3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
1QCYA 3ZE0B 3ZDZA 1BHQ1 2XWJI 1MQ8B 3PPXA 4HQLA 3HXOA 1AO3A 3ZE1A 4C2BA 4NENA 4MMYB 3Q3GE 4O02B 2I6SA 4G1MA 3NIGB 2QTVA 3V4VB 2VDRA 4WK4A 2VDKA 1JEQA 4F1JA 5E6SA 3PPVA 1T6BY 1M1XB 1Q0PA 1JEYA 2IUEA 1SHUX 3IJEB 1V7PC 5HGJA 4MMXA 1IDOA 3T3PA 3ZDZB 2ADFA 1IDN1 3T3MB 3E2MA 3VI4A 4NENB 2I6QA 1JLMA 3K6SB 3ZDXB 1SQ0A 3EFOA 1TYEB 4WK2B 4Z7QA 3V4VA 5KYWA 3HXQA 3HI6A 3PPYA 2VDKB 4HQOA 3BQMB 2NUPA 3EH2A 4FX5A 3TW0A 4Z7OB 2VC2A 3IJEA 1L5GA 1YVPA 5BV8A 4F1KA 3ZQKA 4JDUA 2VDOA 1IJBA 2WW8A 2XWBF 4CN9A 3VI3A 1OAKA 1PD0A 1U0OC 3N2NA 4BJ3A 3NIFA 3K6SA 4UM8A 2VDQA 1FNSA 2O7NA 1AOXA 3V4PA 4WFQA 1QC5A 4WK2A 1CQPA 3NIDB 3EOAI 3EH1A 4C29A 5KYWB 3ZE0A 1DZIA 2VDLB 3BQNB 4HQKA 4Z7OA 3ZE1B 1LFAA 3ZE2B 1U0NA 1XDGA 4WK0A 4M76B 3RAGA 5KYUB 1ATZA 4G1MB 5E6UA 3NIGA 4XW2A 3NIFB 1M1UA 3IBSA 1JEQB 2VDQB 4UM8B 4JX0A 5E6SB 1M10A 3QA3E 1M1XA 1YVRA 2VDMA 5KYYA 2ICAA 2WINI 4IXDA 3EG9A 4IGIA 1RRKA 4PN7A 5KYXA 2VDPB 3K72A 1U8CB 2NUTA 1PD1A 4MMZA 1RTKA 5KYUA 4WK0B 5FFOA 5HDBA 1MHPA 1MJNA 3TVYA 2X5NA 1DGQA 4Z7NB 3EFOB 2P26A 5E6UB 1MF7A 3ZDYB 3FCUA 1FE8A 2ODQA 3F78A 5ES4B 2VC2B 2VDNB 3EOBI 3EG9B 3F74A 3TCXB 1IJKA 1M2OA 3EGXB 2VDPA 2B2XA 4UM9D 5LN1A 2I91A 1ZOOA 3VI3B 5HDBB 1AUQA 1T0PA 1PCXA 4O02A 1ZOPA 4UM9B 3NIDA 3ZDYA 5FFGA 4IRZA 1RD4A 1UEXC 3FCUB 2XGGA 4G1EA 3FCSA 1SHTX 3EGDA 4HQFA 2VDLA 3PPWA 2VDNA 3ZE2A 1JV2B 4CNBA 4WJKB 5E6RA 1M2VA 3EGXA 3T3PB 3T3MA 3VI4B 4CN8A 4IHKA 4C2AA 1BHO1 3K71A 5KYYB 3ZDXA 2VDMB 1ZONA 4Z7QB 4UM9A 1TYEA 3BN3A 3M6FA 5HJ2A 4NEHB 2NVOA 3EGDB 4HQNA 5KYNA 5KYXB 3FCSB 4G1EB 2M32A 1RS0A 1N3YA 2NUPB 3K72B 1U8CA 2NUTB 3TXAA 4MMZB 1L5GB 1JV2A 4WJKA 5E6RB 4MMYA 1MQ9A 1M2VB 3GXBA 4Z7NA 2VDOB 4A0QA 1CK4A 1NA5A 2VDRB 4WK4B 3K71B 1MQAA 1XUOA 4DMUB 1JEYB 3V4PB 1N9ZA 1PT6A 1QC5B 2ODPA 1XDDA 4MMXB
chains in the Genus database with same CATH superfamily
2W6QA 5LIRA 4X8LA 4TVPD 3UTTD 3BESR 3I0MA 3K5IA 4HMDA 4YHMH 3UG6A 1MXFA 4YQEA 4H4CA 1U8HA 1NW3A 4FDVA 1G84A 2Z2YA 4LY3A 3CD4A 4QUJA 5GJSH 4D9KA 4Z7VF 3RC8A 1U4CA 4YLGA 2HEIA 4B3RB 4O0MA 1H4TA 3VFNA 1W9XA 2ZYVX 2PZJA 3DROA 1I9GA 2PZGA 4JYCA 4JRXE 5B57C 3K8KA 1JIXA 2EP6A 1QBLL 4RAOA 1D1TA 3NC0C 2ZSUA 3EGIA 5H9VA 3RY4A 3CPEA 4MEAA 1D5IH 5FEBA 4WNAB 2ODIA 3UTQB 2AOUB 4RIGA 3PT9A 3DR5A 4KO3S 3D4GA 4Z7NB 2WINA 1QONA 1UKSA 3E1GA 1GYQA 5KHAA 4ZVLA 2HX9A 3SKJH 1U0EA 1XZGA 3DONA 4LUCA 4KVZA 3IMGA 2VQ3A 2XODA 2OZEA 3UTTE 3RBXA 4FFWC 4CG2A 1S7TA 4ARZB 5MHTA 3SR0A 1QK4A 5CLZA 1QWUA 2OR8A 4R2LA 4FWIB 5CLWA 3D2CA 3G6JE 2CLVA 4CMIA 3EYFA 2W71A 4JZNA 2NY7L 4LOJA 2L2QA 2DDQH 1AG6A 1C3XA 4DSYA 3FN4A 1NN0A 2B30A 4F58L 1W80A 3UPUA 1G16A 2UXDB 1O75A 2PABA 4GSUA 4J1UB 2BGGA 2A1UB 3RFHA 4EJ6A 2V7QD 1CMOA 4OA8A 4UTBL 5M5UA 4ZVUA 3OT5A 3T0DA 2HQRA 3KGSA 4UCXA 4ECAA 1XDUA 3GUTB 4OHXA 4P0DA 2I24N 3N58A 1NGXA 4PRZA 2JHAA 3MLZH 4PJBF 4K0OA 3MS7A 5D8JL 3PP8A 3L3OA 2QGCA 3A37A 4EY8A 2UUCB 3C39A 1I4FA 2HPAA 4P9HL 3VTKA 4D94A 2AMUA 2IUUA 1LLUA 2F7SA 3DEJA 1UR5A 1LGVA 5DYOA 1YY9D 5CCKH 2ZXFA 1M2EA 4RU1A 5DPMA 4BZZA 4WJG3 3NGLA 3ED5A 5LJLA 1R0XA 4R68A 1RIUH 4GOLD 2PYEE 4YEDA 4REOA 4RIFA 3QJHB 4JY6A 2JFUA 5K9OB 4YUYA 4L3GD 3OX8A 2XR1A 1RLJA 2X86A 1TU3A 2CFSA 2V7XA 3SSGA 1J88A 2PYEA 1L4KA 1HI9A 3UMJA 1ULTA 4ABYA 2BSRA 3LL4A 4FNLH 1RADA 1YSCA 4S0XA 4AKPA 3W8EA 3ITDA 4M0UA 1TFUA 1V3KA 2Y05A 1WS7A 2VDNA 1FXSA 3OM1A 1FIGH 1JCKA 4MS8D 1P77A 3ROMA 2ZITA 5HE0B 1AK2A 1U7TA 1U8CA 5K3FA 3TCNA 1QHFA 1QDEA 4MYSA 3K1DA 1LLAA 1OCCB 5KVMC 4OIIL 1I7TA 4ZFQA 4LLQB 2CE2X 5E9DD 1H6DA 2X42A 1TOXA 3CVXA 3D5EA 3TAUA 4MVJF 4CM7A 4PW3A 5EIIG 2C34A 1BDBA 1S9VB 3AVVA 1ANKA 2YARA 2Y1KA 2C9UA 1E7VA 2IP2A 1DKQA 3HYLA 1YQXA 1L7PA 5E2VH 4X0NA 2A6IA 2RCSL 4JN1H 5D5MB 3EVTA 3ZZ0A 3WTUA 1JPFA 2EXSA 4BCBA 1R75A 1XCMA 3KFLA 2GEDA 1DTWB 3F5WB 1PSWA 4ZEVA 2EW8A 3G6AA 5AUQA 3WGLA 2WG0A 3SGDH 1BE1A 3OKKB 2XT6A 4BVKA 2YD1A 5DFAA 5DVMA 1ISPA 2FBRA 4AQZA 3O4RA 3FRUB 2DLFH 2RB8A 5IXSA 4XVHA 4RY9A 1OE2A 3C3AA 1EAOA 2H6KA 4XZ4A 1PYOA 3EEIA 4Y5RD 3HFQA 2MH4A 2FF7A 1Y34E 1NJ9B 2JFGA 3KLLA 4ZYKA 3BQ9A 3V9CA 2BS8A 4WXHA 1WCYA 1L9KA 1DE4B 4LSPL 1UD4A 4FLQA 1NE7A 3BKWA 4UD2A 5HF5A 1URPA 5JJ5A 1WUNT 2VLKA 5A16A 3TX2A 5K8TA 2GPJA 4EO9A 1YR1A 2NUAB 3TLXA 2AEIT 3RS8A 3H1EA 2B1GA 4CU6A 4DK6A 5KDOA 1EUDB 3JQBC 5C7XL 4X1YB 1CFVH 1DBAH 4BA8A 2Q2NA 1Z6ZA 4Y2OB 3NBMA 1Z9SA 3BTVA 1P4HA 5I66A 3LG2A 1Z2AA 1DIGA 1ZV9A 4LJ8A 5AYUH 2C7VA 4IQHA 1P6QA 1CB7A 3O2DL 4E5UA 3GBEA 1X5AA 1V7NL 5FGRA 2VDOA 1EM8B 2OB2A 3DEYX 5JQIB 3DKKA 3IJ5A 3T2QA 5CK5A 4D92A 1U31A 1PIFA 1AS0A 3V5KA 3ND9A 1TQ8A 1AE6L 3CT6A 4GZ3A 2WA2A 2BSRB 3CLEL 4D0SA 1XR3A 4EMSA 2PXYD 1ZOXA 5IW3A 4DNOA 1AGDB 2WNSA 5BV1A 4XP5H 5SZIA 3LDHA 2DBQA 2PS3A 3I89A 2AFVA 4GQ9L 1X7SA 1PJBA 3O0LA 4JC5A 3GBML 2DL2A 1E6MA 4I5EA 2CO1A 3PWKA 1IGMH 2P11A 3ORFA 4EPVA 3TOPA 4X7PA 1UJ3A 3BX1A 3ONVA 5FBLB 3MWLA 4UZSA 4PR3A 2UUBB 4LG1A 1WEKA 3SKXA 3OPUA 4X5XA 4GIPD 2VR3A 3VVMA 4OCNC 3VJ6B 3TH3T 1S9KC 1TAUA 3LUGA 4EKDA 2TMYA 1HQ4B 4GRMA 3MRKB 4HKZB 2VP4A 1WP4A 1RQLA 5LWQA 3G6JA 3WI9A 2QLTA 2BELA 2W43A 4RZKA 5EXXA 4YCBA 4PU2A 4BO3A 3UT6A 4BCDA 3M6VA 1F1GA 5F7JA 4AC4A 4KV5E 3CN2A 4MRCA 1II9A 3PI7A 2R96A 4MUBA 3MJ7A 2P3QA 3DTTA 4K3JL 1T8UA 5C08D 5CR9A 3SJBA 2YWJA 1TNDA 5IT2H 3X13B 4F8EA 5IARA 3KM2A 1SKUA 3L16A 2ESVE 4DM4A 4PJ5D 3AW9A 1IZ0A 1KAMA 2ODHA 5T1LD 1VYVA 2DCUA 1WOYA 5TGZA 2BC9A 1DBJH 1O7DC 3H97A 2DFPA 2VHXA 2IV3A 5DC4B 3QQ9C 5EH1A 4L29B 4X00A 5E4JA 3NABL 3LBHA 3IDXH 2DQCL 2CDRA 4HSQA 4R5XA 3L08A 3ZKQD 4AM8A 3B3AA 1C3EA 1K4YA 1YA4A 1KN2L 3FZYA 4FUQA 4TSAL 4G9FD 3U9TA 1YZLA 2XA9A 1WNTA 4QO7A 3NGXA 5DBOA 3TKLA 2ENWA 1J8MF 2ZXCA 3OR7B 3ZUGA 3SEZA 1DUYB 3QE2A 2R79A 5J40A 2H45A 1Z33A 3AJAA 3CLHA 5JXAL 1GFZA 4QM6A 4K9JA 4I1PA 2FZLA 5H17A 1YK1A 5AJUA 1DC7A 3GDFA 3H16A 4CVZA 4WMLA 4HH4A 3EEBA 4ZQEA 2W9DH 3NDRA 3O8DA 5IOPA 5DZNA 3R09A 2HADA 5KPDA 2DIJA 4IX1A 1QIKA 4PJ5E 2Q1UA 3BP7B 2D8AA 4RLFA 4JRWA 2JFHA 2P9LC 4D8PB 3L17A 3OSVA 4K9EL 1I85C 3JAKB 3K2UL 5A02A 4GKNA 2YFOA 2R44A 2BCJQ 5I8PA 3C5WP 4U1NA 4F8JA 3IDZA 5JQGA 4DAGH 1G9TA 3GBMH 2JV6A 4O3FA 4PO3X 4W9CC 3MWDB 2WGXA 3LHPH 1HDIA 3QRGL 3SE6A 3T38A 1FVEA 3O2DH 3MAJA 5F2OA 4KVPA 3WU1A 4A36A 1KGWA 3Q5TA 3GNMH 2X1WL 3UYRH 4NE9A 3OM8A 3NIDB 1OD7A 2F7RA 2ISDA 3WYAA 1HDOA 1QFJA 4YQYA 2XTJE 5EUMA 4EELA 1HXMA 2YIJA 3I7NA 4OMDA 5GJBA 3RREA 2Y24A 1FP7A 4YVFA 1FTYA 2A0YA 5EP4A 5SY4A 2IPXA 1J0BA 5TPWB 3KKQA 2W38A 3L4TA 1ONNA 2HQSA 2NUTA 3KPWA 3NTOA 4WK0B 3PF8A 5E8RA 1CIUA 4L5CA 1K0UA 1ONQA 3Q2OA 2VDNB 1C1YA 2WNGA 1CG6A 5AD0B 3NJLA 5AW9B 5L4FA 2WXPA 5IMKB 3VNZA 1VCIA 3D7NA 2Z8WC 4AZ0B 2EERA 2C5FA 3W6NA 5CIQA 2DWCA 2FVNA 4OJDH 1TYEA 4GZ5A 3GTNA 4YE4L 3RIHA 3Q9UA 1G64A 4NC2B 5CIYA 1QRAA 2KPOA 3QORA 1RXLA 1QTRA 1NFKA 4CMHB 1V9CA 1L8LA 3DAHA 5IKOA 3B2XA 3FTZA 4PRIB 2E75C 5D96C 3FLAA 3U7AA 3VFVA 1DBRA 2Y1YA 4Z9XA 5DM2A 1T3SA 2CK0H 2AFRA 1Z74A 5K0GA 5TPZD 3UXMA 4DDWA 5L2KD 2WBXA 4U2KA 2C4FT 1AO0A 4RVFA 3TINA 5ELMA 1KEKA 4MJ2A 5L0QB 1GGJA 4NSXA 3CA8A 2KZKA 1YRBA 3V4LA 4O4LA 5MGBA 2OXHB 3LECA 5ANMB 2H14A 4MWGA 4PGZA 5ABPA 5JCZA 1U3JA 5ESWA 4GMXA 3UWOA 5EJ5A 3UJIH 1SZPA 3TK1A 3GCGA 2XC8A 2QVZX 4RZIA 1PW5A 2VP6A 1V16B 4KXQA 4NUQA 3HLYA 1AQLA 2ZWIA 1I9RL 3W0WA 2Q1WA 1MCOH 3EYFB 3GFUA 3VXKA 2V9TA 2ZWPA 2YBRB 1QWHA 1F4HA 1ETUA 3Q4GA 1AGEB 1TU2A 4GR9A 4U1JB 3FR8A 2G76A 4JFDB 4QA9A 3QDMB 5BURA 4M7LL 3S37H 4KQ3H 4X3PA 2QKIB 1PP4A 1LNUB 5KKAA 5I45A 5K8JB 1N8ZB 1W0WA 2COQA 1GTFA 4H5SB 2CK0L 3OB0K 3PIDA 1UTDA 1E4EB 4EHAA 2OFXA 1U36A 4V39A 1P2FA 4L15A 4X92A 3TSWA 4M0DA 1GT6A 4M00A 5CXBB 1P3Y1 2XZZA 3ANMA 2FO8A 1LW6E 3CF4A 3AS2A 4EK9A 2WAAA 4NYMR 3EPKA 1YDGA 5JDCA 5KWYC 3K6KA 1JWLA 3PV0A 2IPUG 4KOBA 3DIFA 4I5BB 4Y2TA 2EDWA 4NZYA 3QQXA 2E27L 1QX1A 5G5DB 1ILUA 3VA2C 1TDJA 1RVV1 5LM3A 1JPNA 3M34A 2HBZA 1E7RA 3ZIYA 3H6AA 2OG2A 1IEVA 3RWFB 5D55A 5L7TA 4HGZA 1LWOA 3V5HB 4JN6B 3TTXA 4AG3A 3A6KA 3PFWO 3QIVA 2F74B 1BXGA 1MCPH 1DAMA 1ECCA 1D5MB 2W2XA 3GJYA 1KEEA 2DULA 1NOLA 5GRUL 1G94A 1E43A 4C7JA 5FLYA 4KP7A 4Z7WE 2E6JA 4HWOA 1YWGO 4Q9NA 4OT1H 1PDKA 5DHUA 2W0PA 3MUOA 3VR4D 3IELA 3EJZC 4M61B 3SCMA 1PFKA 3G1WA 1K6QL 1D6MA 3A1CA 2P3YA 3O3EB 2RARA 4PHZA 1MIHA 3KBBA 4Y1SA 3QUYD 4HDMA 2APWA 3MGGA 2WXRA 1S3SA 3T0FA 1OB1B 3RFFA 1AUQA 2WTNA 4D97A 5C0RL 3T61A 3M6MD 1DQPA 1Y37A 1I7QB 1HAUA 4Q4HA 3UUWA 4Y2GA 3SKMB 1PNDA 4NUMA 1XT5A 4M8LA 1NOAA 1S2IA 3BXNA 4QSHA 3FTYA 2RD0A 1EQ2A 1R5BA 4P2RD 4DAEA 1FQWA 4MZ2A 3NYQA 1HTYA 5EC2A 3PKJA 1P9NA 2WGNB 1PT6A 2UAGA 1F0NA 2XD9A 2R0LH 3TG8A 2JE8A 1A8HA 3NCCB 4O02B 2VXTH 1K4CB 4XVOA 4S2EA 1L9SA 2ESVB 4YT5A 4F3TA 3U48A 2YRLA 4Y18A 1FP4A 1ZITA 1CI5A 2ZCJA 2ODAA 3QEBZ 1M2KA 1FFNB 4YDVA 3NJ4A 3VFOA 5TXGA 2WZQA 1KVUA 4BNGA 1QCCA 4KFMB 2FB4L 1VFMA 1JGLH 3VI3A 2R00C 3GLHE 4F8QA 2D0GA 4GM8A 5J13B 2VK2A 3HYSA 2WVHA 1PWHA 5KVDL 2GC4A 1JIVA 1GRVA 4AK2A 3K80A 3QOWA 3LKNB 1VB9A 5JVDB 2H6QA 2Y7LA 4PJDA 2OBLA 2D8KA 1T1EA 2FMUA 5CF3A 4EVQA 3I6MA 3I01M 4ZYVA 3T6WA 1J7KA 2QPDB 3DTYA 4COOA 2O5EA 1OB2A 4PQRA 1TM1E 3GIVB 5LQBL 1DJNA 3OOSA 3U7WH 1UBHS 4KO6A 2BVNA 2VPQA 3WGOA 5DMKA 4QQKA 3M1OA 4KI7A 4B85A 3MRDB 1AD0B 5H16A 1US8A 1S4IA 2PP9A 2IZ1A 2QM0A 1O89A 4PG6A 1MPTA 3AIMA 2EEFA 3IP1A 1ZT4B 1P4LA 5ICMA 1DU4A 4UTCA 4EMBA 2QUHA 2O14A 1IYZA 3ZGLA 1WFNA 4DLLA 4KROC 4PREA 1VKOA 1NN5A 1S8OA 2BWDA 4H8WL 2CXUA 3WGJA 4FYJA 3N5KA 4YJ2A 2NMSA 4FJ6A 2XBUA 2HSGA 4C0HA 4S0TD 1C7ZA 3P96A 1BTOA 4U8GA 2E76C 1FTQA 3K6NA 1YRAA 1NBIA 3RJQB 3GFOA 3U9PL 2OMKA 2FL5B 4M56A 4KDTC 1S9YA 2X2YA 4D2IA 4MJIA 5CJQH 2WIAA 3WJMA 2P0YA 4LNVA 3AC0A 3WIDA 3HJ0A 4BD4A 3DXAB 1BF5A 1HRDA 3STUA 3Q9QA 4XWAA 3HUJA 3V7YA 3J7AC 3WLJA 2E4ZA 3P97A 2XCMC 3AIKA 1YJDC 4NX2A 3CVIL 3DMNA 3A05A 2OXGB 4JVUA 1YR2A 4RFNC 4L4UA 3ZHYA 3KLMX 2D3TA 1KSGA 4BQFA 3NNNA 1RPQA 5FKAA 4LRYA 4YBLC 4ODXB 4Y3UA 1R19A 4UUPA 4GMHA 1TUIA 4LP5A 1QNLA 3UMTA 1SCQA 4UBLA 4B0OA 5EOTA 4ZAZA 4APQC 1SWVA 2IYUA 3DQQA 1MO2A 5KBYA 3IETB 5ALVA 2Y22A 1T6NA 1AGPA 1JKIA 3MXTA 3N70A 2QW1A 1E60A 2NUPB 1SHMA 1M2VB 1VLHA 1UJ2A 4E88A 4KO9A 1OY3B 3TD2A 1VZ3A 4NZOA 1CZ8L 1GL4B 1USQA 3SGLA 4UMFA 2PJDA 4OZHE 2LVCA 2DTML 2DPLA 3H5TA 4EKGA 4LPTA 2XY2A 3NJGA 3O2JA 2WDPA 3IVRA 1BOGA 1FLVA 3K6JA 4B9KC 1RAGA 3UC2A 3O2WH 4WO4B 2OOKA 1ZVVA 2V5MA 4MIYA 5I73B 1JFHA 2REQA 4MA0A 3CFQA 3V0AC 5D01A 1XZIA 1PLBA 1NAHA 3W8NA 3D8SA 3NXKA 3LQZA 3P2OA 3P9SA 3ATBA 5JXWA 4YRSA 4HJUA 4YBLB 3MIIA 4GS7C 4X41A 3TKYA 3OUTA 1SCAA 1LXCA 3ANTA 1MCWM 1WA2X 4EIUA 4JELA 1BV8A 3C7TA 3SE9L 1WIUA 3RBGA 5DM60 3ZD7A 5JAPA 3FDZB 1FJ1B 5HGBB 3PR3A 5LNK1 4L9SA 4L8VA 4P06A 4B3IA 2Y71A 1OE3A 1UIMA 4HJJL 2FT6A 4LQCA 1BE0A 4MZIA 2J3DA 5FO2A 1FE8A 2BW4A 2P9TA 2BVPA 3PNWB 1Z29A 3FSEA 2AI2A 3ZV4A 5CYKB 3ZGHA 4G1UC 2YWBA 5KANI 3U60B 4PLCA 4RWZA 5A5VA 3OOYA 1UOLA 2IP1A 1XEXA 4UTAH 1M1NB 2XQBH 4BFLA 1IFXA 3VSCA 4PJBE 3W82A 3DX9A 1HTBA 3WEXA 4F4DA 3TOSA 1EAMA 4XPTL 1K8XB 1QLFB 1ZY2A 5DTFA 5B3JF 4EYEA 2KZBA 4QXGH 5EXEA 2ZI3A 3ANXA 4EN3C 2AUMA 3AXTA 1LEGA 3Q9LA 4XCFH 1NAKH 1U93B 4QNPE 1OWMA 4LARL 4WZ6A 1PR1A 4F24A 3RU8H 2I5YH 1TEFA 4D3SA 1WQVT 4Y4KD 5FWNA 1YUHA 4A8TA 4K1LA 1T7XA 2CDGB 5FGBC 1LLFA 5F4ZA 3S2EA 3QA9A 3G59A 3T7CA 2XSZA 3C6LA 1KP3A 1IT9H 1TJGH 1C9EA 3AF2A 3UMGA 3DF9A 1O6VA 3CXHK 4F2ME 4C0QC 2RHHA 2OBBA 4Z0PA 3EYOA 1Y1LA 4OQFA 1G55A 3CEAA 3S3JA 3G5LA 1C8VB 3Q3GA 5CEXA 1A3CA 1S9HA 5KOHB 1GM5A 2XTZA 1OT2A 1JR3A 2P24B 1Z5OA 1ZHLA 1KDVA 3F1LA 1W36D 3WN6A 2YPKB 2AEMA 2PW2B 3BWAA 3TZVC 3DHUA 4E68A 3APNA 5IROC 3BLBA 2RSLA 1NFDE 5AHWA 1KYVA 3C6ZA 1EWHA 2HSJA 4Q6IC 1F6FB 1BCIA 4XPGL 1G9HA 4EPTA 3NHPA 4QRPB 2ALAA 3NOVA 3OKLA 4CF7A 4NN6C 4QRFA 1VPVA 1L7VC 5DTJA 2B1OA 3Q01A 3H3XA 3MLEA 4DR2B 4EM6A 2WIMA 1ISFA 3QXUA 2AK4A 3I1JA 1Y3IA 2W81C 3Q87B 4ONOA 4ACTA 3R4DA 4M8VA 3EUDA 2F54B 4MUJA 5DLDA 3C6LB 1ZK2A 1DQML 2W91A 5CJ5A 2BFVL 3RB7A 3HUTA 3EFOA 3MBEB 2LKDA 1K2WA 5K0CA 3LQ1A 4NT6B 1L7NA 1QAMA 4NR0A 3LH5A 4ID3A 1FFDA 5K0FA 4JLPA 4KVGA 4XNXL 2XLCA 1XVAA 4KOCA 4RIRA 3VFGL 3UT0A 4KTVE 4NZTH 2OTUB 1U8YA 4C4YA 3OP4A 5I0WA 4DZRA 1BVUA 3LTNC 1KVQA 2EW2A 3ZR4B 2DBYA 4NN6B 5ERWA 1N0IA 3NQ41 3CHOA 3RUGF 3OAUL 2KSQA 1CU4H 1N7ML 1PV2A 3UERA 1YK0A 4UM9B 4XVUA 3PAVA 4RIIA 2ZSKA 3TM5A 3UT5B 3I6QA 1G6RL 4PBTA 1HXYB 2E3VA 5D4HA 3JV7A 2QI9F 4ZXBB 1CFSB 3WL6A 1E5DA 1G7LA 4JJHA 1BKDR 1JTEA 3AHEA 4ZKDA 1WKBA 4MKMA 2FQXA 4O25A 5JYCA 3PQ5A 5DW3A 4A15A 4YK4B 2CK2A 2JIXD 3P19A 4FI3F 3BCHA 4UCFA 2X7LB 4HWTA 3QG7H 3VDXA 3NSCA 3B3FA 4BE6A 3WMFA 4R7NA 1RI3A 3AY2A 3DV9A 3LH2L 2B4YA 4QNPF 1ZRHA 1RZKL 4UV7H 1SF5A 1A1NA 2IEGA 1EBUA 2ITCB 2PQ0A 2YMPA 2BSTB 5F1NA 4RZXA 4A5SA 5G0WA 2ICCA 1FMLA 5K9ZA 3LVEA 1WA0X 4E5YA 4ZAFA 2EO1A 5HHVH 3T7EA 4XUEA 2REQB 2ADOA 1UOVA 4P3OA 4PFSA 4ZV7A 2G0NA 1TZGH 3IK2A 3JPYA 5B6PA 1EDYA 5JPMB 1K9VF 4IGKA 1MI5E 1CY2A 4DUXA 1QYGL 1IUKA 2FFHA 2OUIA 4XR8C 1TA0A 2VRQA 1EWVA 4JKLA 5GS0H 1ZI6A 3PQ7A 3IETA 1GY8A 1W29A 1JB1A 5A2QA 1X42A 4BFXA 5I48A 1C1EH 3KEFA 4ZUSA 4HFWB 3R4VA 3A36A 2QHRH 5K8LA 1WA5A 2Q10A 4DA8A 3SDZA 3I8EA 4CV3A 4NO0A 1NFDF 5T5QA 4OZ4B 4PJDB 2I33A 2WB4A 4J3NA 4AZ3A 2ZCHL 5DK2B 4KI5E 5EBWA 3TO2A 2P7TA 5H5JA 3HI4A 3LBAA 4W9EC 4OF4A 4I9FA 1QK3A 4O1QD 3KKKA 4KQ9A 4PGCA 3THWB 4E0BA 3LKBA 4AP6A 5BZDB 2AT1A 1M1YA 4CTNA 3I1IA 1IAIH 5TEEA 4FZRA 3OZCA 3ENNA 3NC4A 3I2IA 4DFIA 5F12A 3ARDC 4D43A 4R7XA 1TYEB 5EE9A 3QJ5A 1HETA 4HVAA 4YJZL 4HQOA 4Z7OB 3BD9A 3FT0A 3E0QA 1IEAA 2WLHA 1R5JA 2H26A 1GGIL 3FCBA 2D5BA 4X6DF 2WO3B 2QUJA 1F14A 4X8JA 3IRZA 3WHE0 2BZGA 4AYGA 3IGLA 2YUIA 4OSUL 1UB5A 3R6DA 3MMEA 1KMCA 4WVRA 1KB3A 1A3ZA 2A5FA 4N3CA 3PE9A 2IEPA 1QHXA 4XYMA 4PNEA 2ZUFA 4J0WA 2E7HA 1XLVA 2DH2A 15C8H 2F61A 1F12A 5KSAD 2VJOA 3M8OH 4EHBA 2XWTA 2CDGA 5KBDA 4GSDL 1K8RA 3D08A 3SY6A 1RPAA 2XXAA 2UY7B 3OZGA 1I3KA 1EUDA 4X1YA 2FEXA 1T8YA 3KVQA 5CB8A 2VL5A 3WY3A 3B53X 2WIGA 4Q4JA 1CHNA 3NHWA 1GZSA 1SOXA 3CZEA 4IRZL 3CN9A 1QGED 3MELA 1DRVA 3I2GA 2XRZA 2QTLA 2YMXL 2CHNA 1A04A 2ZNWA 4BLPA 1HFEL 5EJ6A 3CFDA 2BI8A 1QYGH 3E7WA 2IAMB 1Q0HA 4KAQL 3UGEA 2H06A 1OHHA 1OZHA 5FTNA 4K9OA 4X7BA 1MWAL 3E6FA 4ZVVA 2O8BB 3TVMD 3ERXA 1R8SA 4WNQA 4WKCA 3FC8A 1WY5A 1NR1A 4HCGA 3UZVB 3U3OA 4OSUH 3K0BA 4HJTA 3OLEA 3VU1A 2DL9A 1VEOA 4IIYA 2N75A 4ZGBA 2Q76B 2H1VA 1FV1B 1CYDA 3HCWA 1ZIBA 1FFNA 2BDUA 3VYWA 3MPOA 2GARA 2HCBA 2C3VB 2VZTA 4DEVA 3C60D 2XEXA 1MNUL 4G7YH 4KXWA 3P9ZA 3RZCA 1U9ZA 4A5OA 5CDHA 4KKVA 1KO5A 2ATKA 4B5LA 5HQ3A 2ZUWA 4LRSB 3ZKAA 4LZNA 1HPLA 1AOHA 2FZ3A 3VFMA 3TVMC 2ATPA 3FAZA 1YZGA 5KHLB 3FUCA 3I5UA 4JSXC 3MBWB 3KHOA 3HB1A 4X0KB 2D7OA 5F3HB 4TUJA 2AYZA 2DB8A 1JGEA 1EHIA 5BR7A 1X8XA 5C81A 3BFWA 3RBSA 4L3OA 1T4BA 4UDTB 1NNUA 2XGOA 4FERA 4ZHQF 4QHTA 4YH1A 2GERA 2B9BA 3N59A 5TT1A 2GI7A 2V17L 1AZSC 1O77A 2M9MA 1P3DA 1FBIH 5JLZA 4ND1A 3QI0A 3EY4A 2GTPA 3GUYA 3L6DA 3L3IA 2EU8A 4UBIA 3FTEA 3VV3A 4URYR 4MR8B 3MJ7B 3WZLA 5KNCA 1SGKA 5F6HI 2QBYA 4FEIA 1DLHA 4NZTL 5A6LA 1AGRA 4TMTA 2IPOA 1MCEA 1AQIA 1WLYA 4NMLA 32C2B 2A5JA 4RM2A 4L8SB 4YCAA 5HDBF 1WXQA 3WK9A 3JY6A 1EINA 2YV3A 2F53D 5C2BL 1GKYA 3WFZA 4I2VA 4KFTA 5AAMA 4U0RC 4NS4A 4TTTS 4OQLA 1GGHA 3H11A 2A6PA 3GGJA 3VM7A 4L4VB 4ZOAA 3ZIAD 3RG8A 1E0KA 3ZSTA 2G1UA 4FD2A 1DEEB 3AONB 1AE1A 4LLAA 1QZ1A 3BWMA 4GL2A 4N7BA 1QQAA 4JKYA 3AHHA 1PLJA 1XAJA 4UNNA 1ZCJA 3GMIA 4Y6RA 1SUSA 1BROA 4LV6A 4LP8A 3GNQA 1HQRA 3A4VA 4JNCA 3P2DA 3SN6A 5K1CC 4NO5A 3U25A 4LV8B 2Q8AL 3B7WA 1TOAA 5EMKB 4OXIA 1DDIA 5DCLA 5IJ8E 3I2CH 5DWPA 1T1IA 1UP6A 2OCFD 3LH2H 2EJVA 3EO9H 1E7WA 2YFQA 3I3DA 4PJXB 2J1KA 4C20A 2I8LA 4QJ3B 3W1VA 2R85A 4PSAA 4IGFA 4MAAA 1N2RA 5JQHC 1WFMA 1BXRB 2BNQD 4L4TA 1OBVA 1ZVJA 1JOIA 4WOBA 1TXGA 5DHQA 1XLTC 3MPCA 3WNDA 4YAEA 4AY3A 3LUHA 3TD9A 5J56B 1MV5A 4XR4A 2QADD 5JMWA 5M95B 5CP3H 1JDSA 4C9BA 4YHKL 3QXCA 1M3JA 5KWVA 1K6JA 1ETZB 1ZK9A 2O1SA 2V7UA 3GJFK 5TDHB 5M94B 4OFBA 2GTQA 5E1AB 2Y1DA 3MUY1 3EGVA 3AEQB 1EQAA 2FYYA 2DF3A 3BIKB 3GO1H 4EO5A 2AXQA 3Q3HA 2H4FA 1FFOA 4G71B 5H14A 3SS7X 4HHWA 1Y9AA 2I3SA 1Z66A 1TF5A 3QIWB 1KGXA 2Z83A 4XVSH 2VZ9A 1NCDL 4EG7A 2A1TS 4FLMA 3TV8A 3NC1C 4U7PB 4F8PA 4DS3A 2RGEA 3M9LA 2G8LA 3W05A 5CPBA 4JRYA 1FZQA 3PUJA 1T34A 4D0LB 3I2YX 5LMNB 4DVGA 3D3WA 3O8XA 4LK4A 1MY7A 2IZ6A 4MUAA 3G1UA 4X2UA 1DJOA 4RD4A 3VPGA 3N2GB 3D3QA 1BCSA 4U1LB 3B48A 3WADA 3K0FA 2A0UA 4RESB 1SD5A 1AGCA 2QRNA 5MENB 1KBKA 4XEUA 4N2MA 1ISIA 4LT7A 1Q44A 3MNWA 2KLSA 2QVTA 5GGRY 1NASA 1N1GA 4OK6A 2VZ3A 1H9BA 2I3TA 2F19L 2H7YA 3MTAA 3BRWD 1E69A 1YEDB 4HNSA 2C7QA 2C9QA 2E5LB 2BWQA 1MOZA 5DGTA 3S8EA 2Z8XA 1JLHA 1J0JA 2QMHA 3HHSB 4J0IA 1HE1C 5ULLA 1KZ7B 3GJFH 5BQ3A 3USES 3EO0A 4BB9A 2J6IA 4F8OA 1YFQA 3LEVL 4AENA 2R1TB 4ERNA 1L5ZA 3HC3H 1NXVA 4GOKA 1BREA 4ZV4A 2H52A 3S96B 1HHKA 1DARA 1ADYA 1NY5A 2Z5FA 2J25A 2Q6TA 1CDJA 1WUZA 1NFRA 2RGGA 2XCIA 1X0XA 4ZW6A 5IQMA 2P2YA 1K9SA 4MWOA 4N9WA 4H2AA 5DU2A 4ND2A 3QHAA 2WWYA 4A6YH 1J9EA 4D9NA 2NXZB 1KG0A 3AZUA 3LUDA 3W38A 3R7LA 5IVPA 4BNTA 3VOSA 2LZ0A 1BCSB 4LGSB 4HUKB 4WW0A 1HK7A 4L8BA 4G1FA 2BV3A 5IVKA 3QO0A 1TIBA 2CNWD 1GGTA 2WTAA 2EUWA 4ZI7A 3JWGA 4LY6A 2E47A 4P9HH 3MCUA 4L28A 4NO2B 4X95A 1E27A 1JZIA 3OA0A 1KTVA 4TXMA 2OENG 1XEUA 5KWSA 1V43A 5CCHE 3D8MA 1R66A 4Y2DA 2GAZA 2FSHA 3A31A 3AHCA 4HEA6 5LO7A 4NBYB 1HEJC 3FYUA 5IYZB 4WTZG 2QV7A 2AZMA 3DV6B 1ULZA 1TNMA 2RJMA 1VE7A 3ULUL 3HUUA 3L6FB 4XYEA 1RC1A 4H0HB 4EXPX 3V5KB 3ES6B 4RDIA 1ZOIA 5DGQA 1GOGA 4DGVL 1M5UA 1UZ8B 2O8DA 3L7AA 3BCDA 5AW7A 2VF5X 4DP2X 4A7VA 1KPHA 1FL9A 3DO8A 1JG9A 4W6WB 1VL6A 1R24B 1X5KA 3PG5A 4HEPA 3TNJA 1A4KB 1F90L 4ZMLA 2I4OA 4ZVQA 3TH2T 4ONFH 1H93A 2BW5A 1OI7A 4HMQA 2R0WH 4YIQA 4M0PA 4YHHB 3RTEA 3ONDA 4O33A 1SQGA 1RI6A 1VMEA 3W0WB 2PUWA 4HZGA 4IRSD 1U11A 4LLWA 2M1XA 4J28A 4N03A 3IQHX 3GLIB 3OKOB 3U3RA 4FWWA 1IHXA 3BVXA 3UFXB 4FW8A 4OG2A 1KNOA 3FNHA 1CZHA 3FTWA 5ADWA 2I26N 4NQDD 1LE5A 3DV6A 3I8OA 3CGTA 5E1IA 1ET5A 4JL8A 2C5BA 2OXHA 3VXOB 1WB5A 2BW0A 5D7JB 3RH0A 2FRDA 4IWXA 5DMYA 5AVWB 1HV8A 4Q4DA 1W6RA 4BNUA 4PIMA 1IJFA 2XGSA 4X5XB 5KSAC 3H3KA 4FTVB 1WDTA 1N6IA 4BE9A 3KPQB 3HOGA 1M72A 3CFEB 1KK2A 2CBTA 4XNQA 1ZC4A 1W76A 3H75A 2YICA 3UIEA 3BEOA 3QKIA 3W4KA 4DBLC 2GD1O 4YQXH 4H1VA 1JX6A 5I1HL 1K3ZA 1YS2X 2BNUA 4MD5B 1AZVA 4OD3L 2W48A 4B45A 1EX1A 1ZS9A 5JXJA 2QRZA 1ZSHA 4HBZA 2JI6A 2YW9A 4ZHSA 5GZND 4B81A 3RS4A 5JIHA 3L1FA 2HFFB 4JLRB 1H42A 3C6KA 1CZKA 3MRHB 2OYMA 5EESA 5DT1H 2R4RL 1SUWA 3FZEA 2WU3A 2QK4A 1SCBA 1AA9A 5LQCA 3H87A 4DCSA 4RYDA 5GRWA 4WEOA 1EM8A 2V2WB 3P3RA 1SCJA 4BSVB 2J3MA 2X0IA 4TX1A 3URKA 3P4NA 4KUHA 3QJTB 3K0YA 5GGRB 1L7BA 1I8AA 3FNBA 5I66B 1J70A 1OGAE 3IS0X 5AI5A 2CHUA 1YIDA 3VDNB 4LLMA 3GRWH 1DBWA 2KM1A 3VYRB 1I7TB 2POQX 2VDLB 3I7OA 1A69A 4ANKA 4PS3A 2Q1XA 3QE9Y 1T9BA 3EO0B 5H8WA 2L8AA 4UZFA 3HKEA 4TLLB 3SIXA 1XCJA 4PI2A 1OH6A 2EYTA 3SI7A 1YMME 2O6LA 3T5DA 4AW7A 3CVYA 1I01A 4WDQA 3E82A 4IHQA 1IAOA 3IU3A 1RLIA 5DQ9A 1R6XA 4IYJA 3K4AA 2Q6OA 2VDLL 4JPKH 3PSAA 6AT1A 1FIGL 2EP7A 3K27A 3AS1A 2G3XA 1UC5B 1VKJA 2QGFA 4EG3A 3Q0EA 5GINE 1ZLVK 1OAZH 1W25A 4WEEA 2I0RA 3KB6A 2WB2A 5IV2A 4M1SA 4O58H 4FABL 1QIMA 3EHBC 1PG2A 2HA2A 4G5ZL 3TQSA 4F4IA 1JQEA 3QTTA 1GEEA 3E8UL 4NMMA 4XXWA 5AKSA 2QAIA 4EQ2A 3E58A 3D0LB 2E89A 3T4AC 3WFBH 1SMOA 4ZMPA 5M3BA 1U8NA 2LU4A 3HCAA 3WTBA 1AHPA 1XDDA 1EBFA 1CY0A 1NLDH 3D31A 2ORWA 1OOAA 3KVRA 1B2LA 3MB8A 2GSIB 3UBXA 2QX8A 3IPCA 4TKZA 5EC1A 3KX2A 3G6AB 5T67A 4N5UA 4ER3A 2Q5LA 2WUDA 1NF9A 5EP1A 3DYVA 2RKOA 4N01A 3B7FA 2WO4A 3KRXB 1KJ9A 3UJAA 3RUHA 1IXKA 1M0WA 6ADHA 2IXQB 4LVNB 4WUUB 1M0EA 4Z3FA 2CBQA 3V4VA 5JS1A 2H0QA 3RS5A 4P3XA 2QIOA 1D5XA 2HVBA 3T6XA 1R0WA 4HRVA 3JQAB 2RA1A 5CEZE 2PV0A 1B0ZA 2EUVA 1FW8A 4J3OG 2DQKA 4J1UA 3ER6A 4MVYA 1KLGA 5EEVA 2NDGA 3SDAC 3H4TA 1ES0A 1TTHA 4UREA 2W6PA 2H9AA 3W5CA 3WC4A 1GUBA 2XXAB 1RFDL 1EEHA 1XCTA 4ABTA 3NFPB 5BPHA 4NAUA 4UE2A 3QRLA 4RELA 2W8BB 4P2OB 3I4CA 3NM4A 3Q8WA 4HKTA 2WCGA 3MCYA 3QFJD 2Q45A 4J8PA 4BMVA 3IIYA 1INEL 1HOCB 2BLNA 3KYCB 1N2RB 2YJ5A 1E28B 3F01A 3LBIA 1BXKA 1XO1A 1DOHA 3B8HA 3UUFA 3BULA 4OVVA 1WKVA 4YO7A 3U16A 2GJZA 2JAWA 1GL7A 1E4KA 2REBA 3VDRA 4A2WA 3LN4A 4LSRH 3KQLA 1RI2A 4JDTL 2H7CA 4OCXL 2VO1A 2A77L 5DX1A 4H20H 2JDIA 1GNRA 4JREB 5BV7B 4LX8A 2QNIA 1FJGB 1HQYE 3L7OA 2LV4A 1THTA 1XDSA 5JIBA 2QJOA 8FABA 3UPDA 1DJLA 3RSQA 2CCWA 4ZQTA 1KQNA 2Q5QA 3SKJL 3TEZA 2P9FA 2FTAA 1IL1B 4JUDX 5ITWA 1U02A 4XCYB 4M6ML 1OP5H 3Q9SA 1JH8A 5FOJA 2X1OA 1HFJA 3FBKA 5F9DC 3KEQA 3R77A 4TSFD 1VERA 4LJ6A 1D5IL 5I24A 2WNIA 2ZRKA 5HKBA 3CR3C 1QOKA 5I30H 4G6AD 1TT7A 2A0WA 4XAKE 2ZWAA 4IMRA 5ELLA 1YGPA 1PY4A 3EYAA 2FN9A 3E2PA 2IYSA 5LWYH 2OK0H 3H5WA 5C0CB 4GPVA 4ZOCA 3TE7A 4YNYA 5KNCH 1Q90A 5IHLB 1E2QA 5DJ8B 1OPGH 4UIKH 3QX8A 3ZHZA 4EG5A 3AO0B 2ZE0A 4EA7A 5D7KD 2P9IC 1X9LA 4P54A 2JAOA 1E3WA 2YXLA 4JFQB 1CI3M 5IB2B 1U41A 1E7YA 1M7XA 4JFFD 2AV7B 3KSMA 4MWEA 3EOYG 3U0PA 2X8LA 2XE4A 5IDWA 1QSFB 3WGQA 4C08A 4GP5B 2Z30A 1ECPA 3CPSA 2C84A 5A3IC 1MR3F 3RVQA 4MGEA 1TSRA 5C6TH 4IA9A 4ZO4A 4HS9A 2E87A 3IGAA 4Z7NA 2X6MA 1SLUA 1XVIA 2G60H 4WKXA 4HATA 5K8UA 4Z7IA 3A3YA 3VB9A 1R5NA 2OSYA 3ZGIA 1Q0YL 1TDQA 2OXTA 2VDRH 3LXBA 3VFUB 2AS0A 4LF6B 2QAGC 3DWTA 1M8KA 3MCAA 1GPOH 2WWMD 4EBQL 3OCWA 5CFZA 1Q1AA 3FCYA 1E6EA 1E67A 1I30A 2JJ8A 3OMNB 5EEXA 1WG3A 2F7PA 3AQYA 4L4TD 3MNMA 4ZI7B 4AK1A 4UQCA 4JAMA 1S8DA 3OZLA 3PDUA 4YXLL 2X7XA 1T5HX 3EA4A 2CF6A 1MI5D 2A14A 4BNKA 2ICEA 1U2ZA 1L5KA 5LA6F 2ZUSA 4KQEA 5HDBE 2QLFA 2IPTL 3NEPX 4KK8D 3TTSA 1KIRA 3MGCA 1AQJA 4EY5A 3KYNA 1EFXD 2BNRD 2IAMA 1Z5VA 3BZEA 2QE7A 4JKMA 3WLSA 4BVAA 1UA6H 3TV3H 1Z9OA 2FSEA 4Q1CA 5T8IA 3LI2A 1WULS 3MGOA 3A2MA 1S9VA 2ZJFA 3LP5A 1XTIA 3MJHA 4EY6A 3IJHB 2O0HA 4IDEA 1QB7A 1NMSA 3SF8A 3DSRA 2YA0A 2ZF9A 5C8YA 4K2HA 3UO1H 4I9XA 4IEFB 3U4BL 4GI7A 1VFBA 4Z6KA 5KQMA 5EZLB 5BZXA 5AJYA 2V6HA 3LN9A 4L4TE 1ZWIB 3IEAA 1OLXA 3AY0A 1S7SB 4G8IB 1U33A 2X4NA 3IAS1 1OAQH 4LCEA 5DTQA 5GOTA 4PG7A 2IV2X 2ZOOA 2LVEA 4R2XA 2DQJL 2ZVPX 1RP1A 4PPGA 2DWYA 2C58A 2ZJ1A 4E07A 1EAYA 2JIZA 4U0QB 3SP1A 2DWEA 2I87A 2G2RA 4K9LA 5D1QA 1BAFH 5DLLA 2WIBA 4NG5A 5IJ0A 2DBVO 3HXQA 3S36H 4BQRA 4QRPA 4J76A 2ZANA 2FNBA 5IT4A 5K8IA 2YBAA 1GKEA 2K9FB 2H1RA 3I0ZA 2JGAA 5AG8A 1ESZA 2NTFA 1CBJA 3LQ4A 2CZGA 5ACZB 1S7WB 1RYEA 1VLJA 5EEUA 5AQ1A 3KOXA 3IU4L 4KRPC 1U91B 3D18B 4X7TA 2CMRH 1TJHH 1Z6GA 1PGNA 4TNGA 3C8KB 2WBJD 3RPIA 2IK8A 1N2GA 2NNWB 3UJBA 4D4HA 1H2FA 4LCIL 3H9YA 5I7HA 5F7MC 3ZHSA 2JKSA 1Z4LA 1BRTA 4ZD3H 1UPXA 3QXDB 2MQCA 2G0KA 3GPEA 3PWPA 1UK7A 1SEBB 5DO8A 6FABH 4NQVA 5IFLA 4HA1A 4YAUA 3U4AA 4PRIE 3BE1L 1DKPA 5T3UA 2X5OA 4RANA 3UADA 1ZN8A 5J43A 1N6NA 1PEDA 5EU6B 1M3SA 5K0BA 2H1IA 3BCUA 2FG5A 3RUCA 3D4NA 1CQWA 3P9LA 3JVUA 5E4IA 4ZGWA 1G7QB 3KGUA 4MP3A 2WXNA 5JS2A 5C1PA 1UDBA 1UBSB 1ZSYA 1ZSDA 3AM3A 1BFKA 1CQYA 4GVXA 2CUTA 1XGZA 1A6ZB 3IMSA 1KEML 1R24A 4J23A 3KT8A 4CM3A 5LOVF 4NBUA 2A9PA 5C71A 3X1BA 2KHZA 3QUYA 4EZBA 5LZ5A 1NW9B 2XY4A 4MAUH 4O3MA 2AZUA 4WF7A 2VSMB 4Z1OA 1UUSA 1WW8A 1TJHL 1ZANL 3HZMA 1W36C 1KKMA 2I76A 1FW6A 4IRSC 2YN3A 4XD7A 4IMKC 4JLUA 4BQBA 1IUNA 2ZULA 1QRNA 4XBGA 2CHFA 3O8QB 4XZ3A 4PRID 2J2ZA 2LFEA 3C9NA 4GM0A 5EQFA 4RGYA 4IXDA 1K8ZB 4HUWA 4W6QA 4FXGA 5JJIA 3WL9B 3QX3A 5L2KA 3ML8A 4TQPA 4HS8H 4KCGA 2GHZA 1ULAA 4UMEA 3IEVA 3P5SA 4TT3D 5ANHA 5GGVY 2PGOA 4JASB 4BLVA 1CFVL 3HLTA 3KAAA 1YR8A 1E2ZA 5M5BA 4Y7MA 4AUYA 4YV1A 2Y36H 3BPOB 4MNQE 3V4VH 2DKFA 4HEA1 5DTIA 5KNCD 3PWNB 4BLQA 5EZPA 4MAMA 3O1LA 3GXFA 5I6XC 1SXGA 4YDHB 2M2DA 1KEMH 2FEEI 4YUVA 5E4EC 3H0EA 3WV0A 3LQZB 1FLDA 4NWTL 1SKQA 3I84A 3FF4A 2PM9B 1BPLB 4Z78B 2IOYA 4KLCA 1Y18B 4Y1FA 5CFNA 2H3NB 4IOSA 5I7SA 3AL8A 3ZK9A 4CN4A 5FPSA 2Q1SA 4QKTA 4YLCA 1MO5A 3NBUA 1H9AA 1PX3A 3V6FB 3ZW3A 3MWKA 2F17A 1NYLA 2G77B 1O9WA 1N59B 3D43A 2PNDA 3O1JC 3MREA 1HURA 4LGYA 5DJCB 1L7TH 5K01A 2PYED 3TCKA 5DFVD 3DWIA 2HSEA 1IB5A 3SFTA 3VXUA 4EY3A 1X87A 3RJOA 4XCEB 2PZMA 1VB5A 1S3GA 4LF9B 5EOQH 3THXA 2R1YA 2YD5A 3DECA 2WV3A 1ZK3A 4NQEE 4WPGA 2ARKA 5K6AA 3VU0A 1V8OA 4E9TA 2FEAA 4HV4A 1WQ3A 1FDVA 4N9QA 3V8VA 3HVJA 3PCRB 1ZYUA 4YI3A 4HDNA 5M61A 4S1OA 1BXZA 4Z8YA 2NU8A 5G53C 1NCIA 1COZA 3WRWA 5LFAA 3CSSA 5F7FA 5D1ZB 4HRAA 1OSYA 4YHBA 3S37X 3Q8KA 1S5HA 1TCMA 3U5TA 3FN0H 4E03A 4RSYA 5ENWB 1H0SA 3PDCA 2DQIL 1EO5A 4UD6A 4XQ9A 5LQRA 2UWEA 1ZD8A 3K05A 3TFKD 5TC4A 1P44A 3A1EA 2GZ3A 4KFCA 3SPHA 1H9DA 3ULUD 2BS9A 4OGAD 1HX7A 1DO6A 3O3NB 4FNRA 2BJWA 4BV2A 1LI4A 3CVHL 5DK3A 3Q15C 4A10A 1BAFL 3G9XA 1W93A 1X4YA 3K92A 1MO3A 3WL5A 5FWDA 4JZJB 4KY2A 1VSTA 5HYQA 5C3IA 5HBGA 3CLUC 3NVDA 4Y88A 1GTG1 3DL0A 3P0IA 4WNQB 8ABPA 2KX7A 1WHSA 3F67A 1ULBA 1R6AA 4LYJA 4TPRL 4ND6A 3EMDA 2HNAA 1H2RS 1TVCA 2YQ3A 4PJHB 4KVCH 3E9EA 2I8AA 3GHYA 4RVSA 5IJXA 1X4ZA 1TQWA 4A09B 2OVFA 4PTLA 1T2AA 3B7UX 4BSWA 4QDKA 1L5RA 1CR6A 5A2CA 4GD3Q 3PQDA 1D5BB 3KXLA 4MQFB 3NVXA 3COYA 4B4VA 3TJHC 1FRZA 4C6HA 4GRLD 1P4IL 3EIHA 2PUEA 4LBVA 4LDJA 4Z4IA 1QO3A 5ERYA 2AW2A 1YY9C 2NO6A 1KI6A 4M48L 1CF8H 4YAFA 2AMVA 2IH8A 2I4LA 4HZ1A 3N50A 2GH1A 1U2QA 2EEAA 2Y72A 1NW8A 1FSPA 3SOBL 3DLQR 2P8LA 4B3BA 4D56A 4WW2B 1EYZA 3JZMA 1E77A 3FU7B 3Q5DA 2ZIZA 4GQAA 2WAYA 4HO1X 3ZWLB 1INDH 2ADIB 2I85A 3AI7A 2D06A 4UKDA 3WB0A 4BK4A 2HLPA 1TX4B 1F4PA 1G8JA 3KAPA 2H26B 3DKRA 2UVPB 3QZWG 1GCFA 4FRWA 3P9CA 4J0QA 3VI4F 3N42B 3OGCB 4HYTB 5EMMB 4CN6A 2IYZA 5IR1B 2V7QA 5E6IB 1JIIA 4ATNA 1NC2A 1TM3E 4DY6A 2ID4A 3EO9L 3MRNA 4INPA 1EZSA 2H92A 3RJ5A 3GXIA 3K4DA 2CZCA 3UICA 3KQKA 1IBSA 4FKKA 3FDIA 3ZJ4A 3P4XA 3PHLA 3QEQB 2EDFA 3HFJA 1CTQA 4UXJA 3CLFL 2XTJC 4F4UA 4DR6B 4ZCRA 4MUHA 4TL4A 4JDZA 3RU8L 3GLKA 5BQPA 1Y3BE 5DK4A 1REIA 4OATA 2BFPA 3PUVA 5J2UB 4BB5A 3PHJA 2ZT9C 2XVXA 2XN9B 2WSSA 3ETNA 1GS6X 1RIUL 1YOBA 5DR5L 2QV4A 5CHNA 2PEYA 2Y93A 1W88B 5AI4A 2R29L 1Q2UA 3GD7A 3JWPA 3QUBA 4RHEA 3SLGA 2E56A 3WRYA 3C1UA 5FOUA 4HISA 1VI6A 3N74A 3DURA 1AGYA 4I2XE 3N44F 3TCLA 2CNZA 3GJ8A 4DUGD 4KZCA 4E22A 4DP4X 2AH0A 2I07B 5H2BB 2D1RA 2D2EA 3BL8A 1T5XA 4R7AB 4Y16C 5J2UA 1ZUNB 4HQ0A 4MWFA 4J4PA 4KZEH 1JI2A 4PPFA 1G5FA 3GSQB 4RL4A 3KVPA 3I6KA 3PE3A 4U1EI 4KFUA 3ZGZA 4BMXA 1BZ7B 4BZQA 3BFOA 1N5YL 3A9RA 4XA8A 3FAWA 3CFBB 1WW3A 5A3ID 2BCGY 3GSNA 4G2TA 4FA6A 4YDSA 3MXXA 4F9PA 3RBVA 1BDJA 2V7TA 1NCNA 4E41D 5AVRB 1F0KA 2YS7A 5LC1A 1KJJA 4WFFE 4H44C 4H08A 4UOQA 4MNGE 3EUUA 1J1PL 1FFRA 1UJTA 2P4UA 3HWRA 4L8DA 5DK6A 2EACA 1M1ZA 4R2GD 2IY9A 1T4GA 3L1OH 4QBHA 3MODL 1VP3A 4KDFA 5IVNA 2VH5R 3D64A 1U2RA 1FLTX 3LK7A 5HW0A 1E9AA 4U4BA 3MLYH 2JEOA 5IJ9B 2QN7A 1Y5NA 1L4UA 3HYTA 5IULC 5JIDA 2ZBGA 4YRMA 2Q7YA 1ID1A 3CSTA 4C7OB 4DW2H 1G8KA 4RCZA 2Q21A 2NXWA 5IBTL 2NZ1A 4XNYL 3LEYL 2J33A 2FLMA 3CXFA 5CMAB 5H70A 5DJ2A 1KAEA 2PLNA 1RAAA 4X8HA 5C3MA 3KCIA 5E51A 4NKRA 1Y4SA 4AVHA 1DEAA 4WGFA 4OGQC 1AO7D 4PREB 4IVRA 3DX4A 2P79A 3H1AA 3MSCA 3HNSL 5D5HA 1NVVR 3AMKA 1XR8A 2IIQA 5IKEA 3V2UA 3UBTA 1P4IH 1RUQL 1SO8A 2MOQA 1EGHA 3VXPB 4KPGA 4LC0A 4OJAA 4HIIB 4WKZA 1SHTX 2VLKD 2G9RA 2K78A 2WWKT 1OX4A 2ICWA 2YV5A 4MS3A 4MJ4A 2F54A 3MOBL 3NSXA 1SBHA 4WW1B 4WZBE 2QX7A 1TZIA 3KU1A 2OMVB 3CVIH 1WXHA 3PEVA 3AEUB 1RCTE 5E9WA 3M1YA 3U0WL 3FHLA 3GXBA 2RHEA 1CL7L 3DHMA 3O26A 4G9DB 2NU6A 4TQUS 4CV0A 3AFNA 3WQRA 4XB2A 3GELA 1KFBB 3E9CA 5MERA 4PZEA 3U13A 3GZPA 3GTTA 4DW2L 1UJ4A 2H0JA 3RTQA 1J39A 1KCBA 1U92B 4XX0A 2VNCA 3HA3A 2QVXX 3SODB 2OMYB 3EF7A 3W39A 2AH1A 2O07A 3ULSA 3T3PA 2YAQA 1MEXL 1SLWA 5EEZA 4WTOA 1Z2PX 1X7GA 3N1PC 1F58H 3WP1B 2ZUDA 2QR0A 3BP4B 4ILEA 4RGMC 4PTUB 2QN2A 2ZIEA 2OMYA 1A88A 2CYBA 2XRYA 5I17B 2X9WA 1U0OC 3KCNA 1GGIH 2PY6A 3PVUB 3QT2A 5ID0B 1HILA 4ZI8A 1R0BA 3NTLA 2VLKE 4PGBB 2DQGH 2FWPA 3LNGA 1C30B 2G3MA 6PFKA 1I4TD 3E70C 4JS7A 4RJKA 5B58T 3AUUA 7FABL 3PC2A 2VPIA 2VLLA 2XA3A 2JWYA 2BCEA 2G5PA 3HMQA 5HDBA 1ZSNA 1IQPA 5CVTA 1GZ4A 2RI6A 4G0YA 4DBVO 5KWJA 2H4XA 2PK3A 2VH1A 1IGIH 1GQQA 3TYXA 4A7SA 4DHLA 4G2AA 1OIWA 2G0LA 4D0NA 3AFLA 3F5MA 1NUAA 5ALTA 5EN3A 1KWKA 4Q47A 1KFAL 4X60A 1MY5A 3EPJA 3Q2IA 2ZUQB 3TZ6A 2YCBA 3G7NA 4CC1A 5GJSL 4AP9A 1R4AA 3ER9A 4FLSA 4HEHA 4WTQA 3IKCB 3UHPA 4DUPA 1DWUA 2R8RA 2GASA 3MA0A 1MFPA 2J4WL 3N3AC 3F1KA 2ZZMA 1I8KB 5DYFA 3IAS6 1RWNA 1NY6A 4N3NA 4A04A 4C0JA 2WXFA 4N9OB 2QPUA 3RI3A 4MQ7B 1A1VA 4LQDA 4AMUA 5AFAA 1Y6JA 3W1EA 2DLHA 3UAWA 1GYUA 2FRGP 2GZ1A 2FEPA 5EDSA 4ZU3A 3NS7A 4V2CB 2EG5A 1R8QA 4CR7A 1ODAA 4WASA 1XTPA 3FTCA 5DO9A 1N18A 4OLZH 4AWXA 4DOHE 3OXSA 5LD2C 1MFZA 2C96A 2WD9A 4U1HA 2BZ7A 4LVHC 3NDBB 1HCVA 4N0DA 4FHCA 3AOEA 2HJVA 1ESMA 1TA4A 5FL7A 3ZWNA 3MLTB 4WBNF 4KRPB 4F2MA 4O5AA 2CM5A 4QRRA 1KYQA 2PX3A 3PEEA 4H8HA 2NYZA 3IAPA 3A3KA 4QGGA 2C29D 4L22A 1MHPL 3ROKA 1WMSA 2QVFB 3NRQA 2WYIA 3QI7A 3TZBA 4AGQA 2Q5EA 1YFZA 2ONCA 2QPFA 3VU2A 3MO1B 1XGTB 1H3VA 3V34A 5D7JC 3VD0A 3L4EA 4RV4A 1JZ3A 1VPTA 4EUFA 3A6CL 2V2TA 1Z6QA 4IIJB 5D6NA 3ZDAA 5D70L 3JB9L 4XXHA 4JBIA 4JJKA 3UGKA 3E1F1 1C5BL 2VXSH 2G28A 5BSVA 1UXJA 4UVEA 4NESA 4KHXH 4Y2YA 3PQ6A 3A2KA 4IQFA 4RKFA 3DURB 3TPZA 2X7JA 1JUFB 1H3NA 2XWZA 2YIHA 3QDGA 5HD8D 1L3WA 5BXFA 4I1RA 1BIFA 3U44B 5HP4A 2FPWA 2XIQA 4F7PA 5CXQA 4NNYB 2A7QA 3GLHB 2C9XA 3RHWK 1GY1A 8MHTA 2DR3A 5LLTA 5I47A 4PRDB 4QICA 2DWOA 2ZE8A 5JDCC 1RERA 3ZVRA 3FTDA 3CNNA 3LYHA 2ID9A 4BTVA 4H0LC 3NT2A 4IMPA 4DA7A 1K8YB 3LIUA 1FX0B 4DN6A 3MLRH 4PLTA 2YN5A 3X12B 1AR2A 2WMDA 4PLFA 4CQMB 1R5VB 5BWMA 3VJRA 3MUFA 5I9MA 5ANME 4X6DA 3GUUA 2WWTA 2XT0A 4KJZA 4BHUI 5D2NB 5ADPH 5FKRA 1ZVNA 2OC4A 3BSHA 4F45A 2C7RA 5CUSH 5I17A 4FA9D 2N1TE 4PGEB 3WWZA 4S10A 1A4JA 3K30A 4RBPK 1RXYA 1PK8A 4UQLA 3CRNA 1Z5PA 2A2QT 4XN9A 3R7AA 2QUIA 5A62A 4NBZB 2P26A 1MF7A 5DLYA 4PCVA 4MB4A 4ODUB 2JQMA 2G82A 1HG1A 1WU8A 4M88A 2J9YB 3I9MA 4V1DA 1RQPA 4RY2A 2J41A 5DMIL 4MVJI 1OLSA 1V95A 5KNLA 1NINA 1JLLB 4J3VA 1WKCA 3V55A 4Q9QL 2FIKB 3M5CA 1T04A 5AD0A 1K89A 4HI0E 2Y1AA 1NPJA 3BHBB 4CEJB 5CX1A 4H16A 4YX2L 4BZ1A 4RCYA 3I76A 5KVEE 1S7UB 3V8NA 2P0EA 3FQWB 1YZ3A 4HPHA 2Q3XA 1OI4A 1RK7A 1ML3A 3EI1B 1M8PA 2BGUA 4MAZA 1X7QB 4DJEC 5CBPB 2QQ5A 1DC6A 1CF8L 4GLRI 2G5BA 2NDFA 4IS6B 4ARIA 1I1NA 1TENA 5M5RA 3LHSA 1AZBA 3HI1B 1F42A 4LHQB 3ARWA 5J1SC 1Z0UA 4OJTA 1TYCA 4W9ZA 3P69A 3ZX1A 2BFDA 3D2UA 1BWMA 4YJFA 2JB9A 5CZRA 4UNUA 4QTIH 2Q87A 2ICES 4UDXX 3LYRA 2D7NA 2DEXX 3GH3A 3S28A 4C1BA 4YFLF 4DGUA 5E08H 1DBKH 5CM2Z 1R88A 1CUOA 2LHAA 3AGVA 3FQNA 1TTBA 3BQUC 3UYKA 1ZHBA 2Z7ZA 2R84A 2ZVQX 1JXGA 5EIBC 2Z31B 4JY5L 1XMPA 4FTVE 3K8MA 4N28A 3K7UA 4RMVA 3F5QA 2WD7A 4LMQI 1E9VA 3H0TB 3IPLA 4BTEA 3VKVA 1G4RA 5CLGA 4BUGA 3F5WA 3JAWA 1Z62A 3LMJL 3B5JA 1W2WB 1GJIA 4HNAB 1LF5A 2GHWB 4U1SA 4HIQA 2BFOA 3PC8A 3P40A 3IEIA 4NKOA 1SFRA 4AICA 4N3TA 1GL6A 4A6EA 1NCOA 1CUXA 3BLKA 2V0GA 1A9BA 3SCMD 4DMCA 2OHGA 1XHMA 3GXUB 1XF4B 4GRAA 1V35A 2EDXA 1ZUD1 3DLBA 4BMSA 3QEMB 3HVIA 1M0SA 3ZHNA 2XTNA 3F64A 3MRBB 3RYFB 4M7WA 2V7NB 3PRYA 4WCFA 1I1AC 4EIBA 1Z47A 4U2FA 2DQUH 5I1DA 5DJCA 4G3YH 4JM0A 4DCVA 1TQDA 2VDQA 1L7DA 3ND5A 5KTRA 3WLKX 5K03A 1NVUQ 3TQTA 1WU7A 4I14A 2WUBL 3U4QB 3A8TA 1AQMA 3N9IA 1PN3A 5JQGF 3IUEA 1XKSA 43C9B 2EFGA 5KW9H 4CKWB 4PI0A 3AUWB 1R9JA 3T5AA 3HDQA 2PGJA 2QFRA 1VYHA 3UTSA 1D1SA 3V8RA 5HGXA 3KPRB 3PPEA 5B3NA 3QI9D 3OKYB 2F74A 5IB4B 3FR7A 1PBNA 1ASPA 3OKWA 2C4NA 4I6GA 4GEIA 1FE8L 3QWRA 5IEKA 3RS7A 4P2RA 3UYPB 3C2SA 4UNRA 1U3HD 1AOZA 4KX5A 1GJWA 1QFUL 3HB0A 1HWHB 1KN4L 2C88A 3GEFA 1EPUA 1X3DA 5FDWA 3OX2A 4J3SA 5GOZA 2VJYA 2QS9A 4NYLA 4TWAA 2WV9A 3O4LD 4JO8A 1CT8B 4FADA 2GZHA 3M5DA 4OTZA 1ACJA 3JYQA 5T6MA 3FXAA 4BU0A 1QRNB 2NTJA 3R7QA 1YQVH 4OHFA 2H13A 4Y4HB 2IHZA 5GSVA 5CFPA 3JXEA 4WHCA 4OUOA 3QDHA 2FK8A 3L4CA 3R3XA 4L3CA 4DPLA 3HKCA 2FPUA 4Q1EA 4ENSA 4BVJA 5J6GB 3KZCA 5TS3A 2DHEA 4CLEA 4QY8A 1LNQA 4J2HA 1N3NA 1PJLA 4E9YA 1ZD9A 4WW2A 1AK9A 4ELME 3OF5A 4EX6A 4GM3A 1CZ8H 1NMBH 2BC4A 4V38A 4J1SA 1XCTB 2GDJA 2Y76A 4U7GA 1X6LA 2WE7A 4GPAA 2X0DA 1SG0A 5H02A 1P4LB 2A4CA 3FB6A 3NDPA 4DP6X 4PJGA 3GSVB 4QWWC 1YQDA 2LDBA 1YEHL 2VQ1B 1L7IL 1JAYA 1E8NA 2BCKB 3WS6C 3G5MA 2BSED 5FO9B 2X5XA 3L7FB 1X94A 1LZKA 4DP9X 4R8VA 1X7ZA 1XZMA 4X9YA 2WXQA 5EWLA 3IR5A 2D9QB 4MNQD 1YC8A 1VFAB 4OVKA 4C4OA 1MZYA 3HZVB 2IIBA 3SLRA 3OCUA 5BVHA 3K0AA 1FCGA 4YVUA 4XMKL 3OWHA 4LRUA 2FRXA 2ZOWA 1QSGA 2PANA 3UANA 2Z6VA 4OOEA 1UBUS 5T1DL 1XZWA 2FGWH 1WUIS 3T6QC 3QVJA 1IBMB 1N5IA 2ZRCA 4YI5A 3TCTA 2FSVA 4K6HA 4H35A 2G5TA 1DVZA 2Y6SC 4QRTB 3F7MA 4DILA 1P5JA 4FE9A 3BMVA 1E79A 2PMWB 3PEFA 1MJHA 1SXJE 3U1TA 3VFOB 1W59A 3ADKA 1KEUA 1SHUX 2PL3A 3PENA 3HN6A 5JUEL 4AZ0A 3DX2A 4G8FA 3BIJA 5F7DB 3BPSA 4BQQA 1MJ7L 3BJ91 3WGGA 1FZKB 3QUHA 4OM0H 3D87B 3B52X 2WSBA 4D9JA 2JH3A 2CDCA 4BNJA 4FU0A 3I7KA 2B2XL 4WK0A 3LCJA 2A6KB 1U8JA 4P2QD 4GP7A 1SBBA 2NY6B 4PGFA 2R1TA 4AENB 4JCOA 2FKNA 2QPTA 2Z2OA 3DE2X 2MR6A 4PG8A 4HNUA 3ULUE 5K3CA 2EDCA 3PFBA 1GN8A 3ELUA 1MJUH 3OQ3B 2QT0A 3WE6B 5CCDA 1NBVL 1TF4A 2OQRA 3DFZA 5FB3A 4LGNA 4JFDD 1OU4A 1KETA 3E6HA 1G21B 4HJ0D 1TGYA 4TM9A 2ZGVA 3MR9B 2P9CA 3LQAL 4LCWB 3B7TA 4D8XA 2F7QA 3CH6A 2VLRA 1M1YE 3U3XA 4R0MA 1EJ8A 4X9HA 2MINB 3E8VA 4H13C 3KD2A 3AWEA 3WLFA 4TKLA 5DWDA 3H8WA 5DN6D 1WZAA 4GRWH 2R1VA 1AGBA 4N8VA 5A3SA 1VKNA 5HYSB 4U31A 3EXHA 3AW5A 4PS4H 4JKOA 1KYTA 3RHWF 1MO6A 4FMDF 2ITDA 2EC9T 5BO5A 3DM5A 4J0GA 4XBEH 3BXOA 4CWAA 5KSBA 3FLMA 4Z0TA 4D9CA 1E5TA 4P5EA 4WGGA 5JXHA 5BRZD 3DBXA 3ROGA 5BV0A 4HIPA 1LEKB 3T0EB 4YSUA 3E7DA 1JDBC 3GPIA 3QOYA 5FQDA 2AMYA 2PZBA 4NJ9L 2MTAA 5IEHB 1QC5A 1GHTA 3CBRA 2P2SA 3Q8FA 2VP9A 4IHOB 5GS0C 4A0FA 1MVYA 1YZUA 3LPPA 3PQCA 1L6IA 2QP4A 2B8OT 4ETWA 2LU3A 1P1RA 4UW9A 2P46B 5F9JB 1GUDA 2JZCA 2QDKA 4WIAA 4OFZA 1YY8B 2GT9A 3W5IA 4GKAA 5EIXA 1T66D 3L1VA 2VNIA 4RY0A 1VIDA 1MQSA 4Q9AA 4LF3A 1RZRA 1FFWA 1XZJA 4EVNB 2LTAA 3P9LB 3Q3IA 2IANE 4PJ7A 3KSZO 3X44A 3E1SA 1FUUA 3GI9L 3FRJA 3GUCA 3UTOA 5BRZE 1PR5A 2P1ZA 1L4BA 4TS1A 3L8HA 4HWGA 1AS2A 1UKYA 1SXBA 1A7KA 2P9QA 1GPAA 3QP3A 4GQ2P 5JLJA 4JHAH 4PR5B 1CSEE 1M33A 1BBJB 4B60A 4GRMB 1BECA 4TNVK 1PAZA 1SQSA 2J5BA 2ISQA 5IQOA 1TQCB 4KQ6A 3SVLA 4MS4B 3ICVA 2ESVD 2YY6A 2HKHL 2BSBA 5C97A 4Y2DB 3LD8B 1HKUA 3AUFA 2MCPH 2W0FB 2ID7A 2QV0A 2EXYC 5EFOA 2V4UA 1LNZA 3KYKH 1NGSA 3B34A 3LLVA 5DLMH 4FI7A 4E31A 4MDIA 3ILQD 4HXAH 3AM8C 4NNJA 3ZHLA 4M99A 1JR3D 2YAMA 1USUA 1K98A 4IVQA 4UXIA 4XWTA 1A7UA 3I7PA 2VYCA 1NUFA 2DKUA 3GWGA 2FPKA 4MA3B 2AGWA 2CV0A 2BM0A 1XN4A 2Q3FA 1JPGB 2H1PL 2F62A 3DIDA 3CG8A 2Y0SA 1HJBC 2QBYB 2ZKYA 3H42L 3E5MA 4FFVC 3LKQB 4QUAA 4UAOC 4LARH 3T1WA 4UTAL 3PC6A 3RC7A 3FNIA 1GG5A 2QZSA 3ASUA 3IOBA 5CA1B 3U09A 3WLEA 4EG0A 5DT2A 2J5XA 4DNXA 4MDJB 5AW3A 4B6JA 4KR2A 1IL0A 4JQCA 3CG0A 1SBZA 4CIDA 1RMTA 4FXKA 4TVSA 1GADO 1JYWA 1CQJA 1Y7IA 3NX4A 5JSHA 5EBMA 1T8WA 3KIPA 1MT0A 1RPZA 1IEBB 2ENUA 3L45A 4E5XB 2CDFB 4Z7OE 4EW6A 1C5DB 5K9KB 4Q9LA 5C8JB 4ER7A 2IQAA 3M45A 1DAOA 3RAJL 1WBYA 5HI4C 5AB2A 4YPVA 2Z6QA 4A0RA 4HOMA 4P9NA 1MOQA 3EZ7A 3RFTA 4LZOA 4EGAA 2VLRD 3JQ8A 1OGTA 5DOVA 3TL6A 1DCEA 2H57A 1EHNA 3ED1A 1YR7A 3O4JA 1B8PA 4MARA 3MV7A 3VYNA 5DMIH 1FVXA 1II8A 4YHOL 3WNBA 1H4SA 2YL2A 2XCQA 4QRTA 4YDLC 2H0AA 3QLTA 2YWEA 35C8H 1KV7A 4LAQL 4Y7OC 3RX9A 5CBAA 3GSWB 1V7MH 4JG0L 1HBJA 4E5ZA 1UP4A 3TT3H 4C05A 4NHEA 2HA6A 1A4CA 4FGWA 4CMCA 1B1CA 1JGTA 1O6BA 4U6SA 2F7IA 4WSOA 4A7QA 3E6FB 1BEXA 3LS2A 4TMKA 1EDOA 3QUMB 2X4GA 3GOQA 4AL8L 4NCJA 3JWDH 3QUXB 2OJZL 5ERGB 3U9UB 3FF7A 4EI6B 3V6OC 2FHSA 3D8TA 2IKQA 4L8CB 5DCWA 4F85A 1NG9A 4XDGA 3SJLD 1RRPA 2DMBA 3RWIB 1UQSA 3PXUA 3SY8A 4GM1A 1UAGA 4XXDB 3BSYA 3UAEA 1GYWA 4F56A 3DK0A 1DSWA 2EYTB 3FTXA 3RB5A 5D7IA 2IXFA 3WNQA 1AY1L 3G2LA 5AW3B 5ETUB 3UB4A 1A8UA 2B83A 5L2KE 1VZ2A 1Q3TA 2F1HA 3VKWA 4R4NC 6TAAA 1KELL 1BCRA 4FC6A 4TL6A 1DJZA 1M9NA 3WDMA 4JHPC 2X4TB 4HWNA 5M7EA 4YCSA 4LIQE 4WO4D 3TU6A 3BPLB 4Y1AB 3CE1A 1Q7EA 1RHHA 4JMNA 5GZ6A 5HMMA 4UDUB 1XKQA 1W48A 2VRAA 3BSSA 3AL0C 2BRUC 1ZUWA 5E2JA 2G25A 1F11A 1MAWA 2VZSA 4M02A 1WTAA 3WKMH 4QIRA 4MCNA 2OMZA 5LNK6 5BN3A 1JHKL 1XA0A 2Q6IA 4WFKA 3FFOA 3F4KA 4B53A 5ICYB 4M8NE 4MRNA 4UEJA 5BSUA 3NHAA 3K96A 4APXA 1Z7GA 2MPVA 4R71A 4X9IA 4MA5A 1DVFC 3A21A 3ULVC 1MH1A 3FD8A 2IUSA 1E4XH 2J8UA 1XD0A 4ENEC 5HM8A 4OI2A 4F37K 5CP7B 1TTQB 2QQLH 1CD1B 1EE1A 4U7WA 3HEBA 4HLUA 4OBEA 3BHIA 3BXPA 4HD9A 3RGWS 3ROLB 2GLTA 2APXA 4ZHQB 3OE7A 2ZSWB 1WLSA 5DEFB 5AB1A 3WFEH 4PB9L 4X6XA 5J9PB 3C6SA 4IMKA 3JS5A 1UA3A 5TF2A 1PS3A 5ALPA 2GTWA 5KQSA 1XVVA 3VO8A 3PUKA 2VTVA 1SY6L 4KROD 4TPKA 4Z3GA 4HVBA 3ENZA 3AVQA 1AIZA 4C04A 1MIMH 5JQWA 5ESQA 3UWSA 3Q7JA 3EDFA 3GYBA 1BQHB 3GC3A 3QUTA 3QZWB 4RRPG 5HHXH 5LSAA 3FTUA 4DC0A 1Y1KE 1GYPA 1QRTA 4W1TA 4QYOA 4GI3A 5AOAA 1OXBB 1RY7B 3O41B 1Z6XA 4Y5YC 4IKKA 3DEFA 1U5CA 1KPRA 1OASA 2CXRA 1YYLH 3KOWA 4GMBA 3OAZH 4HGWB 3ES6A 4CDHA 3HDGA 1J2TA 3MXWH 1EFRA 2R25B 2H4HA 1OC2A 2H4ZA 5HS6A 4ANWA 1AS6A 2JA1A 3NBZC 4MXQC 4EA8A 3ND8A 5IQ7L 1T1WA 5LDSA 2PS9A 3MYYA 5HQ3B 3KZ8A 2FUKA 5HCUA 2ANCA 4Q16A 2L7JA 3B2NA 3K5SA 4FQHB 4BMPB 1S9DA 3V33A 3QWQB 3T0GA 2HFEB 4LTDA 4P8QA 1NI4B 4MXWL 5B3JA 4L5FE 1QKZH 1XMWA 4GIOA 1QGAA 3BHNA 4AEIH 1AUXA 4H3VA 5I75B 3OJMB 2A9QA 2Y9MB 4WZAA 4I77H 3ZTTA 4P2RE 1OXMA 3AT8A 3E0XA 4PJXE 1ZGJA 4L2LA 4BNYA 1UD2A 2I91A 3VD3A 1YONA 2RMKA 1ZU4A 4YE0A 4OGXH 3BWYA 4PLJD 4OZIA 3UHJA 5I6NA 4B9EA 5ALJA 2Y25A 5SWZB 3LFUA 3ZHDA 4R31A 1MA0A 3EC1A 3UVEA 1EHAA 2R9HD 1XYVA 1ORSA 3OXRB 3KAKA 2W9LA 4IBTA 3FKSD 6CGTA 3C43A 3PQ3A 1Q12A 2ZPAA 1R00A 1X7YA 5F77A 4JPWH 1M6VA 4IMJB 2DJUA 4URFA 3A6GA 3Q3VA 1UBLS 1MZPA 4HWZA 4FNPA 3ZXIA 1RC0A 1TJNA 3VMOA 3OZXA 1LI7A 4MYWB 1A21A 4WWKB 4AL4A 5IHZA 1KJYA 4RFOH 4M1QA 1V45E 5FTMA 4O08A 1UH3A 4V2BA 3SZRA 1PZHA 1LBHA 3DOOA 1SHYB 1ESDA 2E9WA 5D6DA 4IKJA 4U6TA 4JPVH 1XU4A 1IRAY 3W7VA 4F5YA 9CGTA 2ZNXA 1UACL 4TMXA 3LH9A 4EB0A 3WE1A 3CIFA 5H4GA 1PD1A 3FQTB 4FNQA 1HL9A 4JRXA 4I13B 3ZDBA 1FAIH 3L06A 1KMGA 1E5CA 1P1BA 3BI9X 4LL9A 1V54B 1JF1A 4KAAA 3IBTA 2ZAYA 3S34L 1HX0A 1OMWB 2X05A 4Z7VA 2IVFA 3U30C 1D1QA 3O0DA 4IBSA 4JYAB 4XI5D 1ADBA 1IONA 1L6PA 3VE0A 2VP0A 5IBUG 4FB4A 2G9QA 5FAXA 2IFTA 5B5SA 5FOQA 3BT0A 2DM3A 1D8TA 5F9OH 3SDAB 2NPLX 1H2WA 1AP2B 3TLCA 5BNTA 4F04A 1SN5A 2AFHE 3ZE2F 4EKEA 2ARJQ 7GPBA 2HPTA 2XL2A 2AJYL 1QG3A 4ZANA 5G02A 5TVGA 1CDEA 4PV9B 1WBZA 3EH3B 5BVHB 3CC5A 4I55B 3T2PA 4DP7X 4TWIA 1HYGA 3RRXA 1BBJA 2QAGA 4HNTA 2PTHA 5FBWB 4FZ8H 3N76A 1R0LA 1V5IA 1VL8A 1ZH0A 1M2HA 2HDHA 3WFCH 3HPRA 1ICEA 4OFDA 4ZTPH 2Z57A 2F8IA 2E9BA 2OMNA 2R56H 4UQ2B 1MCOL 3UW1A 4RQBA 1BVLA 1IHYA 1E5AA 4J49A 4BMYA 1E2FA 3ZDRA 1TPZA 5F73A 4U5XA 5D00A 2J5KA 1WIPA 1P1HA 2HREA 3IBSA 1I1YB 4BK5A 5C0AE 3WA7A 1IATA 4ZFZB 1GFWA 3JW8A 4TMFA 2X4PA 1WWAX 4LRQA 3PCXA 2VXUL 4KTDH 1TZ2A 5CIPB 5TQVA 5CXCA 4QHMB 4P33A 1W8EA 3QU7A 2W6OA 4NZ8A 3GGSA 3LPLA 5AVXB 3E3AA 3EGDA 1P22A 4DCGA 2F43A 1PHPA 3OHSX 1EIZA 3L2MA 5I26A 5SWSD 4JLDA 5BRAA 4OXRA 5C0EB 3I7HA 2ASVA 1IO4C 2YOAA 4CN8A 1M67A 2K7FA 4N6RB 2K87A 3Q8AA 4F8YA 2XUHA 3DSMA 2JGKA 1CJUC 3F7NA 3RUGB 3REQB 4I7ZC 2Z3WA 2J6EL 1UYWL 1XUOA 1C9JA 4G25A 1Z68A 1CY8A 1BQLL 5FDWB 2GSMB 1QCYA 1QNFA 1TJMA 1A6AB 1BVRA 1DBBH 1XAHA 4BE7B 4BMCA 1EERB 5C08E 2CJYA 5C08B 1P4UA 1G1YA 3LX8A 3RUFA 1SJMA 3UYPA 3QNYB 3CFCH 3FAXA 3OXSB 1I1QB 1HDXA 3FKQA 3ZOAA 5GGTL 1SURA 1L5MA 3HH8A 4E1AA 4R5TA 4P83A 3Q8CA 3K9QO 3GBLA 1FFYA 4K5MA 5A04A 2GA8A 4BDTA 2Z4SA 4KITB 1JLRA 1OVZA 1ZPUA 1RHMA 1NATA 1DLHB 2IWEA 4D8UA 1GDTA 2RH8A 3L7EB 1U1IA 4HG4K 4A6PA 4KQ4L 4AYEC 5SV4A 1T36A 3L49A 3TXYA 3WD5H 3U9WA 4DLXA 3QKTA 4LSVL 3OFVA 3NP3A 2Q3ZA 3MBEC 4EATA 5ABDE 1TUEA 2OHHA 4OBXA 3ZHQA 4M6NL 4ZQFA 4NOJA 1FEZA 3KYIB 4D3FA 4QOKE 1U2PA 1DBKL 1MVUB 3SOBH 3EUAA 3TZVA 4OV5A 3M17A 1SOWA 2IDJA 1ISJA 2OTWB 3RYMA 4EBQH 3MPUA 4TN5A 1MAUA 3IILA 4HDIB 4BLOA 2JKZA 4ARAA 2QM3A 3IFLL 4ALAC 2CXOA 1F8XA 4FC7A 1ZIDA 4W9GC 1II0A 4WE3A 4OFYA 2N0KA 3LEXA 1X6NA 2D2IA 4GSRA 2O20A 1ZH4A 1KOFA 5G4KB 3LBNA 2Q6LA 2Q0QA 1YO6A 2CDEB 4D9SA 2A73A 1P0PA 1LK3H 3FZGA 4WJLA 2D7DA 3HJBA 3ZH2A 2VSFA 2WTRA 3JTEA 2UZXA 2I34A 3TBSB 3TQHA 1Q0UA 2X77A 3VPAA 4N48A 1D6EB 3MUEA 3UF0A 1EVYA 5IHXA 2I3BA 3VX3A 3M1LA 3W39B 4D44A 5IXYA 1L9OA 5DVNA 5I19L 2VJMB 5H4HA 4DEPC 3KTFA 1FGNH 1FZMA 3GT6A 3M3DA 2ARJB 3NCTA 1J48A 1F60A 3BDYH 4C01A 2Q41A 1DCFA 3DPSA 4F2GA 3WKPA 2P27A 5HRCA 4TLSA 5F1IB 2QZQA 2NZ8A 2HTEA 1ZNQO 1G7TA 1GZ5A 5JW4M 5IBPA 1PCXA 1IM9B 3VGDA 4IKEA 4A2DA 2XDHA 3FTSA 4IK7A 3D2AA 4KTTE 3MD0A 4U3SA 4KR7A 3DDNA 1XZ0B 3NEAA 2P5UA 4EJSA 1KB5B 3I9V1 3PGFL 5D1ZD 2N3ZA 2GD6A 2C2GA 4A0AB 5CGYD 1ET7A 4TS4A 1BX2A 5I1GH 4PD4J 3W2FA 4KPUB 1N32B 2WJAA 1CPYA 4PWYA 2W6IA 3BRCA 2ED7A 1E40A 4BKLA 2VJMA 4DK5A 5HGAA 3P4MA 3IPXA 3CN1A 4G42A 3W2HA 3CH7A 4KMLB 4PLYA 3AUKA 1SVKA 3U6XS 1UTCA 5JOFA 1KIQA 1AS7A 2J8UF 4QGAA 4MUFA 3O1HB 2V7BA 2OQJA 5CEYA 1ZA6B 4LLVB 1HKLL 5AI0A 2GC7C 4AUMA 1QGOA 3VKUA 3BMNB 1BJ1H 4FHDA 2Y1VA 4TZ4A 4DBLE 4E6PA 5JH7A 3QZPA 2LW7A 3AUTA 3QXTA 4X6DB 4HB0A 3N0AA 4KTYA 1AZUA 1XELA