3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
b'FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
1XUOA 4MMZA 2VDMA 5E6SA 5E6RB 3ZE1B 3T3MA 1FNSA 5KYXB 2QTVA 4PN7A 4UM9D 3K71B 1TYEA 5KYXA 5KYYB 3T3PB 1Q0PA 2B2XA 3NIDB 1M2VB 4CN9A 3T3PA 3N2NA 1SQ0A 5KYYA 4CNBA 3NIDA 1IJBA 3VI4B 1SHUX 2VDLA 1M2VA 3NIGB 3K72A 3VI4A 2VDNB 4Z7OB 1U0OC 1U8CB 1MJNA 1YVRA 4WFQA 4G1EB 3F74A 3EG9B 5FFOA 3NIGA 3M6FA 1SHTX 2VDNA 1QC5B 4WK0B 4WJKA 4Z7OA 4Z7QA 1T0PA 3EFOB 4G1EA 4HQFA 2NUTA 1AO3A 4C2BA 3BN3A 2I91A 3ZDZA 2I6QA 5KYNA 2VDMB 5KYUA 5FFGA 3T3MB 1MF7A 1PT6A 1IDOA 1LFAA 2P26A 3ZDYB 1TYEB 1XDGA 1XDDA 1U0NA 4UM8B 3EGXB 5HJ2A 4HQLA 2VDKB 5E6UA 1PCXA 3ZDYA 1JEQA 3ZE0A 4XW2A 3RAGA 5LN1A 2WW8A 4UM8A 3EGXA 2VDKA 3HI6A 2XWBF 3ZQKA 3QA3E 2VDOB 2VDLB 1N3YA 2I6SA 1UEXC 1T6BY 1PD1A 3K72B 4DMUB 2VDOA 1AOXA 1RS0A 3FCUA 1RD4A 1L5GB 2NUPB 1JV2B 2VDQB 4WJKB 4Z7QB 2NUTB 1BHO1 1ZOOA 1L5GA 3ZDZB 2VC2B 3K6SB 2NUPA 1JV2A 2VDQA 3PPYA 4IHKA 3PPWA 4F1KA 1M1XB 5KYUB 2VDRB 5KYWA 3TXAA 3K6SA 2VC2A 4HQNA 3IJEA 4NENA 1MQ9A 3BQMB 1DZIA 4CN8A 1M1XA 5BV8A 2VDRA 4BJ3A 1MHPA 4UM9A 1QCYA 3ZDXB 1CQPA 5E6UB 1JEQB 1MQAA 3ZE0B 1BHQ1 2ODPA 3ZDXA 3E2MA 1M2OA 4A0QA 4G1MA 1N9ZA 3NIFA 4HQOA 3EGDA 2WINI 1ZOPA 4F1JA 3HXOA 3EH2A 4HQKA 1DGQA 1PD0A 3BQNB 1M10A 2ICAA 2NVOA 3FCUB 1ATZA 3V4VB 4MMXA 4MMYB 2IUEA 3Q3GE 5ES4B 3EOBI 3TCXB 3V4VA 4NEHB 2VDPA 4M76B 4MMYA 1M1UA 5KYWB 1JEYA 2XWJI 5HDBA 1FE8A 3IJEB 4NENB 1JLMA 2O7NA 4IXDA 3TW0A 1AUQA 3TVYA 3HXQA 1YVPA 4UM9B 3FCSA 2M32A 1NA5A 5HGJA 4Z7NA 4WK4A 3EH1A 3V4PB 4IGIA 4JX0A 4C29A 5E6RA 3ZE1A 4IRZA 4G1MB 4C2AA 3NIFB 3ZE2B 3EGDB 2ADFA 3V4PA 3K71A 1MQ8B 3ZE2A 4O02B 3VI3B 4WK2B 3PPVA 4FX5A 4O02A 3VI3A 1ZONA 2ODQA 4MMXB 4WK2A 3IBSA 3EOAI 1V7PC 2VDPB 2XGGA 1RTKA 1U8CA 1JEYB 1IJKA 5HDBB 1OAKA 3EG9A 1CK4A 1IDN1 3GXBA 1QC5A 4WK0A 3EFOA 3FCSB 4MMZB 5E6SB 1RRKA 2X5NA 3F78A 3PPXA 4Z7NB 4WK4B 4JDUA
chains in the Genus database with same CATH superfamily
1TYJA 3CZAA 3KJ4C 2CN2A 4YDRA 1C1DB 1B0WA 5JFOA 1F4LA 1ZXBA 2P78A 3PQFA 5B58T 3RWJA 4AKOA 3K31A 2H1RA 3FRPG 1KJVB 1ZHFA 5DWQA 1QHFA 1YFLA 1WWBX 3SODB 1O0BA 4L37B 4OU5A 1PNOA 3TPZA 1EJ2A 3UTQB 4WWPA 5D7EA 2QYHA 4RF4A 2JFFA 2EDKA 1ESMA 3C4VA 3FM9A 3FQNB 4AP5A 4ZN4A 2FU5C 3LYHA 4FE9A 5F2OA 3Q8KA 2FWPA 4N76A 2X4GA 3ATFA 2ZI7A 2N47A 1NM4A 4Y4HA 4Y1GA 2O8BB 3BQMB 4ZFGL 5FB8B 4C3ZA 1Z1WA 7MHTA 4WW2C 3KNBA 2QAIA 1F6LL 4RBNA 1LQTA 2W7TA 3E0CA 1U5CA 3RYIB 2CDNA 1YS6A 2OMTA 5IF3A 3KHOA 5T3XD 4DP7X 4MVCA 43CAA 2ZXFA 2MQGA 2XQYG 3NG5A 1Q0ZA 2J9FA 4P9NA 3VB9A 4LAFA 5SY9A 3TCXB 4C4UA 4D8UA 2O7NA 4WN9A 2EYSB 1J5XA 1V3KA 1IGYB 4D7BA 1NVDA 4MEAA 1AXSB 4NQRA 2WQAA 1U8KB 4S2UA 1QDUA 1XGPA 4ZPVB 5IKOA 2XYCA 3ZE1A 1J1UA 3WS6A 4ITUA 4M36A 4BMNA 2GZDA 2J9ZB 2ZJ4A 1J9SA 3QKUA 4TMZA 3GJFB 2GTIA 3C6MA 5L8VA 2A84A 1XT5A 1QVAA 4Z7AA 3A24A 2GERA 3HZVB 3OE1A 5TT0A 4YPJA 2GJ6E 2UY6B 3DXAA 4Y6SA 2XL3A 3PA6A 1YAIA 4D4MA 2EIDA 4JVMA 1QONA 2AP2A 4IHQA 1KFJB 5CURA 1W4LA 1ZM7A 4JO1H 5DEZA 4TUYA 2GD1O 2XTJC 3OIWA 4TLLB 3GIDA 4GRLA 3SE9L 3DD5A 3DG9A 1JUDA 4LXYA 4LASL 4JMXA 3BN3A 5IMMA 2ZULA 2FSUA 4N4YB 2BXYA 4ZPJA 5E03A 5EQJB 2BWDA 1AP2A 1YE3A 4S1RH 4P5TC 5TDHB 2HP4A 3ZEAA 1JZJA 1YU6A 3UW3A 1GDTA 3HC7A 3D7NA 1YUHA 2C84A 5HGHB 5DZNA 5FKJA 3SDBA 2CMGA 1EQAA 4YJZL 1M6VB 1MT3A 2QRVA 4WI0B 3ND8A 1J0CA 1L4KA 4I13B 5F3HB 4U49A 4WKOA 2BIMA 4IM7A 4TTAA 2WMNB 4KTTE 4AMZA 2GXQA 1VTKA 5DTRA 2Q27A 3U4BL 3B83A 3Q9PA 5TEFA 1VFAB 4Q4IA 2B1IA 3D0KA 4UCFA 1OV4A 3QYNA 1Z5OA 4HIIA 1OLXA 3ISYA 3WE7A 3PDHA 1E2LA 3FTNA 5AKJA 2R6DA 4JEUA 1FJ1A 4W7IA 4S11A 1SHJA 1TMOA 1IE3A 7CGTA 3F3KA 4YV7A 1A6AA 2EQDA 2CVFA 4NOKA 2HVBA 4E30A 4Z3JA 3TV3L 5D7LB 1L4MA 4AY4A 2OBFA 3B9AA 5BCAA 1NF3A 4BE4A 4K15A 5E6YA 1HYHA 3Q41A 4R16A 1B8VA 1ODSA 1DRJA 2WC1A 2PMBA 2NY4D 2D0PB 2NYYD 4G6ML 5EULV 2ZJ7A 4YT4A 1EHXA 1QYGH 1DPFA 3DFKA 2J3IA 4MQSB 3H7AA 2D1SA 3VWKB 3GT0A 3KPQA 1I4WA 2EP6A 4FQ1H 4LTDA 3JTSB 3RKDD 1P5UB 2QGEA 4F1ZA 4WAUA 1DUSA 2CNKA 1E3MA 1YCHA 3ZHVA 4ZQKB 1R0BA 3AL2A 5IVHA 5HKKA 3GMSA 4OFIA 1YAZA 1AQKL 1DBIA 5ABAA 4U5QA 3OJVC 4PJCF 1DZ3A 1LPOA 3ZNQA 4AZ0A 3E03A 3NIFF 3WK4A 2F90A 4KGXA 1KB5L 3GGWB 4IGBC 4MCYA 1J10A 3VX4A 4F04A 5C8DA 2ATIA 1VFOA 4NZPA 4W5WA 4PSWB 2ZX8A 3LW7A 3S28A 2XZAH 5HGDB 4XBPA 2J88H 3X11B 4EUPH 3MV7D 8ATCA 3WLPA 5ED4A 3LN9A 4M6AA 4TLKA 1WUYA 2AOXA 2Y71A 5D87A 4D97A 3AZOA 4KO5A 4M8IA 3K6JA 3RL2B 4FQ5A 4GYBA 1A47A 1GS8A 2DWDB 3MTRA 3RB7A 1KI6A 1OSEA 2PM6B 3SBOA 1JE0A 3N3AC 1ODFA 2ISCA 3ULSA 2G2PA 4LPWA 5FYJL 1I6MA 1I7SB 5HP4A 2X44D 2HN9A 3LTVA 3KYDA 5F9AC 3VXMB 4P2QA 1JIVA 1UKZA 4W5JA 4BVJA 1GCAA 3GJQA 3RTQD 3SR0A 2V0GA 4N48A 1JA9A 1N0WA 5D84A 1E0SA 2F1RA 4KJWD 1OAYH 1O0SA 1FH2A 3GLGA 3P94A 1BC5A 3K09A 2C42A 1W1IA 3WY9A 1CF9A 2JE8A 4L8SB 1RERA 4WECA 4U1NA 1D4OA 3V7WA 3RIKA 3RFTA 1RUAL 4QHPA 5CXQA 1HSBA 1IXSB 2ZS7A 1F4WH 4EJ1C 2HRCA 3MJEA 2FE1A 4UCQA 4PAWA 1A7NL 2O8EA 4MQ6A 2HMVA 1RLUA 3MBEC 2H47C 3REVA 5CRIA 4G43B 5KVFE 1M8PA 3WHIA 3D06A 3QIVA 3LX9A 2JJMA 3B7UX 3SCYA 1J07A 1HDEA 2E4TA 4YRMA 1GNQA 2YWCA 4RJIA 1Z8HA 3RYFB 4PV7A 1KSHA 2VUHB 4G6JH 5ALQA 2VNIA 4CR6A 4Z7UE 4QWWD 4L16A 4V1DB 3KCQA 1C0KA 1KBOA 3VD3A 1ZM4A 1BG1A 1KV3A 4ADIA 4ZVSA 3G6JF 1UEJA 3DKPA 2H3NB 1ZW6A 4DCTA 3OO1A 1I9IL 3THRA 3GUTA 5JTTA 3NORA 4OY9A 4YL4A 1MMFB 2P47B 3I30X 1C0EA 3RY4A 2ZXBA 3RL1B 1AKJA 3T3PF 1IG3A 4MQEB 2R97A 4UVGA 1BHGA 1QFOA 4N2NA 4QZVA 4JOQA 3BT2L 4AIZA 3QYCA 4BIIA 2GF0A 5LQJA 3D4YA 4JFHD 3VPCA 3O3CA 3RSSA 5L3QA 4XRCB 2AYZA 5IHHA 1SXHA 3VXME 3ZT7A 4LSGA 1YI8A 1UEXC 4XP5L 2ILVA 2GJ9A 4HDSA 1JV2B 3VTZA 3OSVA 2XXGA 4GKZB 5E2TL 3R4VA 2HOQA 5IHWA 5KYUB 2IANB 3MJTA 3PNYA 5AVOA 4FQHB 1EHYA 4F5WA 2AV7B 3ACDA 5I1LB 4YCBA 4XBEL 5K9KB 1NUUA 3UL4A 4JK3A 1TENA 3EZXA 1KJQA 3UGEA 1FO0A 2BVQB 2Q2OA 1X3DA 2DW5A 4HXFB 1KN4L 4BQEA 1G6OA 1ATZA 3MOGA 1KYYA 2XOTA 2KH2B 4KMQA 1DIOB 1RJFA 4XVOA 2NWQA 1RJEA 5HQ3A 5H94A 4PMFA 1JXJA 4X7RA 2W4IA 3JQ7A 5A4FS 1VOTA 4JKIA 3ISJA 3G04B 4IRJB 4QJ4B 5I48A 4HLCA 1DVFC 3D6NB 3H4IA 4BYMA 3CLEH 3CINA 3TBVB 1A4KA 2AFHB 5F3BA 3GKWL 3AR5A 4YFVA 4EWRA 1Z2DA 1JHVA 4LK3A 1T8RA 5BW7C 2FUQA 2JI3A 2F43A 1DIGA 3KUDA 4MPDA 2ICEC 5CJXC 5FORA 1E2QA 1RFDL 3E9CA 2XADA 3BHBB 4V1DE 1SCJA 1MP0A 2R6AA 3B3JA 1HEZB 1MB3A 1E1LA 3LKVA 1MC5A 4LRNL 1A9RA 1TA0A 3ZKWA 4CMCA 1KSRA 1XCGB 4X85A 3FFDB 4EENA 3QAQA 5E8OA 1TQ4A 2HYMA 2FMKA 4ENQA 1W1UA 1GMIA 3BWAA 4Y1SA 5F7JA 4U1IA 5IVXF 5CAEA 3X0DA 4FSXA 1X5AA 3JV4B 1SXIA 2JVJA 3OU7A 2XY2A 2YAFA 1JHRA 2EP7A 4NJ9L 2YZ1A 4H20H 4BBJA 5KVDL 2D5CA 1XMSA 3E82A 1HL3A 5CYPA 1KMNA 1RYZA 2V7QD 4YCAA 3O8CA 4L9LB 1C29B 1XZGA 3O7WA 3EDJA 2P5EB 5CWSB 1Q94B 3U0WL 2O0KA 1GN8A 3GGSA 3IS0X 5JADA 3K3QA 5ARCA 2J32A 1AK2A 5T8IA 1EK3A 1DTEA 1WXGA 3P9YA 1QG6A 5AOJA 1S3FA 3S96B 3PXXA 1Q2UA 3D0VA 5FLYA 4C4KT 4A7GA 3E22B 5IP4A 3AB3A 3V2HA 5ALLA 3KAPA 2HA2A 2JGAA 2P7TB 1TTAA 3D08A 1CTMA 4N18A 3TPCA 1GD1O 1KCSH 2Z34A 4DXHA 4YUZA 1CUOA 3MD0A 5A7EA 4TKZA 1DBBH 1N1MA 3ONEA 2PX2A 1LH0A 2DQUH 1GKLA 4MSUA 3R6WA 5D85A 1CFTB 3VU8A 4W1TA 3HGQA 3EQ8A 4MV0A 4LQFH 3KK0A 1R3DA 1JG2A 4ZI8A 1WZ2A 3V5HB 1QFYA 4J8RB 4TM8A 4CMGA 5DOZA 2IZ5A 2WAAA 3B6ZA 1TZCA 1WEKA 4QEDA 4EDXA 3PE3A 4P54A 3VW3L 4XWGL 4Y1TA 4MLCA 1Z83A 2C1OB 2R4QA 2YVKA 3EGXB 3GHBH 3SICE 4ZEOA 3TM5A 4CJXA 4LLUA 2VXQA 3QYMA 3T12A 4AOFA 1OXSC 5LSAA 3WKQA 4YLGA 4OHYA 1M1ZA 1DC7A 4E11A 2JI8A 2A33A 3T6QC 3OCYA 2LD4A 1NBYA 3UMTA 2L82A 4GECA 2QM0A 3F85A 1PWYE 1Z7JA 2EYRA 1CUSA 2EKJA 2H0FA 2UX6A 3HY4A 3EPLA 1Q15A 4ZAXA 3VC7A 4LSRL 3GMQB 1D0IA 5ERWB 2AC7A 3GGPA 3WOHA 5JZ7D 4KZDH 1ZIYA 3JX9A 3IF1B 3CN2A 3B7GA 3FFCD 4LY3A 4ABVA 4D1YA 1GT6A 4NO3B 3TBYB 5JQ6H 2WM3A 3RJ5A 1VE5A 1IOLA 2X1OA 3S7GA 4FFRA 4B3EA 3KXDA 3EH1A 4G0VA 5EBMA 4BZ2L 5I3ZA 2QM7A 1PLCA 4UNSA 3QYPA 4PAZA 1PHPA 3MTDA 2RHHA 3OD1A 2FQXA 1J42A 2PX0A 5J6HA 4BL0A 4TV9A 3MUEA 3TLCA 4PN3A 4ZOXA 1DB3A 5DK4A 4MB6A 1XBRA 2J6EA 3O7MA 2Y23A 2C82A 2UZ4A 3UW1A 5DA4A 1IC7H 1XX6A 5F7WC 1XZHA 2Y9MB 4KFRA 4P0PB 2QD2A 1D9ZA 1JB9A 1LW7A 4ARAA 1SB8A 2D0HA 4OCXL 3V7NA 4FZEH 1XZAA 5TQ0H 3ZWLB 3KHQA 3BG5A 1D1SA 4N2BA 3Q7JA 4PLTA 3QUKB 1XDGA 3QJZA 4JL8A 3VDNB 2JAQA 4UTRA 1OZHA 3WTYA 1AGNA 4KQJA 2EVWX 4CU2A 1FLRH 4OQ4A 5LBVA 3LXCA 1U7DA 4L2IB 2NUPB 3ZE6A 3Q13A 1G18A 2QQLL 4QY8B 1BXUA 4YDVB 5LQDA 4CDGC 4IFBA 5HJ7A 3EO9H 2Z93A 1ENZA 3WLAA 1MG2A 4YCSA 4P5DA 1JNYA 4B81A 2IHUA 5FWNA 3T1FB 5AAMA 2BM9A 3BXZA 4YIKA 1ASPA 2QL7A 1LDPH 2LKDA 1I8KA 3SVWD 1TQ2A 4OT1H 2JK5A 2PUWA 5KJ7E 3JZDA 1JGLH 1J90A 2QG6A 3WYFA 3IDMA 3D0LA 3CSSA 3TMYA 3U16A 4HXAL 4XGQA 1TCRB 4JZJB 3PEVA 4KN6A 5K0EA 2ZLBA 1INQB 3ZDDA 3ASWA 4NCHA 1A1NB 1B6GA 4L4VB 1CRPA 2DSNA 4ZWNA 4JJ6A 1JBQA 3B9BA 4KK9C 1Z15A 2X12A 2YBDA 3T3HA 2CL6X 1ABEA 3ZXXA 3W38A 5C2JB 8AT1A 3T7CA 4FCAA 3RVWD 2NADA 1JNXX 1KKMA 3GGOA 2Z7ZA 2QR5A 1KA9H 5EALA 3CFKB 4INJA 4PTUA 4RGBA 3OC5A 1HXHA 3KJZA 2J5WA 4L4TD 1M1NB 4X1KA 3TI7A 1A0QH 5F2EA 3LOUA 5EU5A 4YMUA 4NUJA 3F58H 1MR3F 2XWJB 4XOIA 3ASYA 4YQZA 5L3ZA 4HSQA 2QJTA 4P7FA 3QG5A 1ZHNB 5DYFA 5E0QA 5E0KB 3WYNA 3M7FB 2BBWA 1BXAA 4J3OF 2NU6B 3LPOA 1WB5A 2XAAA 4ROSA 4X5WB 3QWBA 3SIRA 3SHTA 4M88A 3D4ZA 2ZTBA 1KJJA 4IU2B 4RD3A 2JIDA 1KGXA 3TZEA 3QKSB 1UZUA 2WSMA 2HYEA 2Q07A 3DDUA 4ETQB 3NBQA 1UMKA 2QAGB 5J1AB 1DBWA 1YYLL 4CFSA 1PUXA 4YCDA 3L7LA 2J57A 2XETA 4HPYL 3IHWA 1GNPA 1WPRA 4EI6A 2VDJA 5MHTA 3COWA 1G9HA 1U2HA 4Y2HA 3ORRA 1RIFA 1E6EA 2JKVA 3AV0B 3I01A 2TRHA 1JYNA 3PNWB 3HNVL 4K5OA 4PGCB 2X4NB 3N44F 1OK0A 5ILTL 1MNQA 1S2NA 3L1KA 4V02A 4W9CC 4L0QA 5HMLA 2D8KA 5IB3A 1PEWA 1GC1H 3MKSB 2CF6A 2WVHA 4JDTH 1U2DA 5HDQL 4HKZA 1TJGL 3WGIA 2WZDA 2VAPA 3ABQB 4PZEA 2NU8B 3TSOA 2B1GA 1K2DB 3GQBA 5SWZB 5CCJA 4H7EA 4Q9QH 1L9NA 1NCNA 1Q83A 2A83A 2GJ6D 2H7YA 4IOLA 1HKHA 1CL7H 1MIMH 5KC9A 1BBJA 4MUBA 1CD5A 1KJIA 3DEIA 3T1HB 5IMKA 4NESA 1N34B 3N6YA 2O5VA 2AJCA 1N6FA 1BQ4A 4CRWB 4JAMA 1YDPA 3L1IA 2WD9A 2X1QA 1C41A 1N6UA 3S3CB 4AY0A 4HQ0A 1P69B 4A09A 1DX6A 4JY5H 1U8EA 3MRCB 4FD2A 3KZNA 1U2TA 2JNWA 4DQKA 4YMTA 3MX0A 1C9DB 3OY2A 3G9AB 3IDIB 4GY4A 1TA9A 5E5RB 2X2UA 1PK9A 4DUYB 4UU9B 4OJAA 5FOUA 3RIXA 2OM5A 1NCBH 3E18A 3QV2A 4RIGA 2C59A 3TN0B 2HSGA 3TBSA 4OLFA 5H4YA 1S7VA 4WGWB 5CN1A 4PJCE 4PIBA 4IOFD 3BUTA 4KX7A 4QAWA 1II8A 1XTKA 3DT9A 4QBHA 3BYTA 1BZYA 3SIPA 3IDFA 2M9MA 1N36B 2IQIA 5I15H 1BXXA 4RTJA 4N9WA 4A11B 3PDUA 5EO0A 1N8TA 3QOFA 3HU1A 1PZ5A 3C4QA 2FP3A 3W0WB 3NN8A 1RSYA 5DMHA 3ESVF 3OH8A 4PZAA 3BULA 4FFVD 3T3PB 1TUBA 1T6YA 5B3NA 4KACA 1EHAA 1P0PA 4DEXA 6YASA 3CF0A 1YZVA 5HRAA 3LS4H 3VH8A 2IGTA 2CCVA 4MGXA 3CFEB 3I4CA 4XYMA 5K99A 5SWZE 3O31A 1YEJL 2JELL 3OZIA 4BASA 5EP1A 1IBKB 3ZTJG 1EAJA 4P2BA 3ESPA 3DURB 1QHSA 4DIOA 1E9FA 1N10A 3RBAA 4LFHD 4BELD 3ARXA 4GBED 1QI5A 4A2HA 4KYIB 1GUDA 2MKLC 4M89A 3FC8A 3SWWA 3GLEA 4DLAA 1UWYA 3BWUF 3PAVA 3MM4A 4FYHA 1AIZA 3OZSA 4ZQBA 4E0RA 4G63A 4LCYA 4QRUB 1R5VB 1ZDSA 3R0MA 4M1DH 3PV6B 2XY1A 5BMVF 3P9KA 5I1KL 2XXCB 3K1YA 4G8AC 4XVQA 3UHPA 2Z08A 4Y0NA 3GU3A 3K1AA 2POCA 2W9LA 4DQ0A 4ODVH 2P6PA 3EB9A 3COPA 1ULZA 3QH3A 1HH4A 4C57C 2OQIA 4NC2B 3ON5A 5GJCA 1PQUA 3T8VA 3ODTA 1EAQA 3FLMA 1RWVA 3R7QA 1WFTA 3DCIA 4RZUA 1KDRA 4BZYA 3MS4A 4RXMA 1XXDC 3IDNA 4WTXA 1PQZA 1JERA 1N19A 2MPVA 4O29A 1T24A 1UASA 1ICTA 1G20B 1U7TA 5THQA 1HH9A 2I2CA 1GQYA 4P06A 1O4VA 1C1EH 3W0WE 3I9FA 1CFQB 3UCRA 5GPBA 3H84A 3IAUA 2W0FA 2NV0A 3W3AD 4ZFOB 1K85A 3T3PE 1JECA 1KEEB 2IGLA 4HGRA 4CBPA 4U1KB 5J7CC 5E6IB 3FETA 3NCHA 4N1EA 4D3CL 1B43A 3DGGA 5D7LD 1YB5A 2QFRA 4Y88A 5ALOA 4D9QD 3GRAA 4MB1A 3FPJA 4AITA 3CY6A 3F2VA 1GQQA 3IQHX 1CQPA 3LQ2A 1C4WA 3NRCA 4GE0A 5A71A 4CY2A 1VGEH 1E3IA 2HQ1A 4P08A 4RY8A 3GRPA 1O0VA 4WFFE 2V7HB 2JZOA 2YYZA 2ZUXA 2G2RB 3VWKD 3K9FC 3PUCA 1X2BA 1M05B 1S7RA 5HHXL 3MFFB 4NIKB 4QLBA 2PIDA 1ZVKA 1MEOA 2R8YA 1X8KA 2AHIA 2KMLA 1GPNA 5KWVA 3BKYH 2O0HA 5DC9B 2P5PA 2QGCA 3QUHA 1RZUA 2Y3IA 3GELA 1VJSA 2G3ZA 5F0JB 4G26A 1K8YB 3B5EA 5I1JL 3K7EA 4OJFH 2VQ1A 1TLFA 15C8H 4F6RB 1X7QA 1KJ8A 3HPRA 5IY5B 4HZUB 2E27H 1LK0A 2QMJA 2Z92B 2D4AA 2YUTA 1M0EA 5C0DA 3W1EA 4QOGA 3M3DA 1FVCA 1BIIB 5I7UA 1XSIA 1QA9B 3S3JA 1P0MA 3JTBA 5IZ4A 1YQDA 3GCGA 2D2EA 4NZRL 1SQSA 3GJ4A 5ESAA 2WCPA 5CR8A 3MLAA 1KPRB 2P26A 3AG1B 3A9UA 3SMRA 5I4IA 2O5XH 2R65A 1XN1A 4Z99A 3ZWWA 1B0GA 4O63O 1V5GA 2H5EA 2QU7A 1NGPL 3CNEA 1XNJA 3DM0A 4TUJA 3T5CA 1QHPA 1ILUA 3VXMD 3ZCQA 5E5UB 4QKXB 3RFRA 1BW9B 5IVXE 2AVDA 4JWKA 3QNZB 4Z78B 1UEIA 5F35A 3O6KL 4MNTA 1ULAA 3CNHA 2O19A 1KK3A 3EYUL 3ZDFA 3KKPA 4GWGA 2GPJA 1ORSB 3HCVA 3FF4A 1LEIA 3A06A 4URWR 2GFBB 3DROB 1QPZA 1BQHA 3WDHA 2A57A 2XTLA 2ZJOA 3WGVA 1RUKL 1YACA 3NHYA 3EGSA 3N6VA 4CKEB 1G21E 2A78A 3TNNB 5JW5A 4EG8A 3KM1A 3ANYB 1T2AA 5CILH 3FOCA 1XTPA 2DV6A 3L8DA 4DMCA 3EH5B 1H3NA 4RMWA 4G09A 1HFWA 1NX6A 4HKBA 1ESNA 1K7SN 4YCCA 3G5XA 3FMFA 1T8TA 1O6SB 4JEGB 5LBSA 4CG3A 4X7PA 2C9ZA 3ZRSA 5FGSA 4R1OA 1EKXA 2QDKA 3WO0A 4OCSH 3FJ1A 1JQ3A 1SC4A 4NCIA 2G5CA 3PL5A 2BUBA 1UWEH 1QTSA 2BIPA 3HEIB 4DR7B 3IFLH 1KJVA 2B4AA 5I30H 4L37A 4OLXH 3N70A 4V1DD 5E4IA 3D64A 1W6WA 2LU5A 3HRKA 1DFBL 3ZJYA 1RK0B 1OD7A 1I6LA 4RDQG 4RF5A 1U7WA 3EQZA 4GOXA 1TYRA 1RZFH 4XFJA 4BNYA 1DE4A 1KQGA 4W5RA 4GW4B 4ARZA 3V4VL 1QLFA 3TQOA 3KQUA 4JKOA 1DEXA 3HEMA 3N07A 2CJSA 4RETB 2B5NA 2MOKA 2QD4A 4D4HA 2Y25A 3T7TA 2QRGA 1EP1B 3MIIA 4QECA 5FB8A 3DLPX 2ZX9A 4WFIA 3E7PA 4JMPA 4C7JA 1MQ8A 4B5EA 3SYLA 4I9XA 4FC6A 5KNCH 3VB8A 4BTEA 1XR3A 3S81A 1QWHA 1X3SA 2JGKA 1BAWA 4DILA 2HL6A 2EYSA 1IN1A 1AXSA 1FNSH 1ED3A 5K1ZA 2X8WA 1OGTB 1IAQA 2P9UC 2AYYA 4QL1A 4QXTB 4C4TA 1P7CA 1V45E 5DTIA 3ZVRA 1Y6RA 2XYGA 3EAFA 3IVCA 5KVQA 3QIBC 3AFGA 2JPDA 1NPNA 1NCIA 1H22A 1RQNA 4RF3A 1BKSB 4ZVTA 1HHIB 3FWYA 1A8UA 2WTEA 3HZVA 2XFGB 5E4JA 4P84A 1OAXL 5AB0A 5LN8A 1OP5K 1ZLVK 2RGWA 3GSNA 4IRJD 1CGSH 4RGYA 3VU2A 3VNBA 4AEHH 3FN9A 1X92A 1X0XA 1U0OC 4R2KA 5E1AB 5HFAA 2RH8A 2OAQ1 4QDTA 2I3ZA 4Y2GA 3U7QA 1YEIH 1HN1A 4Z3DA 1NXWA 1SN5A 1K7FB 4K40A 3B1ZA 2CUHA 5SWSB 1UWCA 4RHUA 4MJ5B 3EZJB 1YEEL 5ICUA 3EZ9A 5IAGA 4NU6A 3MLVL 5JPNA 1R5MA 4R9VA 4LLVB 4JSXC 2EEAA 4I9FA 4ZVNA 3VH2A 4C4PA 4CMBA 5FYLL 1LVGA 1IQWH 3ZZLA 1PFQA 1JZ8A 1OVZA 5AM2A 1UFRA 4GO6B 4E46A 1T3LA 5AVXB 1NKVA 2GYSA 1ETZB 5F9WC 2BM1A 2WJ3A 4ANXA 1PYWB 4RGMC 3RNLA 1H8LA 4NFHA 3ZN2A 2B59B 2CWDA 2V1XA 1R4ZA 2DWYA 1NPDA 5JFGA 4PQFA 2FRDA 5ALMA 1N2JA 3C5JB 1ZR4A 3CLRC 3WK6A 2P5ED 1FQOA 3PRZA 2WNHA 3F6YA 3EXHB 1K8IA 4O2RA 4S1DD 4CW7A 1F00I 2V3EA 2QTWB 3GPBA 4MOWA 2MCFA 3N91A 2GF2A 1IQ0A 2OECA 1JXDA 1VC2A 3OZCA 2HKAA 2CLVB 2A59A 5EEHA 5I8CB 4KK3A 5SZHB 4KKQA 2WHEA 3NP3A 1HX0A 2FYYA 3FULA 3O6MH 2KPOA 1OE3A 2Q6LA 1IDOA 2P9YA 1W72A 2R0ZL 2ECKA 1ILSA 1NFDF 4GQ9H 1W0YT 1Z3GH 3L16A 1JHTA 4CA4A 1N77A 3WFBH 4GPBA 1Q1JH 3UMYA 1LQSR 3K70B 3OD3A 3VWKA 3G0HA 1VIDA 4XM0A 3KPUA 1U8JA 3JTSA 4G8EB 1NRXA 3L4BA 1NT4A 1U2SA 3UGJA 4QUHA 4CZVA 1MQ9A 3KR3H 5F3RA 3MOAH 4TL4A 3WLWD 3ETNA 1RC0A 4QG7A 1KIFA 3Q06A 2X0KA 2ZB4A 1M10A 1N64H 2V5TA 3QPXL 1Z25A 1NPYA 5HPYB 3QRGL 1DUIA 3BIOA 3NRPA 3A9SA 4PYKA 4Z7UA 1T2QH 4ES0A 3F5QA 2F3QA 3RJMA 4X9FA 1I4EB 1OW0C 2F8SA 5BYJA 2AB0A 1PFVA 3E5RA 3KJIA 2BVYA 5CG1A 4KR3A 1VMIA 2EKLA 5HGDA 2RKBA 2HU2A 3GVHA 4R9SA 5FWYA 3QJTB 2WO2B 3UWOA 4DJDC 1U1EA 1MCQA 3B9EA 1C9LA 12E8L 4G7YH 4DRYA 1GQSA 4NC0B 3ZQ9A 1TVMA 4A38A 5AKZA 5HHPB 4JDUA 2DWDA 3TIGA 4MIKA 3TW4A 3L4WA 1L5MA 2UZYB 4OI8A 4JGBA 3FDFA 1CBVH 2GCOB 1AF7A 3OKMB 2JDID 1YQUA 3ABZA 4Z3EA 5KVEH 1TO1E 4OD1L 1W34A 3W11C 3HDQA 5ADWA 2QBWA 2A2ZA 1FFXA 4TLSA 4WI8A 4BGDA 5TQ2B 4GBXA 2HKHL 3BBLA 5IAOA 2BOCB 5FTKA 1SF3A 1GGCL 1HL4A 4JT4A 5JNSA 3EJPA 5D93B 2C9VA 1IOZA 1X1SA 3PC2A 4GSQA 2ZBDA 3FTEA 2W6ID 1FF9A 1BW8A 5LGKA 4J2TA 3MTIA 5ALZA 3ROGA 2E9JA 4NL4H 1M1XB 1YIAA 1OFGA 4OLVH 4TUKH 3C5ZC 1QCYA 4QYIB 2HLFC 35C8H 2ZKYA 3SDCC 2OA0A 2HBQA 4EO5A 1F42A 4AM0B 6PAZA 4GWKA 3RS2A 4BC0A 2EOAA 4P80A 3LQZB 3OSKA 4G43A 2AQTA 3U3OA 2IUVA 4RKFA 1WHTB 1JKFA 2P1DA 3IP8A 1SD2A 2XRZA 5F7EH 4KEAA 5IT0A 4QEGA 4OGYL 3HE7A 2G82A 3ZHCA 1RJ9B 1L7XA 4FBLA 3CIKB 1XEFA 2X0WA 3IJHB 1XXHB 1S78D 3RYFA 2XZGA 5BV7B 1L7RA 3D8SA 1CS0A 4HLUC 1UIMA 2QUZA 1J9EA 2FPXA 3RFGA 2AFRA 1XGRB 4S0HA 1MU0A 3J07A 3GXNA 5L4JA 2WTOA 2JJ8A 1NXQA 1A1MB 2D5IA 3FMPB 2A9VA 2AG6A 4C89A 4P23C 5FV1L 1VJGA 2BDTA 1H5BC 4Q0XL 1WGOA 1USIA 1XTBA 4AG4L 1UA6L 3MV8B 3R9KA 3KWVA 2XL2A 4A7VA 1NY5A 3KO8A 1E20A 3G9XA 2D03H 4E42B 4L4VD 5DR5H 4B4OA 1C81A 4MQEA 2G9RA 3VI4F 2Y4OA 4LTNA 4GPVA 1WLYA 4AGNA 3R6DA 1NM9A 4RFNB 1NR1A 1N59B 4H6WA 1MCDA 4OHXA 5CZXC 3TOXA 3OMIB 1BD2E 1IN6A 1NV8A 2E87A 3SZLA 1QQTA 4YWHA 2A9NL 5CCEA 4KP7A 5JWRA 1WZAA 1KBKA 1FYTA 2ZIXA 1QLEL 3MJ7B 1PEAA 2KS6A 1JV2A 1Q9WB 4GKZA 2PVPA 3ZTYA 4RVGA 4HC4A 4FQHA 4MZ2A 1C7ZA 1XEWY 2XITA 5I1LA 5E7JA 1RRCA 3ITKA 4XASA 5FOQA 3D5EA 5GRJH 3JY6A 1NC4B 5L0QC 4DTGH 1ZTMA 4QR7A 3LKPB 4E41B 1N5AB 3S8WA 2Q8PA 1A9VA 5DFAA 2IUYA 4G9BA 2XECA 2Z2XA 4QJ4A 5JMWA 4ZZFA 3T09A 2IQ9L 4YJGB 4IGFA 4JSNC 2I3SA 2QVZX 5C34B 1I85C 3QZPA 4FWBA 1K4DB 4LLYB 4HJEA 2ZYRA 5T5FH 3SDDB 1CQXA 3JAKA 4EHDA 1OAKA 4UREA 3PI6A 5IM5A 1B23P 1KR2A 3PVSA 4OCWL 4KREA 3RWDB 1R16A 2A2QT 1V8ZA 2JVKA 4FIZA 1R37A 3ABLB 1XXHE 3EA0A 1V7CA 3TEUA 3OQHA 4PFKA 3BHBA 2D7PA 1KENH 4Y2DB 4Q34A 2GIYA 1UXLA 1SGWA 2WY3B 4I4IA 1CUJA 1HEZA 4DEUA 4RMNA 4NVRA 4RSYA 4OLHA 5FOSA 5CYGA 4V39A 3F12B 2R7KA 3HE6B 3MV8E 4YRIA 5SWZD 3FFDA 3EZ8A 4IA9A 3GN2A 3FUNA 3LEYL 3N85H 3QI9A 4KKVA 3HXPA 3MJSA 5IJVA 2YRXA 2PWFA 3DHVA 5SV2A 2J21A 3VD2A 4MYDA 4NNYB 1JIQA 3JV4A 4RKYA 3UTPE 5CXSA 3IP6A 1TO5A 2DIAA 3UJ6A 5KI6A 3VHQA 3W2FA 1JPFB 3CFUA 1TTFA 1DQYA 5ADOH 4I46A 4UMEA 4X9BA 2BHFA 2GI0A 2AR0A 2G72A 3D54D 4L9LA 3SHVA 1PT7A 3WK8A 5CWSA 1CUEA 2FW1A 3EIQA 4YSDA 2QG4A 5DP2A 4D46A 3D3QA 2QZZA 1G2OA 4DCVA 3ZJVA 5DNCA 4GUCA 4Z5RB 4ZIRB 4WUUB 1OLSB 1EHKB 5IJWA 3C6BA 1U3HB 1GP2B 3KYKL 4PTYA 1IXYA 1G9NL 3SYQA 3CISA 3E22A 4BNFA 1JMXB 3KKZA 4W6YB 4MVJP 4E41E 3LNTA 3QITA 4GT0A 4UZGA 4J77A 1U8CA 1N5DA 3CFJA 3TN0D 1IBRA 4M3NA 4IIQC 1JK9B 1EFPA 1FLTX 1K5WA 1W96A 2P80D 1F3RB 2HLDD 4AYGA 3HB5X 3KWFA 1IRIA 4MO9A 2DQMA 1E43A 3IPEA 3GBDA 1N4XL 2DAVA 4LPKA 2X6RA 3I3EA 1BFKA 4FX2A 4POUB 3USZA 3CE6A 4DEPC 5J4HA 3V5HA 1VPLA 4L4ZA 4J8RA 4Q7KA 4K8OA 1KTRL 4N1CA 2DM4A 3CSYB 1LMKA 1L1QA 4NYJR 5T3XE 5KBLA 4D42A 1AK1A 1L7VC 5JCJA 2JTYA 2MSCB 3W0WD 3KPMA 2K6WA 5CJJA 1UXIA 3I8CA 3EGXA 4Q16A 4F7EB 1ZJBA 2B1QA 5L3RA 1TFPA 2FE0A 4KHZA 1SOUA 3PQCA 4RAUB 4B7ZA 1F9EA 3ILQD 4PLYA 3R3JA 3JQQA 4A8TA 1I82A 3LDAA 4ES8A 1YZFA 1KI2A 4K07A 1LVHA 4X1OA 2RGAA 3T5MA 3DWIA 5LLTA 4YGVA 5K9QG 5JHGB 3N50A 1TJIL 3WUWG 3DB2A 3M5DA 5IG7B 3FZUC 3IH5A 3MHPA 4JFVA 2WOJA 2X3UA 3IF1A 3WN5C 1CF2O 3ARFC 3Q48A 4WFFD 2PQ0A 5G3ZA 1C5CH 4POYA 1N6QL 2DZEA 1NBWB 1CXHA 1KHTA 1M2WA 5IEJA 1VFNA 1VI5A 3RYCB 4UQPA 4QXAA 4FZ8L 3AVQA 2JDIA 4A8PA 3WXBA 5BQFA 4L1MA 4EPRA 5CEEA 5DEFB 1E0KA 2R2EB 3KZCA 4CM6A 4MO2A 5MN6A 3OEYA 3MRQA 3IE2A 2IP2A 1EBUA 5DUML 2AK3A 3OIGA 4CDMA 3MN8A 4UE6A 2W6IA 4OCZA 4D5GA 3M7IA 1ULTA 1GMEA 2P9GA 3AKDA 3FMGA 3TT3L 5AZ2H 2OVPB 4WY5A 4IDBA 4RZHA 2OHHA 4IVPA 1YEWA 5DLDA 3OLZA 1SU6A 4ZPTA 4K3JL 4M54A 1C5BL 1E77A 4U02A 1BDHA 5A5GA 4D5EA 5A6SA 1MABA 2NUPA 4I48B 4COOA 4N5LA 1RWXA 2ARJA 4QY8A 1I4LD 3BWVA 1Y1LA 4RMTA 4YDVA 2IH3A 4OOEA 4LNVA 2WKGA 5E1IA 4PGEA 3UH1A 3CBRA 2C5DC 4RGQA 5KANG 2QYSA 4RX4D 1OGPA 3FO9B 5DK0A 4D6VA 4LIQE 2FXVA 5SY6A 5E6ID 3PTZA 2BBOA 1JPTH 1JGDB 3WB9A 1B73A 4ZI2A 4FNAA 2XVMA 2OBYA 2X40A 2H7WA 1DAKA 2ZRBA 4NZJA 1GCOA 4A6YB 4GM1A 4HA1A 2JC3A 5TF1H 3EARA 3GRKA 1O2DA 2I9LA 1A1NA 4HV4A 2FZ5A 3JRPA 1JRHI 3WYRA 1EMTH 2WOOA 3TOCA 4JHLA 5GZOC 1IAMA 1WX1A 2UVPB 2J6WA 3OJ0A 3WRVA 4R8VA 2OR9L 1CDUA 4EHHA 5GRVL 1RHFA 1TBGA 2Y1GA 4DHLA 3EJYC 3N3EA 2C2KA 3RVLA 2VDOL 5AI9A 1RWNA 4ARIA 1SQ0A 4OVVA 1Z2KA 1IVYA 1TR7A 2ZBPA 4EIBA 3BGSA 1M1NA 3PL6C 3WGUB 5JW3H 4XN2A 5DZAA 2XWJA 1K6QH 5HI3C 3GCDA 2YJNA 3QVMA 1XH3B 5DWUH 3IU4H 2R0QC 3L3OC 5IEBA 3GLFB 1JR4A 1JDJA 2PUBA 4FN0A 5JNUA 1SZPA 1MKYA 3AI2A 3KQTA 4QBKA 1PNTA 4NN6B 3D4OA 5GGSA 2ZX5A 2YNMD 1YONA 3BKWA 4QDJA 4GL4A 5TFSH 3PTLA 4AYWA 4IU2A 4L8CA 1JPSL 4WLEA 4BSWB 1J97A 3G5ZA 3QKSA 5JMOC 4L9OA 3DETD 1GFIA 2DY0A 3ZKNC 4WGFA 4PJCA 4FR2A 4L0YA 4F3RA 4MS4B 5LQBL 3NIFA 3QG6A 4NS0A 3U60B 2QAGA 5J1AA 2YOCA 4HPXB 3GJ5A 4C76A 4AZ3B 1P0FA 2GB4A 1W9XA 3OR6B 4ZHSA 3V6FA 1ZIPA 3Q87B 1ZPLA 1K6MA 5EJMA 4EHLA 5B3LA 3MNZB 3U3DA 3SQOL 3HBZA 5KUMA 1EVKA 4PGCA 1LYQA 5LCVH 1E67A 2C29D 3KJXA 3CZCA 3CLWA 3WHE0 1OXUA 4HNGA 3TE6A 4JR1A 3FPCA 1NU6A 4XO5A 2Z31B 2IOMA 2Z65C 5TE4L 3SE3A 3RT9A 1U9CA 4A04A 1F6AB 2VBIA 1SVZA 2CRIA 4KAQH 5DJXA 4KHTH 4BO7A 4ALLA 3ETJA 3TLYA 4FQCL 3KXFA 4LHJB 5HS4A 5ALNA 1L4IA 3MCUA 2JKIS 4FA4D 3GSOB 6CGTA 4IKJA 2Q5JA 4HHAB 1B9KA 4FGKA 3J7AC 2WVVA 4PPYA 3TBKA 4ZT7A 1RWQA 3CPLB 1R3LA 1MHPH 3U4EB 5LBGA 1C9JA 3GI8H 1QZ3A 3VFOA 4A36A 3WLBB 4WCVA 1NMAH 1CQIB 1FHNA 1NLBL 1NFDE 2OSYA 4HJGA 2VCHA 3M6IA 4GDMA 3QRWA 5AL0A 4J73A 4P3KA 5C1IA 3GLFE 5DU7A 3IDIA 3KWLA 2Y66A 4K5MA 3VDAA 4CG1A 4GQBA 2B8TA 1L9MA 4UU9A 2IT1A 3ZDXF 1EFTA 2FX7L 4OB5H 3OLCX 2JVUA 3EYVB 1ND0A 4OK6A 5BUCA 2DJSA 4XD2A 2AW3A 2DPXA 5KQMA 4OLWH 2C5LA 1MCPL 4M8QB 2HLDA 4ZTUB 3DV9A 5JWOA 5E5LA 2P24B 1FZOA 2WFMA 1ZW1A 3A1EA 3ONDA 1CB0A 3KETA 1VJCA 4A11A 2H11A 4XB2A 4ANVA 3BPNB 5KJCA 1QFUL 4Y1AB 4GXQA 3L3KB 3G6JA 1LO2H 1XEXA 1U1DA 5C9ZB 3W0WA 1AQIA 1R9FA 4BAGA 1QACA 2GCEA 2VZOA 3T3PA 1A9OA 2NYZA 2H0PA 2JJVA 3VI4B 3MNWB 1Y1DA 4GPAA 3N5CA 1XDTT 4OQFA 2DM2A 2EEZA 2QMYA 5C1DA 4TVOA 3OPVA 3CFEA 4DN3H 3IKOA 3OCCA 3BYYA 1Q0EA 4N2EA 1GCGA 3HCNA 4BFWA 2ORVA 4RMRA 3DURA 4IGKA 4F9FA 4C22A 2BS8A 4LUCA 2CLEB 4APQC 2GRAA 4MYWB 4AJLA 4GFTB 3NWOA 1KYIA 1DLFL 4L3CA 2B4CH 4BJ1A 3PF8A 5EQTA 1A22B 1MOEA 1Y8CA 4C59B 3X1EA 3I1FA 4F56A 1M6EX 5ANHA 1FP4B 2J55A 3EVZA 5EORH 4FQXA 1G9MC 4J3OD 4BZPA 4XLTA 1JGUL 5AVVA 4QRUA 2W83A 2UYCA 1WXXA 1KZGB 4DKJA 2RCNA 2IPTL 1PR5A 1K9TA 3CK0L 4YXFA 3RUHA 5J4VA 1CZUA 1J11A 2D8AA 3F6JA 5SWSD 1OA1A 1JP5A 3TFOA 1S7WA 3EVGA 3L1HA 5DN9A 4EMBA 1WWCA 1WUZA 4UT6A 4LZNA 2C1ZA 4UU1A 3KPOB 4AUUA 3OY7A 2MQ3A 1U7UA 4YHBA 5LFAA 3D30A 1I30A 1PZNA 1KIUA 4TL7A 2X4QB 1YFJA 5JI2E 4EG0A 4BX8A 3D0AA 1EV2E 1G5GA 3DTYA 4N90D 4E4TA 1L9OA 2PETA 1JEEA 1TFRA 3RGBA 1Z6XA 2VDMA 1YDMA 4DB4A 4HW6A 2ICWB 1U8OB 3HI6L 1F8TL 3LQAL 4DPCX 5D7SH 4QLOA 2IXGA 4C4AA 1W7AA 4HLZG 4OREX 5DBOA 1WU7A 3S3PA 1SJXA 4PJ7F 4Y1AE 4GW5A 1BFVH 5BXQC 5ID0A 1QNFA 1F1DA 3KHKA 4I4LA 4XE5A 1CLZL 3VZQA 2JFQA 3LGAA 3H2HA 3HB1A 2H4YA 4Z9YA 5IVXA 1F3LA 1OT1A 3QJFB 3VI4E 1CR4A 1KEEA 4YAOA 4J3NA 2EEFA 4GH7B 4U1KA 4G3YL 3CSFA 5E6IA 5DNVA 1XSEA 4BO3A 2Q0HA 4UNIA 2OC9A 3C0KA 1ZSNA 4ZVMA 4U2EA 2IDQA 5FO7A 1YZZA 2AEPL 4XJSA 4KQ6A 3TD9A 2QLJA 3AF3A 4K9LA 4DSTA 2R6CA 2OK0L 3GI9L 1SKMA 2W2LD 2CDGA 5IT4A 4P4SB 3L7EB 1G21A 5BVGB 3HVHA 4OD3L 2IL1A 3ZMRA 2C9XA 1UM5L 3WSQH 4OAPA 1MPAH 3K70D 2BLFA 4QXUH 3H5TA 5EZQA 3KPRA 2PZGA 4F33B 1U92B 3QP9A 3TF7C 2BMKB 4TF4A 1A2KC 1E94E 2OP1A 2HT2D 4EL5A 3N9IA 3DBVO 2ONZA 4RS4A 1BYOA 1F4YH 1YV9A 2DM3A 3BM5A 3AQIA 2LAAA 1A7PH 2DLFH 5LXTB 2L7QA 2ZAHA 3WFCH 1HZZA 3CLHA 5H7XA 2ZDHA 3QZUA 5AK0A 5KQRA 1E4EA 3BUQA 2ZIWB 2I69A 3PJLA 1QB7A 1PS3A 1OPGL 2BR5A 4WKBA 1YC2A 5B36A 1XZDA 4OTXL 3P71T 1YRWA 3F9RA 2Z92A 4KCGA 4OV5B 1KXVC 4N3UA 3DM9B 4JPVH 4R2XA 3GIZH 2Z3FA 3ZW3A 2HTFA 1QA9A 2NY1C 3ZY6A 2OK6A 1GFZA 1QX4A 1UINA 1RTTA 3L9EA 3EG9B 1IC5H 4WWKC 4K3ID 2DKUA 2I91A 1W5SA 3ULAB 4W9LC 4PIVA 3OP1A 2ISDA 721PA 5JJLA 3N76A 2G0LA 3K2IA 4FI6A 4X9YA 2I2XB 1VZIA 3TOVA 1EJ6A 4NZYA 4F57L 3LKRB 2WQZA 2OVQB 1G3UA 4NQDB 2FXIA 2F74A 3MS2A 2Y2WA 2GD2A 3RHSA 4XMLH 3TZLA 3CTPA 3MTEA 2JB5L 1DBKL 3GJRA 3RS9A 3QNZA 4Z78A 4Q6IB 1NN3A 3GEHA 4BZXA 1E5AA 2R1WA 4XPGL 3RWFB 1ORSA 3M5WA 4PWGA 2MPAL 3QH4A 3AP2A 3SO5A 3P77B 3EPHA 1IQUA 5CGYC 4XDZA 3E5HA 2I99A 3KBBA 2MRYA 1KTDA 5B3AA 3HMXH 5JZVA 4XEHA 4YA6A 5JPMC 4JPIA 4X3OA 5EZSA 2WIDA 1WDAA 4OUUB 2FR0A 4HIPA 4GM9A 2YUVA 1Z3RA 2IZ1A 3DSMA 1FIEA 1D5MA 2FUTA 1B1AA 2VTDA 1A6ZB 3W8DA 2YBGA 3BRWA 1P6UA 4G65A 5HWSA 4LXIA 1JSLA 4O2WA 1G6RB 2GJZB 2C03A 2AZTA 4HCRL 2AR9A 3PS9A 3R6LA 5EJGA 2BKAA 1RUMH 1I7TA 4FJZA 1LY1A 1ZVSB 1HEJC 2OV2A 1V1RB 2X3BA 4HBGA 3BJRA 1KYQA 4FJYA 2OQ2A 3UXMA 1XQXA 1EJ0A 4LMBA 4FSHA 5C51B 4FTDA 3AAZB 3L92A 2XI4A 2DQIL 4PBXA 1L6ZA 1GZHB 2BSQA 2HCJB 1ONQA 1QFPA 4X5XB 1KMHA 3IIKA 5IDXA 3GFTA 3LMJL 2DFKB 1Q90A 3JVGA 1EUCB 2OPHA 5FOVA 2Y8EA 1EQWA 3MV8D 3M3HA 2LVCA 2HZBA 3TTXA 2NY7L 1A9YA 4X8OA 2FQQA 1DCTA 1CYDA 4Y2LA 3SFVA 4BNHA 3KYNB 4CZXA 2ITDB 2ZU6A 4WA8A 3JTTB 5DHYB 2GBVA 3UTPD 1RI1A 5CVTA 2VT3A 2IBSA 3TU6A 2KC0A 3ZLQC 1D3AA 3LX6A 3HB3B 4WY7L 4NQDE 2HDWA 3BSHA 4H3SA 4KPUB 2VO1A 4EPWA 2NQDA 2W6ZA 1IKFL 1Q44A 2Y1VA 4EVSA 1GYQA 3D4PA 1SMAA 1AXRA 3U4AA 3QXJA 4CIBA 4N7JA 5HYSB 1XMXA 4X71A 4OJYA 4LI3X 1SLXA 3K35A 1GPOH 1OGTA 4KMRA 1XNHA 4HLEA 1LE5B 4NHCH 2HH0H 3SIXA 2V3VA 4BV3A 3INRA 3LHAA 2NUAB 1W2HA 3CFNA 4KOCA 1NC4D 2Z95A 1X5HA 4E41D 1KQ3A 2DX7A 3LL4A 3E9QA 4I8XA 4PJXF 2IP1A 5HKAA 3WGOA 3GO1H 1HQ4B 3DKVA 1Z2CA 4F27A 1KJ2A 1ZCZA 5F3DA 4HIJB 3I3OA 2P9ZA 3HBJA 3T3MB 5GGRB 3L84A 1YK1A 5EEWA 1IHPA 3DEJA 4NX2A 2I7VA 4FHBD 4FG6D 2W2OA 2DLDA 2R6HA 2ZJBA 2HCBA 5CEXA 4Z3TA 5CFQA 5E8DL 3L8MA 4L8DA 1AQLA 5ECGC 5BQ3A 3OIVA 2FVNA 4I0PB 4Q4CA 1C12B 4Y2DD 2BJVA 5CXUA 1XA0A 4AQEA 4LLVA 2C9QA 5CBEB 2EHJA 5EJFA 3C5CA 4G86A 2ODHA 2G36A 2PL3A 1GSKA 3B9DA 1GCFA 3HE6D 4C4ZA 1NCGA 3CVDA 3USES 1B0ZA 1NLFA 3L7FB 1AZNA 4F4FA 4MPRA 1MCEA 3KEMA 1ETZA 3QG7L 4XXCA 5BN1A 4EKNB 4X5LA 2XH8A 2B59A 5C1BA 1NSFA 2QVMA 3FBKA 2D8MA 1A8PA 2ODQA 3KALA 4OFPA 2C00A 4BCBA 4KV9A 1MFNA 3AREB 3EXHA 3KKOA 2OMUB 5IQ7L 1JHUA 2NQTA 4Q4HA 4MWZA 2ATCA 3WIVA 2DKOA 3RE1A 3FWHA 3GEMA 4WUUD 2IMMA 3IS1X 5EMLA 5FUBA 1EJBA 4CQMB 1CR9H 1U3HD 1X13A 4F3YA 5BQ5A 4BMDA 1MFBH 2CLVA 3QQ4B 4NN7C 2ZONA 3E70C 2FSPA 4KIGA 2ZOOA 4DPBX 3EVTA 4YHKH 1LJLA 2TMYA 3OOYA 3WL4A 1JKMA 4RNRA 5CW2A 2O2EA 2B8EA 4XFDA 2DH6A 2AA3A 4JL1A 1E1CB 2YV3A 4GEKA 1A8ZA 1SQ2N 3BDVA 3CLTC 5JARA 1GJUA 1O7DE 4G8EA 3BD4A 4HYQA 4QJBA 3PXDA 1XDWA 3T7KA 3ZDXB 4TLDA 4JRYA 2VNHA 1CD1B 2IXBA 5EWMB 6AT1A 3QB7C 3IC5A 2DTDA 1GTMA 3BGOS 2IUEA 1WDWB 2R51A 1KMMA 3KT3A 4JENA 3BOVA 4AYTA 3F4BA 3LCUA 4OCYL 4QOIA 1DO0A 2B34A 1TQCC 4AGPA 3H5OA 3WMXA 2YWRA 5LG1A 4BX9A 1DVYA 3G79A 2DJMA 2WIGA 2PGNA 3L2LA 1M54A 5TMBA 3NP7A 4F9LC 3FT0A 3UT0A 4UTPA 4HCJA 4OTZA 3T0XA 1W8NA 5HI4C 3ZNNA 3UC9A 4RH0A 3HZKB 4F93B 5FD8A 5BOSA 4F2FA 4MB0A 1A3LL 5BRZB 2Y1DA 4DLUA 2VH5R 1MA0A 2C4TA 2G3MA 4Y2PA 4CGZA 4I5DA 2GCOA 1BD2A 2WAYA 3MMEA 1Q47A 4RZIA 1SG9A 3H55A 5CUSL 3L8EA 5TQ2A 2BOCA 3ID6C 3AG5A 5DM2A 4PLZA 4ODWA 2C78A 3SQXA 4TTDC 4WESB 3TLXA 4FYKA 3AXHA 3EFEA 5JW4R 3FQRA 2CDRA 4TTTS 2YZ2A 2JLWA 3GAAA 5CLIA 2AJXH 4OQMA 1Z3IX 3O11A 4OM8A 2UUAB 3MOBL 4L3EB 3BMQB 4G7RB 2H3XA 2Q6VA 1M1XA 4TLTA 5BMVA 3ESMA 3PVCA 1O5DT 4C58B 4ERYA 5D4HA 3FDZB 4FR5A 5GZ6A 4IRZH 4MDJA 4XSGA 4NCXA 5DJ0A 1RPUA 3CHRA 4HY3A 2LBPA 3BVWA 4DA0A 4KO2S 4AM0A 3Q7QA 4NABA 4K6HA 4ZYKB 1E6CA 5T67A 4B3IA 3JYHA 3DA0A 3LQZA 3TE7A 3ZDXE 1GIGL 1F60A 4QQKA 3T0FA 1I0ZA 1WHTA 3H5LA 2X1HA 3WJMA 5LMUB 3TEMA 2CNXA 2C3WA 2FOLA 1RJ9A 5I8KH 5FYKU 1EBPA 4RGOH 2IBTA 4FI7A 2BDNH 3GLHA 3IJHA 1XXHA 1TF2A 8GPBA 1VZ3A 5DHEA 3OKLB 1J8KA 2Q8NA 1NGYA 1NPJA 2CO2A 5FUZH 4XAQA 1XGRA 1XWVA 1HCFX 5D7LE 2TSYB 2CCLA 3LQYA 3O5AA 8OHMA 4PJ7B 2X6MA 4NBZB 4D9QE 4Q1VA 1V95A 1C0IA 3DV0A 4ZEVA 3VR6D 5E99L 1TJHH 3AR7A 2X0IA 3QE2A 4NKMB 5GS1C 2PLAA 3DVLA 3VQLA 4CT5A 4E42A 1VKXA 3MA7B 3CC1A 3PQ8A 2HC9A 2X3YA 2RGRA 3KW8A 4UMVA 4GEIA 1Y7PA 3FTGB 3VR3D 2BSED 2OWDA 5BRZE 3W5IA 2UVEA 1N59A 3SZUA 5IN5A 1BQ5A 2CV2A 1TZIA 4J6IA 5IF0B 2A6DA 4OI2A 3O4FA 1NY6A 5AQ1A 1C7RA 2W2MA 1QFWM 4AJHA 2BC4B 1G8SA 4YLQT 3HXKA 4FYVA 4R1LA 3IRCA 1FVEA 3PP3K 3FWPA 2WLKA 2XB9A 1KY3A 1WMSA 1WRBA 4KMLB 3ZBTA 5KNDD 1AI1L 1SXCA 2BFEA 3PTAA 2F55A 3TEYA 4WNSA 1EZUA 3LLCA 1CURA 3LKPA 2AJDA 3QXXA 1H8HD 2DWSA 4E41A 4UUOA 5MN5A 4L27A 1PX3A 2EWWA 1SUDA 1V3LA 4JQIA 4HWBH 3QWRD 3QVWA 4LXQA 4JA0A 2QA5A 4J0XA 3GUCA 4WEQA 4RM3A 1HNWB 4LE0A 2A5FA 3BS4A 4L5FH 2I4TA 1O77A 1RYNA 2GEVA 1K4DA 4LLYA 2BSSA 1MDBA 1GPWB 3EFOA 4TGLA 4II3A 1FQWA 2Z2JA 4JKLA 1XUOA 4L02A 4F5CA 2DB8A 3WE6B 4D8XA 1IY8A 4LYYA 2HK7A 1IM9B 3DBSA 2C9MA 3SKMB 1C9IA 3OTWA 3O0RH 5CBPA 4FCHA 1O6VA 3II1A 4QKQA 4KGZA 3OXRA 3TYFA 1SPBS 2PCFB 2HRGA 4INPA 4PSXB 2IBZX 1YDEA 2Z31D 4PJ7E 4DR2B 4ZHQB 2UV8A 5TH2B 2XE4A 4HQLA 1UPBA 3EDQA 3A6LA 5IDVA 2BXZA 5F7KC 2NTFB 3HE6A 1U2EA 4PWHA 4PVMA 5FWQA 2PM7B 3VMNA 1E7UA 2G07A 4YJKA 1GVHA 1Y9AA 4CTOA 1Q7CA 1YRKA 2WP0A 1Y3AA 4B5ZA 3EZGA 4N5HX 3II6X 2GUOA 4UEWA 1UPXA 3E9UA 4OSUL 1M1YB 3HC0B 4AH2B 3P1JA 2NXWA 5G0WA 3DFIA 3ZQJA 4M7LT 4ZMOA 3DBRB 3WYGA 1P4IL 1DGQA 1AS6A 5FYKH 2IPUK 3RKRA 4NY1A 1MCRA 5IFHH 2Q5EA 2GVNA 2GZSA 1V5FA 1YQVL 1UVQB 3S98A 2ED9A 3OCXA 4J2QA 4AGMA 3C3JA 3AQYA 1QVOB 2XA2A 2QL9A 5HIJA 2ADFA 4OHZA 4BSVB 1JG1A 3NT4A 5HIMA 4ZIRA 2CMKA 4X9HA 2BFDB 3CSPA 3P4LA 1WHOA 1OLSA 4TLAA 3MMPA 5IUKC 1GP2A 1JMXA 1E4JA 1FNMA 2YV5A 5CZVL 1XEDA 1Z5HA 4WOCA 4KJPD 2Q1EA 1W88A 1JPST 4X50A 1BJRE 4B75A 4CF6A 3KR2A 1OWPA 3FRXA 3UADA 3AHIA 4M1YA 1WT5C 4O00A 2B8OT 4D4KA 2Y7OA 2DBVO 1KC3A 4MNHB 4OJTA 3ZL4H 3VM6A 3WL7A 1MFCH 4DAGL 2IV3A 3U09A 3CSYA 4CMHC 4Y1AD 5U4QA 3BISA 1D9KB 5HS6A 4AJJA 3VAAA 4YXKL 1R66A 3LE8A 2IU4A 3IMTA 4RMSA 4B4VA 2MNJB 2RTTA 1W2WB 4C7KA 4ZAKB 1Q16A 3OKNB 4F7EA 3FKQA 2IANE 3KQVA 1LV8A 3JWEA 5D5HA 2AS5M 3P2JA 1LLFA 3EY9A 1WIPA 4P4LA 5D2LF 5ALBL 5L8JB 2W22A 1RVFH 2XC8A 2YQBA 2OMYB 2XQFA 3ER8A 4FP8L 4FNTA 2VXCA 4AL8H 5AYUL 3UG4A 1VHDA 5DYTA 5YASA 1PUIA 3IN0A 3MLWH 1A4JB 3ZZ1A 1ZVMA 1G6VK 1QNZH 4WTZG 4MHSA 4OM1L 3GXFA 3R18A 4WDRA 2FWMX 5AW1B 4WUVA 1ET7A 2OCBA 4PLHA 2VN6A 1AZUA 2IU3A 4TYNA 4XVTL 2AFHE 2ZYGA 3ROFA 1HNFA 2A9MH 5IASA 2W0MA 1R4AA 5IG2A 1JXQA 4IKEA 3Q0EA 2E89A 2D74A 3WLSA 3PWUA 4PJXB 5K1CC 3FHCB 4G81A 2CQVA 5DEFA 1R5IB 1P7KB 3RRMC 2Y06H 4KTYA 2R2EA 2XA9A 3WV0A 2ZR9A 2QMZA 1DX9A 3QPBA 4B76A 1ZSHA 3WB1A 3H65A 2RH9B 2IDCA 5K8VA 5C8ZA 2R4UA 4M38A 5LGJA 1WBZB 2R0LH 1P6QA 4N6GA 3BK1A 4YRGA 4RK5A 1IZ9A 3ZT5A 4FNGA 2ZSVB 1RZ7H 4EFKA 3MUGA 3D8BA 4A27A 4DIBA 5EAIA 4KJYB 3I9IA 2JARA 1JAYA 3MV7A 1U04A 1DQDH 4PE5B 6REQB 1J2EA 5EQDA 1GTZA 3BZEB 1GPMA 5JIQA 1UDXA 2DM6A 1RZPA 5C0RL 2ZRJA 4UEQA 1WQVT 3OJWA 5I7RA 5CGTA 2JLZA 2CFSA 1MO3A 4E9QA 4FHZA 2P5EE 1P61B 4D9SA 3B9KC 4GM3A 2QKIB 3VYVA 3ZY4A 2M6SA 3EH2A 5LQNA 1YOBA 4P7GA 3IE0A 2PLWA 4KYTA 5BWNA 3FO9A 3RTQA 4B9FA 5I71C 3JUYA 4O51B 2G1AA 1J9RA 1USWA 3AWIA 3CSUA 1GKEA 3GMMB 4HDMA 4UM9B 4OYHA 4DLPA 5DHXB 2Y77A 4XI5C 5GSRB 4YUWA 3VR6A 3VD5A 3NBMA 4NBYB 2EGHA 5ALHA 1AQNA 4PCLA 3MRGA 4FXLA 4A6YA 2OYPA 3WFEL 1WLSA 3FOEC 3Q5TA 1T2NA 1MW1A 5JZBA 1PJRA 4H25B 1MCIA 3VR3A 2BSEA 2Y6SD 2FDCA 1VE1A 2QIOA 5A2AA 1RPKA 1O54A 1DDHB 4EOWH 2BSTB 4J76A 5B4WA 1YAHA 2WWYA 2CLOB 4PJXE 3VDRA 4OJCA 1WFMA 1FDLL 4ZJPA 1X8LA 5C0JB 1JVBA 2CNBA 4Y4FC 1D07A 4UTZA 1NFDA 5D8JL 1B16A 1FA9A 2J59A 1S4MA 1RJLB 3I7OA 4GKSA 2ICWI 3PL1A 3HKBA 5KNDA 4X9GA 2O5ZL 3D4NA 2Y0PA 3F5DA 2BVNA 2CSUA 4QWWA 4HN2A 4EFDA 5JUEH 3QR1A 2XMRA 1VXRA 3MNMA 4MULA 5KYKA 1NR7A 4D80A 2VRBA 5E8RA 1H6BA 2CKBL 2XCIA 4K23L 1UATA 1PJAA 4GYKA 4CUZA 4GYJA 5EZIL 3EZ7A 4R96B 1TIPA 4BGVA 4Y89A 1UC4B 2D5BA 4I4NA 2V3CC 4MS4A 3LWBA 1QUFA 4F46A 3C16C 4G9GA 1K4MA 3UC0L 2IWHA 1V16B 1FDIA 1PZGA 3OR6A 3AFCA 3HFSA 1OALA 3L4XA 2C3VB 4NQDD 4X93A 2HK6A 4D82A 4GI9A 1DTUA 1LD9A 1HYEA 2PWPA 3MNZA 3DVRX 3O2DA 2YD4A 2W18A 1J56A 3FOAA 1LE9B 2C2BA 1JIKA 2VJQA 1N3NA 2KLRA 2ERCA 2V33A 3E8UL 4CCAA 3WFHA 3RU8H 5TDOB 2WGNB 4FQIH 2BWQA 2XUKA 3R5XA 4WI2A 3NEAA 1A9EB 1GOTB 2X2IA 5I01A 1FPTL 2G08A 3UAJD 5A6LA 2GTZB 1J20A 1LLQA 3IPLA 3A23A 5EC8A 5J57B 1UQSA 3DEAA 3DSRA 1BF5A 2NM0A 2AR7A 4P2OB 4LXFA 2IPLA 4FKBA 4KO8A 3VU9B 4HHAA 5L7WA 3E6FB 1LFAA 3CNQS 2DP4E 4MZRA 4MGKR 3ZKXC 1YUKB 1DR9A 2APXA 1U3YA 1ETB1 3M8KA 4C4RA 3OX8A 3VGPA 1GYPA 4KK5C 4X80L 4YO0A 4ZUVA 1HEHC 2VDQB 4XWTA 3ZDZB 3NYWA 2BI7A 1TF4A 3LY6A 2XA1A 2D2IA 4ZJ9A 3UNXA 4MW1A 2WSDA 4LKCB 4O4IF 2QYTA 3AT8A 3GSRB 4HHWA 1AR1B 4XRGA 1RKRA 2ADOA 1M6WA 4YK7A 1RZ8B 1PV1A 2GMWA 2UYGA 4NAAA 1ZHKB 5JMRA 1Q92A 3TJZA 4KWEA 1A64A 3BESR 4HDCA 2XACC 3ZWVA 1Z8NA 2XUAA 1U9YA 2BIIA 3IERA 4ENWA 4M8QA 4L4VE 3EVFA 1ZSVA 4TUUA 3ZI0A 5H82A 2P24A 4UQAA 5LAXB 5IT9A 3PXHA 3KH4A 3HB3D 1RTKA 3MRIA 4NBXB 4Q3AA 1VEOA 1J48A 3FOLB 3KVQA 3L3KA 3ANMA 3C8UA 2V7QA 2XYQA 4U2CA 3QO1B 3EXG2 5FI0B 3PGA1 2H17A 2VT2A 3EYQC 4K9DA 2DPLA 3V8QA 3R3HA 1QBLL 4FADA 3LH2L 3VMOA 5A3ID 3VI4A 3U6RB 3UKOA 3MJ9A 2VSDA 1ZHBA 1KIMA 3QWFA 2IEAA 4KUEA 2XVYA 1E3EA 9GPBA 4JUSA 2WWWA 3SE9H 2J4DA 3NBFA 2PJUA 2IDJA 3CN3A 4WU5B 4B7LA 4LASH 3VX0A 3DXKC 1DEOA 5KQSA 4YBQC 5I7AA 2Y24A 2O0MA 1EDHA 4I2NA 4H5SB 1IM8A 3OHMA 3A1UA 2MQ0A 4AOWA 5FYJU 2F6AA 5KAQG 2BVEA 4PG2C 5M7QA 1LEGA 1TK3A 4MUGA 2X28A 1P0QA 4JM2B 3EXAA 4EQ6B 3TD6A 3ZZUA 4KMSA 1FP4A 2JG3A 1NUDA 3RZCC 3NSYA 2IMNA 5ECYA 3HUFA 3E6HB 4MDHA 3VPFA 3NACL 5EMNA 4OOFA 5JSZB 3H11A 4PIMA 2ICAA 1ROWA 3BWYA 2AI1A 2ZUQC 2PA0A 5HYVA 4GPTA 3ZDZE 3VGJA 5CYKB 4A2CA 3VFTA 3DWFA 1GDHA 4H3KB 2PLFA 4I0PD 3PQ3A 2VT0A 1BCRB 2P7IA 4O2FA 3D1LA 1BQLL 5SV3A 3MSPA 3KPOA 3U4BH 4WK6A 2CCJA 1G94A 4HRYA 2JKJA 1PNVA 5DLPA 1LWJA 4PNKB 2X4QA 1W4BA 1FNCA 2PYZA 5I9LA 2ZI4A 4W9IC 2A6IB 2Z8RA 1T0NA 2FSEA 3JV6B 5BSEA 5AW2A 3I9V1 5T4FA 3IAAA 1MLCB 1XJQA 1RHUA 3L4ZA 4XQ9A 4UJ5A 2OMEA 2IE8A 3QFDB 3G2NA 4JD2C 3TV3H 3HSSA 4LJ8A 5A3JA 3FFCA 1YDFA 2VTKA 3LIPA 4J82A 2Y36L 4AQ1C 4N40A 3VGBA 5D4JA 4KY2A 1OX6A 2C9PA 4UMDA 3RT7A 1U3UA 4QRQB 1V35A 4KDRA 3ARED 3L6BA 4BIMA 4G6MH 4DQVA 2CO7B 3OQVA 3T1QA 5SV4A 1Z4PX 1K5DA 3APCA 5C2BL 2HHJA 2I25N 4QDZA 1P17A 4Q02A 3IBYA 4HUXB 5IT5A 4AYEC 5FM5M 4CQMD 3HAEH 2FUG1 3S27A 4CEHB 3GIVB 1RQ5A 3SHOA 3S6CA 3OF5A 4PZ9A 1DAMA 5HM8A 4EKDA 3ZK8A 1GVIA 1KE1A 4QU0A 1V7ZA 5K8JB 1WHPA 2CL0X 1VF5C 3Q7RA 2CDCA 1BQUA 1U9IC 3AEYA 1PTJA 3L9WA 1V8FA 4M1CC 4XNXH 4P4SA 3L7EA 1GRVA 3LZPA 1NJ5A 5J40A 3KQQA 3RVVC 5BQOA 1QFWH 3AM5A 1KB5H 3E3AA 3CD4A 4CMEC 2Q5IA 3KB8A 5EIBC 2BMKA 2NPOA 1XDUA 5BS0B 1Q1EA 2QSYA 4G1FA 4LLMA 1PGPA 4KX5A 2NXCA 1U7XA 2VCEA 4S2EA 5BUGA 5DVPA 3VR0A 2YN4A 3OTQA 2FVXA 4DJMA 1ZPUA 3F78A 1X15A 2FWIA 4NBKA 5ALJA 1D2NA 3HYLA 1AV6A 2TRCB 5B39G 3MPUA 5DSCA 1PIFA 3LNIA 2VNSA 1NJ6A 2OCKA 5FYJH 1SQ6A 2DOCA 3TNMB 4ZCTA 2VZ1A 1MWAB 2D4DA 4GKAA 3ELWA 4W5NA 1E4VA 3GYBA 3EF4A 2NZYA 4XTRD 4ZVLA 3T2LA 4AO7A 1H6EA 1SVIA 4NFYA 2IWEA 2D0DA 3T52A 4XX1E 3Q5DA 3THSA 4K55A 2P7HA 3T4PA 5D2LB 1ZGCA 3KYIB 4G07A 5BRZD 4CNIB 3GGGA 4NQDA 1HHKA 2RACA 1ZU5A 3OMNB 5IMLA 5JDJA 1RT9A 1R27A 4WKNA 1RUAH 4L4TA 2GJAA 3NJNA 4Z0HO 3OKFA 1GOHA 3EOYG 1EFRD 5CD3A 1Z16A 4ND1A 2YHSA 2ZBEA 3BQNB 3RWFA 4ZQFA 4HZLB 3VZSA 4M0LA 1A7NH 1UG9A 1A6TB 5E8NB 3ANXA 2DQKA 2IDFA 3HR5B 4HAZA 3UAJA 4L3ED 3ZLVA 3SGJA 5KVSA 2IQAB 4W4NA 3VKUA 3DLHA 1RI8A 1SOVA 1SOXA 1HMPA 4BP9A 5IVDA 1G3RA 3V7AG 1C9EA 1UEMA 3H3XA 3HNTL 3SBWC 1CFZA 3H83A 3D50A 1C0PA 1G20E 3RRFA 1WA5A 1R9MA 2NTYC 2X3AA 1LB1B 1D0VA 1ZBDA 4FINA 4N7RA 3H04A 4DL9A 4ETYA 2V65A 1KAHA 2FJFB 1I9IH 1II9A 4LW8A 5JPIA 1V1RA 1Q17A 4LSTL 5AIAA 4QLAA 5IFJB 2J72A 1L0QA 2CHEA 1F11B 4X5XA 3Q0HA 8PAZA 1DN2A 3QTLA 4HR7A 4FWTA 3K0AB 2GAZB 4Q97A 1CU1A 5A9RA 5JR1L 4TNWK 1ETHA 4BKLA 3V0EA 4M43L 1NLUA 3DJZA 4BIKA 4BVEA 3PNSA 4GNKB 4XP5H 4WUTA 4FNLL 4Y30A 1RI2A 5AOZA 2GJ6A 4G56B 3EYFA 4LWOA 4DRXA 2WVUA 3R0XA 4XBEH 3SXUB 5D2LE 3KYCB 2AC4A 2NNRA 2AQHA 3D7SA 2C4FU 4NO2B 1XTLA 3CX2A 2L0XA 4KPUA 5CVDA 1KN4H 4DH2A 4JLRB 1JNHB 3QUMB 1DJHA 5DJ6A 4NQSA 2YJ3A 1E9VA 1Q1PA 3ND5A 3HZHA 1C1DA 1QF7A 3GFBA 4P9HL 3NHRA 5HYSA 4I1UA 1TF5A 3VZDA 1OAJA 2ZI9A 4HNAB 3FNRA 5DMGD 4BNGA 1KC5L 4J3BA 1IFHL 1LE5A 1Z9SB 3ZMNA 2YD7A 2DQGL 1KYXA 4NFDA 2PWZA 2NUAA 3UTQA 3GKWH 3TG2A 2I27N 3GM0A 4LDZA 3WN6A 2OV0A 1X7YB 4XGZB 1HT1E 2B2NA 3A31A 1K0FA 1JE1A 3FQNA 2OTUB 3H17A 1HKUA 1RFDH 2AITA 5FA5B 3JU3A 3K8QA 5IC5A 4BDTA 4GSDL 2VAWA 4V0LA 4BCYA 1T6BX 1UH4A 3CG4A 1MXDA 2CO4A 4J3UA 1QHNA 4HDOB 4HIJA 3GC6A 2O8BA 1RQGA 2HK9A 5LU9A 4LRNH 1AU9A 4LDLB 3KLHD 5FDWB 1GU7A 1BF2A 1DQML 4XIGS 1QVWA 3RYIA 2H8PB 4DNUA 1IM9D 4FMBB 4HF7A 4O8ZA 1NAML 5A05A 1WLHA 3TCXA 1R8JA 2X2HA 4JOCA 4UTAL 4I0PA 4BRWA 2BEKA 4CLHA 2O6HA 1V2HE 4JSYA 1IGYA 4NJ9H 1U8KA 2IAND 4DFIA 4EKJA 3GIWA 3L41A 4FFVA 1YFZA 4ZPVA 5KVDH 3OLDA 2IOHA 3FSVA 1SD5A 1VHJA 4DCCA 1T4MA 4CL2A 4IIZA 4R8SA 2QD3A 3H97A 3HFGA 3OCUA 4NN5B 3GJFA 3U0WH 5IB5B 1MAML 4KQ3L 3SR3A 4OKDA 3HA5A 4UFOA 2UY6A 5E08L 4PAGA 3CPHA 1NVWQ 3ILHA 3HM9A 2GTWB 3K0EA 4I9NA 4R2HA 5DFVC 2XUWA 1SN0A 2SODB 1ST3A 1Z4IA 3GH1A 1XRPA 3AGWA 2O0LA 3TBHA 5A3RA 2OMUA 3GUUA 3WFZA 3PZRA 5DN6D 5F88B 3X2EA 2PGLA 2C92A 1V6AA 1JLKA 5C1PA 5FDFA 5TDHA 2WQVA 3PUVA 4HFNA 2VJ8A 1TOXA 5E1QA 2P9BA 3U6BA 1E2PA 5LDHA 1ZOLA 3ZWMA 3ASNB 1P2SA 3IS3A 2BP8B 5HGHA 3BVUA 1JH8A 3VW3H 4XWGH 3GS7A 1R0AL 1FRGL 1M6VA 1N6NA 4FNQA 4WI0A 4DP8X 1O5IA 1I3UA 4FL4C 1QCDA 3I9V6 3GLVA 1A12A 3T34A 5F3HA 1G1KA 5CZKA 3W8NA 2GC4A 4O4IB 2BTOA 1G9XA 1CPUA 4AECA 3C1OA 2CXNA 5C0GB 2IJ0C 4MIEA 3M3PA 3ZDXA 1RLWA 1CD1A 1VFAA 1D9KD 4IRMA 5CB0A 5EWMA 2J0QA 3PWTA 2R11A 4HOXA 2YYAA 2ZWZA 4ZAKD 5IJKA 2M6RA 4YLCA 3W3AA 5D55A 3BXGA 3VRLE 1OCCB 2FGZA 2O93L 3B9VA 4FGLA 3TRKA 3KLQA 3S7TA 4BLVA 1A9TA 2W4MA 2FUG6 4N41A 2CNOA 2Y76A 5D7LA 4BZ2H 3OQPA 2VYCA 4HKXB 5I18L 5F5XA 1SH7A 3GNQA 2CE2X 2BZDA 5ERXA 2OAAA 2H45A 4F12A 4TSAL 2AEQL 2G60L 4N01A 5JWHA 4XTRA 3DXYA 4DJFC 4JHWL 3T9BA 4L8LA 2J56A 2PL5A 2VR4A 5GM1A 2BDEA 1WF5A 3KJEA 3IK2A 4WV3A 3HZKA 3W2GA 2VFAA 1P84J 1G41A 2O1SA 3VZRA 4AF8A 3QC5X 1E6OL 4JJFA 2EIMB 3VTMA 1RAMA 3NFPB 3QMMA 4G0WA 1P5UA 1YQ2A 1YMQA 2QC5A 3TONA 5JHHB 3BWSA 1JEDA 4NC4A 3NB0A 4OCXH 4ZQKA 3H5AA 4XLLA 1N0XL 3BKJL 4Z2YA 4YI3A 5SWSE 2YXDA 3N42F 4BZ1L 3GPCA 4LXTA 3L54A 1UJ3C 1IZJA 2XWCA 1HINL 1EFRA 2PZFA 3EDYA 1Z0UA 3OJ2C 2LZ0A 1QZZA 4AQ7A 4R5VA 4I77L 4YDNA 4ZO7A 2DU8A 1MB4A 3NCEB 3TLKA 5ILOA 3GGWA 3QBVA 4NH0A 1K66A 1TQBC 1B88A 2GZHA 3BMQA 1NDHA 4Y2XA 2QQLH 5J1TB 5GS0D 1ZLUK 1BHQ1 2XB2A 3D8MA 4N90E 3KM0A 2WBKA 4NWIA 3GEDA 1GCUA 3X11A 3ER9A 4J16A 3LTNC 3IB4A 5GV7A 3SE4C 4GYWA 3LRMA 3RL2A 3OSUA 1HA3A 2AGZA 2QL5A 3GJ3A 4AN4A 5MGNA 2UXFA 4HP5A 1AUPA 2UUOA 3V9FA 2GF9A 3Q2OA 3O45B 4KK6D 4HXAH 3ZHZA 3K5SA 4FHDA 3ZKQD 4JBXA 1DQJB 3VXMA 3CEAA 4G2AA 3ZI7A 3NM6B 2MTPA 3RQIA 4X91A 3EH4B 2D31B 3GZOA 1NCOA 2YLKA 3OKLA 1TEYA 3O9MA 1KOJA 3AT1A 2CJXA 5CAYB 3QYAA 3PHAA 4NIMA 4UM9D 4D8VA 5AENA 5DYNA 4LF5B 4PJ7A 4RAVB 2PCLA 5J89A 1Y4ZA 5F3WB 3DDZX 3W9EB 5IUSA 3K5IA 2ID4A 2QSUA 6FABL 4P3XA 5FLXA 2G63A 3UAGA 2DJIA 4L5CA 4L8SA 4Y6GB 3RU7A 4RESB 2Q20A 3HXTA 3VTKA 1QEWB 1OAZL 5DD5L 2DBYA 1PQWA 3IAM1 1KO7A 2GN6A 1X86B 4HH9B 3DX9B 3FF7A 5D2NC 3ULVL 1P4GA 1EDZA 5CGBA 4J4TA 4LQLA 4IH4A 3TQRA 4OUDB 3T6WA 4YSSA 4D92A 3DRQB 1G7SA 1YYLH 1UADC 4UJ3A 4RRPA 2P1YA 3UJ8A 3LSOB 1L7IL 1T8SA 1DNPA 4MW7A 1DV1A 2ZYAA 2B37A 4V1DA 3OLEA 1XZ0B 4HPYH 4YVDA 1U80A 1F56A 4MRMB 2EDJA 1UKSA 3BEWB 1RE0A 3FBGA 3NIWA 2H3NA 3F3HA 3HNVH 2ZBFA 1HQDA 3JWNE 5ILTH 1V8HA 3RC9A 1A4XA 3FB5B 3FQ1A 1VRVA 1WZIA 3RL1A 1L0BA 3NP9A 4PW9A 5AD0B 3VR5H 5HDQH 3PDOB 1TJGH 4BVLA 1NZDA 4XRCA 3FW6A 1NZRA 1WS6A 4C83B 1S8FA 2QVLA 4I18B 4BJHB 3EW9A 4B0MM 4BX3A 1GQRA 3C6QA 1VMKA 1O5OA 3DBOB 1PV2A 5AM3A 3UO8B 2PCFA 6NULA 5KYUA 2IANA 1BQSA 2AV7A 5B3SB 5KSAB 1XKTA 5K9KA 1YB7A 1K6JA 3RJQB 4XJVA 4YBZA 1UANA 1I14A 2BVQA 1CWVA 2PO7A 1CDYA 5D8DA 4Y8VA 3Q12A 3SYMA 5HX7A 1CFJA 2JLSA 4P2OD 2EP8A 1Z0JA 1T1ZB 1H6DA 1FFHA 4NZDA 2OD2A 4Z1OA 3G04A 4IRJA 3HC0A 2Q1XA 3UMFA 3NDIA 2YJ6A 3N04A 2P3YA 4U0RC 4PYQA 4I5GA 5KB3A 4KDTC 4W1PA 3TBVA 4HNSA 1VKHA 2AFHA 2BISA 5CS7A 4WASA 4EI5C 1UB6B 3GBPA 2D0IA 3HFFA 1DKMA 3QW2A 4QUJA 3HC2A 1JCVA 4Y7RA 4IRSB 2XQKA 4OIBA 2R29H 3DEZA 1S7CA 1JWAB 4OQ1A 4EVIA 1M8GA 5DMIL 3V4LA 3ECSA 1RJYB 1QJCA 2W6QA 1AR1D 1EG2A 1UMBB 3L7JA 1YSOA 3JSSA 1EQUA 3RVKA 3VRIB 1G4MA 4PRIB 2CVZA 4XRRA 4C0QC 3K2KA 4DV2B 3HU2A 1ZIXA 1JFTA 1A0OA 4X1IB 4OBEA 1I32A 3QULB 4MS6A 4E5ZB 2QLFA 4BA0A 2VIRB 1UJNA 2PSHA 4DIXA 3FVVA 5DB4A 2OZ4A 2DWTA 3IP3A 1V7ML 3HG4A 5L8KB 1A14L 2XMGA 1YEJH 3STZB 1YUMA 2Q0XA 3ABOB 3CZKA 1V5IA 4GP7A 5FWAA 5C6PB 1F0LA 1GU1A 3QORB 2P5EA 4HIXH 1ZS9A 1Q94A 1EJ8A 5HSGA 2P68A 5NLLA 4LTMA 1MDFA 4QRTB 3OKNA 1USUA 3AMVA 4WN3A 3ZVNA 1LDSA 3DULA 5BZXA 4DUZB 1EDBA 3OFKA 1LTHR 4BYHA 3S96A 2NO7A 3BD8A 2WLHA 1QSGA 1E6LA 1IGML 4U6QA 3S36L 3R7DA 4BUJC 3H8NA 2P7TA 4DWWA 1QBAA 3GDWA 2EDFA 2WB1A 3L0ZA 5LXTF 1XC7A 4WO4C 1B26A 4LCJA 2IBGA 3E8SA 1IOVA 4JM2D 3VCLB 5JHDB 4UNPA 1EBAA 4UE2A 4YS6A 1CFTA 3OBBA 2PLNA 2ZT7A 1ORIA 1M5TA 3TM6A 5D96C 4BFZA 2WSSD 1UZAA 3K92A 2KBEA 2R1ZA 2ZBRA 4JLNA 5HIAA 1KWGA 1FU7A 4UOQA 1XF3B 3AR2A 4PJXA 1ZI6A 1P7KA 1YR2A 3FB7B 1Y5RA 2QHRL 2BI8A 2C1OA 1YQXA 4NK4A 2DLEA 1CD8A 3PI7A 4Y1EA 1JI0A 2QTGA 3JASB