3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
5KYNA 1AOXA 4WK0A 1MJNA 1IJBA 3K72B 2VC2A 3EH1A 4UM8A 2O7NA 3N2NA 5BV8A 4JX0A 4UM9D 1DZIA 1RRKA 3EFOA 1RTKA 4WJKB 3ZDZB 3NIFA 4NENB 4MMYB 3ZE2A 1PD0A 4M76B 2NUPA 5LN1A 2VDRA 3TVYA 2VDKB 5FFGA 4IHKA 4G1EA 2VDPB 3K72A 2VC2B 3VI3B 4CN9A 5KYUA 4HQFA 5KYWB 1JV2B 3PPYA 3ZDYB 2VDNA 1ATZA 4HQLA 4IGIA 4F1JA 1U8CB 1ZOPA 3IJEA 4MMZA 1IJKA 2NUPB 4FX5A 3V4VA 4O02B 4IXDA 3K71A 3TXAA 2VDLA 1ZOOA 1BHQ1 2NUTB 3F78A 3ZQKA 4Z7NA 4Z7OA 1CK4A 2NVOA 4WK4B 3ZDZA 4NENA 3ZE2B 1RD4A 1V7PC 3ZE1A 5KYWA 1SHUX 5HDBA 1M2VB 3HI6A 1T0PA 3BN3A 4O02A 1NA5A 3K6SA 3EG9B 1L5GB 3EH2A 2IUEA 4HQNA 2B2XA 4MMXA 3T3PB 4WK2A 4WK0B 3T3MA 1TYEA 1YVPA 4XW2A 4Z7NB 4Z7OB 1JEQB 3FCUB 3NIGB 3V4PB 4WK4A 1UEXC 1AUQA 1XDDA 4C29A 2XWJI 3HXQA 1JEYA 3V4VB 4UM9A 3IBSA 2VDMA 3EOAI 1MQ9A 3M6FA 1M1XA 5KYXA 1N3YA 3HXOA 4NEHB 1QCYA 3Q3GE 1BHO1 1M2OA 5HJ2A 3PPWA 3FCSA 1SHTX 1MHPA 1PCXA 4G1MA 5E6UB 2QTVA 4BJ3A 2VDPA 3TW0A 4WJKA 3RAGA 4A0QA 4CNBA 3V4PA 1U0OC 2VDOA 4DMUB 5KYYB 1JEYB 4UM9B 3EGXA 3GXBA 2ICAA 2I6SA 5FFOA 4C2AA 2ODQA 1QC5B 4IRZA 4G1EB 1YVRA 2VDLB 1AO3A 1M10A 1MQ8B 4WFQA 4Z7QA 1LFAA 2X5NA 4HQKA 3VI3A 4UM8B 2WINI 3EGDA 4HQOA 4MMYA 5KYUB 3IJEB 5E6SA 1RS0A 3K71B 1XDGA 1ZONA 2M32A 3PPVA 1XUOA 1OAKA 3EGXB 2I91A 2VDKA 1IDN1 3F74A 4G1MB 5E6UA 3ZE0A 3NIDA 1MF7A 1Q0PA 2I6QA 3BQMB 4JDUA 5HGJA 1FNSA 2VDQB 1SQ0A 3ZDXA 3TCXB 4PN7A 1DGQA 3VI4A 2P26A 2ODPA 3EOBI 1JEQA 2VDNB 3ZDYA 3E2MA 4C2BA 5E6RB 2ADFA 3EFOB 1U8CA 2XGGA 3ZE1B 4MMZB 5E6SB 5ES4B 3NIFB 1JLMA 1MQAA 2VDMB 1QC5A 2XWBF 1M2VA 1M1XB 3EG9A 4Z7QB 3T3MB 4MMXB 4WK2B 3T3PA 2NUTA 1FE8A 2VDRB 3NIDB 1PD1A 1T6BY 3K6SB 3BQNB 3EGDB 4CN8A 3ZDXB 3QA3E 1TYEB 3VI4B 5HDBB 3FCUA 3NIGA 5KYXB 5E6RA 1JV2A 1PT6A 2VDOB 1CQPA 1N9ZA 1U0NA 5KYYA 3PPXA 3ZE0B 4F1KA 1M1UA 3FCSB 1IDOA 1L5GA 2VDQA 2WW8A
chains in the Genus database with same CATH superfamily
2NNXA 5AVVA 3EO9H 3CE9A 5CZRA 4KQ3L 4FHJA 4XQ0A 2QTVB 4HN2A 1YR8A 2ZG6A 4UBOA 1NL3A 4GMKA 4JKYA 1Z9NA 4OWRA 3SKVA 1RT9A 2H52A 1DEEA 5ED4A 5B7QA 4I8IA 4JFYB 3AR6A 3RRQA 5TFSL 4RZXA 3WDHA 2J8UA 1JAXA 2YQGA 4R0VA 1R6TA 5ELIA 3TJHC 5IEHB 3WE7A 4GKZA 1XV5A 5THXA 1U9CA 2AVNA 3MLZH 5IOKA 2NY0B 5HYJD 3ILPA 1OFHA 2P6RA 3LDBB 3CFKA 4HMEA 1G6Q1 4D3CL 4KPHL 3DGFC 1RIIA 3MV9D 4OCRL 3P4OA 2GOYA 4FLFA 2G6BA 3LN4B 3EMDA 5JPMA 4Z78B 4YBZA 4R0LC 1K88A 1N3IA 4BP3A 3U19A 4EI6A 3MROB 2OG1A 5AO9A 3ACCA 1CE1H 1WMFA 1TJIL 1VZGA 4GSKA 4JRYA 1G5IA 2PXYD 2Z8WC 5LO7A 4AJNA 3P0IA 5FYJD 3EYUH 3PVSA 3RFXA 4CT5A 2DQSA 3M8OL 1YZZA 5D2LA 4NZMA 5BXFA 4ZGGA 2FO8A 4W9JC 2YUXA 4G41A 1S9YA 5JMRA 1QYRA 2IBZY 1N5AB 3TZVD 4TV8B 1ZH8A 1M8JA 5A7FA 3NSDA 1JF8A 1AP2B 2ZJZA 3UOWA 4AJ0A 5EO9B 3OAWA 1PI3A 1XTPA 3TSAA 4ZIRB 1L9PA 1Q1JL 2E4TA 5F9DC 3H4VA 4L95C 2QKIB 2NSQA 4WY2A 1A1OB 3C6YA 3KLMX 4FFZA 3QPQD 3O8OA 3BP4A 4WZ6A 1D7FA 4WVFA 3BBLA 4X7BA 3X1YA 5CVTA 4BFRA 3OHMA 4Q0MA 2CRZA 3BMQB 2QV7A 1GUZA 2ZYGA 4WNAA 4Z7UA 4PJ5A 4NZUH 1DO8A 2ZUEA 4MXQD 5EC2A 3FR8A 5K03A 3VXOB 4LGCA 4ELMF 4TMFA 1O7JA 1XGUB 3VXSD 1OBCA 1Z3GH 4KK6D 3PWUB 2JCGA 4EJMA 1J1OL 4Z3HA 3MLXH 1UM4H 1RZJC 2BZDA 3UXYA 1UBKS 2VF8A 3I1YA 1MRSA 1S7TA 2ZF8A 2J9FB 2IAND 2NADA 4AXXA 1YC8A 3MV9E 2Y0SA 2QTNA 3WOVA 3ZCXA 4RV4A 1C1XA 1F7UA 1MFVA 4RIFA 4L5BA 2LU4A 5JIHA 3KD4A 2H0QA 2V1UA 2BVUA 4E42A 1ZK9A 3N1FC 3QWOA 2EEZA 2IL1A 2IA5A 4JGIA 4FZ8L 1B8OA 2OVRB 4DCPA 1NLUA 5D93B 5F1OA 4I4WA 4JVSB 4ZCPA 1CJYA 1MJUL 2CNYA 4C0AC 1IUKA 3NIDB 3EOYG 3L2LA 1JG6A 3T65A 1T1XB 3CGWA 1T20A 4OLVH 2P2LA 3IMBA 1Z06A 4R3SB 2XZOA 1AR1C 2AP2A 4U1RA 4KK5C 3NGBB 1O9HA 3RVQA 5TT1A 5NULA 3CH7A 3DA8A 2ZUYA 1IEAB 2V7HB 2YAHA 1S02A 4GM0A 1DE0A 2VH5R 1V27A 4QXMA 4JBIA 2PM7B 2OTWB 4XD7D 4GOSA 1Z9SA 1U7DA 1KWGA 1H2RS 1R5IB 4OB6A 3IAEA 4EKIA 4TL7A 3HPLB 2XBLA 3FNGA 4AG6A 3R7BA 4KQFA 2KQMA 1HHKB 4JM2C 2LLLA 4K9DA 4RF3A 2DLCX 4AT1A 1T80A 5FPHA 2A1IA 5DSCA 3O5AA 4U6SA 5I3ZA 4ZD6A 1PJTA 4PJ7B 32C2A 1ZMTA 5ICXB 3FY4A 2WTRA 2J09A 3CVHB 2ZJ4A 3IBGA 4JI5B 3NCBB 1BSIA 1N64H 3DIVA 3OSUA 3LVBA 4F7CA 1TCRB 3WJMA 3UC0L 4C2AA 3UA4A 2BFCB 4PREB 1ZVQA 2C2YA 2HNKA 3GW8A 1FORH 4G5GA 1DSYA 2UYLB 2NY0C 4IOFD 1O75A 2FEEL 2X09A 2HWYA 3Q8KA 3ASYA 3P2YA 3HG1D 3LLMA 1OD7A 4HC1L 3NCJH 1U2SA 3K20A 1GKEA 3KJXA 4L6IA 2OV8A 5JC8A 2GIMA 1VEMA 1FFBA 3R6WA 3HBLA 4TLEA 3ZZUA 1W0VA 2QTBA 4CUKA 1OVGA 2NR6D 2GZ3A 2Y1KA 3LV3B 1KAQA 1A6AA 1QLFA 3IAM6 1P6QA 4XTRD 2OYSA 1FQ9C 2EDJA 1P0SE 3TNMA 3KBHE 1U36A 4TKUA 4S11A 1O6SA 5FUVA 2WWIA 5JSYA 3OGOE 1ZVVA 2ERYA 1HNFA 3KUCA 3WENA 3IJCA 3DMMB 4HV8B 1JQKA 4IG4A 5ALJA 2N0KA 5J9PA 3KQWA 3ZKWB 4C4SA 5HGBA 1DHTA 3BXPA 4EG4A 1FTSA 2OX5A 5HPYB 2XKJE 4L4VB 3JZGA 1V2HE 3FBGA 4HIXH 4MVJG 4QTHB 4ILKA 3PPYA 2FPIA 2H3NB 3K8KA 4XUDA 4FA4D 2PUAA 4O02B 2ADFH 1BVKA 2C9VA 2VNHA 3V8CA 4OZGA 3EBGA 2XUWA 3GT0A 5C51B 4UM5A 1ZWIA 3NHKA 4E94A 4ZOZA 2WD0A 1SNYA 2WLLB 5BZXA 3IKJA 1QRRA 1OPGH 4GW1B 1VYUA 3DE6X 3G0OA 2O2ZA 2WQVA 3CUTA 3LTVA 2ODNA 5HGDB 3ECQA 4NOMA 1G7IA 1XXDC 1T91A 3UNXA 4CY1A 2ZUVA 5COAA 5AVKA 4TTRA 4N12A 1LXMA 1CUSA 2D3TA 3WD5H 1QIDA 2O8CA 1MVUB 3VPSA 3IMSA 3IJPA 1CGXA 3BZEA 1QGOA 3TXYA 2VAAB 4KL8S 4DCSA 2GTWA 5AOBA 1ZHLA 3DYIA 3MLYH 3F1LA 5FEUA 4KBGA 1ONQB 1AB5A 5KS9A 4W9IC 2D1FA 4D4IA 2NAPA 2P1RA 1PD1A 3HA7A 1XQ4A 5I1GH 3F96A 4PZZA 3HN6A 4OGQC 5EQTA 5A4JA 1F1DA 2HAZA 1GYVA 1BMTA 3UEZA 1H9VA 2FAXA 2EZUA 4F3FA 4BNWA 1CZ8L 2Z6FA 2FUEA 1HQCA 2NU6B 1RWQA 3TXXA 1A8ZA 1ED3A 1KXTA 3L3KA 4MJ4A 1TLMA 3GT4A 5DI8A 3S3JA 1JOIA 4QGTA 3JQ9C 1E3WA 3SKNA 5CA1B 2LTQB 4H4EA 3OR6B 3VNBA 3OAYH 5ESXA 2BELA 1ILWA 3CHQA 3TVMA 1ZS2A 4IGBA 2H6UA 5FQOA 4ODWA 3W5MA 1OF2B 3MZTA 1NPJA 1JPST 3GP3A 4EZIA 2C9UA 1XGQB 4J73A 2FR8C 3CLUC 3ZE1E 1ICEA 4IBVA 4X62B 3GDBA 3GAZA 3ULVC 4PRYA 2XWJI 4A8TA 3VPDA 3OOYA 1I4LD 3O2VL 5FW7A 4GC9A 4U3SA 3KCNA 4O2LA 4B3BA 2AQ3A 3SQOL 1LTXA 5DD5L 2WQ8A 1DAEA 4L5JA 2FW8A 2QVBA 3BN9D 1XR9B 3UKDA 4I0PB 5JJLA 1PX4A 3VGBA 3DPSA 5IBRA 2WF6A 5T8KA 5HYNB 1O8BA 1KMIY 4P4UA 3GXNA 5F2KA 3WLOA 2H00A 2WSBA 2YD1A 2BNRA 2R0LL 3NT4A 2JSFA 5AVQB 1Q1PA 3D0QA 2ENPA 3LX8A 1RAEA 3WQSB 2KS6A 2HJKB 3A1WA 3AILA 1JE0A 1BZ9A 2B1RA 4ODVH 1POXA 1RKXA 1X5JA 2HJGA 5K3AA 4G5RA 5K1NA 4WNYA 1PYGA 4EDWH 4DMKA 3PIIA 4JO4L 1YUKB 2PPCA 4CM9D 4CV1A 3R9KA 3L5XH 3QHFH 2DD8L 4D0BA 5FFGA 1OSZA 3PNBA 3HXTA 4RV9A 2ATKB 2ZX9A 2HVKB 1F9AA 5TF1L 5EQJB 4PPFA 4H8WH 3E7JA 3FN4A 4LYGA 3DMTA 3LRMA 4D0DA 4RAQA 4WY7H 5E7BA 3GJEB 3WGMA 1WRBA 4PJAA 2HRPH 5J8OA 1YQDA 4X6UA 3ARSA 4KLRA 1JXOA 3AP3A 3QBTB 3V1KA 1MUJA 5KEIA 1U9KA 1EERB 1E5VA 5FT9A 3QQDB 4JFQA 1ZCAA 4KNVA 4HAFA 4U0KA 3IT8D 4U2YA 1A0RB 1I4EB 3V4PH 5DGXA 3IBEA 1WQ3A 3PXSD 4BHUA 1D7AA 3SDAB 4I3RH 5EBLA 1TZGL 4D9QE 3N9IA 3TW8B 4S1NA 3IF1B 5JZSA 3OJCA 4DREA 4ARSA 2L3BA 5AD0A 2F1JA 5M7EA 4E0RA 3VJLA 3HBGA 2P80A 2AJVH 5I6NA 4BKUA 1XTQA 1IUZA 1Y3CE 5L4JA 1CB0A 3B53X 3CIQA 4GL4A 5EEHA 2JAOA 2Y2TA 3PBKA 4C30A 4G7RB 1EJ8A 3UMFA 1RIVH 4XC1L 5DD0L 4FUTA 2PCPA 1ETZB 2R86A 2XUDA 1VIDA 3QDGE 3C15C 1BREA 2P2ZA 2H7CA 5HTOA 4FLSA 1KJVB 5FKQA 1HOCB 5HJBA 5FB3A 4K07A 1Z9MA 1J8SA 3QG7H 5HP5A 4D5GA 4QOKA 3HC3H 4Y5VC 2HA2A 3K2QA 2XN2A 3A0FA 1SC6A 4OV6B 4MMZA 3STZA 1DQIA 3N6YA 1VRWA 2QC5A 2V74B 4BRZA 8MHTA 3ZDXE 2EVHA 3Q9UA 2ECFA 2LVCA 5H37A 4ZFNA 4CTNA 2F90A 3AVXA 3NVQA 1H93A 4GRLD 5FPSA 5L4IA 3ARGA 2J71A 3G9AB 2ECKA 1OYWA 3BH7A 5KTEL 2BKAA 3SWSD 4ZV4A 3KLLA 3EHDA 2ID5A 4LI0A 3HZ3A 2DOCA 121PA 4D94A 2ZIZA 1FLTX 1DC5A 3DE0X 3DE4X 3KKPA 3REVB 3RVRA 3HPRA 5C09D 2AKAB 1EXGA 5DK6A 1XUOA 3AP2A 4A0RA 4RY2A 1LBTA 3S6JA 4W5QA 2IPTL 1E77A 4M5ZH 1B0GB 3PXHA 3UYPB 3ZWKA 3EUWA 1U3ZA 1O5IA 5JI2E 3GFBA 2Y68A 3VOTA 4QPPA 2F5BH 2CJTA 4FCHA 4XM1A 3SPVB 4PNPA 2GFHA 5I73B 4MPRA 3N04A 5I1AA 2Q5IA 4PYMA 3K81A 2JFBA 1D4FA 4RFNB 1NXWA 4KTTE 5GV7A 2IXAA 3IXQA 3AIKA 1EIZA 3K5IA 2ZRGA 4MR8B 2Q2QA 3EVDA 4B4VA 5J56B 3I9V1 3DHWC 4PY8J 3AIOA 4G4SO 4US2R 4HJIA 2Y5TB 3HTLX 3HFQA 4RGVA 1HCYA 4IHKA 3OA2A 5IDYA 4BLSA 2BEVB 4EDHA 2C5AA 4S0ZA 3QULB 3F5QA 1XD0A 1SUDA 1K6IA 2CXOA 4YHZH 3H4MA 5HHQA 2UKDA 3SYCA 5SWZA 2P0EA 1YA8A 4FYTA 4KKBC 1SOAA 5ICFA 3PL6A 4FL4C 2HG0A 1NE2A 1T2FA 2OO7A 1Z4NA 5I71B 3MGOB 3QNFA 3UVKA 1ADQL 2R60A 2P8SA 4Q8BA 5CVUA 1ST2A 1Y6ZA 3M6FA 1Z25A 4D42A 4CCWA 3OZLA 3HFFA 4AC4A 1P1JA 4LSSH 4UCFA 3RFZA 1A6UL 3S0PA 4EHHA 1HE7A 3N2KB 1QYXA 2P7HA 3BI9X 1E3SA 3V4RA 1B9ZA 3OB8A 3KPSE 1NN5A 4GBJA 1EFAA 4N65A 5ALRA 1J8MF 3AS0A 1WMSA 4NXKA 2O3RA 1YEHL 3B7YA 1CJKC 2J56H 3ITEA 3C3PA 4DEPB 3OSZA 1RZRD 4NJEB 4H8WC 1E4JA 4N0UB 3WIHH 3BVNB 1KELH 2JBAB 1E2WA 1DFIA 4HLZH 1LWRA 2BNRE 3QK0A 2GCYB 3U30B 5AM0A 5IMSA 1KV7A 3VXNB 1HGXA 3MJTA 1JG9A 2JKJA 2NZ9C 4XX0B 4B53A 4JFED 4OIFA 4GQAA 3EEQA 3G8BA 1TJIH 2WSDA 1JXJA 5I0VA 1CDOA 1JLRA 4KI7A 1EX9A 3I2IA 4C0JA 3E3QE 1YRYE 5EIHA 3LQZB 3RQSA 4HVCA 1MKYA 7YASA 4DN6A 4NS1A 5KYTA 4WOBA 3O2VH 2W00A 4Y9EA 3I28A 4Y5XA 2AJTA 2WQUA 5LDGA 1EX7A 4CEHB 3SKMB 1KNXA 5AI8A 1COWD 4UQEA 2E75C 3TTXA 1TFUA 4MK4A 4JM2B 2ZICA 4YJ3A 3KAPA 1SGWA 4N5HX 1JQEA 4R01A 1CTOA 4N68A 2GSGB 3FT0A 1NVWQ 4MQFB 1JG1A 3K4ZA 5CUSH 3X1WA 1T4CA 1GG2B 4JS0A 3BT2L 3RVTC 1IY0A 3PS9A 5AKJA 3LS2A 3ZQUA 3IEKA 3EDOA 5EYPA 2I7SA 5D5MB 3O83A 3EK2A 4AK2A 1AHKA 4KUZL 3MRRA 1P9WA 1FFTB 1YQ2A 1HAWA 3MRDA 2FBRA 1Z8DA 4EQ2A 2VPZA 3B8EA 3RURA 3KLHC 4TLSA 4J8BA 4AQ8C 4NMHA 1W48A 1LLQA 3THML 2QGNA 3G08A 5A4FS 2XXBA 2WIMA 2VPIA 2CFIA 3O2QB 2VYRE 4AL8C 4ITVA 3WO4B 4PNEA 5E4EB 1EZVY 1E5QA 4KXNA 3HKCB 3OESA 3OKDA 3EYVA 1EHYA 1AGYA 1MFCL 1HKFA 821PA 4IU2A 2VERA 3RBSA 3TE6A 4JENA 1GADO 2ZEJA 2QGFA 5C1OA 4DCUA 3K2BA 3EQZA 4K9EH 5T41A 1HL8A 1WT5C 1H8EA 2GTIA 2B35A 2F8IA 3F71A 4EHDA 4CM6A 1O77A 4A5SA 4NP6A 4YLQT 2EFGA 4L73A 2NTNA 4JDTL 4Y98A 3P27A 2PMFA 1FL6A 2C3VB 3H05A 3UTOA 5BQOA 1HN1A 4UDXX 3WLBA 2ZTSA 3ZZSA 2N56A 5C2VB 4RX1A 3LDBC 1GYUA 1KLUA 2P2GA 2H4FA 2A9QA 4KEAA 3NPZB 4OQNA 1XAHA 3IAS6 4YT4A 1HZJA 5LNK1 1JXFA 2JZCA 1IEHA 3REQB 4RMTA 3WNOA 4IDDA 1A9SA 3GJ7A 1KGYE 4GSYA 4BCZA 2RHBA 5LOVA 4PJ9A 4CU2A 1LQTA 1JKJB 2QF7A 3DEFA 3LZ6A 2FUNB 5KBMA 2J3HA 4IM8A 3OQJA 1Q94B 2QZJA 4U7MA 4O2FB 1XAGA 3NBQA 4TT3A 2YPVA 2JI8A 5HY9A 2HMIC 4BV9A 2PYFA 2D3NA 3DTYA 2WHRA 4AZVA 3CN3A 3U48A 2NXZB 4DCMA 4B7CA 2QGEA 4HFMA 2BT4A 5FUWA 5C1BA 3HJRA 3U1SL 5ID1B 3CDGB 5D1XD 2LD4A 4GFXA 1AZCA 3O4VA 2N0MA 2YUVA 5A5DA 3O6FD 4OMCA 2Q5OA 4OAQA 5K0ZA 4MRSA 3O4FA 3BUSA 2EXYD 3DUSB 2FP4B 3ZHUA 5L4LA 3RKDD 5C37A 4QXUL 2VDNL 4Z7VE 3V34A 4CTMA 4Q4AA 4DIXA 1N25A 4PG6A 1EUYA 5IBLC 1BGXH 1SHKA 3HHRB 4CMEA 2VQUA 5J2UB 1MPTA 4LVUA 3HAEH 4E5MA 3RRMC 3E6HB 2ZKLA 3NBUA 3VHQA 4XYLA 3ZZ1A 3B36A 4TSCL 3N8DA 2PFSA 4FQIH 3SE4C 1CR9L 1QFOA 2JLPA 3HE7C 4O5LH 4ZTPL 5CTAA 3BRSA 3WLNA 3WRWA 2VQ1A 4HISA 3WY4A 4XJVA 1WB9A 4JPWH 5IN5A 4LLWB 1RLJA 5CB4F 3QTTA 1KZYC 4CY3A 3LECA 3SZLA 5LQBH 3U7FB 1KY5A 1FNLA 1U0RA 3RTDA 3D4GA 3VQTA 2A9RA 5FYJE 5LXTB 1JIJA 4QIRA 2HTKD 3VH8B 4H35A 1EP9A 3D4OA 2OVQB 4CVUA 3NWPA 1K8RA 4HAXA 1P18A 5B58T 2WIDA 1ZK1A 2UVDA 4R69A 3Q6IA 2Y06H 3QNMA 1Q9KB 4NRXA 5CEJA 4I0PC 5BR7A 3HBZA 3B2VH 4ZI7A 3I9IA 2D00A 1B23P 3Q7SA 4U49A 3HI5L 3DXAA 4P5PA 4NBSA 5KBDA 4JP5A 4FR5A 3BJLA 5C09A 5DSZA 3RPIA 3IJ8A 3L5IA 2EH7H 4WOCA 1YQ9A 2HKAA 3UQYS 1RQXA 2GFQA 2BNUB 4S35A 5ESRA 4JI3B 1U8YA 1CQPA 4HP8A 3J81A 4Z0XA 4M7LT 3MSPA 4U1SA 1Z0ZA 5CCDA 3U9UA 3H9QA 1VJ1A 3WNIA 4ENZA 3EFDL 4ZS6C 3M1BA 4B6FA 2YPLA 4XO3A 1OTHA 3UO1H 3IQWA 1ZHHA 4DXDA 1P7KA 4I5IA 3WE6A 6AT1A 5A6LA 2VP9A 3V3KA 3LRGA 1YMUA 1TNMA 1ZC4A 3GQFA 4IYKA 4OCLC 1LO4L 1ECYA 3UCFA 3H4FA 3FZYA 5KTOA 2DCUA 1DKUA 1NA8A 2C1OB 3POCA 3L4YA 4C4KT 4X5RA 1OMOA 3IUYA 2JK1A 5JZ7C 3SO3C 1AI1H 1W72B 3FPSA 2ARJQ 3F8WA 3ZWVA 2BIHA 1Q72H 1FNNA 3I92A 5KNCD 3LRKA 3S5LA 3UZQB 2I66A 2QENA 4CTJA 1U8XX 3A1UA 4TTVA 4XZ3A 1I7RB 1WZ2A 2LAGB 4AH2A 3K1ZA 2PUGA 3UN1A 3FROA 1S5IL 1GU1A 3H11A 4FHDA 3EVFA 1DQSA 1QS0B 2NTSP 1EWYA 1G5AA 1A25A 4NWUL 4TKLA 2IDCA 4K3JL 5I4CA 5J6SA 3AOEC 2R4QA 4N2IA 5F0PB 3RU2A 3L8DA 2AXJA 1M71A 1XIVA 3KVQA 4WV1A 3WMSA 1X9RA 3BIBX 2W2LA 4HS9A 4YVDA 2A9CA 4WNJA 2FSGA 3M8OH 3PHQB 4UATA 4U2BA 1XKTA 2DTSA 2Z5FA 4YT2A 4J2QA 3ZE0B 3M9LA 4PCAA 4OVVA 3RAJL 1YZUA 4ALMA 1KRWA 2ZRAA 4GW5B 5EEUA 1DKLA 3A4DA 1I2DA 4F3CA 4LGSB 3VFSB 3L2OB 1WAAA 2BFVH 3HRPA 4QFDA 4KDVA 3VXUB 4UB0L 4RY8A 4BEVA 4L8CB 1N6NA 2BVYA 3VJRA 1R5VB 1HQDA 3R6TA 2AJXL 1P4BH 2HO4A 4ND6A 4WLCA 1KI6B 1LNUB 1D8AA 3TO4C 4XX1E 2EDFA 5JAZA 2C84A 2A0LD 5JVDA 2AT1A 3H5AA 1RAAA 1GA1A 1FTGA 5E5MB 2QXTA 1SQSA 1LBIA 1W8DA 3WL9A 1MX3A 4EUSA 2HRBA 4HXFB 2CK2A 1FDUA 1X1SA 2ZK7A 3SO5A 4KDTA 2F5AH 3EXJA 3X13A 1XU9A 1DAOA 2GPWA 2YDYA 3PNOA 3E9EA 2ETWA 1U63A 1HE2A 3GB7B 5EC1B 3NOIA 1LFDB 2OORC 2KMLA 5FM4A 2X4NB 2XD4A 1R2QA 1YOBA 1M66A 4UTBA 2YHIB 3CV5A 1R3HA 5ENDA 3T7IA 1ET8A 3HE6D 2TS1A 3B2NA 2IS6A 2AQRA 3M1IA 4X92A 3RB8A 5IGXH 2OXCA 2XQBL 2Y69B 3SE6A 4DLSA 4LOKA 2NMSA 3OQOA 1YFJA 4FJZA 3L7IA 1WZ1H 4GWLA 4HNVA 3DT6A 2YFOA 1KI1A 2HCBA 4BH7B 3B5HA 2P5WD 4FFVD 3FB4A 5HXMA 2BUAA 3VKFA 1Y1DA 2VQTA 4PS3A 1E1LA 2J2ZB 4WLEA 4Z9BA 5KB3A 3DX4A 2X4RA 4C0SA 5MERB 1UZLA 3DFUA 3H4IA 5KYXB 3W56A 1WW3A 2ARWA 5IOPA 5CXBB 3QR2A 5GY7A 1RUAH 3KBEA 4JFDB 3FN0H 1URLA 4XRCA 2Z92B 3CMGA 1AY1L 2L0XA 3ETSA 3JZ7A 3SE9H 2J4DA 2P6PA 5C5IA 2X9XA 1XZ8A 1NMAL 2HREA 3AU1A 3JQ8A 1LWJA 3WVNA 1ZHKA 3MTRA 5MN6A 5KMGA 4JQXC 5I1CH 3VFWA 2GVYA 3TEMA 3CCFA 5CU7A 4F15C 2Y77A 3ZDZA 3U26A 3T3PE 3DE7X 4A15A 3ARQA 3DOFA 2GWHA 3IV6A 2P9IC 1N5AA 1PNOA 3VDMA 1TF2A 1JVKA 5DSXA 4GUCA 4B0OA 1XFPA 4OA8A 1PUJA 4I99A 3TP4A 4D9RE 4WLUA 4QJIA 3CINA 1H2BA 3M33A 3GJ5A 3NW9A 2P5WE 1QP8A 2FX9H 2N7SA 4YHKL 1TAUA 1WNFA 3BDXA 1PZMA 3MPCA 1G6VK 1H3GA 3UG5A 1P77A 2JJVA 5CJBA 1NMYA 1QH1A 1SCNE 2D4AA 4YHKH 4WESA 1HIMH 2HVJB 5B1YA 3FPKA 5L3QA 3PY9A 1NM5A 2EEAA 3RS8A 5HBGA 5BPPA 1YJCA 2Y99A 1NXTA 2GRAA 1E2UA 1EGAA 4PJ5B 3V42A 3W2HA 1PDWA 2PY6A 2X4PA 2PMZA 4GKNB 5BOSA 1BZEA 3FLBA 3VFOB 4P23D 3FSZA 5IFJB 3P9NA 1J9CT 4NPAA 4AU1A 4WEQA 4XPIB 3FQXA 4M62L 3U30C 4X64B 1ACXA 2B1HH 3KPSA 2GZ1A 2EBUA 3ZQ4A 3IP3A 5CILL 3FZGA 3V33A 4C4ZA 1KAMA 4UZGA 2VHXA 4GPBA 4IS6A 2V3DA 2GYWA 3GGOA 2ADIB 4LSSL 3UR4A 4Y4HB 4M8RA 1FNGB 1KYQA 1SVLA 4OSOA 1YB2A 5KTNA 3ITKA 1JMXA 2A4MA 5IX8A 5I8OL 3QKRA 4RL4A 4H8PA 3PJGA 5GPRA 4OLJA 5B2FA 2KDYA 1UWKA 2BSEA 2P65A 5SWSB 2B8NA 3ELDA 2UZIR 4XBPA 1EPUA 3KGUA 5BN1A 4ECNA 5IESH 1P73A 2CO0A 3OPXA 1BJKA 1T6ZA 4MGXA 1T5OA 3UXFA 2OMVB 1VPEA 2JJ2A 3S70A 2X1XR 3T65B 4D0NA 3GLKA 1S2IA 4EL5A 3QXXA 3C9NB 3SVWD 2H1PH 2IYNA 3TZEA 1WKVA 2YBRB 4K8RD 2Q8BL 1I3LA 4NL4H 1AQIA 3AR2A 3M34A 4AM0A 2NY3C 3NHYA 3KJNA 4QNMA 2ZWSA 2AUMA 2ZP9A 3STHA 1NLDL 2CXRA 3CFTA 2JXMA 4ZJ9A 1NY5A 2V7XA 2BGWA 2Q21A 2JJSA 4DGWC 3EDKA 3B2DC 4Z9FA 3S35X 1WUTA 4EY4A 3N43F 3HPLA 5JTWA 3M9WA 3MZ0A 4FBMA 2WXOA 1LX7A 2I3BA 4DKXA 4MS6A 3O4OB 3QUZC 3IDOA 3DVQX 5AVVB 5DEZA 4D80A 1MB0A 1VE5A 4LXYA 3DBIA 3U9PL 1EMTH 3PUXA 2WO2B 2XTLA 3UTTB 5I19L 3MRCA 4G42A 1QEWA 5JHDD 2WTRB 3TF7C 1SEQL 1YS7A 5JORA 3FCYA 1F90L 3BB4A 1TVDA 3WJMB 1UM9B 2O7RA 1NDMA 4EG6A 2DKFA 4ZVOA 4OI0A 2XU9A 2LT9A 3MODL 1XRRA 4C7JA 2P6OA 4B41A 2YV5A 3NIWA 1WGOA 2JD1A 1E7VA 3MLXL 4Y1AD 4G0NA 3MFFB 5FHBL 2MCPH 4XI5C 3QFTA 3AWEA 3DVRX 1Z73A 4L1SA 3VSBA 4UILH 4A7PA 4WI5A 3K1JA 5DBIA 4N0CD 3I0MA 2XXAA 1TQ4A 4JRYB 5ICYB 5FOXA 1BQHA 1GTNA 4WJKA 4RV5A 4EITA 1W36B 4ZZ1A 4DF3A 1W1WA 2VP5A 5J9PB 2F3SA 1S9WB 5LKAA 4L4VA 1MH9A 1K98A 3ZOZA 3LXRA 3TAHA 4G70B 4QRTA 4QTHA 2DQFB 3QX9A 3TEJA 1H8SA 2Z2KA 4LOUD 1NI4B 3G2OA 8OHMA 2K3HA 4F8OA 3QUKB 4B8YA 5TXGA 4ZDHB 2QQNH 1J8HD 1BLNB 4DNFA 3PICA 4K6GA 2PO7A 3AXIA 3VI4B 4FFWD 4K73A 3TLAA 3M49A 1U0NA 3AFGA 1UXHA 2D7MA 3UMNA 4FOOA 1SJMA 4LZWA 5GGRA 2UY6B 4OB7A 4S1RL 4UM8A 1KVRA 4WNAB 5DMYA 2HLPA 2P3SA 1CIVA 5E0OA 3DX3A 4XNMA 4OIIH 3K0KA 1DBIA 2EDAA 2K6WA 2ANBA 4X1IA 3U49A 5LAXB 4OFYD 2CNKA 3UG3A 3ZHNA 2G4VA 3FHQA 1C3OB 1I2ZA 5CFMA 5IFHL 1NOFA 3X2FA 1CETA 3GI8H 3KPQB 4EJ2A 2M1ZA 2CMRL 1OPOA 1UJTA 1LGYA 5EEXA 4WRLA 2BSRA 4JUDX 3EZNA 4LWPA 1UJ5A 2NYUA 3FWHA 3DK0A 4XODA 3AY4A 1AZRA 1QLEB 2F15A 1X5HA 4HNRA 4HGPA 2VBFA 3V5DA 1II8A 1EFHA 1BAFL 3U83A 4MQUA 3MA0A 3FFCD 3K5SA 4TV3A 4AYFB 4EHNA 2FVXA 3EQ2A 1HEZB 3RUHA 4YXWD 4QATA 5DI8B 1EWRA 2C54A 1DAMA 2CB9A 3L16A 1RFDH 1VLMA 3CU7A 4DM3A 3SDSA 4G6KH 2FR4B 1J2JA 1YTUA 2G67A 3VU9A 4JYCA 2SNIE 3ELYA 1MEOA 4I81A 4KIUA 1DADA 3JQQA 1IBKB 5BRQA 2XV2A 1L4LA 5KWSA 3S3DB 3PGFL 3QXHA 4JBWA 4CQMD 3BIWA 3SZRA 3W7AA 4CN8A 2IHUA 4A82A 1M1YA 2FG6C 4HXGA 5H3LA 3HIZA 3SXUB 1R0AL 1S3FA 3JZYA 1QPXA 2X5XA 2VO8A 1YBMA 1P75A 1VI6A 4FW9A 1LD9A 1LBSA 4DM7A 3JYLA 5AJYA 4K03A 3P2EA 3UENA 4H26A 1VXOA 3NVAA 4WA7A 4RS3A 3GLTA 2D2CC 5DFWH 1IGYA 2VNJA 1BV8A 5JG7A 5DSCB 4B80A 3FNHA 2ICEB 2KZKA 4C56A 2JGFA 2SCUB 4W6YB 5LGHH 3QF7A 4W9DC 2YOAA 5ITSA 1ET5A 2J73A 1Z6GA 2HJKA 3PA8A 1R3JB 1JUFA 3BZFA 4XCNA 1CXFA 4AXWA 3WAJA 4TVPE 2ZXEA 3PF8A 1RZ7L 4YPJA 2FZVA 1CLYL 3PK0A 3QH4A 3WDSA 1NGZB 4XOIA 4AULA 1KJQA 3P4NB 4PREA 2XWXA 2JF1A 3CM0A 1SBTA 3RAGA 1RBQA 1DSSG 4FAVD 3FNQA 5J63A 1ID2A 1IX2A 2Y23A 5AALA 3Q5EA 4MXQC 4RKFA 3W39B 1DRUA 5JAHA 4G89A 3EDEA 1QOKA 2HHJA 5ERGB 2XPZA 4ZQTA 3ZCSA 3GJXC 1XCBA 5GJTL 4G63A 2FZLA 1LY1A 3EIHA 3H2SA 3KPNB 1GDDA 1MJJA 3BORA 2B1AH 1RWWA 5EF3A 5CSZA 3PUKA 4JDPA 5H8WA 3BQ9A 1KPRB 4U7AA 2PV0A 1F2VA 3UFBA 2JLYA 1JR6A 1RZGA 4RTNA 1IZ0A 3NVDA 3SMVA 3AJRA 4HFRA 1IJBA 1GSHA 1RY7B 4D8VA 3BL8A 2FWLB 3Q5OA 2OZKA 1ZM3A 1YSOA 2V9ZA 2QSCH 9ABPA 4RD1A 4U7TB 1VPVA 3HMXA 5CAYB 4ZAKC 1SUEA 2YYYA 2R2HA 1VHWA 1YVDA 2A5GA 3TBTA 3X14A 4KFRA 2FQWA 2GJ6D 5DM0A 4W70A 2R0ZH 4O3FA 1ZO8A 3UMBA 4YMIA 1ZLWH 1XGRA 4ONHA 4PJ8D 5B7MA 2MQGA 2W8BA 2Z3VA 1KYWA 3M81A 3BPNB 4YL4A 1A97A 2CFRA 1IC5L 3EO0A 3BHBB 4IWYA 1AK2A 5K59E 1NMQA 3NBKA 4Q24A 3EG9B 3RGVB 5FAAA 1IEWA 4R7GA 3F4BA 4A7GF 1RM3A 4FGJA 1ORQB 1FNHA 1UH3A 5IQ7H 4TV8F 2OK4A 5JUEL 5E94B 1MVUA 3V80A 4HG4J 1C4WA 3G5UA 1OU4A 3L6CA 1QKKA 3TW0A 1UCBL 4AIEA 2B2XL 2MKWA 4MWFB 4J0FA 4DMUB 4PSKA 1VI2A 2PTUA 4FG4A 2J08A 4CF5A 3HMWH 2HFTA 3D06A 2Y0CA 4ENSA 4FTDA 43CAA 3U3KA 2VZUA 4OZHE 2XDAA 4JFTA 3WO4C 5IVOA 4HS8L 4AITA 5F89B 1DBPA 5AHKA 2EWVA 4D56A 4H3VA 4IDPA 1S8NA 2BONA 4PV9B 2P5PA 1SXBA 4OQZA 2FW9A 1V8OA 1XWFA 3IB4A 2NU6A 1CL7H 1ZUIA 1SAYA 3JTMA 3AB8A 4YCNA 5AG8A 4G9GA 2LCQA 4WZBA 3QHFL 2A0KA 3PPXA 2YRLA 2GJ6B 1OAZH 4KSYA 4Y1TA 5GS0C 5KVAA 1F6AB 2EFCB 2X0RA 3LHPL 5TPWH 1WBBA 1G8HA 1ZLXA 3VXME 1LRKA 1RAGA 1Q3TA 2I6TA 1YZGA 1MFDL 1C3EA 3QUML 4BMOB 1V96A 2I4OA 1JQBA 4IDEA 4IXDA 4AW4A 2C88A 4YDZA 2O5ZH 1IRXA 2A1WL 1X1TA 4GBXD 4G3YH 1WUIS 3OX4A 2VJXA 4F9LA 1PY4A 1MCPH 4OLYH 3IQFA 4WCFC 2LTQC 3TFOA 4QYTA 1ZD4A 5DJ8A 3ZDZF 4WK4A 5EUKB 4KFMB 1L6RA 5D85A 3RT1A 4NYIQ 3T7CA 1O6VA 1DDIA 2CXUA 1X9HA 4BZ1H 2OJZH 2MOKA 4I5DA 2Q20A 3EGWA 4D8UA 1TZIA 1K2DB 3VO0A 4OJEH 3MMZA 3W9DB 3EFHA 2F8XC 2Q9UA 3EBPA 4JOCA 4UHEA 3SX0A 4J39A 1UB6A 5EJGA 5C46F 5LYJB 4DQLA 1YY8B 3QULA 3HI1B 1ZLWK 4JQVC 2IIJA 4Y8DC 3G2LA 5TQ0A 3U3RA 3GZJA 3AEQA 5BVJB 4NQCD 1R9NA 1XXHA 2DQTH 3WP0A 1SWVA 2VSXA 4LC0A 5GONB 1PD6A 1ZZGA 1NT4A 1MF2L 1CUDA 3L7EA 4N7MA 4ZVNA 3RFTA 1SFDA 5MENA 1BEXA 1ZVNA 3A9UA 2OAEA 3CG0A 1OSZB 3GJYA 1G4AE 2MPAH 2EP7A 1MJ8L 3G2HA 2KBEA 4XSGA 2A9DA 3OCJA 4TQ8A 3TA3C 3GJFH 5DRZB 2X15A 4X66B 3TVYA 4OK5A 1FVHA 2C2BA 4QHLA 2EFHB 5LHDA 1US8B 2CFSA 1KULA 1E8DA 3L95B 3OF7A 2I26N 2QM0A 1L6XA 4ADGA 1T13A 1FNEA 1MCQA 1UJ3A 2WHEA 1FIGH 3B3JA 1BLIA 3UPTA 3O0RH 4BUGA 2LW7A 3I01A 4N0UA 3QBTA 1MUJB 1TJPB 4JFQB 3L05A 2R69A 4WFHE 1C8VB 4TVKA 1V05A 3VSDA 3WEBA 3MNVB 2CBGA 5JXWA 2YYAA 1HESA 2VLRA 2J1KA 4AWJC 2ZDQA 1GFIA 4P99A 4L2LA 5DCUA 1EFKA 1NC2D 1G3QA 1LDYA 1J20A 4M61A 1KTDA 4NNYA 3ZWOA 4JQVA 4Y2GA 2ODQA 5BMFH 3HCVB 3D3NA 5AKIA 3PD0A 3IFPA 3WLRA 2V9TA 2FZ5A 4U00A 3QNXA 2QR3A 1MGOA 4E6EA 3VNYA 1MP0A 2QI9C 5BN4B 4Y5XB 4Q37A 3VXPA 3PHOB 1AE6L 4BQ8A 3VR6D 1E9OB 1GEGA 2CKBB 3LXBA 3D1JA 2PZEA 3MA7A 2XECA 3PXTD 3MV8A 4ZZKA 2GN1A 1J18A 2GSGA 5EU3A 1E9CA 3D6MA 5SYAA 4EL0A 3WS3A 3L1HA 4K5PA 3RA7H 5A2IH 3VKVA 3QHPA 4HD5A 1T4CB 1HT0A 1GC1H 1G4RA 3T8XB 4BINA 4IGKA 1DLJA 1R9JA 4RMWA 4FB1D 2QRUA 4OK3A 3KR9A 1U2RA 4YSEA 4I6JA 4E70A 3LPFA 1EFUA 2G30A 2VAXA 2RMNA 3STZB 1GPKA 4DN4H 1TMCB 3EIWA 3P9CA 5AJZA 3T5DA 2XQYK 3DYPA 3MRBB 3WO0A 2PKCA 4LUCA 2H51A 2DF8A 1JTEA 4L8DA 3IS3A 3ZGIA 2EL7A 1IQWL 3PWVA 2ODWA 3HKCA 3VH0A 1MFAL 5E6IB 1VLZA 1HXKA 2Y5EA 4YBLC 4CLEA 2XICA 4Y4FD 2JFUA 4HCRA 4LOHA 3H65A 3HP4A 4TF4A 3AKDA 3U9TA 4U33A 1W44A 4CSTA 4B9CA 1G6RA 1V7CA 3FD8A 3W79A 1OIWA 3EVNA 4YIKA 4J23A 1WVGA 2Y6TE 4FGSA 5JWHA 1N18A 1OWMA 4G7YL 2PSEA 4BB9A 4JQSA 3KB6A 3NEOA 2H92A 1GAQA 4NK4A 1QRDA 3KLPX 3VI3A 5HSGA 1NQTA 4GH5A 1E1RD 5HDQA 4LVOB 4TTSA 4B0PA 1MH5A 1VKZA 2BLLA 3FGZA 1D2NA 4AVHA 1KLUB 1UPTA 3LH5A 4X20A 5ENZA 4DEWA 5BV2P 1EUCB 5DLDA 3A1SA 1QBMH 3D0LA 3T6QC 4A27A 1NKSA 2FVNA 1Z3RA 1OARL 3QUZD 4EB6B 2VERN 1TJNA 4GM1A 3BPSA 2ED6A 1UZMA 1NGPL 3NSYA 4UU0A 5TQJA 1YJDH 3TWCH 1Q9LB 4V33A 1F0KA 2H47A 4X1KB 1L5GA 1QLJA 5F3DA 3C5JA 4A2CA 1LRLA 3MLTA 2BMFA 1OB1B 5HYIA 5HHOB 5FXMA 4L3HD 1YEGH 3RVDA 3NP3A 1FC0A 1S7RA 1CQWA 5FOBB 3QX8A 3H8WA 4QF1B 1TEGA 5JMPA 5D7HA 3A4YA 5FCSH 4J07A 4R7ZA 5DJYB 3JWGA 3Q3IA 5E1HB 4O5LL 2Q8NA 4K3EL 4YQXL 3FPLA 1A2BA 3QF4A 3X1BA 2J0UA 4QPEA 3GRWA 1WV0A 3WMGA 1JECA 5ALPA 2XXCB 4NSKB 2MOQA 4WEEA 5C0AA 4PSAA 4UBMA 2FUCA 1YMME 3II2A 3T34A 1UQSB 2VIRA 3HUFA 5IK2D 2J1WA 2X3BA 1BCRA 1G4MA 4TUOB 1D3CA 2BI7A 3F7LA 4L1BA 2DYPD 5JOFA 1L4UA 3TASA 2HNBA 4E03A 3HPJB 2XA2A 2PX6A 3SU8A 5AM1A 5E2UH 1CVSC 2BTQB 2WAQA 4JP2A 4INZA 2YXBA 5AWNL 5B7PA 3F7VB 3QWFA 1UF9A 5BO1L 1J00A 2PBZA 5H68A 1NJ9A 4LRUA 2YWHA 4WV3A 1X5GA 2A92A 4LRIA 3MOBH 1MCWW 3A4TA 4XX0A 1GTL1 3I50L 2QGDA 4Z76A 1LZLA 3T04D 4M48L 4OGYH 1VL5A 1BM3H 5CEXA 3HZVA 1DXHA 5F9JB 4EUPH 2N9UA 2HFEA 3FRPG 3WDJA 2JIDA 3IEPA 1J1PH 3RYHA 4IG9A 4JX0A 2RHWA 4QR7A 5F44A 5JZ7D 4DARA 3S4SB 4N76A 3EX7C 2OR9L 4BKTC 1AD0B 3VDQA 3REOA 1Q9KA 2XZZA 4NRXB 4LTNA 3CX7A 2OMKA 2FSSA 5CSBA 1Z3IX 5BRZE 4MQFA 3W8NA 4ILDA 3P32A 4BH8A 5H2BA 2ZZMA 1HHJB 1KYTA 2Y3AA 2H2WA 4B4UA 3AXHA 4JKPH 2GN8A 2EYRA 4OX9Y 2MCG1 1N10A 3H1EA 1M1ZA 4FQCL 4UHCA 3CMOL 4FTVA 1SOKA 3KIPA 1ZJWA 3VI4E 2GHIA 4NFSA 2FEKA 2A0WA 3BG5A 5GWXA 1MT3A 3TPZA 5E8PA 3BWEA 5DLEA 1YAIA 5AJXA 4M03A 3H5RA 2C4TA 1WBXA 2VDOA 4PW0A 4ZT5A 4DW2L 4GYYA 5H9VA 4CIBA 1HQYE 4MR7A 4RFSB 4V24A 3BQUC 4XVJL 2WWRA 5DZVA 3CUPA 4JVMA 3NA4A 4RETA 1J8DA 2VDLH 4JQCA 3WE6B 5DDIP 4KKPA 3TGPA 3SKOA 2I1QA 3IE0A 3MMNA 4MVJE 3MOQA 3RRFA 1RJDA 5BURA 4TNFA 4MD4A 5A2Qg 4CRWB 3F6BX 3SKUD 4QI3A 5E95B 2V7EA 2D1TA 2W22A 1UYWH 2GO1A 2P68A 4ER5A 4ZMVA 3HFJA 2W9DL 1N9PA 3OLDA 4P4RA 4XVTH 2ASEA 421PA 4XCEB 1AQ8A 2RFXB 1J88A 1W72A 4YJZL 2BFEA 3O8BA 1OCOB 2VYVD 3CFSB 2X0JA 4Q3DA 3G6JF 2P8MA 1UDWA 2XQBH 4DPRA 2WA2A 1R6AA 5L4MA 5J2TF 4INAA 1ZD9A 4Y4HC 4EN2A 1JXDA 5KU1A 4QHKI 1J0KA 4F57L 2WM8A 4G0PA 4DQVA 3FCBA 4GAYA 2IUPA 1V7QA 5KDDA 3LUDA 3G0DA 4A23A 4G0WA 4QJ4A 2QQNL 1XA4A 1IAIH 4JN2B 1ZNXA 4KMMA 2EF0A 4AKIA 4B6RA 1ZH4A 4P4SB 2ZI3A 4I2XA 4HAGA 1SCKA 5DWVA 1WZIA 4W9GC 1XTRA 4JEHA 4YVNA 2AJSL 1MABA 1NGYA 4J7UA 1JTTA 3PHQA 1YDMA 3NHZA 4BIMA 2GK4A 4D81A 3IXAA 3FPAA 1MI5D 4MYSA 3D3VD 2OHOA 3F6IA 4G9BA 5T1JA 3RFGA 4UT9A 4HKBB 4WH0A 4JO4H 2G9HA 3CBJB 2JFXA 5HIMA 3ZWAA 2QDKA 4MNQD 4W9ZA 4RAVA 1IEBA 4GJTB 4BKQA 3LRSB 1FW8A 1TTFA 4OHPA 5I9MA 2H68A 2FE0A 4F7TA 2J8UE 4A39A 3UBMA 3QUXA 3BGMB 4U3CA 1MHEB 1Q5PA 1F8GA 2MNJB 4OLXH 4AGPA 2DWPA 1LU9A 1X7DA 1FYXA 4P2QA 5HHOD 1BG1A 5JPMB 2Z30A 3OZWA 3ZWDA 2NSJA 1I4FA 4PQRA 1HKLH 1CJTC 1J22A 2AEWA 1NOJA 4M0DA 3EISA 2VC2A 1OXYA 3MJHA 2YD9A 2MSWA 4P4TA 1WTAA 1ROCA 3EIFA 3EJRA 3T2NL 1BE6A 2D7JA 5BUCA 4I0CC 2DLNA 2VWQA 3GO1L 5DDHB 3BL5A 2OL3L 2ZRFA 1U30A 3AS2A 5BXFB 2DFLA 3AM8C 5EV7A 1SLXA 4DMCA 5I18H 4UQ3B 5A2LH 3D9QX 1B1CA 1S4MA 2QP3A 4ALJA 2GC4C 4LSVL 4GI6A 5CDYA 5JXAH 3KSRA 3D4IA 2ZIGA 1G9EA 5JASA 2QMJA 5C81A 4U1EI 1TZJA 1AZNA 3BC1A 1BXUA 3B5GA 4L85A 4J82A 1TEHA 1ULBA 4IICA 3RAPR 3ONNA 4TQIA 1AKWA 2YCBA 3BP4B 4M4RA 3ZK0A 3MV7A 5FYLL 5CP3A 1IBCA 1P29A 4LSGA 3HDJA 2HC9A 3QLEA 2CAKA 4UDYX 1DJWA 4B9EA 2MTAH 1PQPA 4QUIA 4KHPB 1N75A 1RYYA 3PP8A 4H7IA 4TKVB 2GC7A 5E6ID 3W4KA 2ZOUA 3O47A 8CGTA 5CJQL 4H5SB 4PO9A 3V7DB 2EDWA 1DI0A 5BUSA 2VDKA 1Q74A 1GZQA 5M61A 3OJXA 1E3ZA 3NWEA 1OAQH 3I6SA 2BP8A 4BGEA 3UZVA 3FUMA 2Z35A 3DBRA 4TULH 3AFHA 3AL2A 4PIMA 5IT0A 2HDHA 5EFZA 1JXGA 2ONJA 1C1XB 4Q3EA 3BRDA 2IYSA 4QOGA 3IAUA 3K0WA 2LRHA 3K30A 4J2XA 2VDJA 1MFBH 5J43A 2YC4C 2CNOA 2WUCL 1DJYA 2F74B 1YEIL 4K3GA 4Q58C 4JJKA 2BGMA 5AYTA 2W6JD 1OX4B 1N26A 4UUQA 2K45A 2PGAA 5F1YA 1QJ4A 3LJKA 1GL9B 35C8H 5I9NA 3U1VA 2O4CA 2GUOA 3QIBD 5J1AA 3V8BA 3AF5A 1YQTA 1EVEA 3I8EA 1BQHG 4ZT4A 1JBKA 5EUBA 3EIUA 3LL4A 4LYDA 1SVMA 4AMVA 2UVEA 4E9RA 1NA5A 2NMVA 3QXWA 1XD8A 2PDAA 5CW1A 1XPJA 4KFSA 5EHFA 2ZUCA 3OP1A 5D2LE 4LRNL 3ME5A 1FNCA 1Z75A 1WF5A 2OTWA 4JO5A 3FDFA 3ZWNA 5KREA 4PLOB 3JVEA 1TEFA 4GEJA 4NYIR 1E5BA 3HQ4O 2Q1UA 4XMPL 5EINA 4YXLL 4MEAA 3HJGA 5FO0A 4R9UC 1JMXB 5M5VA 1AK9A 4UDUA 1G21A 5IJ9B 1EK6A 4IQ4A 1QP7A 4CY2A 3IV7A 3FMGL 1J8QA 2FTAA 1T3LA 4YXKH 5KI6A 4PCUA 2EIKB 4JFFD 1MG0A 5IZ7A 5JT1A 3AACA 1XTBA 1USGA 1BC5A 2GPSA 1EHLL 2WLIA 1BAWA 4YDVA 4NZFA 1PZ3A 4XGKA 2B0SH 4QECA 1ZT1A 1SZJG 2EBSA 5CB0A 1KZYA 2IRWA 1DL7L 1Q9OB 3S55A 2HF8A 1B0WA 1T4DA 4RWZA 5TS3A 5FGCE 4PV7A 4TVSa 4MIOA 3G5VB 3VG9C 4FJ6A 3B43A 4NGHL 3LEVH 4TL8A 4JI4B 2CUKA 1J5PA 2GUGA 5CT4A 4GGDA 1T1SA 2IYAA 3I3SR 1KVQA 4ZZFA 4MCHA 5CH8A 3S5ZA 4DFDA 1PJAA 2F6AA 3HW7A 4MR9B 1IO4C 5CO1A 1T2QL 1NFDF 3WQBA 1EANA 3X13B 1AE6H 1L5OA 1QUNA 3I2NA 4MICA 5AOZA 4C0XA 2OE2A 3NU1A 5HVHB 4HMPA 1UBTS 2SKCA 3G04A 3VO1A 1HNNA 1Z5UA 1G4UR 2Y2VA 3ZE0E 3EU7A 2NQDA 5C3MA 4KO8A 2DI8A 2PFKA 3PEWA 3CRNA 2XN1A 5ICZA 2Z31B 4XWOD 2XOTA 2AJUH 4Y2OA 4XFDA 4QT5A 1K27A 1K0UA 2G36A 2C2GA 4YWGH 2XSZA 3N8NA 1G6RL 4BE4A 4MA4A 5HYSG 1ZWIB 4PGBA 5ECGA 1B43A 1DBBH 2A6JB 4DB4A 1CEEA 2P77A 4ZP1A 4NO0D 1IC1A 5DGQA 1V6AA 1IC7H 2C83A 1WFOA 4IIGA 2FWSA 3BGSA 2Y7SA 1SM4A 2R4RH 4BNTA 3Q9SA 4XCXA 4E2WA 3WY3A 4UMVA 3G7TA 4KDTC 5DHUA 4CLOB 1BCIA 3WL7A 5ALCL 4FOLA 4LCCB 4PPQA 1JNXX 5JATA 1UIRA 2Q4RA 3A6HA 4WJKB 2WILA 4C0LA 1KIAA 4LKOA 1X1QA 1KRHA 3K9HA 4LF8B 2HTLD 1H2FA 4XWYA 1NU8A 4WIQA 4EGAA 1BVZA 1S5PA 4OP1A 2GPNA 2GJ8A 5GIOE 4BK5A 3UV3A 1P31A 4QRTB 2KQNA 4RFOL 4H8QA 4Z5XA 4HWZA 2PS0A 2VZLA 1FMTA 4OKNA 3ULUD 2H45A 1S01A 3ESPA 5IQLA 4BQ6A 2RGNC 1NAHA 3O2NA 4JC5A 5FYQA 4J3JA 1PLCA 3HG7A 2RKBA 3MBOA 3BUBA 3GSQB 4EI5C 1TF5A 1NC4D 1ZW6A 3X3GL 4UW9A 2VN6A 1BIIB 1U95B 2R25B 4WESB 2YWEA 4U1LB 4MJIA 4HGRA 2OGWA 3WY1A 5AVSA 3IFLH 5IKXA 4L4TB 4R96B 4CDGC 3U4EB 4ILEA 3A3PA 5A5FA 1N0UA 4XO9A 4MUHA 1M10A 4X1IB 4IGBB 4CEIB 1F97A 4NX2A 3AB0B 3KVPA 1OI2A 2ZCUA 3URMA 1L7DA 2P1DA 3QDGB 3OFJA 4OUOA 3HA3A 4P3XA 4FXGA 4G6AC 4UTRA 3KPSB 3VKUA 2ORIA 3TRKA 2MT9A 4KRFA 2HJFA 2QYOA 2JARA 1F3OA 1QC5A 4GE3A 4CDHA 3TBWA 3LMJL 2H29A 3OTHA 2PLFA 1RFDL 3TLRA 1I1YB 2D4FA 3AMLA 2ICWA 1R4MB 4JREB 5JWRA 2VR7A 2DPKA 2BF4A 1GGIL 1EFCA 1YG9A 4DKFH 2EHJA 3IV9A 2CU9A 1KIFA 1ZAKA 3TLKA 3EMKA 5EMLB 1I1AC 2XB4A 1Z0SA 4XPHL 1SNRA 5C8ZA 5ALQA 2UAGA 5DISB 2NT1A 3HKBB 4RGNE 1AHMA 1HHIA 4PXAA 4HX1A 1CQKA 2J85A 3K96A 4YYEA 4W9CC 1N8KA 1GPH1 1XLVA 4BO6A 1W2KT 3M9XA 1U2VC 1MEEA 1Y1TA 3T7KA 3MLZL 3GLSA 4PN3A 4EGSA 3JB9L 5CX4A 4MZIA 4PRPA 5GIRB 5DHMC 3KFXA 4X1YA 1U8IB 3PHBE 2ARJB 5IK2A 2ZVQX 2HIHA 2C2WA 3SXUA 1DX4A 3BD6A 5A3QA 1XL4A 1XSKA 1KCRL 4MIEA 2I25N 2BBOA 3P69A 1GH7A 3C5WP 4OGGA 4MAFA 2C4FU 5HVFB 4BNZA 2HVKA 2DQEL 1M34E 1UK8A 1J70A 2Y7MA 4C3VA 4RJLA 2ZYRA 2A9BA 2O2SA 2VXQH 1AUOA 1BGXT 2QFRA 4WJLA 2ZAOA 3KR1A 2CJUL 4RDQG 5CD5C 3CUYA 4B9GA 2IALB 3LZQA 3EZJB 1KQPA 2O6CA 3O2DL 2GHTA 3OKYB 2IQAB 1O95C 1NGQH 4ZNEA 4YCSA 4WBSA 1C5BL 2ZP0T 3RN1D 1JGLH 1QNZL 3FYEB 2WVSA 1IXRC 2CLFB 3FULA 3JD0A 4F2DA 3GLGA 4PY2A 4AUKA 4L48A 1P7PA 1M1UA 3ZBQA 2PYDA 1MJ5A 3ZPDA 5JO9A 2YNMD 1NL0H 2RH9B 4N54A 3HJFA 3TW8A 4ZOLA 3C6LB 4P4LA 1VG8A 4OXIA 1PZXA 1E5TA 3FMFA 2BXZA 4QGBA 4EPXA 2QTWB 3RRMA 4GKSA 2VRNA 1XNHA 3QUZA 1OE3A 1MZYA 1BVLA 1G9NH 1Y8ZA 1A3QA 3EUUA 2BFAA 1EVLA 2J5BA 3JWHA 4X8LA 4KAJA 4DIUA 4CL8A 4ENEC 1HUQA 4D8TA 3SWWA 4C01A 2A5FA 2KERA 4R54A 2Y67A 4P57B 3LT5A 5JHDE 2V9RA 1ZXBA 2ALWA 2J7KA 3C6EA 2WV3A 2EJUA 2YJGA 4Q9AA 4Z3DA 4JLBA 4X6FA 5JMOA 5LN4A 4I2XE 1E2KA 1KYDA 4LPXA 4KR0A 2VSNA 5C8JA 2QTLA 3PQ6A 4PS1A 3LNDA 3TRJA 2CO0C 2YWJA 4RE5A 4CG1A 3TBTB 1BQKA 5F5XA 2VR9A 4FGMA 2HJRA 1JHOA 3OCCA 4XXWA 4RGOH 3EGEA 3AQYA 2HWZL 4RMBA 2OSYA 2ESRA 4Z3IA 3PUWA 4I5BA 4FT2A 4DUXA 2UY7B 5DHYB 4BO1A 4GI7A 5NLLA 1TUIA 1GTG1 4CLRA 4GG6E 1XCTB 1R8JA 4L9LC 4WHDA 1J8HE 4RXUA 3TJEH 3IA2A 1UXMA 4Q2ZA 2HIGA 2HXYA 2VLKB 2VXUL 1UFVA 4P5TC 1E9AA 1RQNA 2J21A 5D7LE 3LSTA 1OB2A 4W4OC 5CU9A 2C4NA 1JVBA 1XMVA 1DVSA 1XZMA 3KPQA 3DL4A 2NVUA 5H7XA 1GRCA 4WLNA 3HFML 4WRRA 4CEJA 1ZEMA 4PB0L 3OO0A 4K9MA 4MRNA 4MB2A 2O6EA 1UKZA 3ARVA 4Q6BA 1A4KB 4GIOA 2DMBA 1RD4A 4PHFA 5AG9A 4BK5C 5AVXA 2A5YB 4YMLA 2R2GA 3GI9L 3T6KA 4MR8A 2IURA 1T1ZA 3AWFA 2EBWA 1MHCA 4EGCB 3ZWWA 2RR3A 1ESNA 1VHJA 4TT3D 5JD3A 3ESOA 5A5GA 1F3JB 3HI5H 4YFLF 5FAKA 3GUVA 5H14A 4X0KB 3R19A 3IVKB 3ML1A 1FA4A 4R31A 1RQ7A 3E2PA 3B51X 1LLUA 2WD7A 3RUPA 2IS1A 4KMTL 1BQLL 4N1EA 1WXEA 2VP4A 4MAMA 4F56A 3EXAA 4GRMB 5HMMA 3BWXA 2AF2A 3JQBA 5LSAA 1QHHB 4MV7A 2IITA 3TO2A 1BZ7B 3QQ3A 4FYVA 4N47A 1T03H 4KDWA 4JPIA 2BHNA 4UQDA 1NFDB 3FB5A 4UIKH 4HQFA 3VO9A 4JHBA 2VT0A 2XLBA 2DWEB 4PHGA 5DJCB 4DNVA 5F21B 4ZI8A 2FMXA 2QRJA 5ALMA 1FZMB 1YNTA 4UIKL 5CX1B 3IJ1A 5BPHA 1CPUA 3W11D 5D6CA 4U4IA 5CK5A 1LK0A 3AUUA 4JIMA 2ZXGA 4ANUA 1G0XA 2DT5A 5ELLA 1T5XB 4LVEA 4Y19D 2NV0A 2DQIL 3CN7A 3W9DA 2YWCA 3S44A 1DO0A 2FWUA 5FWQA 1NF8A 2YXFA 5D7JD 4QFMA 3S88L 4ZAKB 4E6PA 1K2VN 5HIJA 3IMRA 3AESA 1ZOLA 1B3BA 3EA4A 4KHXH 1V5FA 4C8XA 2EWWA 4K28A 1L5QA 3WL8A 4KK6C 2G70A 3RYIA 2DPXA 4RQUA 1U1IA 2OG2A 4QNNA 5IXJA 2Z4SA 1M7GA 3R7WA 2APSA 1VGRA 2CVPA 5A6MA 4LSRH 1R4ZA 2GLXA 4JDVB 5LB1A 1JHKL 1PW7A 2E8YA 3ARDB 3OXSB 2G9QA 4OFDA 1P6UA 1Q6ZA 2QUIA 3G6DH 1D0IA 4J0JA 3RHFA 1P7QD 3A1VA 3TA3D 3ZZ0A 1SBCA 5E2TH 3O75A 4WHCA 3KPNA 1MJJB 5LDDC 5BMFL 1FP2A 3QKWA 1CE6A 4X61A 4ANVA 2A9VA 2H7YA 1C80A 4DLAA 1YD7A 2A5JA 2VDNB 2JLXA 5F9HA 3FGNA 5FFFA 2DYPA 1QNFA 4BUJC 3W9UA 3WFEH 3QVLA 1P9RA 4M2LA 1A7QH 3LN5A 3Q5YA 1DUSA 1H0DA 5BS0D 2VEOA 1QACA 1W5SA 3LCVB 3TV3L 1RQPA 4M86A 2WA1A 2W95A 4HWNA 3U82B 3ICQB 1M5UA 2ZKXA 4HUXA 3A27A 3F65A 2SHKA 2X1QA 1C7JA 3VXRD 1XR3A 3DXZA 3KWVA 4F4JA 3EYVB 2LU7A 3OW8A 4NBYB 4XPFH 4IU2B 2Y7QB 4L18A 3DGDA 1SUFA 4Y8VA 4LCWB 3R5TA 1KQFA 2YKGA 3HXKA 1E2EA 4XUCA 4B50A 5E94A 4PE5B 5LQRA 1UXOA 4TS4A 1L6ZA 4N8CH 2WHYA 5FBRB 3P2BA 4EPWA 2UDPA 3HE7D 1OAXL 3P0JA 4YACA 1Z0UA 4MYRA 3DBVO 2ZIEA 2RGGA 1IFHL 4OGFA 3SQNA 3OSVA 1U2HA 3W5UA 4HAYA 2VUIB 2R7LA 1H94A 2W2QA 4R1QA 4AZ3B 1QHQA 5E2TL 4RMNA 2BVEA 1ZIYA 3SMRA 5EJ9A 1XCQA 4N18A 1WHSB 5T1LA 1C2YA 5DMXA 5CNJA 4UNSA 4BXOB 1M9WA 3DTVA 1NL0L 1MQKH 1KI9A 4Q1EA 5F7XA 4O4IA 3CLRD 2BS71 2BFBB 4Z7NE 4BLOA 4LASH 4ETQB 4YAQA 3UVLA 1KVSA 4GGPA 3MG9A 4FFTA 3OKMB 2R29A 3D33A 1HL9A 4PJ9B 4DM4A 2FSVA 1YU9A 3WDLA 2I24N 1YS1X 2NO7A 4HYYA 1XQ6A 1NGWB 3GYGA 1R18A 5GZOD 4MVCA 3VR2D 2BZGA 4AYGA 3AJAA 2RFLA 4HX2A 5LDSA 3UAZA 5FV7A 1T36A 2Z31D 2WNHA 4AJ1A 4E9VA 4GUPB 3M88A 3PIQB 2AWNA 3PT9A 1F1AA 4ETYA 5DJ8B 4X95A 5GZ1A 3RSZA 4WK4B 1NMXA 1VSQA 2CBPA 5H0IA 4G3YL 3KNBA 4OZFH 3NGXA 5IB5B 4ZO7A 2FPLA 4FKHA 5EZJB 1HX7A 4HKZA 1LEIB 3GL9A 1HWGB 1JI0A 3Q7JA 4Q4AB 3QVWA 1RM0A 1EU1A 1ORWA 5FCUH 4X1KA 1DJZA 1WIUA 5C0GB 4AIZB 4LDOB 5K0CA 2AG6A 5DRNA 1Q0LA 4KNUA 4WSKA 2QVZX 2RGAA 4ZU6X 2NW3B 1EVKA 4M02A 5JIQA 5M34A 4NRYB 5LYYA 1DEHA 4R8SA 3TTVA 3SQMA 2IUVA 2L82A 4CUCA 5TNXA 1ILEA 4AMKH 1H5BC 5EUCA 4OLZH 3OOSA 3MMSA 4XIJA 3SI7A 5MENB 1W34A 3IDSA 5EOCJ 4NSXA 5DK4A 3FOMA 3QUTA 3IA7A 5DM1A 4WLVA 2DKNA 1YVUA 3T61A 3CLRC 3CCHA 5KTSA 2R1TB 5HJGA 4PJEA 1NURA 3NQKA 1VGEH 2FLRT 1P9MC 1KJWA 3Q1KA 1C8QA 3OY2A 1O97D 1T2NA 2B8WA 1VCMA 4DVRH 4QHLB 2HXCA 3WXWL 1SIBE 3WTSA 1VE7A 1KJ2L 5T1MA 4LBWA 3G85A 5C2UB 2VXBA 5K0TA 2LBPA 2NV6A 5JOFB 2ZWIA 3S1AA 3IFLL 1HL4A 3QUCA 4FMVA 1JG3A 1S2LA 1IC5H 2ZSFA 3HKEA 2EAEA 3OJEA 4ND3A 3DWFA 3MNVA 2ANCA 3F3GA 5IABA 4LJSA 5CA0B 1GZ5A 5KNCA 2GHWB 1AK1A 2UYOA 4BZPA 2OK0H 2GQHA 4EUEA 4Q4LA 1MCCA 3WGKA 4NBRA 1R4NA 4LY6A 2YPLB 3T8MA 4WY5A 1SU7A 1GPWB 1OCWH 3ZMNA 4FDUA 3OU2A 2O6PA 3BMNB 4XVCA 2GBCA 3NXSA 4XNQA 5DI3B 1A2YB 2HFEB 4X7MA 4B9KC 5KSPA 2X6BA 1S5HA 3LMKA 6TAAA 2JLCA 4F15B 4NKIL 2ISCA 3Q5DA 2WD8A 5A7HA 4KN6A 2DUJA 3H1BA 3R4RA 3TBYA 1JQ3A 5JXIA 1MIOA 1U1CA 2C5SA 1SDYA 4Z3OA 1N3BA 2L7JA 1OOEA 4IDAA 1U8PB 5DLQC 3ZT5A 1NAIA 4A03A 2NTYC 5CDSA 2NW2B 2Y2WA 4OKVA 3UT6A 3MRTA 3IYLW 3L1FA 3D5EA 1SOVA 2CLSA 4JEMA 1RRCA 1XPUA 1GPNA 3UH8A 4K3JH 3DFKA 4YH1A 4UAUA 1CU4L 2A94A 1E0OB 1BXXA 4EKXA 2F53B 5DMIL 1PGPA 1TXGA 2Z1MA 3HC3L 3CF4G 3PGXA 3PJNA 1E50A 4RFSA 4JRXB 1N5KA 2QY9A 4EY3A 2C2XA 3CISA 4AQEB 4Y5VB 2QLJA 5B8CA 3O73A 4LOAA 4D4HA 4X5WB 4JODA 1E8MA 1LTQA 3FC8A 1UATA 2GT1A 1QO0D 3EY9A 4A4DA 4JY4B 3ZT7A 2YNOA 1G8JA 1AJ7L 3KXFA 1A4JA 4X83A 1QRNE 4EVSA 1NCDH 5FTNA 2ZCJA 4P4RB 2V7NA 1QGAA 2PPAA 5IP5A 3A14A 4NIMA 2BFEB 2CIIB 2E8ZA 4NM4L 4P5KB 1QIKA 1GFZA 1HE4A 4FF9A 3BUPA 5HYJE 3N2IA 1W0WA 1KENH 5CLWA 1R0AH 2X2OA 5EMKA 4JE4B 5GXBB 2MJWA 3D7NA 1XRLA 2ZBRA 1ZU4A 2OM2A 3H2IA 1DX9A 2CUZA 4YRFA 5JNTA 4QJ4B 2HT3D 3I6GA 1XHMA 4JN2A 3L2NA 3FOLB 4UHDA 4CA4A 3BKCH 3ORSA 1U8KA 4PJFE 1C3LA 1CFVH 3GB7A 3B7SA 4I2XB 5EC1A 2A5LA 2A0UA 3KAQA 2BZ7A 2J9RA 3GLAA 1OLUB 1IN7A 4KGZA 3PDDA 4HT1H 1EA9C 3C5JB 1AKRA 1KEZA 2VHWA 2NAFA 4DCCA 5DVPA 1AVAA 3E7WA 4JYMA 5AVUB 1FP7A 2LQRA 2JATA 1FMLA 4C6SA 3VI3F 3PNWB 4YS6A 4MOWA 2X4IA 3H8NA 1AHWB 1C7FA 3LUAA 2Z5GA 5BMOA 1DELA 4UNTA 1H2AS 1KO7A 1Z7EA 1N2CA 1ZT4B 5C6TH 4KLNA 3OM9A 1I8MB 3J81g 4RD3A 2CR3A 3LRSA 4BO7A 3LQ2A 4JI2B 4R1UA 4MTLA 2B9VA 4HJXA 2FLWA 1OP3H 3MT8A 3B9KB 1R66A 4FL4B 3DXKC 2YARA 4NCJA 5IOPB 4UXJA 1RK1A 2OPCA 2PNFA 1W88B 1XXLA 2Q86B 1CS4C 4G1CA 2Z92A 3JZMA 1OXBB 1H22A 3KWJA 1ECFA 1E27B 4UI9R 2XWBA 1T6XA 4BQCA 4WJZA 1F3LA 3A6DA 4WSOA 2DMHA 5GOTA 3BXOA 4PCSA 1QQ5A 1JZDC 4HJGB 4AEZA 4QRJA 1N5MA 2J0VA 3X1NA 1E32A 2BP3A 4PRIB 1N1GA 4KHZA 2XVLA 4K3UA 3F7VA 2F2TA 1NLBL 1OGTA 3DEJA 2AW2A 2NNAA 1CJSA 4IRSD 1U3HC 3QDMD 2Q3JA 4JB9H 1GWNA 5EMNA 4Q9CA 2FW7A 3GS7A 4HIEA 4CW1A 4NB7A 1A6TB 3DB2A 4HRVA 3RUFA 1FXWA 3C5ZD 2QADC 3EARA 1VP9A 1S6NA 1VIWA 3MACL 1E3JA 1L1RA 2AOTB 4HHAB 2X23A 3B9VA 3G82C 1OZAA 2AE1A 4HDRA 4ES8A 5LCXA 2VUKA 4N3TA 4WLFA 5L3QB 1DL5A 1GQFA 3DHPA 3G5AA 3DTTA 3WKDA 3AJ7A 3WIDA 2E47A 3EVGA 4YONB 3G02A 4YE4H 5EPEA 3GSUA 1CI5A 4OLEA 4PXSA 1SXQA 4ZFOA 2AG1A 4LL4A 4ZZ3A 2Y6SC 1GUFA 1H6CA 3FT3A 2FK8A 2OD2A 1ULTA 3AKEA 3LWDA 4U9UA 5AKSA 4RENA 5I19H 3ATDA 3IFOA 4OHMA 2P8JA 3T5GA 5MI0B 2WDPA 3ULSB 4HDIB 2NU9B 2X0FA 4AKGA 1Z9PA 3GEEA 4DIMA 2ADIA 4EHJA 4MR7B 2PQ0A 4Y4HA 4DCQA 5CFQA 4NC0B 2PGXA 1CMOA 1NJ2A 2MCAA 1T66D 3TPUA 3E5MA 3QT2A 4IJ3B 3RTQB 1X1BA 2ZE7A 4GP9A 2IYXA 1W5EA 3WTCA 5CT8A 3KVDD 2PVSA 3PUJA 2YGNA 5C0IB 5FOVA 4TM8A 5DULA 1Q0XL 3GDOA 3I8XA 5I0ZA 4WEBH 3CPEA 3WKNA 2EP5A 4BNFA 1E79D 4EIGB 3RWMB 3SEFA 3S37L 2WXIA 2P3OA 4HUVA 2C9DA 3FCOA 2RGBA 4X6LA 1ZYUA 4RMGA 4WENB 5K8CA 1NEUA 4DGIH 2YXWA 3NFNB 1VJ0A 3H9EO 2GBUA 3WJAA 1BF8A 4LXHA 4PGDA 5AKHA 3O8XB 3ZTNH 4J1QA 4DEUA 1A7BA 3MUEA 2H59A 3P30H 4PO8A 4EDFA 2OBFA 2XV0A 1SBHA 3QEBZ 1GVNB 4KVPA 5EUQB 4DYDA 4FI7A 4DT1A 1JSZA 2DF3A 3V4FA 2G8LA 5I01A 1XHHA 5DHFA 3UEQA 1NVMB 4NQDB 3QHZH 3TURA 2C92A 1GSAA 1IGMH 2ZJ7A 2JIQA 5E56A 3R6GA 3ID6C 5D8DA 4R9VA 3ZK7A 5F3HA 3KWTA 1H4VB 1LDEA 3EXIB 2V8OA 3EMVA 3JPYA 1K3UB 2G5PA 1YVPA 4NBZB 4UQOA 3VFUA 1A4RA 4HZUA 2YWZA 3DDZX 2MMGA 1S7WB 3BO8B 3VXSE 4IRJD 1Z6XA 1MCFA 5J3HC 3D2UA 4TL4A 3BZBA 1OGYA 1FUKA 5C9ZA 4JHUA 3QQ5A 3D50A 3L5JA 4XMPH 2RBLA 4O02L 1Z56C 1TB4A 2HA5A 1RZJH 2CV0A 1IGTA 1D7CA 1B6DA 3ITNA 4AENA 4TSKA 1QW8A 4OQPA 4A09B 2O3UA 1P7VA 3K71B 5EMHA 1WB6A 2W65B 3L4ZA 5AKRA 3BQMB 5F64A 4CMIA 3DROB 1JXQA 1WIWA 3G5XB 5FEBA 1UJCA 4IKLA 3OQ3B 1RK0A 2FG5A 4B6JA 1OV8A 3EXFA 2QYSA 2DWCA 1BQHB 2XNSA 4J4PC 3IUQA 4TLKA 1E5AA 2ICWI 1PEVA 4MV4A 1X70A 3KYDA 1L7MA 2V3EA 4C56E 5EIOA 1N70A 3L7AA 3F9IA 1YXMA 1N6QL 2MSNA 3DHJA 3GFUA 4FWBA 3HE6C 4TYUA 3L43A 4HWSA 1Z29A 2DRIA 2GZRA 3QNWA 3S2IA 4S1VA 3HDGA 1W2GA 2ZPUA 4DGVL 1ZA3B 3VSUA 4PG7A 5TDHB 3DVLA 1ZDMA 3VVLA 3P11H 4W5WA 3BPNC 4N90E 5IHBA 7AT1A 2MCFA 4E9YA 3CMOH 4H1LA 4BYGA 3MV7B 4XH2A 2Z8ZA 4YYZA 4NPCA 4BKLB 2RGYA 1J05B 3S1LA 1VFOA 4WDIB 3UT5B 4DP7X 2IYTA 4OTXH 2XW6A 4NQEE 4WQOA 3EZ8A 2JIZA 5FOSA 4RH1A 2G72A 4LV5B 3DF9A 3EF4A 2WJVA 5IQ9B 2Z8YM 5BRAA 4HMDA 1N2IA 5I0DA 4DABA 3PJRA 4H5JA 1MJ8H 4KK9C 2NG1A 1GZPA 3RNKA 3KYMA 1KL7A 1WITA 4WW2B 4AE0A 5HA5A 4B84A 4B9AA 5JD6A 3WKQA 1D1QA 3OFND 5K39B 5DVNA 1N8TA 1S7XB 2NT0A 3BVDB 2XV3A 1QHIA 3GINA 2GEUA 3NH6A 2COKA 2GA9A 3PQ2A 5F12A 4IAOA 1Q77A 3JVDA 3UANA 1CYGA 4HJ0D 1DDHA 2FR1A 1JWBB 4ZTBA 1P5FA 4ZTOH 1N32B 3EA0A 3K05A 3L0DA 4TZ0A 5H02A 2G6TA 3L01A 1XKQA 4GXUM 5AVJA 2D5IA 1Q14A 4MKIA 1PLJA 3USES 3VR6A 2OLJA 3SYPA 4QGAA 1P4BL 1L1FA 4RS4A 2IO5A 5AKZA 4YSUA 1FDLL 4DPKA 4DWVA 1U3DA 3BZWA 2Q8AL 2FWRA 3U7JA 5BSUA 1RM4A 1B4DA 4NVRA 5A7GA 4AE1A 3KZVA 1VMIA 3R06B 1QKZH 5IU6A 4FNAA 1LC3A 1C30B 3T9AA 1ZN9A 3MGAA 4P5TA 4CN1A 3MUFA 3VR3A 2IH9A 2C34A 2HJFB 2X7LA 1FYEA 4JDZA 3FYSA 3BJRA 4D8XA 2YUWA 2B94A 2VLRD 1JZSA 1OANA 3QUYB 1Z08A 4ER0A 2FEMA 1NCWL 1I1YA 4M8SA 4EUPB 1GRWA 1MIML 3PGDB 3KB2A 1PCXA 2HQBA 4DR2B 2H0AA 1OGAA 2Z1NA 3X1ZA 1NX6A 1JEYB 5CJPA 4W5HA 1Z8NA 4LHQB 2NYYD 2EZTA 5HE1B 3MX0B 4NIYE 2PBLA 3FHTA 1W4LA 2GEQA 3ENWA 2ATVA 4L4RA 5CB6A 5JIPA 3LKOA 5EO0A 1R3JA 2VUYA 3NIGF 3ZYOA 3KD3A 1Z7GA 3ZJAA 3JYPA 3NTLA 3HBPA 4OGXH 3KL0A 4L3AA 4JCWA 5LUAA 3SHVA 4DNOA 4LLDA 1F2TA 5G5DB 2YVUA 1U8JA 3O81A 2GEBA 4M1GL 1KSFX 4X1YB 2I3TA 3O2DH 1X5FA 1MG3C 1IY2A 3QFHA 5FFLA 2DBVO 4KP7A 3X2QB 1NOAA 4FQXC 1OE2A 2AS0A 3AZQA 4H7KA 2YMXL 4HB3A 3F3MA 1VRCA 4XEIC 1NAMH 1GPYA 1LO4H 1X7WA 1WSDA 2BNRD 2GIXA 3KPMA 1QSEE 3PNSA 1GNPA 2VKQA 3DBLB 1BHJA 1P91A 5ILGA 2IW1A 3HFRA 4KQ1A 3V55A 3W78A 3K70B 4QKQA 5J13C 1I0LA 2VXYA 1IGJA 4YNYB 2YAPA 3HUDA 4P0QB 5E5RB 3IAM1 4GVPA 3MLRL 1UKSA 1RH8A 2J7LA 4MXWL 1CR0A 2ZB8A 4IHQA 4GOXA 4JT8A 1DBSA 2EKSB 1RZGB 2Z91A 3INRA 4BNHA 3L0OA 4RHYA 5HMLA 4X45A 4YEFA 2RHOA 1G9ML 4LX8A 1SUHA 3BZ5A 4MNGA 2WZDA 3IOBA 4CCYA 2ZXFA 3SZOA 4HQQH 1PZSA 2DN7A 2IV8A 3W6OA 5EORL 1BO6A 4M1YA 4JI7B 1MB9A 1DQQB 3PABB 1CURA 2WXJA 1EH9A 2OVPB 3LP6A 1E8XA 3L0SA 3PYMA 3JYOA 1AGNA 4JUSA 4Y1EA 1Z47A 4DEXA 4XZUB 1G0DA 4BFNA 2E9SA 1WIOA 1I1AB 2DY2A 3V9FA 3PS6A 2CKDA 1A8HA 4MDIB 1MVLA 1Z4JA 2G40A 1Q7BA 2VTEA 4M62H 3IOMA 3JTBA 4KE9A 3AQ4A 2QSQA 1MLDA 2E49A 4PVDA 5EJ5A 1F1GA 2LV8A 3ZKND 2WP0A 3ALWA 2G3ZA 4TLBA 1J06A 1KC5L 4WHYG 4YDLB 3ZD9A 5JZVA 3VU3A 3BEOA 5AOLA 3WTYA 4NN5B 5C0OE 5E6IC 4GYJA 4QRPA 3L3OA 5A2BA 4JKMA 4FONA 4NQTA 6ADHA 5I6PA 3OICA 5HTSA 1JYVA 5BV7L 1FLAA 1U8LB 2YOGA 2VBGA 2LE9A 3SQRA 2QD2A 2YR0A 3SFVA 3PPEA 3TO4D 3QKSA 1TTTA 1AYRA 2YW9A 4PIRF 2FJFA 4BMZA 4AVYA 4AICA 1HBJA 3QIWD 2VDWA 1DIHA 1ZGBA 4Z7WA 2HHLA 1YR2A 1YEKH 2UY7A 4MJIB 1DDOA 4MLDA 7REQA 1KEWA 4QUHA 3FH8A 1P17A 2VLJD 1QPKA 3H85A 2L8AA 4HH3C 2VVTA 1FIGL 1V43A 3UV7A 1ISGA 1MEXL 5T7BA 2Q46A 3JRXA 3NHMA 3TCXA 1D6SA 1U8MB 3IRUA 2GSIA 4FXGB 3LP5A 5C5DA 4IJ5A 3JQBC 2GGSA 4G25A 3NHJA 3OZKA 5DZPA 1O4VA 4OJFH 3LD9A 3ZVRA 2XCIA 5JIBA 3KOYA 1WS8A 3EH5B 2EGHA 1FFGA 3LC1O 1QH8A 3RIHA 3NJIA 3LPAA 3L45A 4ONGL 1RP7A 2ICWB 2MJLA 3ZIYA 1BQ4A 3L8GA 4EH1A 2YWBA 4W8HA 2O1SA 5CIWA 5I9IA 3ORFA 2R69H 2K8QA 1M2HA 3M1OA 5C70A 3EI2B 1K2DA 4R26L 4Q01A 3D6GA 2P30A 5MEQA 3BK2A 5GVSA 1KJ8A 2RALA 2CVOA 3G0HA 2CSUA 1O94A 2DAPA 1EM8A 5DMKB 4LF5B 1E8YA 4TPRL 1E94E 3VV2A 4BATA 3AEUB 5FOUA 2BTEA 4O4HA 3CVYA 5AZUA 1B6SA 2VSKB 4CIAA 4AMWA 3T3PF 5IBCA 4LA4A 2OMTA 1PG7H 3I6IA 1N6OA 3KQYA 5BSGA 3T7RA 2AHRA 2EDLA 1HI9A 5F2NA 3LT2A 2VR6A 3LAFA 4OVUA 4E51A 2AV6A 1P5UC 5JXED 3A6LA 3NRBA 1AUQA 3V7AE 5IQNA 2RONA 2FUQA 2ZKMX 2AJUL 1DOZA 1FSGA 5JPMC 3OA0A 4B3CA 2PKXA 4J7XA 4Z7QF 3FCSA 5IY5B 5LWYH 2DVMA 1OVMA 3S6CA 3KDMB 3TLEA 1BFVL 3TCTA 3ANSA 5JQGF 1FNEB 1DIRA 2CBXA 1JPFB 4LV8B 2HWXA 3L3DA 3FUIA 2O2DA 3A7DA 1KY3A 3MCG1 1RI2A 1KNOA 2ID9A 1R6DA 2EE6A 2GIYA 2V2WB 5HJ7A 4GINA 5HF8A 2MSDB 1ZUHA 2LNDA 1GZ3A 2X76A 4MAZA 3SBXA 4XPBL 1YIDA 4R41A 2XZCL 3TN7A 4L50A 1MLCA 1NZFA 3H13A 5IJVA 3EZYA 2D0GA 1T3ZA 4PJXB 1R5JA 5JLZB 2VF7A 2DHCA 4JVLA 4PZ0A 2I4LA 4NQSB 1TO6A 1BG6A 1S9XB 5THKA 4K7PH 4ZJUA 1AGFA 2JKWA 3PHSA 2G3XA 1TOXA 2H9NA 2CNNA 5B1SA 4HGKC 2QX6A 3VWKA 1QO0A 3M07A 1XNGA 3VXPB 1DJOA 4HZGA 3GC6A 1CSEE 2RBKA 3ZZQA 9ATCA 2IH3B