A 4WU3A 3VX3A 1TMJA 2RBGA 1DBQA 3FAKA 1NPDA 4N9WA 3G0HA 2V58A 2GBCA 3E18A 3RV4A 1K66A 4KVFA 1YT5A 5AKGA 8ATCA 1QX4A 1UZLA 2EK6A 1S57A 1MW8X 5CVEA 5HE8A 4TV9B 2DGVA 3C15C 3WLNA 3JAMY 4KGDA 4OQPA 1WOYA 3ZDBA 3MPOA 3EW9A 4TM8A 4CTAB 3AL0C 3O7WA 2HV8A 2XGGA 4MA4A 1HH4A 3GLHA 5EFOA 2BQUA 4OHBA 4TSFA 1VFNA 4MQUA 2I65A 2IBMA 2ERXA 2I87A 2D1RA 1H3DA 4GKVA 2A5JA 4E6EA 3BEDA 2ZVJA 4OQ4A 1CYEA 4PIPA 1PFWA 4BJHB 3JTEA 3RG8A 5L38A 2ZK7A 4ZFNA 1TVCA 3HGTA 2J5AA 1VIVA 4YJ3F 3AM1A 1B4SA 1VHIA 2W2LD 1HHSA 3R3UA 1SXJE 3KK1A 1L3SA 5JD4A 1HBOA 4N3GA 2JFXA 5JQGB 4W90B 3E0XA 3AY6A 3BQNB 3T6BA 4ILKA 4PLFA 4LNAA 1H7WA 3TD9A 2C2EA 1NSQA 5DU2A 4ZT6A 4CIYA 2DEUA 1AZSB 5BR8J 1VQYA 2O1EA 4K9QA 2AFIB 1FDBA 1M54A 4FBGA 4LZWA 1UMCA 2X6QA 3P2EA 4NZZA 5I3PA 1SXHA 4RTSA 4ZDWA 2Q3FA 3NH6A 3SEQA 4TOIA 5CB4A 1Q7YT 3QYFA 2C9BA 4Q3LA 5IK2A 4J4BA 4C22A 1FRLA 3B1VA 1T9ZA 3SHVA 3LQ4A 1Y6QA 3RYCA 4MJ7A 3GLVA 4WBXC 4HEQA 5AK0A 2O8EB 4NX9A 5AJ3F 2XAAA 5TVGA 2E1RA 1DKRA 1Y8ZA 5AM1A 3PQ8A 2GBIA 4B6RA 1R4NB 1E6WA 2V2VA 2OG1A 3MVEA 3G59A 2CZCA 1EIWA 5B2EA 1VC6A 1SQGA 2YWCA 1GD1O 3KWFA 3LPYA 3C70A 1K75A 3GLQA 1Z6ZA 2YWWA 1W1IA 2ECOA 3OQHA 2XBPA 2XOEA 4QC2A 3PEYA 2O8DA 1X7YA 1NSAA 2B56A 2P0EA 3RVPA 3LWBA 3UCUP 2ZHBA 1JSRA 3ZHSA 3A6FA 2WM8A 4ZO9A 1ZC3A 2GZMA 4CBVA 3OT1B 2P6TA 2RH8A 1OX4A 3TQ1A 3AFIA 2B7LA 3GLKA 3O8LA 1KE1A 2UXBJ 2ZM6J 1G17A 3V48A 1WZ2A 3WGGA 4MWBA 5AKKA 1M3SA 4I9HA 2GV1A 1T9YA 3G0IA 3BMOA 1HRKA 2I7DA 3CEJA 1DE0A 4A8TA 3LLMA 1CUYA 2IZ1A 1F1JA 4IIYA 3KUHA 4FEGA 3DYVA 2Z57A 2FZKA 2XB9A 3QYJA 3IBFB 3RR8A 4LVOP 4CM8B 1HIYA 2VAVA 2WD7A 2FPGA 4AK9A 1KH2A 4UASA 2NTNA 3E9ZA 4OJGA 4L5YA 2R2UA 3K9GA 4D5GA 1FFYA 2OFHX 3QJLA 3C15B 5KX5B 3IM9A 4DIEA 4Z0PA 4Y8VA 2CJPA 4ZO7A 1FNSA 1HG0A 3M6LA 3UDVA