3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
4NEHB 1M2VA 4WK2B 1JLMA 1RTKA 2P26A 4Z7NB 5KYWA 4O02A 3M6FA 4PN7A 3T3MB 1FE8A 1SHUX 3FCUB 1YVRA 4C2AA 4XW2A 1DGQA 3NIDA 4IRZA 4G1EB 2VDOA 3EFOB 3HI6A 3PPVA 4CN8A 4MMZB 2VDKB 3ZE0B 1MQ9A 3K71A 2B2XA 1T6BY 2IUEA 3Q3GE 3HXQA 3TCXB 3V4PB 3T3PA 1MJNA 1L5GA 4M76B 2VDKA 4CN9A 5KYYA 3ZDYA 2QTVA 3K6SA 3PPXA 4JDUA 1M1UA 1NA5A 3HXOA 1DZIA 4WK0A 4CNBA 2VDLA 1PD0A 1U0NA 3EOAI 4C2BA 1BHO1 4MMXB 5ES4B 4WJKB 3ZE1A 4F1JA 4WK4B 3TW0A 2VDMB 5KYUA 2XWJI 4Z7OA 4A0QA 2NVOA 1IDN1 4FX5A 2VDNB 3GXBA 2VDRB 3RAGA 1IJBA 3E2MA 4G1MB 2X5NA 1JEQB 3EH2A 1Q0PA 2VDPB 3VI3B 1OAKA 3EGXA 1V7PC 3ZDYB 1FNSA 2VDRA 3EGDA 4HQFA 4G1EA 2VDOB 1M2VB 1ATZA 3VI3A 5E6RB 4HQLA 4IHKA 3EG9A 3ZDXA 1XUOA 4WFQA 5KYWB 3T3MA 4UM8B 4MMXA 1MQAA 1QC5A 3IJEA 1M2OA 2NUPA 1RS0A 4WK4A 1M1XB 2I6SA 1JEYB 4NENB 3NIFA 2ICAA 3IJEB 2WW8A 1RRKA 3FCSA 3VI4A 3ZE2B 5KYNA 1MQ8B 4DMUB 1L5GB 1RD4A 1JEYA 3IBSA 4UM9B 5E6SA 3BQNB 1CK4A 3F74A 4IXDA 3PPYA 3TVYA 3FCSB 3VI4B 4Z7QB 1N3YA 3ZQKA 4F1KA 2ODPA 4JX0A 5E6UA 3QA3E 3ZDZB 1TYEB 1CQPA 1PD1A 5BV8A 5FFGA 3K6SB 3EOBI 1BHQ1 1MF7A 1PT6A 1AUQA 5KYXB 1XDGA 3F78A 2O7NA 3EGDB 2I6QA 3NIDB 4G1MA 1JV2A 1IJKA 5KYXA 1YVPA 1PCXA 4WJKA 5LN1A 4WK2A 2VC2A 1XDDA 2ODQA 4UM9A 5E6SB 1SHTX 2VDMA 5KYUB 4O02B 2VDQB 2M32A 2VDNA 1AOXA 1T0PA 2NUTA 4UM9D 1LFAA 1SQ0A 4C29A 5FFOA 3NIFB 5HDBA 3BQMB 2NUPB 4WK0B 1QC5B 3PPWA 4BJ3A 2NUTB 3ZE0A 4HQNA 4NENA 2ADFA 3V4VA 3V4PA 2XGGA 2WINI 3EFOA 3T3PB 3EG9B 5E6RA 3TXAA 5KYYB 3ZDXB 3K72B 1MHPA 1QCYA 1M10A 3BN3A 4IGIA 3K71B 3V4VB 4UM8A 4Z7NA 4HQOA 3K72A 4Z7QA 2XWBF 1JEQA 3FCUA 5HJ2A 2VDPA 4HQKA 3ZDZA 1UEXC 5E6UB 1ZOPA 3ZE1B 1TYEA 1ZOOA 4MMZA 3ZE2A 3EGXB 3NIGB 4Z7OB 5HGJA 5HDBB 1IDOA 1U0OC 4MMYA 3N2NA 3EH1A 1U8CA 2VC2B 2I91A 3NIGA 1N9ZA 2VDQA 1ZONA 1JV2B 4MMYB 1U8CB 1M1XA 1AO3A 2VDLB
chains in the Genus database with same CATH superfamily
2DL9A 3G23A 1BHSA 4GI1A 3K6OA 2DWEA 5JATA 1RQRA 4RHEA 5JAIA 2ZTMA 1HXMB 4R68A 2JZNA 1D2OA 4PI2A 4XI9A 2WDPA 3L6FB 4A2GA 4DVRH 3LBFA 5ICYA 2EDJA 3FHCB 3A27A 5B4TA 4OLYL 3E8UL 4QYSA 2BJML 2FX9L 3RS5A 4Z0NA 5HHNA 2ZSAA 4TMTA 4UOEA 3WEXB 1A6VH 3QA9A 1Q90A 1XEXB 1ADFA 3R7BA 3CZ5A 2VAXA 3I12A 4CLRB 3WMPA 5JCOA 4ZUWA 3EYVA 3NQKA 5DK2A 2AEWA 2YWYA 1WOYA 2FEMA 1BVUA 5TY0A 3GP5A 4PRPD 1WG8A 1AKPA 2R0WL 4KW7A 4M46A 4EHLA 4F1KA 5G02A 4JC0A 1PG7X 2OM2A 1PWXA 3U17A 4YK4C 4QBTA 4G8JA 5I6KA 2SODB 4K9LA 3IERA 1I7RA 4DYHA 4OI4A 3KUUA 4FP9A 1QUFA 1WDKA 2R65A 4J0QA 4U6XB 4P35A 3S2EA 5CXCA 3VGGA 2EEAA 4FMFA 5I6LA 2CNLA 2R4QA 1JJFA 1I4LD 3ABIA 3FYUA 3HDGA 1LTQA 3B2DC 1E3JA 3N1MC 2Q9UA 3LZ6A 3NLLA 3UT6A 1PDVA 2C8VA 5DHUA 4BZ1A 4RRPM 3F6JA 5JH7F 4X3PA 5GRXG 1RTTA 1JTOA 3IV6A 3QYAA 5EQFA 4QODA 3QJSB 3O26A 1EWQA 2EUVA 1Y18B 2RBLA 3QQ9D 4QYWA 2R6JA 3K92A 4OKSA 3RDTC 1SUFA 3VXNA 1OM3H 5MEQA 4JT9A 5ESRA 4NQEA 5LMUB 3UEZA 2H29A 2Q6LA 4UQ3B 6REQA 2HA3A 3Q13A 3OOYA 3M1BA 3VO9A 3OXRA 2F53D 4JFYA 1RC1A 1TMCB 3O4HA 5JVDA 1E8WA 1XZNA 1AB6A 3DDWA 1NXSA 4AQEB 3I8SA 4RGOH 4DO4A 5KOJA 1T9ZA 2G5BA 4WXPA 2WOOA 4JLWA 4TUYF 4FYVA 4WCVA 2IWRA 5I1LA 1IAIL 1H2RS 1NSNH 4LXGA 4A6XA 1F6WA 4I88A 4EA8A 4KXCA 1IZ9A 4EF4A 4PGMA 1S3KL 2QDVA 5BV7H 4U3SA 3VHQA 9PCYA 4UNVA 3ECAA 2VQUA 4ELDA 4XNDA 2W18A 2HDHA 1YT5A 4XUCA 1CUJA 4N2MA 4HDAA 4YRAA 2IGTA 2Y2YA 5EBGA 4NH4A 4H7IA 2CGYA 3KLKA 3Q72A 4JHPC 1K6EA 4GKOA 2K2QB 1NH6A 5ESXA 3K73O 1TDQA 3R24A 4RYDA 2DIJA 2N0SA 3TVMC 1GKOA 3CPHA 5E6SB 4YEFA 3OO1A 3OKYB 3NJFA 3U1SL 3WL6A 4EYKA 2V7BA 3H05A 5CD1A 4OOFA 2ZXQA 2F5BH 3KPPB 3F5FA 1OR8A 4F58H 4O5LL 2H1PH 3VACA 4BWWA 4CR7A 3DXKC 1X8XA 4PSAA 4G5GA 2X0UA 4UARA 5C0BE 4XJTA 4Z6KA 1IEAA 4XPBL 3GEIA 3GUHA 3RWDB 4BRSA 1T89C 3ZWMA 1DBBH 4KRFA 5C51B 3MO1B 3VDNB 8CGTA 1J07A 1ZONA 4Z2AA 1K4CB 4PMFA 2GPWA 3O8XA 5F7JA 4QX6A 2J9GA 5FHRA 2P9QA 1KPGA 1LEHA 3QWOA 4B31A 4F8PA 2RGRA 3D2UA 1E43A 8FABA 5EZJA 4Y18A 5BQ7B 3OHXC 2GYWA 4WHYG 3LZCA 1JS1X 4K8RC 3L7EA 2BSXA 1I1CA 3Q0EA 1SMDA 2PA3A 4S1OA 1U81A 5JROA 4DJEC 3EYUL 4JC8A 2DY0A 3A6PC 3RN1D 3AR6A 4OZIB 2BONA 3WWOA 1UXSA 4APQA 3QEGL 3CH6A 4PJ9A 4C7JA 1VJTA 4HFMA 3ITKA 3WE1A 3WIOA 3HMWL 3UWSA 3RAFC 3TFOA 1J12A 2B30A 3H8WA 1D5CA 1DANU 4NAVA 4Y2VA 4A0RA 1U2VC 5AAMC 5E38A 3BERA 3GMMB 1LJ8A 4MTCA 4JO3H 1MABA 4K2UH 3JPYA 4UW9A 5DLDA 4BKOA 1JEAA 5JPCA 1E4WH 4EGAA 2XICA 3UROR 4A2FA 4Z7OF 4PYQA 4YMIA 1T2CA 3MX0B 2ZT8A 3IS3A 5JPNC 1ZD4A 4NNOA 5FLKA 4HUMB 5D7HA 1YY9C 2NUAA 1DP0A 1UEIA 1RQXA 2XBUA 2DFKB 1UAAA 3QNUA 4FQCH 3A58B 2MNJB 2BFPA 2WMOB 3DE1X 3G2JA 3I4LA 1BTOA 4K9KA 4HR7A 3B8SA 1JGLL 1NWCA 3GDCA 5C2BL 1GGYA 5K0FA 5TQ0L 1PR1A 4RXUA 1XEDA 4Z53A 4JEGB 1M8FA 2O0LA 1DG9A 4IGBC 3WXVL 4YWGL 4AECA 3PFGA 4ODWB 4XIYA 1FAIL 3T5TA 3CSSA 1ODFA 2F8OA 3OLWA 4AJ2A 5BSKA 1WS7A 3SDYH 5KYWB 2GN1A 4UBNA 3P4OB 4D45A 5AVWA 3SE6A 1YS7A 1Z66A 4KRPB 3IE9A 2J5LC 3BDYH 4QPEA 3T5PA 4QC2A 2KPOA 2GFBB 1QI5A 5AAWC 1I0IA 1KOFA 4QGBA 4DTIA 5KWSA 4JX0A 2VS1A 5IWCA 5K33A 1V1MB 4CDNA 3TNMB 2AWOA 1G4MA 2YVKA 1OCRB 3EYOB 5C07E 3CF2A 3VGJA 3EH4B 4QYAA 3WFCH 1HMYA 4KSYA 3B3AA 1A21A 1EFTA 4DEPC 4G09A 3ABZA 5EBMA 1ZK1A 5D5MA 2MOQA 2HPVA 2OHHA 4L5CA 3FB6A 4OCSH 4RV4A 4UXJA 3RFXA 1BE6A 5BV7C 5F71A 2R69L 5B6JA 3LUJA 1AG0A 3OKWA 4ZYLA 1JHTA 2E7MA 2ODEA 1WA1X 4QTIL 4AT1A 3EYUH 4JKWA 3V7NA 1IH8A 4A0AB 3OZ7A 3H84A 5JG7A 3GJYA 5FLUA 3RL1B 4EECA 3I85A 1AMOA 3OCZA 4PHHA 1FE8A 4FFYL 5CB4F 1XF3A 4B76A 1BHJA 3ZIAA 4M8RA 1IAQA 3RVXD 2YA0A 2W4MA 2IUEA 3EBLA 3GQVA 4G36A 4QRPE 4D0SA 3E9ZA 2WMNB 1I8KB 4UQ9A 1WV1A 4PZAA 2D00A 3GSRB 1DAIA 3CUPB 4R40A 1XAKA 2UZIH 2XVMA 2OULB 4A04A 4DQLA 3UTQA 2F58L 3QIBD 2BUAA 1YRWA 3MA9H 2EDRA 5JRJA 1S9WB 4N2NA 3MI6A 3KLNA 4RNRB 4H77A 1QR4A 3IR5A 3GO1H 1XHFA 2P3OA 5KYNA 5C3TA 1OE1A 1GH7A 3DB1A 4JVOA 4DIEA 3F83A 4G8EA 3E22B 3LNIA 1UP4A 3V5HB 2V0AA 4OWRA 3VD0A 2Y07H 3ODGA 1YEKH 5FCDA 1LK0A 2ZOLB 4YHIA 2PQ6A 3BFXA 1LL1A 2UY6B 1R1CA 1IQPA 1F90L 2FPUA 1OI3A 1K3TA 3WFEL 4RGNB 2GTWB 4MCIA 2SNIE 2P2NA 1MEJA 1YR3A 3LSOA 1A7BA 2IOYA 3TXAA 4B95C 1DIAA 3QDMA 4FKEA 2H4JA 4HGRA 4Z7QA 5A2JH 4IIVA 4HYTA 4HK0A 1W0VA 1VCMA 2CGZA 1KCVH 2WYTA 2CLDX 3LP8A 2UV3A 5C07D 3QWRA 4RKQA 4P6VF 5BVPL 3BUSA 4F3RA 4I18A 1Z62A 3KOOA 2PPFA 5DZ9A 4C56A 5AVTA 2V96A 5DYWA 2DQJL 1FDIA 2NNFA 5B39B 4HB0A 5F1OA 1SN0A 4BNUA 3ZHOA 3QFDA 5IT0A 2EXSA 1TJHH 1PGPA 4NCHA 4G8IB 3P0VH 1U3HD 1A2QA 5KSBB 3HO8A 3I2JA 1LF0A 5T3YA 3JU3A 3TOSA 4DR3B 4M8UA 3LQAL 2FWNA 3CFVA 1BOGB 4OJCA 1KH3A 3SSGA 5ESAB 2HJ9A 5BZZA 4X6CB 3K1AB 2C8KA 1AA9A 4KNTA 4OZFG 1BMQA 3VJ6A 4BQBA 1RCFA 2W2KA 1KFEB 2BFDA 3PHJA 4KQHA 1PQ4A 4OTZA 3ORRA 3I6LD 3BKYH 13PKA 2EXYD 1GQSA 3LNHA 5ALCH 3O1IC 3SSMA 1QTNA 3BW9A 5JDIA 2CO7B 1F1AA 3JV6B 4HH3C 4Q21A 1TL7C 5T8KA 3UVOA 3BF8A 3IPFA 1T91A 1Q84A 1NX6A 4W6XB 3EAFA 3O3CA 4MFHA 5IMMA 1A4RA 1K2DB 3UMRA 4NPHA 3AW5A 5EPMB 4IH1A 4CSZA 2WIDA 3QUYD 2ZAHA 4MJ7A 2XE7A 1T3FA 1RYZA 1IM9A 2G25A 1N3LA 3UVLA 2BFWA 2FGWL 3SEZA 5DUBB 3HKEB 2G07A 4FB4A 1H0KA 2WG0A 3IC5A 5DC4B 3MBEA 3WLWC 3IB4A 1ZQ9A 2NGRA 4PQFA 5JC8A 4RETB 2GITA 4X9GA 3KD4A 4ZT6A 4ZDHB 1JEJA 2ZTBA 3DO8A 4LJ7A 3REVA 3DGCR 2V3WA 5JCXA 1ANUA 2X70A 1S2DA 4M37A 4FR2A 4UOQA 4ZZ0A 3LT1A 3SMRA 3F6LA 1TM2A 2X0WA 1UR5A 1H22A 1LEGA 3U30C 1UFKA 4OUOA 1UOKA 2W2LA 5EXSA 2V5VA 2QEJA 3T3IA 1GITA 4FA4D 3R41A 1BLNB 4DR2B 2GTZB 3AEKA 3FTWA 5FO8B 2ZBEA 4FFWD 4H0IA 4Y4HD 4XGKA 2VT3A 4N8UA 3JVGA 3DDGA 2R7EA 3ASWA 2QMKA 3J81A 1JU3A 3TJEL 3DBLA 1EBAA 4QDJA 1B4JL 3WBDA 2ZS8A 2A5UA 3P3RA 3X12B 2Q2QA 3AVVA 4B27A 1ULUA 4F7TA 3HLAB 1R0XA 4MJLA 2VMJA 4Z7UF 1FFOB 3V2GA 2V0GA 5I1DA 1B4JH 3I04M 3TLEA 3W1EA 3JTSB 5JLZA 1TGVA 2GPTA 2JMRA 5FO2A 1VFAA 4HYEA 3FPXA 1J5XA 4ESEA 5DZSA 4WXRA 1YPZE 4TGLA 4MKHA 4I2XB 2BRRH 5JFOA 5TIIA 4PJHA 3UZEC 4FTVA 3VXQB 4HGQA 3HI5H 4L8CB 5GGUB 3V1YA 5CX1A 5C8JA 1NEUA 3AVTA 1GG9A 5F9HA 1E5UI 2VC2B 4JO2L 1VL5A 4JEMA 2BNQA 1PDKB 3GJ6A 3O3MB 4YL9A 1EM6A 1NTRA 3AR4A 3JARA 1ISMA 4A11B 1GZHB 2H85A 4GI9A 2PD3A 2AZDA 4IILA 2AR0A 5FAXA 4KTTE 3K5WA 2DMHA 4J6IA 2I1VB 3EUAA 5HYSB 4WHDA 4G6JL 1X7DA 1K97A 1KI8A 2CSXA 2JFGA 3KYIB 2DQIL 2R86A 1HHJA 3DX6A 4YDKL 3F6EX 2E9SA 1FYEA 1WJGA 3VWKA 1XPOA 2BKVA 5DJ8A 4DGSA 2Z43A 2L17A 1KVSA 3FYSA 1FGNL 5BSVA 3R9WA 5A5VA 3H9YA 1S7XB 2WQ7A 4ALAC 1JQJC 4ZT5A 4A1FA 4AMWA 1UXWB 2Q5IA 4GUOA 1USKA 3KS9A 1E4JA 2CO6B 3M1AA 2V9ZA 4JB9L 1LLDA 6PCYA 4FR5A 2IG2L 1HAWA 4LLQB 2A0KA 4OLUL 4CKXA 1CXFA 1U8MA 2MTPA 3QBTA 5I82A 5LVAA 2YNMC 2NX5B 1J23A 3OTWA 1YBHA 1N6VA 1TFRA 3ZIDA 3RVUD 2G82A 5HIIA 2EKJA 1T1ZB 1XQXA 2KT6A 2L7EA 1MI5E 3FO2A 3Q1EA 4J5VA 1NFKA 3WBBA 1WBZB 4XMXA 3G2HA 3C9CA 3FXAA 4DIFA 4K7PX 1GPNA 1CUFA 2AK4E 3GJ3A 1AP2B 3ENKA 4FFVA 1OFUX 3E2HB 2G99A 4KRYA 4HLNA 1IIBA 3SR0A 1ZISA 5G0SA 3N50A 5IVXB 3C87A 1XF5B 2P9SC 2HQ1A 3QVKA 1KCSH 1EUDB 4FUQA 5B3LA 1VMIA 2AG0A 3GG2A 5K0GA 2PWEA 3O4OB 1RXSA 1XGYH 1KIQA 2IRWA 1G3UA 2IOQA 2KLHA 2W0FB 4WWKD 3AFNA 4OQNA 5DJZB 4HRAA 1YA5A 2AGZA 4F04A 5B37A 4OIAA 5IX8A 1OTTD 3BL8A 5BQFA 5E8NB 2JIXB 4F9LA 1NBME 2JCWA 1EFPB 5JXEC 4U7FA 5BO1L 4LTMA 4NQRA 3L9RA 3ZWCA 4BP1A 5BVPH 3IJYA 1FJHA 1OWNA 1E1NA 4C56D 2RHRA 2EH8L 4XE5A 2FWMX 1QO9A 2WU3A 4RWYL 1N2EA 4FHEA 3S4YA 3BI9X 4JPKL 1JHZA 3ZN2A 3VI3E 4ODVH 3W5AA 3VTZA 2F74B 4DMFA 3MJVA 1DXHA 4J9VA 4PJ5A 4I1NB 2IQ5A 1RZFH 3KELA 2EDHA 4MW1A 1UOOA 1TZOA 1EG2A 1QGUA 2FMFA 5C5CA 3FT1A 3H87A 2YMXH 4ZW5A 3PUIA 1RP8A 4X8JB 2PL9A 5DD6A 1PL0A 1QX4A 2Z31D 5GRZA 1QYIA 1EO8H 3HYSA 1NC2D 1QHFA 2ORIA 4LFAB 3OWEA 4ZNEE 3IS1X 1L0QA 1KNOB 2W90A 2YBGA 4KO9A 1Y7LA 4W9FC 1U8NB 2XUQA 4ZI5A 3P9KA 5L9DH 4YSPA 4PD4J 4G5HA 1FVCA 1QFWI 1RZRD 1RLTA 4KRPD 4FMPA 2YS6A 3LPDA 1Y8RB 2QHLA 2HVKA 1OFHA 3EIUA 1MWAB 5MHSD 3NBNA 1S8AA 4ND5A 1XIWC 1D2MA 5T3XD 1YMUA 2POQX 1L8QA 4UANA 2XN9B 3RVRA 1WBZA 2GOYA 4DERA 1H1LB 1LRJA 4DV1B 3A4VA 1TZIB 1RXIA 1C9MA 3RWCA 4L1HA 1NGWA 4NCNA 4HJ1A 3RRQA 2F58H 4XT1C 4PXWA 2GTQA 4EUKA 3R6WA 4YY3B 3EG9A 2CK0H 4QBIA 1TJYA 1PT9A 1WZMA 1MREH 1VL2A 4QOGA 1Q1BA 2IE8A 4CM5A 1ZSDB 4Y5VA 3OMAB 2BXZA 4PAZA 1R3IL 1B74A 3KXIA 1HZZA 3L2NA 4G80B 3OZSA 1X5MA 1V1RA 5F72S 2UWEE 2HB6A 3L8ZA 1NGXB 2H41A 2CMRH 4M9PA 4C2UA 2A74B 3PQ4A 4P8RA 2RCSH 3BA1A 5HEKA 5F4ZA 5EEVA 4HKBB 2X5XA 4FI3C 1BXZA 2EUZA 1PYOA 4X50A 4FXLA 5HK9A 3HM9A 4GMGA 1YFZA 1KRXA 1PR3A 1V45E 4NJ9L 1QPKA 1X9GA 3GJ5A 2EVGA 4BAGA 2YLHA 4IFIA 2ZRBA 1PJ4A 4BE5A 3JQBC 3IDYB 4TT3A 2G9NA 1BIFA 3I3EA 4LQLA 3N1GC 4IS6B 1L5VA 4QFMA 3A6CH 4WU7B 4MVJM 5EEGA 2XRFA 1MCHA 4NO0A 5F73A 5C52B 2C54A 2Y7SA 4J0CA 1E7SA 1HWWA 2HRQA 4G5SA 4PLGA 5HVWA 1PU2A 1TQUA 5I8KH 4U6HA 1HYSC 5KOIA 5FTWA 4Z9FA 2J3LA 1PVOA 3SGJC 1GPMA 5GZ3A 1XZHA 4G5RA 2YS4A 4LLYB 3RVUC 1PTKA 1U98A 4ZI2A 4BQ6A 5TSDA 1JK9B 5CKAA 1THZA 4BMOB 1CLYH 2EFGA 3TYFA 2ATCA 2HXSA 3IKJA 2Q5OA 3MAJA 1MIEL 1KZGB 2PZAA 4PRIB 4RHCA 4XCYA 1RLMA 3WJMB 3RWBA 5KTMA 1Z4MA 3QLUA 2JKTM 4DA8A 3T5BA 3WFZA 4JWTA 2AI0L 3DZKA 3R3HA 4FQ8A 1MH9A 3QKSA 3L4TA 3CLRD 3HMXH 1ENOA 1Z0IA 1PJ3A 1TIBA 4BNHA 2OFXA 2JJVA 2V97A 4QAMA 3O81A 2A6KB 5CH5A 2GR9A 4JPSA 5LBVA 1CDEA 4NZRL 4Q4AB 5BQ5A 5BV1A 2VWEC 4QYOB 1EQAA 2KWIA 4JFRA 3NK4A 2R1ZA 5ELIA 3H42L 1AF7A 3DUUA 2YN5A 2O8FA 4PH8A 3A22A 5IMLB 3VNSA 3BBPA 1RAEA 3PHQA 3NDYE 4LFHD 2W98A 3HCOA 4JY5H 2PYEB 3RUHA 2I8LA 1O87A 2J4CA 1U92A 5GZNC 1BIIB 4X92A 5HE9A 2ZQZA 3GRRA 2EX1A 3GMOB 3NVXA 3UYLA 5I30L 3H9SD 3S2FA 3WTVA 4W1PA 2RCNA 1Y3BE 2O6HA 4CMHB 3NWEA 3DZDA 4LRXA 3DAPA 3FZNA 2X0JA 4HNVA 4NCKA 3VD2A 4MWFA 2GLUA 4GPVA 1I3MA 4ITVA 4JXMA 1QWUA 2X5JO 4D44A 1C8BA 1CQXA 5C7XH 1BU8A 4DADA 4OLBA 4BEJA 5B12A 2Q0HA 3BL5A 1CXIA 2VDVE 2Y67A 3SKYA 1KJ2B 4L5FE 1XIPA 3EH3B 3V1TC 2XDYA 1TVKB 2XN2A 1Z4KA 1T03H 3ZW9A 3A4NA 2BM0A 1H5BA 2QAGC 4YUEL 4PFSA 3U1SH 3IP5A 1JSZA 5IEKA 3PNKA 5KWIA 1E8DA 1CDUA 4DDHA 3QXCA 2V5SA 3B1VA 4ZDJA 3TONA 3ZTYA 5KTRA 4F5YA 1XN4A 1ICTA 3RHWK 3L5IA 2QB5A 4X4ZA 2E89A 4GSQA 1GZPB 3KM1A 1PX4A 5IIEA 1YACA 3W6PA 4KREA 4N5LA 5IROA 1DXQA 1Z9MA 2ZTUA 3PPEA 5HQJA 5FA4A 7REQA 2PK3A 2C9UA 5JWRA 5EF1A 4WLOA 4GYJA 2I60L 3GZQA 2BISA 2QRVA 1A22B 3E38A 1J09A 2ZX5A 2CKMA 1ZL0A 5C8YF 4MA5A 4PRHE 1HHGA 1E1QA 4OQZA 2WTRA 2RHWA 4B7LA 4F15B 1F00I 3ARGB 4G8FB 2JFCA 4RLDA 1HEZB 1T0IA 1PLGH 1X5GA 2YWGA 2H9NA 1KBWA 2X70B 3LEXB 3I23A 2C9ZA 2O0MA 1HRDA 5H1MA 3ECBA 4TS3A 3C5HA 4IS6A 3N91A 3KJZA 4IIJA 4ZANA 5EU6A 1LVHA 1OM9A 2XYGA 4ZN6A 2JFUA 4YDZA 4RESB 2H8PB 3R74A 1N0LB 5L3ZA 5T7BA 1X7HA 3SYCA 2OC4A 2O3UA 4RTPA 4AGLA 5I4BA 4I3RL 1DQTA 4RW0A 5E3IA 3B7FA 1XTKA 2HTFA 2OZ4L 5I73C 1VSCA 4TLUA 3F74A 1YFJA 1WISA 1T5WB 1PD1A 4ZI7F 3HSYA 4B9FA 3EY9A 2Z8XA 2JFQA 4Y6SA 1I4EB 3TRDA 5FK9A 2QT1A 4QICA 1Z63A 4TMZA 3PKJA 2VH5H 5BCAA 1YRHA 3PWPD 2IY7A 1F3DJ 3VX4A 5MHSE 4HU8A 4JBYA 3BMQA 4UM9D 4DT2A 5HF6A 1P1IA 3ECWA 4JB0A 1JLRA 3R5HA 5ITZA 1T89A 4H8WC 5LGKA 4Z0BH 3IDXH 4U7MA 2I3BA 2C29D 1L4YA 3IAM1 3BH7A 4PG2C 4AW9A 3BMNA 2DPGA 3A10A 4U9IS 3UJTH 2Z5VA 3SGEI 3T4EA 5A0VA 2FVYA 3VRJB 1JG6A 2AP2A 2QMYA 1P33A 3N2KA 3Q85A 4Z1OA 2DUWA 4A11A 3EGOA 5IASA 5GGSY 1QGUB 1RT9A 2VLRB 2EZUA 1KI7A 5TDNB 2SCUA 4L4UA 4UU0A 3UIEA 3FFWA 4YHYB 1OH6A 3BN3B 3PQDA 3R20A 1I3LA 2K3HA 5CIPB 5EU4A 5HHVL 4OZGF 3GJQA 5EUBA 3HBJA 3OJ0A 2B15A 2AMJA 1LPBB 1D0SA 1T26A 2JLWA 2P9LC 2YXLA 1GGCH 2B1HL 5DLMH 3ZDYB 2V45A 3E6FB 4Z8LA 4RWYH 3EI3B 1J8DA 2MYUA 1GGKA 3M2PA 4R1LA 5G4KA 2DKUA 2OV1A 3UW1A 3M07A 5JWOA 3RGBA 2WP3T 1JW9B 5F88B 3GNSA 4IUCS 1BIHA 1Q16A 4LVNC 1C41A 2BMVA 3IRUA 2VTKA 5TF0A 1OBVA 4DZ8B 1QTQA 2QRZA 2VPPA 2VG8A 3HS3A 3VR6H 1ULAA 1J20A 2EILB 2J5QA 4DR4B 3B53X 3FHTA 3OOEA 5TD4A 1ZIXA 5FHBH 4WI5A 1TF7A 3BAXA 3RY6A 4EDWL 5ANMB 4DG5A 2I27N 1UFGA 5LKNA 2V7XA 3SE9L 5HJ2A 2NY5C 5A9SA 5CD3B 4HNAA 1PL7A 3CHRA 1XVIA 1Z74A 1DUVG 2QKYA 3PNYA 4NBLA 4EMSA 3JZFA 5JOPD 3CMMA 3U4AA 5D7KD 2QPFA 2Z2OA 3ZU4A 2Z65C 3C6LD 5KQGA 2AOWA 1ZT4B 3RO7A 4XUDA 2OLEA 2X2FA 3FYUC 5HK8A 2J9FA 2VJBA 2E4YA 1UXMA 2XY2A 4U1MB 1IGCL 4DPCX 4Q3AA 4TWZA 4UAVA 2HFFB 4NYMQ 4QJ3B 3C3BA 3ZGYA 2XR1A 1YC5A 3HE6D 2H11A 1L5GA 2HTLC 3NHJA 2V5TA 5LXVA 1M5TA 4QBGB 5HE3B 4IQ8A 4NBKA 4HHWA 1UOWA 2J4DA 3B9AA 3O3AB 3BIWA 4FMVA 2NYZA 1U3FA 4Q6BA 4KSBA 4AWXA 3OZKA 1FGNH 4IEFA 1IY2A 5DHFA 4TTIA 4HXBL 3TPUA 4JHAL 3NBYC 4GO9A 1O4WA 1AZWA 1YNTA 2A0FA 3DUFA 3D2CA 3BVNB 4UM9B 3N2GB 2Y9MB 4MB3A 3FW1A 5F35A 3B1KA 5IW3A 3AU0A 3OKFA 5DEJA 4MEAA 2WSSD 3N04A 3G8DA 4O4JA 2IX3A 4FF9A 3ICOA 4NN5B 2PSHA 3EBIA 5CFOA 1XTMA 1ODSA 3ZGZA 2NQ8A 1ACYH 4HPJB 2AC4A 1NAKH 3F5DA 1IEHA 1E9SA 3RL2A 4EHIA 1ZR2A 5F1SA 2EIJB 3U4EA 4I46A 3T15A 5KKNB 4OP2A 4ENUA 2W2NA 4KFTA 1ZOSA 4WW0A 2I3DA 3OX1A 2PZKA 2FZ4A 3WBKA 4PJIA 3RPKA 1VG8A 1K85A 1NBZB 4ARZA 5MENB 1U8CA 4I0CC 2R29L 2WXHA 3I0NA 5CHEA 3TNYA 3ES6A 3M1LA 2ZEJA 3NWOA 4EW2A 1HF3A 1QHQA 2W0FA 1X86B 4DILA 2RCSL 2AXWA 5I23A 1YVRA 3LVFO 2ZT6A 1C4WA 5I2IA 3TQFA 3KO8A 1G7LB 1KLFA 2IDSA 3M1CA 4WNQB 1FDTA 1FQKA 4QXPA 2OSLA 2IU3A 4UT7L 1MX3A 5JC1A 2AQIA 3AUUA 4RH4A 1NA5A 1CB4A 3ADBA 3TWYA 1QFWH 2HJFA 2GI0A 4N5MA 2DBRA 4MA4A 3HI4A 9LDBA 4KJPC 2CHDA 4ACBA 3NDPA 2O6FA 4EVNB 3CLSC 3O4RA 1GLGA 1U3HC 5IBPA 1RXWA 3A05A 2QVYX 3CU5A 2XB2A 4D8VA 3HRZC 2ODBA 3GU3A 2ADGB 3RFRA 2I07B 1CURA 1LJUA 3BDAA 4YUZA 2ZS7A 2EDDA 3L0YA 3UC0H 3CVXA 2BY2A 3QJFB 3A9TA 2O5CA 5KVDH 4NZOA 3OMLA 1T3SA 4G1UC 1N2CA 1C30B 2BC9A 5CM8B 1HYHA 2JJMA 1WDAA 4WLVA 3MQIA 3GMNB 1TFHA 1Y3AA 2BDNL 3T4YA 3N0WA 1XJ0A 3U61B 4FZRA 3ML8A 2O7VA 2MNUA 4TVUA 2BHSA 3KQMA 3DBRA 2YBAA 3OC8A 2IEYA 4FQCL 4KUHA 3MJHA 4OHCA 4P4RA 4I6GA 1RURL 4YP7A 1ZNWA 4XAKD 1U99A 5EKXA 5BVGA 2R8SL 2OVRB 2IP1A 1CF8L 2QG9A 2BOBA 1CS0A 1FCCA 3U62A 4Q0XL 3OKTA 4M6AA 1WAMA 2FXVA 2QM0A 4ARCA 3OECA 3PHIA 35C8H 4M8QB 2LDXA 5DXFA 3UTTA 4ZJZA 1MABB 3K71A 4OB8A 1Q47A 1JMXA 3U9PL 3B5EA 4IIFA 4WWKA 4PLFA 3TM4A 4G5FA 1G7IA 4K07A 3RB5A 4DPLA 1R0AL 3AI3A 5EQJB 3CFYA 4A7QA 1JR3D 3CG4A 2UVQA 2Q1UA 3E05A 5BQ3A 2UZ1A 4YDMA 1OU4A 1IQWH 1G5AA 4LLUA 2OORC 1GW6A 1U7WA 1KGSA 1S7RB 1Z0DA 2QGFA 1FIUA 2P8SA 1JEOA 2H3XC 2PW1A 3VOAA 1I7TB 3PC6A 1EX1A 3PHSA 3MZ0A 2A1TS 1HT3A 4M4RB 1G1OA 1YL5A 3K0YA 2OFFA 1W85A 3H0EA 1TQWA 4P58A 5K0SA 5IQ9B 5HIAA 1ZHLB 2X4LA 4IVRA 2RR3A 3CFEB 5KVFE 4A26A 3LBNA 2FZWA 2C96A 2DQEL 4RMNA 1A3LL 1YZGA 4W6WB 2ZUWA 1JSRA 5HYJE 2H5IA 1DQYA 3LB6C 5KJRH 1U2RA 4IRJD 5TX7A 3QIWD 3QZBA 2DRUA 3OETA 4NIYE 2HSGA 5KX5A 3THML 3BHBB 4CKCB 4OGQC 1WPRA 2X0RA 4CJ0A 3DE6X 3BP4B 3T0EB 4WA8A 4C6TA 1ZANL 1PG0A 2DFNA 3UPTA 2VJAA 5T1KA 2FCAA 5DD3H 4XVJL 3VFGL 1KLUA 3FF8A 4E41B 1CX9B 3I8XA 2M6KA 4DNOA 1AOZA 3VPAA 3P9YA 4AROA 4IMLA 1BECA 1EUTA 1ISFA 3ZHDA 2I71A 3K3PA 4X80H 1I51A 1RUPH 3G5TA 4JZJC 4LGYA 3HG7A 5AVWB 1YEDB 1SDAB 1MQ9A 3USCS 1X70A 4YLCA 5F3BA 1SXIA 1Y6NR 3GUVA 4O29A 3FGPA 3UT0A 3VFTB 4IHAA 3VVCA 2JIBA 3PGJA 4Y9RA 3NFPB 5C6TL 4X7FC 3TK1A 4OLFA 5JS7A 1Q20A 4CM1A 2B7CA 3ZCPA 3BAKA 3GQBA 4OO3A 2AZTA 4WUUE 4QHYA 3EVEA 3ZVRA 2QPLA 2ZF8A 4ICWA 3TNFA 4LJSA 4N8PA 2ZUQB 3AF2A 1MOQA 2GS9A 5K0ZA 4BVLA 3QI7A 4PCKA 3ZR5A 5JPDA 2PAFA 3T6VA 2XIDA 3QJVB 4XPGL 1KERA 1NJ2A 1YEGL 1UEJA 3UDWC 4TTDD 3TKAA 2JNWA 2EL9A 5MGNA 1M71B 1T35A 1QP1A 4MUNA 4LZNA 1O7DE 4AJHA 2EIHA 3TA4D 4WFFD 5CZRA 1XDDA 5IJZA 3PU7A 1PBNA 3ZWNA 2GD1O 3EOBA 5DJ2A 3MLPA 3U5TA 3ADKA 1G42A 2FN3A 2OYCA 1AGXA 4MQFB 4YLEA 3OG4B 2FR0A 2HDOA 4FQ1L 4BFZA 5ALWA 3GHEH 2VDNL 3PNVA 4OQEA 1K8RA 2JCCE 2YC4C 4AZ0B 3N44F 3HJBA 3IFLL 2PL5A 5SWSB 4X97A 2YEZB 4BVGA 2VK1A 3SDDC 2IYYA 3LHDA 5LUAA 3PC7A 4IJVA 4N22A 1M1XA 3BUTA 1H3PH 1NJ9B 2JLSA 1MFCL 3PL5A 1F11B 5M5VA 5B7PA 2PPAA 2RONA 1WK0A 1AHWB 3NAAH 4B79A 3ARZA 1TTUA 4FLOA 1B8PA 2XUHA 3ZKMC 2GO7A 3AR2A 1V48A 4RAQA 1KGDA 4KJWC 2XTJD 3ETTA 4ORZC 4WV1C 3AS0A 1PZ5B 4O2CB 3EOAI 5C4MA 3NT2A 3MC0A 4INOA 3C0KA 1G7RA 4IW3B 4I5IA 1E99A 2ED9A 1V6AA 4CQLA 1F4LA 2DWEB 2ZCLH 4K28A 4OFZA 4L7VA 1Z28A 5AG8A 3I9LA 5BUPA 3A31A 1I5RA 3W6NA 3T9EA 2AZXA 1AMXA 4XOAA 1HINH 3SYMA 3KG5A 3LYLA 2OD2A 5GRWA 3KS0J 1LDEA 1ZN7A 4DAEA 1PZFA 2P4EA 3HXPA 3ICCA 5AP9A 1U4SA 2D7JA 2Q1EA 3CXFA 1PR4A 1JZFA 3LUCA 3X13A 3KLSA 4Z0TA 3AZQA 3TC9A 2G36A 3EX7C 4N0FB 5DLML 4FQIL 5JPNB 1MO4A 1JWSA 2VZ9A 4RPLA 4Y1EA 3JQ8A 3D4CA 1F6AA 2OBBA 4ERSH 3CMCO 4PQXA 1PGUA 3CFEA 2PV0A 2FW6A 5CFLA 3QH3A 6FABL 3Q43A 4Q4JB 1X9IA 4A8JC 3PQYD 1JV2B 3BE6A 3ZT6A 1CR9H 3IJ9A 1I1YA 4PJXA 3ZTTA 2XPZA 3HKCB 4NBXB 2BVYA 1E2GA 1Z45A 5IZCA 4PJBA 2Y06L 1OBHA 4C6TB 3QOXA 2C2KA 4H3VA 5AXBA 5JU6A 3K6SA 2NO6A 4IRJC 2CBGA 4GC5A 1OIOA 3Q5TA 1SU4A 4ND8A 1O0SA 4IS3A 4P4SB 5ECGC 1P1JA 3O8RA 3CLTD 2LE9A 3ML1A 3Q7IA 4L0DA 3VGAC 5HSGA 3GZ4A 3N44B 4YQYA 3C4QA 4TTAA 1KC1A 4F21A 3JV7A 2LABA 5DYNA 4U2BA 1G7MA 1VIYA 3BRDA 4HS8H 1CWUA 4NK5A 5K3SA 3VZBA 2X8WA 3T4AC 3SF0A 1EMTL 4K9RA 4HDOB 1IATA 1EK1A 3P2EA 4R05A 4ZVPA 4I3SL 3OJDB 3VNQA 4GLLA 3M5DA 3IJPA 5FW6A 4JOSA 4FNMA 2GASA 1FYWA 3K9GA 4R4FH 4G56A 4OD0A 2BEVB 2F61A 1JYEA 4UAJA 5IJWA 2C1PA 4Y19B 5JHDE 2WLTA 1YGPA 1MKYA 5JAOA 5AW5A 4F2GA 4LLDB 5AYVA 2FPGB 4O25A 3IMKA 4FQ1H 4B34A 3BXNA 5HI4C 3GIZL 2UVDA 1TUIA 2GT9B 3W5BA 5JPIA 1G64A 2QLJA 1XH3B 5C7IO 3ECSA 2NXZB 5E94B 1SMKA 3LDAA 2DP4E 4XI5D 2C94A 5IBUG 2R62A 3O3EB 3VHRA 3QENA 4EN3B 5BR7A 5I28A 3SHVA 4HMEA 1CJMA 3U9WA 1UAGA 1PGOA 4BEIA 2A6JA 2Z31A 5DMYA 1T10A 1EE1A 4M0CA 1TQTA 3M89A 4OF6A 5JQGF 5KTKA 3UH0A 5JZVA 3NFNA 2QTVA 5ADOH 2IYUA 4UIMB 2XVYA 3GYRA 3GROA 3AREC 3S2SA 4ZTOL 5C0IA 4HVAA 5LU8A 4RIHA 3FQRB 2D0IA 1KAQA 3HNTH 3EQ6A 4M99A 4EI7A 4MYPA 1L7VC 3TJRA 2AEFA 4QTHB 5COBA 1BGWA 3QR0A 5GGRY 3WNOA 2O14A 2R4TA 1NC4A 1CN4A 4WLUA 2WKQA 7FABL 5C6TH 1AQ6A 3JWNC 3IVAA 4YO7A 4JXKA 3GJTA 3L01A 1IGIH 3BB4A 5HBGA 3KPMA 4X71A 1Y81A 3UHJA 1N78A 1ZUNB 2QIOA 5BRAA 4DZ8A 1KJVA 4EOGA 1ISIA 3Q8LA 2F1BA 4TMFA 5K0NA 4BNDA 3PLRA 2M2DA 3BKXA 3G89A 3FL7A 4M1CD 2HI0A 4IIZA 2YJ5A 2CLHB 2E9GA 5CXQA 2ZIEA 3S88H 2BSQA 4Y7RA 1XCQB 3F64A 2TAAA 2PA0A 4TVPD 1OU0A 1D7AA 4CIWA 2OI9B 1U3JA 2AZAA 3AFGA 3G5MA 3RTGA 3PFHA 1GR7A 4FYYA 2ZUXA 2OQJB 4MWSA 1ETHA 2MTBA 2E0PA 1EFRD 5AT1A 3VW3H 4N3GA 3EMBA 3O75A 3I7HA 3KBHE 4P93A 5FEBA 4PJFA 3QS2A 3MJ6A 5IK3B 1TIKA 3QHQA 3QG6B 4E30A 3LXRA 5A2AA 1E0JA 4CKCA 4KWCA 5EWIH 4AEEA 1TNDA 2PMWB 1ZUD1 4GBJA 2EATA 3ZSSA 4KFMA 2ZSBA 2Z7YA 4DB4A 4LCYB 3RIFF 1LK3L 1XQ4A 4MB0A 5K8IA 3N85L 1SU6A 4DM3A 3C70A 4C0LA 3G88A 3ARGC 3RGHA 3GHBH 3P0YL 4YC2C 4CTKA 3HUFA 2IIBA 1TZHB 5LUBA 4JY4A 3BORA 4RLQA 4MCJA 3KPUA 1J9SA 4RQQB 4RX1A 1CYWA 3TMKA 5CJOH 1T66D 5BSMA 2OAAA 1DKLA 1IL0A 1CNFA 4GPAA 1GTSA 4NCBA 3FOCA 4NZZA 3EO9L 2BEWA 4HAXA 1EK6A 1P77A 2NYAA 1I4TD 4LDPA 2XZOA 3RUFA 4ONHB 1L4NA 5IJKC 4CN1A 5MI0B 3EFEA 3DE7X 3MJSA 2XN9D 4UUPA 5C7LO 1P0CA 5FPHA 1ET7A 4AXWA 3JZIA 3OPYB 2OA9A 2HMVA 3MLBA 5FAAA 1P6FA 2BSED 1JYFA 5JJ5A 4PREB 5HCIA 3QZNA 1XNJA 2V2WA 5THXA 3WI7A 1YI8A 1YN6B 4KMTH 1IFGA 4M1GL 2WTXA 3SVLA 1DO2A 4KI5D 2V7UA 1GCUA 1G1KA 2I3AA 5HM8A 4ER6A 4R7ZA 1H93A 3CCHA 1AXGA 4AENA 5IBRA 4NQUA 3NABL 4R5TA 1LSJA 2Q4DA 4MS1B 2R2BA 1OAUH 1KB5B 1SQFA 1BU5A 1P0PA 1RZ8A 2FPGA 3HMKA 3Q3GE 2WT4A 5J2TA 3QEUB 3ZIMA 2QP9X 3IGUA 1UQSB 1ORHA 1P7KB 2D5BA 1KCSL 1JAEA 2VCYA 3P45A 2C26A 4LDAA 3GTTA 2IYVA 1UEYA 2L69A 1DSYA 1QM5A 3KVPA 1G291 2WSSA 3R5XA 2I69A 3H0KA 4Z1PA 2H4HA 3IIMA 3PDDA 2NTNA 4LGCA 5KBLA 3Q2NA 3DDSA 4IIDA 4X6CF 1SM4A 1E6OL 2CKDA 4J90A 5JMWA 4S05A 4JAMA 2G9ZA 5GXBB 4XX0A 2O2YA 3DS8A 2AJXL 4CMKA 1J4AA 4M0FA 3PDJA 3VX0A 1XMWA 1S5IH 2ZJSL 4QXMA 4WZ6A 4EX7A 3VZSA 3VG9C 1K7FB 3FCXA 3PIDA 3DQZA 3U39A 1QF7A 2VQDA 4J7UA 4IJ5A 2D5AA 4WW2A 1WO8A 4V1DE 1HA3A 3VFNA 4R97B 1D5IH 4NFDA 1MRNA 4X6XA 3GS0A 4WSJA 1M54A 1XELA 5TGZA 4JHNA 3N6XA 3P0EA 4ZEMA 3GP8A 1VRWA 5K8VA 2PUWA 3L6RA 4L51A 4HAYA 4B09A 3DSFH 3IE4A 3CDZB 1MXDA 3U2JA 4ERZA 3BO8A 2HKIA 3LN9A 4Q9CA 3N2NA 2RE8A 2PKXA 1TB4A 3ZCTA 3WCYA 1B2RA 1RBYA 1AO3A 4OZIF 5IDYA 3K4HA 2WXRA 3CFKA 2B1AL 4IJMA 3EFOB 1A8QA 2O8BA 2R00C 2VHVA 3UKUC 1N3NA 4XMUA 4BQCA 4UTCA 2Z8WC 1YFQA 4M38A 3NDRA 1RAAA 4DLUA 2DYPD 1OLUA 3C98A 4XMPL 1ITBB 4P46C 1M71A 3RVWC 4POZC 4EEXA 1QV6A 5AM5A 4DJ5X 4G8DA 3WYNA 5FTNA 4IRJA 3BAWA 1HBJA 3VNBA 3VX1A 3IEMA 3TSAA 3NFSL 2PTHA 1OCEA 3BEVB 2XTNA 4MP6A 4LJ4A 4KQWA 5KU7A 2JIDA 3SQNA 1NRXA 3HWSA 1S9DA 2BKLA 1KDYA 3KGUA 1J8VA 3D1MC 4NHUB 5JCJA 4L3EA 1DZ0A 4V0LA 2J67A 1JDTA 3VGBA 1ZEAH 2QN7A 2MCAA 1PQZB 4Y16A 2O4CA 5TPWB 3QYCA 2V3CC 1LK2A 3L7YA 4IOSA 3IHLA 4FG2A 1HYQA 4HEPG 4ZFFB 3AACA 2PDAA 2EGUA 1U0EA 1IFXA 3I6LE 2EH7H 3WTUA 3C5JB 1PAMA 1VTKA 3KYJB 4MUMA 1NUDA 3G9QA 3WSWA 2X86A 5D2CA 3V0AC 4BN4A 2WJ4A 3DVAA 3P30L 3GGSA 1U2GC 1DEOA 1QU3A 5CAYB 4N0QA 4PVLA 2Y1GA 4A6DA 3EJCA 2E6KA 3IJSA 1SHTX 4AI6A 3WU1A 1XL1A 4JCLA 3MRCB 4HI0E 4F6LA 1E2KA 4QI3A 2WPGA 5B38B 2GJKA 4CMIB 3GGWA 4HPYH 3CGTA 5CKGA 1WGOA 2AABL 1GZVA 4PJGF 1RRMA 2LQRA 5A16B 5AW5B 4HZ1A 3FQUB 4NQDA 1M6YA 1VKOA 5CYKA 4N39A 3MJ7A 2QQQA 1V71A 4TTVA 4XXHA 4E54B 3LKDA 5K9OA 4O3FA 4A2WA 4G2AA 4ZOLB 2LRHA 4V0ME 3SEAA 4L15A 1MHCA 3N1FC 1KC5H 2UY7A 5LBUA 3LBHA 1AH2A 4CG2A 2EFCB 3QEQE 3WFHB 2A0WA 4K6FA 3BIKA 1DEEA 2GDJA 1VERA 3V33A 4O1IA 2WSPA 3RUGA 4Y5YA 4YFDB 1DCMA 2WLZA 3RK0A 2HYIC 4XP9L 3PCTA 4YDSA 3VNRA 4XWOC 3U48A 4WU5B 4WGWB 5EU5B 2AKRA 3FONA 3LSYA 1IL1B 1GHTA 3RSQA 4KOBA 1Y4UA 4XGQA 3A2KA 4Z1MA 1ULBA 1X7QB 2OT3B 3ZSTA 3OQNA 3DDHA 4FQJH 1E1QD 2FMTA 3V9EA 3OX2A 4S1DC 4ERQA 5DMKA 4LZLA 3I9NA 4MKZA 5EUOF 3SFVA 2CO1A 4DESA 1WTAA 4EARA 3MCLL 4MA1B 5DSTA 3D8NA 4M1OA 1NLUA 2MINB 4BLVA 4AX3A 4KMOA 1XK6A 3UDWA 1UA3A 2K6GA 1JJ7A 2EEZA 4FFYH 1HNZB 1Y8AA 2QD2A 4WKZB 3T7KA 5I75C 4K6OA 3PWPA 4HYYA 5I8EB 1JFHA 3MRHA 4FQLL 2FQXA 4NPJA 3O2DL 1JK9A 2VTEA 3LN5B 4IO1A 2J32A 3ZJ5A 3ANSA 1ZLWH 3UGEA 1JD9A 2MQ0A 3EBGA 3FPKA 1V2GA 3PD0A 2JLLA 4Y9CA 2IH4A 2QTNA 1EEUA 1YZYA 3RL2B 2Y07L 3T8VA 2ZKMX 4U1NB 3V42A 3G2MA 4QRUB 2Z91A 4GX5A 4EQ6A 4BNZA 3Q8EA 3ZE2B 4MV3A 2MCPL 1RZIA 2RKWA 3KBEA 2CF5A 5JYMA 1CC1S 2YV2A 1ACCA 3ZW3A 1WW2A 1LTXA 4LU5H 2OECA 3MJ8B 1M8KA 2NY7L 2XLBA 4W6ZA 2NZXA 4X7TA 3HDYA 3B8YA 1QHNA 1Q72H 4ZICA 3QHPA 2V9PA 3O8CA 3PGFL 3QDME 2WUDA 3L5KA 2P2CA 3KKPA 4HNHA 4Z7QE 1RK7A 1JUDA 3GLTA 5BZDA 2DTDA 3TAHA 4LZPA 1SUEA 1WY5A 1AXIB 5H35B 5KSPA 3B9BA 2WJ7A 3N1UA 3BWAB 2AK4B 1Q3HA 1H9BA 4AZ8A 1FE8L 1IM3A 1N8OE 1QOQB 4YOKA 4AYSA 5BYAA 1QYXA 2VDLH 1G6RL 2AXGB 3JT0A 5CM2Z 1MO3A 2ZXGA 2VM4A 3BQUD 3N9GL 5KOVC 2ONCA 4M6ML 3DR5A 5JHAA 1CFVL 4YHLL 4QPCA 2ZVQX 2CDGB 2OMZB 5JBQA 4MV1A 1JF1B 4MNHB 1R5OA 4PRNB 3L9BA 5ALGA 4D3YA 4W5WA 2YJZA 1U2TA 5FK9B 4W1TA 1HZJA 3O7WA 5FHAL 5D8DA 4CIAA 1NF8A 3KK0A 1LXCA 2P28B 1U93A 4WN9B 1PEVA 1K7SN 3EAKA 5J1AA 3SDSA 4LHUA 3ILPB 1TETH 2Z58A 1TPXB 1SFRA 2Q6KA 4G3YH 2WKLA 1JS4A 5AB9A 1GKUB 4GO6B 5NLLA 3WXMA 1U8XX 2TMKA 2QZZA 4MNQA 3VNVA 1KO7A 1BDIA 2JB6B 1M6NA 2WV9A 3C1UA 1IZ7A 2P40A 4RQBA 3ZC3A 3ADDA 2GFQA 2G60L 3FQNA 2HMAA 4PM1A 3QRGL 3L13A 5LQMA 5EJMA 5E6YA 5DU7A 2C4UA 4JY5L 2H1VA 3WMSA 3SIRA 1Y9JA 3AUAA 4CBPA 1KO8A 2NO5A 3PC4A 5HXAA 1ZJBA 2FPSA 5BVJB 5I26A 4JSVC 2G7ZA 1HL4A 4ZQCB 3RWEA 1G9SA 4QGGA 5EZOH 2GEDA 2COEA 3FLBA 5TVKA 1LJLA 1I6KA 5E0QA 2YIMA 4RZ2A 4YDHB 4HH9B 4Q58C 1VLLA 4G3YL 1L9TA 4X6DF 2ZWIA 3TB6A 2ODIA 3I7PA 4WZBA 3DONA 1RWOA 7REQB 3FBTA 1JN6B 3UWOA 4HDRB 1CRWG 1PFWA 4R5MA 2A9RA 3MYZA 1JA1A 2YFKA 4BO0A 2QLFA 1SOSA 4I87A 2VSQA 4JFZH 2R8YA 1VHWA 4ESOA 4JUFA 4DUPA 3SGDI 4MK4A 1J9EA 2B9AA 1XB2A 2IZ0A 2JJ8A 3MREA 5F3RA 4GMFA 3L46A 1KR5A 1YZKA 3PXAA 4RULA 5FO1A 2MFNA 1SY6L 1HEIA 3RI5K 1JVBA 4WFQA 3W5HA 4TVSa 1TK2A 4MR8A 3HC7A 3RNKB 2QAGB 3AHFA 3CEPB 4Z9AA 2QVCA 5F6HJ 1E9FA 5E6UA 1IAOB 1DQLH 3P3YA 4Y5XB 2P6NA 2ZP8A 3FT3B 2MHCA 1NC2B 4L5BA 5HA5A 3DK0A 1QCCA 2HHAA 2F5BL 2RI0A 3DMHA 3L18A 4YFVA 5FYJU 4KKRA 3JBG7 1DVXA 1V3LA 1ZU4A 1YPZA 4F20A 3RTAA 2MMCA 4L8WB 3MNFA 2ZYDA 3FOAA 1FXWA 2PCPA 4HGWB 4DQAA 2JJYA 1JPEA 4R7DA 3L3DA 3K4ZA 1HSAB 1GPBA 3CCBA 3X1JA 1V9SA 4X1KA 1JRHH 4OUUB 3BMQB 1GPDG 1PTJA 1R27A 1X7YA 2SKCA 4KXNA 5AHWA 3AUTA 2RGBA 2R60A 3HBNA 4B7CA 5THAA 3X1FA 1VLMA 3RV4A 2A0XA 5FGBA 2EE6A 3FOWA 3FO1A 4G9DA 3IPCA 3CNHA 4RMSA 3TBYA 4G8GB 8OHMA 2C7RA 3RI3A 4D0DB 1YJBA 1TKWB 3F5SA 1FYXA 4WUUD 5B3NA 4DRXB 4DSTA 5HUJA 4YRIA 4PG9B 4DLYA 2ZKHH 2I66A 2JARA 5B53A 1YA6A 1ZJWA 3SIWA 2QE6A 2ODHA 2G4CA 5DFTA 5BJTA 1B6TA 2EJ1A 2W0KA 2BF4A 1BCRB 2VHYA 2DH5A 1DAHA 3ULUL 3ZXIA 1XKXA 5B4WA 2DYKA 4DCQA 1WDTA 2DBVO 5AG9A 5DRTA 4NZDA 4COOA 1G5PA 4ZQTA 2FFHA 4FE3A 3VQMA 2CR0A 4A7UA 2GEUA 4XPGH 3UN1A 1A8ZA 1QH8B 1VL0A 3DEYX 2ZRHA 3RGVC 4KH9A 3RT7A 3NTOA 5AR1A 1MI5A 2X09A 2J55A 4PY7A 4LMQE 4JJIA 4I9XA 2A9MH 3T7EA 3CHYA 3IPRA 5FYQA 4BH7B 2RHHA 3OE5A 1N68A 4NJAL 1A14H 1UT8A 1EWTA 4HIEA 5CHNB 3OZDA 4OU3A 2IYTA 1LD9A 3D4LA 2H2IA 5C2BH 1EVZA 1QPZA 1R75A 1SG6A 1PBTA 1NBIA 1SCKA 4XMWA 4HHEA 1KENH 3H3BC 3D9AL 4C7OA 1IWOA 1ZICA 3QVJA 2IPKA 3I6GA 4X8GA 2RI1A 4RK1A 5DWUL 4XH9B 1DVYA 2W7TA 3GRAA 2GJ6B 1LLFA 3COWA 1ZMBA 3ZQ4A 1N6UA 4PLHA 1DS6A 4P5PA 1N4XH 1ND6A 4JO8A 5DNVA 1WU8A 4OHYA 1GA4A 3Q06A 3GUTA 2WT8A 1W2KT 4ELMF 1FZQA 4ZX6A 3U7WL 3WGJA 4ONEA 1S5HB 4KHXH 3N7UA 3T35A 2ZZUT 3OA2A 2EC9U 4JB8A 4LARH 2C4KA 1WV0A 4PZZA 2WRZA 2B99A 5HKBA 5D84A 4MPJA 5ITSA 2BFAA 1QYCA 3C3PA 5K0LA 4RO0A 1TM3E 4LKOA 1AR1B 1CF2O 2H5EA 2OFOA 2XYVA 3ZK9A 4MYTA 1R5IA 1T24A 4UV7H 3BEVA 4EY5A 4LDRA 3IKOA 3K3QA 3MRPA 3TVYA 1I9JL 1TKWA 4JOCA 4GP7A 5DHVB 1TVDA 4MQSB 3L07A 2EIMB 2D7PA 1S6YA 2AH5A 1ODAA 4GKLA 4RAVA 1AVAA 5JOFA 4E0BA 3QIAA 1VDMA 4P4TA 4F8TA 2A38A 5BMFH 2BIOA 3HMWH 1OSYA 5B4UA 4ZVNA 1U7UA 3DOSA 2PO5A 4XHJD 4E88A 4ZNEA 1MJUH 4G6FB 1AJEA 4ARIA 5M61A 3ZHZA 1V11B 3S8EA 1QSFE 2Z9BA 1P7QD 1BFVH 3QUCA 2KKQA 2VABA 3QEQB 5J3HD 2DQDH 3KZNA 5DLYA 2H0RA 3IESA 2PWZA 1YYCA 3UQYS 2HM7A 2I54A 4RZUA 1K0FA 3BLPX 2X44D 4ZD3L 2XDHA 4F3KA 3VFMB 4MVWA 1OF2A 1ZD3A 4QKQA 3FMGA 1P4HA 2IBMA 2CLKB 4ETYA 2FK8A 3MA7B 4HVBA 1W72A 5I7VA 5AJWA 1EJOH 2GNQA 4NNXB 2WIBA 1QZXA 4UT9H 5ERXA 2IPAB 3GZNB 3TCLA 3NBFA 5E8RA 1B8OA 1XE3A 2FUKA 2OP4L 1PAUA 3ZDWA 5TB5A 3DDZX 5M5SA 1JG1A 3K9HA 2P9IC 3FFXA 1YUNA 1VFBB 2R8XA 4YUAA 1M76A 1RZKH 4KIGA 5EU6B 3AKDA 1Z1WA 1VOTA 1IY9A 1FDWA 2YV3A 3T2OA 2G0LA 2B7BA 2F62A 3ULVE 5L2KB 5TS2A 4RKWA 3RNLA 1NE7A 4QGAA 5I9IA 1IHXA 1E9PA 2A4CA 2WLMA 2AGLA 2MEJB 2OEPA 4C76A 2WF5A 4V2BA 2UXFA 1I0LA 5EZLB 4UT7H 1U9ZA 4HJ0D 1LDGA 2QD1A 2FWRA 4FXKB 2ZJFA 4R8SA 1FRGH 5SZKB 3DV4B 4IR7A 3WISA 1I1AC 2VHWA 5I6XB 3HNSL 4JFQA 2B77A 5D5QA 3ARBA 4IYRA 2A58A 3EZ2A 1QIKA 4L8BA 4O2RA 3K70D 3W0WA 3I6IA 2QTLA 5DJZA 2QGEA 2ZBVA 1M2HA 1KBZA 3OSVA 2ZM5A 1S9VA 2DJUA 5K6RA 4CY1A 2EDTA 1LVEA 4YRRA 3TD2A 2ZJ3A 4HA1A 5HDQL 1I7UA 3KW7A 3CN2A 5C3IA 4K3VA 2J7LA 3VYPA 2R51A 3I1YA 1LF5A 2X8LA 3V8NA 4LIQH 1YZVA 2PX6A 3P2BA 4G6KH 1AGNA 3UPCA 1Y33E 4O1MA 3QMVA 1TZKA 2B5OA 3T3MB 4BQIA 1CUEA 3PGXA 2JLUA 3EIOA 2BFFB 3RGVD 5JY6A 2GUOA 3THMH 3LZRA 3RVVD 1U5BA 4Y5VB 1WXXA 3H3PL 5ESQB 2V5UA 1U8OB 4XXCA 1E65A 2J6IA 3FTFA 2J20A 2OLKA 3DV0A 3VDAA 1U3HB 3OIYA 1N2RA 4MLCA 5LMNB 3EXEA 2QVMA 1KOAA 3O4VA 2XITA 4CMMA 2GXAA 1V43A 2VXBA 1FMLA 4PX5A 4M7PA 5GS0D 3MPUA 5EP3A 1YN7B 3L9XA 4RV5A 2XV1A 2FYTA 3EG6A 5IOKA 3C45A 1BRMA 4EEEA 3RI5F 3SQOA 3L16A 5FPPA 4JX8A 3B9KD 3ZHVA 2V58A 3RVXC 3H2YA 2AQSA 4UOW0 1MLBA 2QGDA 2YOCA 1ODCA 4G9GA 3NHAA 2BT4A 4TZ0A 3ZHSA 3AW9A 4P0PB 2FOXA 3KTOA 4PVDA 1I2CA 5CK5A 2Z6FA 3GLIE 4DVGA 1M0EA 4ZVSA 4Z77A 2OLJA 2R66A 4LDJA 3D4OA 5E8JA 4D99A 1T0PA 3LPLA 4LI0A 5FHBL 3WE6A 5AW4A 4TTJA 4PY8J 2WKOA 2FJ0A 4AUUA 2C9YA 3AL3A 1FVEB 5KIAA 4GW4B 1SC1A 1K66A 5TF4A 4B6JA 3NBXX 5AVKA 3URMA 3ECCA 4HWUA 5EN4A 4I3FA 4JP2A 3L1UA 1EE2A 5ILTL 3VG9B 3HI1B 1MX1A 5J12B 3EH1A 5EEHA 1EK3A 3HI6H 2Y7OA 4YXHL 3OUUA 5M7QA 3E9EA 4BX0A 1P9MC 4OY3A 3U1TA 1MAHA 5T1MB 4JPKH 4R3SB 3MTBA 2C2XA 2DQEH 1Y1TA 3WO3B 4N3BA 1XGPA 1ZHNA 5ILGA 4JM2B 1A6TB 1YJDC 4MLZA 5FLEX 3WJAA 5LR6A 3QXHA 3SKJL 2ZVDA 1T0JB 4CF5A 1FL6A 3C8KB 3HUUA 1RQ2A 2N46A 1KXTB 2HT2D 5TVGA 3Q8XB 5E8OB 2DIAA 2Z3FA 5AAPA 3OR7A 1UXOA 2R2CA 2XDAA 1NMYA 2VJQA 2HWZH 2ZUFA 4LOAA 5T1JA 4E5KA 2HK8A 4CKBA 1EXDA 3IAAA 4K4KA 1C3OA 3GVPA 2F19L 3A1NA 4LV6A 5HY9B 1RCYA 4GFTB 3SDXB 3ULUE 2ROYA 3CD4A 3L6BA 3AY4C 3BEOA 2K4AA 4A39A 3LHSA 2PFKA 1VPEA 1IAMA 4OGZA 5LMZA 1ZS8A 4RF3A 4RX4A 4EHFA 2YMQA 4EMBA 2A83B 3OU2A 1PFUA 3DOUA 4Q1VA 2DJ5A 3FCGA 4TUYB 1MX5A 3BM5A 5JNWA 3SLGA 1MHPA 5DXJA 4RZKA 3ZHBA 1HX7A 4JM2C 1FN4A 1B93A 2EVJA 4GMXA 5ABPA 4TUOA 1YG9A 3OX8B 5LN8A 4PRHA 1IE5A 5IVKA 3VISA 3T0DA 4YDLB 3H9CA 3HDQA 1KPIA 3X1NA 1PEAA 1WP9A 4R98A 5KTSA 5DRNA 4ZMVA 1EIBA 5D1XC 4S12A 4PJFF 2ATEA 4TYUA 4J2XA 4PGFA 1UCFA 2Q45A 5IUKC 3K5IA 3D6FA 3L0IB 3FO2B 1Y3CE 4D7AA 3QKSB 2IUUA 3L1KA 1W2WB 4PRNA 3BDXA 3U6BA 4JZOA 1BE0A 1FHGA 2WWTA 1TVBA 2H4EA 1J1OL 1KYOK 3BIKB 2CK3A 2XX1A 1T9CA 1U41A 3UADA 4AYGA 1GA1A 4GXNA 3D2UB 5G5DA 2VN4A 4UQ2B 1SKYE 2AD1A 2ZICA 1KYOJ 4ADJA 3CG8A 5IK2A 4M0EA 1R5NA 3HDTA 4WTXA 1WHTA 1DPGA 2CRMA 4PQEA 3BIXA 4UHJA 5DM70 2RFXA 3ACCA 2I0RA 2NY6D 2WNWA 4V0OA 1KJ3L 2D7DA 4ETQB 3LN4A 3MYYA 2GPSA 3LC7O 3UH1A 5DVLA 4EJSB 2HRRA 3WO4C 3BP7A 2FFQA 2X5PA 4OFXA 5DBEX 4BO2A 2F2TA 2WQAA 3UBXB 1HXYA 3EYSH 2O8BB 4EO4A 3IQWA 1OGJA 5E4JA 1U9CA 3ANMA 1U8NA 3S2AA 4IBWA 3QP9A 4EMZA 4DKAA 1NFRA 3MR9B 1YZHA 3LKQB 3SDDB 2BZ7A 3I5XA 2JS7A 4IBVA 1B6DA 3FW6A 3ELQA 4I0PC 4JQIL 4KUZL 3T7CA 4BEBA 3DX9A 2PZLA 3R6GA 5ICXB 4BO3A 4QIRA 2W4QA 2V17H 2VAAA 4NX0A 2R7AA 4B6OA 5HI3C 2YRXA 3EN0A 4WK2B 5KJEA 4FFRA 1UDBA 4FJYA 4B3TB 4LO9A 5M34A 5EDSA 1YECH 2ZYGA 1KGUA 1ZV5A 5FYJH 3VAZA 5DEZA 2A9PA 1WPGA 2XTJA 2NTEA 4FNOA 1XZLA 2B5MA 2WM2A 4TTTS 4C87A 4JVMA 3HWWA 1ITZA 1TR7A 5EPMA 1BA3A 4LV8B 3QV1A 1P2SA 2VH5R 5DBGA 3BF7A 2PMCA 4HIXH 4S1DD 1OV6A 5I8OL 2OGUA 4C55A 4GX1A 4OXXA 4HRVA 3FUHA 3JAKA 4BLRA 5D93C 2VDOL 2XN9A 2IHBA 5IR1A 1T5SA 4AYBA 3I2GA 1BOYA 1F9EA 4IXWA 3QDHA 1FFSA 5I1JH 3JTEA 2GN2A 3P4OA 4O5AA 3PXDA 4R1NA 2JD2A 3CN9A 3D43A 4C0WA 3DWIA 3O6FC 4NO5B 1J2UA 3U4HA 3P73A 2LTQC 4GECA 5EO9B 2BTQB 4RCZA 4E9SA 1YS4A 4LJ5A 3KYAA 4E46A 2FRDC 5FL3A 1D5RA 4JKYA 1GDTA 1G18A 1IBHA 5ID0B 1QCYA 1Y7VA 2DJMA 3QQNA 1ZA3A 2HK7A 5WRFA 3AU9A 4AGNA 1PK9A 1LSSA 1D5BA 3KKOA 4PGCA 4UMDA 3ZI0A 4DLSA 2NQ2C 2RALA 1RWXA 2WM8A 1YY8B 3UTDA 5EJEA 1PPIA 3ZZLA 2O30A 2EDFA 4N5HX 2V8OA 3KQNA 4NZRH 3SDZA 4NC2B 5BRNA 3S5JA 1T9AA 1A6WH 2RB5A 6REQB 1DFBL 2B5LA 2BVNA 3IXLA 5DV9A 1BDBA 2DFPA 4RXTA 5E5RB 3R8FA 1MRSA 3WWYA 1EUUA 1MWAH 3GJ8A 5B5SA 1QZ3A 4GI6A 3VGAB 1S3FA 4PC2A 3ZU2A 3NVAA 3OKEA 1QG6A 4N48A 2YXPX 1T04B 4M4PA 2NR6A 1H05A 2K45A 4EZMA 1KIFA 5C5EA 5CLHA 3DAYA 3EFBA 4UHHA 1UPTA 2QMJA 4JGUA 4WEOA 5EZPA 4LSTL 1C1XA 3EZ9A 5DLEA 1X80A 2D2IA 3RASA 1ZX1A 1RU3A 3ZKAA 1HKLH 1UKYA 3OJOA 3GLFA 1QHEA 2B0CA 4PNPA 1PT6A 2ZWSA 4GWGA 5CK4A 4PZLA 4YJ3F 4BZQA 2B94A 1JYSA 1DTEA 3EJYD 2CHFA 4DQOH 1GGFA 3W5VA 3DCYA 1A95A 1H6UA 1UYWL 3U4MA 3RSGA 2FYVA 3PD1A 4EBQL 1ADQA 2R59A 3WEXA 1ZTXL 2GTWA 4EGCB 4DWOA 3CU1A 1BCSB 1RAIA 2NUAB 5DD3L 1G0YR 2DIBA 4EQ6B 4AM0A 1PG7L 4G83A 3HBFA 3TLGA 1V5EA 4YLBA 2IDUA 2YYZA 2NTJA 3X3HA 3PGDB 5I1AB 3U1BA 1MWOA 2CFSA 2F3SA 4QYMA 3B2UD 4EH1A 3UWPA 1NVTA 4QTZA 4WZAE 3X3FL 1E6UA 2Y99A 1EANA 1F6AB 4IGBB 4ZJ9A 4TM7A 5AKEA 4MI9A 1QHSA 2Q8BL 3I74A 3CVBA 2DYSB 4B4OA 4XH2A 4YR6B 4E0RB 3B3BA 3HE6C 4NC1C 2QPUA 3UANA 1WB9A 2LHAA 2A1IA 1EH9A 1GWNA 4Y6PA 3VSQA 1RMYA 3U3RA 2E27H 3OPMA 2IDZA 1LDMA 2ZJ6A 3K09A 2VDQL 1UUNA 4EF5A 3G6WA 2LV4A 4LFHG 3KR9A 3A4AA 1WX1A 4XD2A 2LFEA 1F3JA 1PZ5A 5D7SL 2YWJA 3L81A 1Q57A 3G5VA 1U3UA 2J6EL 1OXBB 5C0EB 4BFKA 4P4KD 4JBGA 2Q9OA 5LJLA 1A9QA 3SX0A 4OCYL 1MCKA 2GBFA 1W75A 4UTNA 3EWIA 4KMLB 1W16A 3IFOA 3RFCA 5K3OA 2H1IA 4JJGA 2JGRA 1D9KC 2P6UA 5H9WA 2NT4A 35C8L 1IZZA 3TBVA 4GP6A 3CZCA 3FB6B 3DEFA 1UZ6F 4QBFA 1BG6A 3I9GH 4URWR 3STWA 1F13A 3O95A 2VDPL 1BKYA 1Q12A 4BC1A 3FPGA 4JLOA 3M6FA 5E9DA 2Z4SA 3QELA 1DHRA 2H0FA 3CX5K 1QSVA 3WTCA 1D2AA 1B43A 4CM7A 1I8IB 4O02H 1FRQA 4A10A 3FGNA 5EXTA 3R5FA 4IDBA 1T8UA 3IQDB 3RE1A 4JG0H 4JT8A 4FSXA 4ND8B 2Y7NA 1IIRA 1KB5A 2H2FA 2YA2A 4G4SO 1T20B 1TZGL 5DASA 5D55A 3DGEC 4PV1C 4H1VA 4RTSA 1BXRA 3S3CB 5D6CB 3KLHD 1EAQA 1ZVVA 5JFGA 1IOZA 1M2OA 1NCBH 2EF0A 2JJWA 3MWDA 3PE4A 4NNJA 2OO3A 3D3VD 1GMEA 5E6ID 2H1XA 2CD7A 5I8OH 3KZVA 3OX3A 4UIMA 1CBUA 4PSKA 3L1IA 2ZRCA 4L37B 3ZL4H 1Z5HA 2J6HA 1O5OA 3I7OA 3E4DA 4QEKA 4R16A 5CCXA 2RGGA 2KDYA 1DKPA 3NR2A 3QF4A 1RLWA 3AIOA 5KYUB 3DX2A 2J5WA 3HY3A 3MVEA 1UXLA 1TZJA 3ZJYA 1QSEB 3OKNA 1G7JA 5EO1B 4ZPTB 2VMEA 2PY6A 3UHFA 4QPPA 1SB9A 4K2UL 4TL9A 5CAEA 4Q34A 5JYEA 2Q8AH 5JNUA 1W0JD 5LDHA 4L2LA 4NSKA 3SHQA 5ETJA 1OHZA 3GLKA 1CGSL 3VOBA 3KXKA 3DTDA 4K3JH 4O9HH 3ODTA 5EARA 2EDYA 3FMGL 4GUQA 2AEEA 2M1ZA 3LMKA 3GRPA 1WBXA 3L3JB 5IT2L 4UHFA 4YGYA 3RU7A 1FYFA 5G0VA 4P22A 1FNNA 1KTJA 5K9KA 5M5RA 1WWKA 3K0KA 3PX3A 2DTSA 2H4XA 3R3SA 1W72H 4N2CA 2QQKL 4OM1L 3WLLA 1K5NA 2VP3A 1UBEA 1MIML 3I9FA 1CFSA 4F3FB 2GCYB 5CYOA 3AF4A 5L3QA 5E3HA 1MO2A 1IT9H 3WB0A 1CLOL 2JXMA 3HBZA 1YEWA 3Q41A 1OAKA 4MI1A 4NFHA 3FO0L 5I1EH 5KUKA 3ASNB 4FKMA 1HN1A 3F01A 3KEFA 3MRQB 5ACZB 4GW5A 4L6IA 5ERWA 2IOFK 1LP9E 2H47C 2G4GA 2RDMA 3FBGA 2YXVA 3QHAA 3WOVA 4PC0A 1HSOA 1XIVA 5L45A 5EZYB 4KJQC 4JQYA 1SWVA 2ZOKA 2P5WE 5KI6A 1E89A 2FEOA 2C3XA 3I4FA 2HWKA 5IEHA 5J2TF 5G2OA 3VV3A 2I4MA 4TLDA 1L5MA 4FZJA 1KFAL 5HQGA 3F3MA 4HJRA 1G7CA 5D8JL 5AZUA 2D4HA 1HXMA 5FULA 5KNBH 1L4KA 3BAYA 3UVMA 4HX5A 5JW3L 2NZ8A 5TH2A 2R68A 2PBFA 1HV8A 4LNAA 1U8IB 1Y4ZA 4H8QA 5G4NA 3IGAA 3HCWA 3KV3O 1RZIB 3NCYP 2ATKB 3AESA 4OU4A 4U1RA 4TRNA 1TD1A 3L3GA 3L0ZA 4GGMX 2C2GA 4E5PA 2QSYA 2XQJA 3QY9A 4IJ3B 3C8HA 3G9ZA 5E9DD 4I99A 3UP1A 4S11A 4OMCA 3DGDA 1QG0A 5GISL 1MG3A 3PKZA 1BEYL 3NFPA 3ROGA 3ULAB 5SY9A 3BGVA 2H0JA 5HQTA 4RIEA 3KWTA 5BUAA 3HAEA 3UATA 3GC6A 3WENA 4PAQA 1FQWA 2VC2L 3Q6FA 2X13A 5CEXB 1KJMA 4DEUA 3RTLA 2RHBA 5DNDA 3NIWA 4GDMA 3CPLB 5IN5A 1KPVB 3QG6A 4NRZA 1O6SA 4GIAA 2JELL 3AETB 4MDEA 4M03A 5T3ZH 2HYEA 4GMSL 2AK2A 4BMXA 4P48A 1TT5A 1L5KA 1GPLA 4JJ6A 1PO7A 1UANA 2Z5GA 4DA6A 2Q3EA 1C5CL 5K05A 3THWA 3HFGA 5KYXA 3QJTB 4ZFQA 4X8XA 1H6CA 1V4NA 3SC3A 2DB8A 1J0KA 4YP0A 2CFOA 2VDNA 5KSUA 4CVZA 5C3MA 4GW5B 4POYA 1ZESA 4TQGA 5HP4A 2UYGA 3AJRA 2O07A 4M6WA 3K0HA 4G82A 5EU3A 3NKLA 1T2JA 3GT7A 1HKUA 1G7LA 4WNQA 4TXLA 3WUWG 5AK3A 4CI2A 3CJTA 3ZQ9A 2ZANA 3I1FA 1OZTG 1GPUA 4J86A 4WL0A 4AJPA 4MA1C 5H2BA 2FATH 3MFFB 5KS2A 3KDAA 2NYVA 1TQCB 2HXCA 5GSVA 1MFBL 4NQXB 1DVRA 4I18C 2VAVA 3HMQA 2WXNA 3P2OA 2Y1CA 4WJKB 1U31A 2DWOA 4JITA 3FOMA 4LHXA 4Z3TA 3L4BA 4R7NA 1H4QA 3KVQA 1IBSA 1VE7A 1WABA 3MUEA 4BTVA 2FX3A 4HUQB 3ESMA 4Z0XB 2ZJ4A 4TVKA 2GM5A 2HK6A 2BVTA 4HB2A 1IGJA 1SCIA 4JKIA 1N2OA 2E6PA 1REIA 2PH5A 3CZAA 4WMLA 4L9LC 3B85A 5I01A 3L84A 2EVHA 1OQXA 4QO1A 4IEFB 1VHJA 4OA8A 3O0RH 3OH8A 1H69A 3ZV5A 3QNXB 4Q3NA 2Y66A 3H2IA 3K6RA 5EHIA 1WRBA 1J0BA 2NUPB 4X6FA 5CT4A 5BMVB 2K9UA 1WMDA 2VZ3A 2I4IA 3OIFA 4HWEH 1GGHA 4MJXA 2A30A 2WNSA 2XX0A 5FWQA 4C7VA 3UERA 5CSGA 1KMQA 1WPCA 1QKKA 2C3HA 2ICWA 1FS5A 2I2FA 4G0PA 4TNWF 3JYHA 1ZGAA 4CM8A 1QRNB 5C1PA 1CT8B 1PE0A 3U4BH 3H8JA 4N0DA 2AEQH 4Y9GA 1UC9A 4GOSA 3QV2A 1QBGA 1LY1A 3IMGA 4PJ6A 4CMJA 2C78A 4N0UB 1Z3RA 5F96H 3HL0A 2HZBA 1VFOA 1UH2A 2CVHA 4F8QA 3U2SA 3VH1A 4TLKA 4UTBL 5FEMA 1QWSA 4PC7A 2NNCA 1F18A 3R7WB 3AESB 2VJPA 4PYGA 5E2UL 4WNCA 1E2QA 1Y98A 1P1FA 1ULSA 3AR5A 4PLKD 2RJNA 2XXFA 1XZCA 5EZIL 4WSOA 1VYTA 4I0KA 4WESA 3EZLA 4Y19A 3NUQA 4MVYA 3ANYB 1ASOA 1ZT1A 4UJ5A 2P35A 1JGDA 1TZAA 2YMLA 2OCJA 4N0YL 1ZL2A 1F56A 2G1AA 3DKKA 2FSHA 1R9NA 3NBUA 3QPWA 4Y98A 1PSZA 2VZTA 3RK1A 4FYQA 3IWVA 4FOTA 3DJSA 1M2FA 1UH5A 2I4TA 5JCZA 1ZGJA 2O52A 4UUNA 2L0XA 1JV2A 1ZGLM 3NTRA 3R9KA 1AGBA 1UDAA 3VO8A 3RUAA 1KZQA 3SPGA 2J2ZB 2R6CA 3H5RA 4G9EA 4F9PA 1M8PA 2F54E 2A0UA 1E50A 2GEBA 5SY4A 3HJAA 1T83A 4Y1AB 3SR3A 3OF5A 4GNKA 2FEDC 1L4BA 2XMSA 3SGDH 3N8IA 4E08A 2VHXA 1NLFA 3U7AA 3CQFA 4G1VA 3NRCA 1SCNE 3ZY4A 1OW0A 5ICZA 1PJ9A 4Z95H 5J89A 1Z3IX 5EUKA 3L45A 5CXCB 3WLIA 3FCOA 1N2HA 3ZJVA 1HQRB 2GXQA 3GBEA 3FFAA 4NO3A 2PYEA 1J2RA 3U7WH 3LP5A 4HWBH 4PRPE 5AVJA 4CG0A 2B1IA 3T0AA 4KX5A 4B7XA 4IRMA 1E3EA 4AQ1C 5JCOC 1Y5NA 2BZDA 1T0HB 3AUVA 2QTMA 1OE0A 1GIGH 1RE1A 2AXNA 2PWHA 3A6DA 4K94C 3BFVA 2GM4A 2ZFUA 3PP3H 4XCFL 2AC0A 2H8PA 3FDIA 4XPTH 4OQMA 4HWRA 2EBUA 2Q50A 5I0DA 3AIMA 3T77A 4NDMA 2P80D 4ZW8A 1N8SA 3U4IA 2J3SA 5A3QA 2BJHA 2HQBA 2OSXA 5J6GA 4IBOA 5FH9A 1L3IA 1QVAA 1S7TA 2WLNA 3TBVB 1KEZA 1XJQA 4BKLB 1GGNA 1DIOB 1AACA 2R1VA 2ZBGA 3N9GH 1U8EA 5JSYA 4FG4A 2WJPA 2O4UX 4RA6A 3KNBA 4L2YA 4R3SA 4GBXC 5HDOA 4FERA 3EDRA 4OB7A 3K4DA 1IBZA 3TE6A 2CDRA 5IG2A 4HUQA 2IAAA 5F76A 3FSEA 1FJ1B 4MJHA 2C00A 4I79A 1E1CA 4S2EA 5JSZA 5FWYB 1BAFL 3H9SA 4WQMA 3K32A 4K46A 3MCG1 4MWEA 2FSGA 3UIYA 2VR6A 1R9GA 2WBJB 1J21A 2OAP1 3MRSA 2WINB 3DL4A 2ZIAA 2DBZA 1JOFA 1RI6A 1NJGA 2D0FA 4FYIA 2PBRA 2PW1B 1SN7A 1UKAA 1WZ1H 4N3CA 4DIUA 3J80A 2GK7A 1FFQA 4O4JB 3BKYL 5EMJB 3AY2A 2QY6A 3NMUF 3WMXA 4GRLD 1RABA 4QEGA 3FVWA 4CV2A 3A70A 5TQ2B 1B0UA 2G9UA 1UOEA 4Y9DA 3P9IA 4U1LB 3CH5A 3KXFE 2Y4SA 5ALMA 1X1TA 1BZYA 5IKXA 4GLJA 3KCPB 1F2QA 4ZX5A 4Z95L 2VE6A 4J3OH 5I9SA 2IUTA 2E5EA 1A4KA 4OT1L 3MODH 3T6WA 3RWIB 3F5WA 4A66A 3T8XA 3MOBH 5DJXA 4WZ9A 1YR8A 1JIVA 1GARA 4IBTA 1A2BA 1HWYA 1T9DA 5K0EA 1U8YA 3K0WA 4AQAA 2CT8A 4FINA 3L1OH 3S3PA 2WSDA 3NJVA 2GQHA 1XTUA 4CMBA 1XPUA 2CDEB 3BKCL 4E70A 4DANA 3QIBC 1H3XA 1Z0KA 2IALB 2R0QC 1QNZH 4KR6A 1FVFA 2XSKA 4DABA 1AZRA 3DPBB 4OMDA 5AUPB 2R47A 4RIFA 2WIJA 1Q9WA 5E03A 3C6QA 1R5VB 4DW2L 3TTUA 3IMSA 4N8VG 1RQGA 2PGNA 5CNHA 4CMHA 9ABPA 4Y6LA 4KJXA 3L7LA 3W6ZA 2IPTH 3MCUA 5GS2H 1FNDA 2HSZA 3A3NA 3S37X 4I8IA 1XTZA 1Q0PA 2W59A 4HNGA 2GI7A 32C2A 1KI2A 1K75A 5DT2A 2FPWA 3GLEA 2YARA 2AX3A 1CYXA 1YK1A 3QU4A 1LI5A 3DP7A 1UOPA 1IKNA 4M4SA 3K70B 2RK3A 2VEOA 4KVPA 3WNJA 3D3VA 2D1TA 2P5EE 4E94A 2WMDA 2V6GA 2CC2A 4ZHQF 4MI3A 3DD5A 1RUPL 2GJ6E 2YXWA 2O2XA 3ORQA 5CA1A 4NBWA 2O48X 1EXMA 3EI3A 1YB6A 3HVUA 1MG0A 3KQKA 4D9LL 1LMIA 4ZGBA 5FDYA 3INNA 4A8JA 4A67A 3G5UA 2FSSA 4AC9A 5KOYA 5FDWA 2PZEA 5DTFB 4BM7A 3EXJA 5KEZA 5CDYA 3EJSA 1KELH 4FQHA 1M7DB 1T21B 5F3HA 2BTOA 2AJZB 4DMRA 1A96A 4GS7C 5AD0B 4WUVA 2BGJA 4QRFA 2MYTA 4WJ5A 3TPKA 1EXHA 2V74B 1NC3A 2Y3NA 3FNFA 2AI3A 1DWPA 1FG9C 4K03A 3NYRA 2AQ5A 1XF4A 4NP6A 1Q1AA 2ONKA 2Y06H 1RYDA 1VJ0A 4XA8A 3QYFA 4G7VH 3PKIA 5IB5A 5CN3A 4TNFA 5K3EA 1ZD6A 5DS1A 1UWGH 4R9UC 2VPWA 1KGXA 4NICA 5FR2A 3ZHKA 3D0VB 2RH4A 3VYUB 1HTTA 5C2UB 1C30A 1W44A 2A5FA 5A5DA 3GPBA 3NORA 2IITA 5LDGA 4LSSL 1FFXB 4PJ8B 3E6HB 5DGXA 4HS3A 3V9AA 1JKJA 4YHHB 1E5DA 1UC6A 3JTTB 5E8EA 5LNEA 5LNGA 4D9NA 3EJYC 4G8GE 1MLBB 1ZEJA 2OTUA 2ZCKL 4QYOA 2HREA 4GF5A 1GCGA 3VPGA 4HUUB 2H1HA 5FBQB 2ZQ5A 4OJKA 2ZJ0A 5CILH 3TH3T 3D1JA 1DOAA 2NTSP 2J88L 1F8TL 5IQ7L 3V8EA 4AZVA 2R0ZH 5GXIA 3GW8A 3AMLA 3L05A 2ZYIA 2AW2A 1MCWW 2VQ1A 5C0CE 3MJ9L 3F58H 4M9UA 4X94A 2OPHA 3LWDA 4Q4IA 3D0LA 4IDQA 2VKQA 2CWDA 3LKPA 3FRPA 3O6MH 4LJ6A 1KEPA 2H00A 3IAM6 4LJ8A 4B3HA 3DNPA 1DEKA