3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
b'FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
3V4VB 1TYEA 3T3PA 2NUPA 3F74A 3ZE0B 2P26A 1DGQA 1BHO1 4HQOA 1XUOA 1QC5B 3NIFB 4WK2A 3F78A 4NENB 2QTVA 4WFQA 3ZE2A 3K71B 3BN3A 1FE8A 1M1UA 2VDNA 3TW0A 1SHTX 3K6SA 3FCUB 4CNBA 4MMXA 1AUQA 1M10A 4JDUA 2VDMB 4M76B 1YVPA 1FNSA 4WJKB 3EGDB 3RAGA 4F1JA 2VDQA 1T0PA 4A0QA 2VDPB 1OAKA 1JV2A 2XWJI 3EGXB 1AO3A 5E6RA 3VI4A 1JLMA 1RRKA 4CN9A 4PN7A 1JEYA 1U8CA 3ZE1B 1IJKA 3VI3B 1U0OC 1ZONA 4WK4B 3IJEA 5E6UB 1M1XB 5E6SB 3V4VA 3ZDXA 1CK4A 1XDDA 5FFOA 3ZE0A 2B2XA 1M2VA 4IHKA 4MMZA 2O7NA 4Z7OB 3TCXB 5HDBB 3K71A 3E2MA 3TVYA 3EOBI 3M6FA 1MJNA 3FCUA 1L5GB 2VDMA 4UM9D 2WW8A 4UM9B 3Q3GE 4JX0A 3NIDB 3V4PB 4WJKA 3EGDA 5KYUB 2WINI 1XDGA 1DZIA 4NEHB 5LN1A 3EGXA 4HQNA 2VDRB 2I6QA 2NUTB 3EFOB 3NIGA 3ZE1A 4IRZA 3VI3A 5HJ2A 2VDOA 4C2AA 4WK4A 3HXQA 4HQFA 1M1XA 4UM8B 4Z7QB 4G1MB 5E6SA 2ADFA 2XGGA 3GXBA 1Q0PA 4WK0B 3EH1A 1SQ0A 5KYNA 4Z7OA 3ZDZB 4G1EB 4Z7NB 5HDBA 3N2NA 4HQLA 4C29A 4XW2A 3HXOA 1QC5A 2XWBF 3NIFA 1ZOPA 1M2OA 1L5GA 1TYEB 3K72B 4NENA 5KYUA 3V4PA 3PPYA 2IUEA 1RTKA 1N3YA 3ZE2B 2VDRA 3K6SB 1CQPA 2VDPA 3PPVA 4MMXB 2M32A 3EG9B 2NUTA 5HGJA 5ES4B 4DMUB 1ZOOA 2VDKB 4C2BA 2VDQB 1LFAA 2NVOA 4UM8A 4G1MA 1MHPA 3EH2A 3BQNB 1JEQB 2I91A 1N9ZA 4MMYB 4FX5A 2VC2B 2VDLB 4WK0A 5E6UA 1IJBA 1BHQ1 1NA5A 1PCXA 1YVRA 5KYYB 3VI4B 1JEYB 1U8CB 3PPXA 1U0NA 3IJEB 3EOAI 2I6SA 3FCSB 3ZDXB 3K72A 2ODPA 4HQKA 3ZDYB 5KYWB 1AOXA 5KYXB 4O02B 1MQAA 3T3MB 1T6BY 1V7PC 1M2VB 4MMZB 1RD4A 1RS0A 3T3PB 2NUPB 2ODQA 3BQMB 3QA3E 4UM9A 3NIDA 1UEXC 5BV8A 1MQ8B 3ZQKA 4F1KA 4BJ3A 3EG9A 4WK2B 4IGIA 1QCYA 3PPWA 2VDKA 2VDNB 1SHUX 3EFOA 1PD0A 2ICAA 1JEQA 3TXAA 4MMYA 3IBSA 2VC2A 2VDLA 5KYYA 1IDN1 1MQ9A 2X5NA 4Z7QA 1JV2B 3NIGB 1ATZA 5FFGA 2VDOB 1MF7A 3FCSA 1PT6A 1PD1A 4IXDA 5E6RB 3HI6A 4CN8A 4G1EA 3ZDZA 3ZDYA 4Z7NA 5KYWA 5KYXA 4O02A 3T3MA 1IDOA
chains in the Genus database with same CATH superfamily
5FA3B 1ZGLM 1KXVC 1IATA 5T1KB 3GZNB 5EN3A 4NNYB 4ERZA 1AIPA 2G6TA 4FHJA 3S27A 1F06A 1L6IA 3IBYA 2GZDA 1HFUA 2IW3A 2R0KH 3BH4A 1BX1A 3EGXB 4TSAL 1KZYA 3HB9A 1GLGA 1Y8RA 3AI3A 5D1ZA 2V37A 2R87A 3STBA 3QM1A 4KK5D 4LOUD 1MDFA 1G87A 4RZHA 1JWUA 4CM5A 3L5WA 4NQZA 2MYNA 5C51B 3DIDA 1R0XA 4Y6QA 4CF3A 3RYIA 2CDRA 1NAMA 1YI8A 3UWKA 1XF9A 4IS6A 2ID4A 4IDEA 5IUCA 1J00A 4TLUA 4C57C 4JD5A 4FF9A 4PQRA 5F0PB 5BUCA 3ZD8A 2PY6A 3MA9H 1NQUA 2BM0A 3CMOH 3QUXA 1K2VN 3HB4X 3HCRA 3WO4C 1RI8A 3A24A 3ZNPA 4EO5A 5G5DA 3ZSTA 4P7FA 4KPEC 3QNUA 3UBXB 1IJBA 2FMTA 1JJUB 2I3AA 4DW8A 1UUNA 1PT9A 4HZAA 3LYLA 4MAAA 1S2GA 4MW4A 3INTA 4IIXA 3S1SA 2QN3A 3QWHA 3T4YA 1GGKA 3L3IA 2BSRB 2QTAA 2COVD 5EU6A 3DO5A 5BW7A 3OZEA 5BPFA 2O7SA 3O3NB 5LXGL 3LLMA 3Q8XB 1Z82A 4QY8A 2VG8A 4D4HA 4NJ9L 2WHRA 2WB2A 3HC3L 4M5YH 1V37A 5K3DA 3SBPA 5I4BA 3FSRA 1DQJA 2CVHA 4FBGA 4XN2A 5D1QB 2A4CA 2JJMA 3QIUA 4AEHL 4CDGC 1G8SA 4EAEA 1AS2A 4E0RA 3UMJA 4L1SA 3VBEA 3C4JA 4PJGB 4GX0A 2VDOL 1MC5A 3UGJA 2FO1A 1YPZB 2YV4A 2WWRA 4YRCA 3CH5A 1KXZA 1V5IA 3DF9A 3AM1A 1E4KA 2WVUA 2Z65C 3AQIA 4JT8A 3FWKA 5C0AE 1YMME 1PQPA 1A4IA 2QPUA 1J5PA 2GF0A 2B20A 1A4XA 3ZBUA 4DHEA 3ROXA 4FCHA 3UMSA 4FQ1L 1G6OA 3D7MA 3CNHA 4RTNA 5LWQA 1CNEA 5EZQA 3UERA 2H13A 2CXUA 4A3SA 3CUUA 3EPRA 1IJ9A 3H86A 4M62L 1TYEB 4A1FA 1IAOB 4N7RA 4N5NA 4XEIC 4Y9GA 1T8TA 2LLGA 2C3VB 3OIFA 3CFQA 1DKUA 3P4XA 3UJAA 4XNZB 3OBIA 1JPTL 4HBQA 1MJ8L 2OBFA 3CX3A 3TM6A 4DIBA 4PJEE 3EO1B 4B9IA 1Y0BA 3RVQA 3PI6A 3RO7A 3SS9X 1G7LA 1Y7LA 4IIVA 3MODL 1WZKA 3TVMD 3CF6R 2ECOA 2JIXB 3N0TA 4LSWA 1XSKA 4M93B 3R0NA 3KQKA 2BRQA 2ICAA 5ALPA 4QF1B 2VLRB 2VDLA 3BAFA 4QAJA 3L4WA 1Q7TA 4C01A 2V0GA 1SXJC 3SFZA 4IXDA 4L8LA 2A8YA 4GH5A 1NC2A 4DVJA 1E7VA 2C9OA 4LSQH 3T9DA 1Q6YA 1O03A 2LLNA 5D71L 2VDNA 3GVHA 4FM9A 4MMXA 4C3UA 2QVIA 2AN3A 3LI2A 4NCXA 4GQ9H 5A9SB 3TZQA 2DUNA 2YPVL 4XE0A 1JU9A 5JC8A 1R8YA 2NXZB 1IHUA 3TJMA 3NTUA 3OAYH 1UGKA 2CDFB 4MS6A 3H9BA 3WK8A 3R1GL 5TDHA 3MTEA 2KQNA 1X38A 2Y1LA 1CFBA 4AX3A 5F3FA 1E5QA 3K5HA 3HBPA 4XB6B 5CU7A 1UB6A 5I71B 2R1XB 1OBHA 4HC1L 1LK0A 1FO0B 4FW9A 4ZOLA 4LCJA 4QO8A 4OQTH 3OKKA 5DA4A 3OZXA 3ZDRA 4H17A 1D5MA 3MLSH 4UT9A 2XOXA 4YO7A 4J0XA 3S0JA 2AEPL 5AVQB 3F67A 4OB5L 3L7FA 1F0LA 1GDDA 3O41A 3H6KA 3EG9B 5L3ZA 1HFKA 1W2KT 2A0KA 4PSPA 5JMRA 2Y67A 4F3NA 2FPXA 3UVKA 5I9SA 3BD6A 2FZGA 1RXYA 1ZWIA 1XZAA 4XFDA 4JL5A 5KNBH 3PXGA 1BMQA 2QYHA 5DQDH 2VF2A 5I01A 3M5DA 4F86A 1RD4A 1VL8A 3SE9H 4U2EA 1QIFA 3THXB 1X44A 3DX9A 3UMVA 2C3GA 2EKZA 3I9FA 4MV4A 5I4KA 5DGCA 3N0DA 1EE2A 4KTVE 5JY6A 2WV9A 4U3JA 2DLFL 1UADA 4Y19B 1EFHA 1XQ1A 1MF7A 5B22A 3BI9X 3BWZA 1Q9KA 2ATPB 4OM7A 1S5HB 1QPKA 4PN6A 3ARFC 2O52A 1WP6A 3FYUA 2UUDH 4MTLA 4PRBB 1KC1A 4Q4IA 1KC5H 1K97A 3WYEA 3O3CA 2RGSA 2P2CA 4KR3A 5FBWB 1QASA 4OKVB 5C7ZA 1MX5A 4C3VA 3BWUF 4YHBA 4B8ZA 5JQGA 3R8BB 4FEIA 2VFAA 4RMSA 2Y22A 1NFAA 1E89A 2UZYB 1P4JA 5IKOA 1OJLA 2NY3B 1GFZA 4JA0A 1A6PA 1QPXA 1DLHA 4EWRA 3BWXA 3ETCA 4CQMD 2ILLA 4G0XA 2J46A 5LO7A 3QUMA 2OFXA 3I9V1 1X3DA 4M1YA 3NSDA 3J7AC 4HHAA 2N1TE 43C9A 2HA5A 3ZHKA 3V2HA 3EKCA 2GLTA 3KPNA 3REGA 4R7XA 3UW1A 4D0DA 4W6XB 4F96A 4S1QL 1TMQA 2H0QA 4AEZA 2PT9A 2WBKA 3SKOB 4TV9B 5KTSA 3F96A 1F2UA 4KI7A 3SJBA 2IOMA 1PZFA 3MRRA 3I75B 1QVAA 3IMCA 5D1NA 5GADl 5EZSA 5HI3D 3VHRA 1O0VA 1B9KA 4ZVKA 4QM7A 3RLFA 1U99A 1HF3A 3H4FA 2I7XA 1OXYA 2P0EA 1YZTA 2WMDA 1FP4A 3GJFB 1G21B 3MJ7B 1EEYA 4A0BA 2XKAA 4ZVNA 1QR2A 5I9TA 2XD4A 4UTBL 1NCAL 5JORB 2BGRA 2WYOA 1N1DA 3WGIA 1I7UA 2GHRA 2LHAA 2WWHA 3KP1A 3EGDB 1T0JB 3CE9A 2X86A 5E1BA 1GGIH 4IIGA 2ZRBA 1MPAH 4WNJA 2DWPA 2NYRA 4KY2A 5T3XL 1KFCB 1Z5OA 1KYQA 2V6IA 3FPFA 4ZFOB 4LASL 4E54B 5D8JH 5K9JH 1L7RA 1YI0A 3F6JA 3DFMA 5A6SB 1PJSA 1Z3GL 4A2CA 4C05A 2A6DA 3ZIUA 1QP8A 4BFNA 4RZCA 2WINI 2ICWA 3DX6B 4RVGA 4CL3A 1V3MA 3GH3A 1D5BB 5D4IA 3ZO9A 2R39A 1JHPA 4LS3A 4DCNA 1J1PL 1CGUA 1P1KA 5CVJA 4DKEL 5C0JB 3LYUA 3EDDA 2B6HA 4PIPA 2CD0A 1IBDA 2ZUEA 3RG8A 2HT2C 5DVOA 3I83A 5EMLB 3RLIA 3FO2A 4DCUA 4E32A 3UTSD 3J80g 1LDYA 4A7TA 3FT4B 4TL8A 1WDTA 4ZVQA 3IPEA 4MWFB 1H22A 3QEGH 3L4TA 4DUGD 3KXFE 1BWWA 3FQRB 4LE2A 1FIGL 2VVTA 3GT0A 1XPRA 4GXVH 2TS1A 1TT5B 1XZFA 3RX5A 3KPRA 3TO4C 3GGSA 4M0EA 2GEQA 3MD0A 3REFA 5JROA 3P4NB 2DB3A 5A3QA 3NZEA 3MROB 4GJTB 3NCFB 5DVLA 2HKFH 1BE8A 1E4HA 1PJCA 4YE4H 1XRRA 3RANA 4WUKH 3IDSA 2CXSA 1NAKL 4QUBA 1G6VK 1J5IA 2DLTA 4HMQA 4E70A 5KYVA 2WIDA 2YVKA 4E42B 5E4EC 1PYDA 3E9MA 3GLEA 1U98A 4X98B 2C4MA 3I9MA 3D59A 1CFMA 1CGSH 1GZDA 1RJ9B 2WNKA 5A2Qg 2H1RA 4PXYA 5LBUA 4D79A 1QKKA 3DR5A 3TBFA 2QTWB 4DLRA 4N4YB 5KEIA 3OLEA 2QTHA 4KPUA 1GAXA 2JGIA 2Z8SA 2EJ1A 1SOMA 2HNKA 4LCWD 4FD0A 4EECA 4NQSA 1U8JB 3D2BA 3EFOB 3B8SA 2XDWA 2E4XA 1PV1A 1E9OA 3TF4A 5LGJA 2WTRA 4GMDA 4C83A 5IQMA 4TULL 3B34A 1B6RA 3K15A 1RVDA 5E4OA 2Y69B 5TDPB 3ZBTA 4MGYR 4HMOA 1G9ML 3ZWQA 1W29A 3GRGA 3RFGA 2QRVA 4WXHA 2A1WH 4PJ7B 3AU1A 1MW3A 5BZXA 3BTOA 3DEZA 1DO0A 2C4KA 2CMFA 2HMSA 3TEUA 3CLEL 3EH3B 4O5OA 3BSYA 3NCHA 3L4ZA 2D6FA 3TCXA 3OCYA 1EDOA 2XNAA 3D39E 3HKCB 5KU7A 1ZDMA 4IW3B 3TV3L 1TCRB 5CXXA 5CLHA 1KB5A 1IGTA 5J57B 2Y6UA 4E31A 2AD1A 3FB6A 3CH6A 4CC0A 4C2UA 4GAGL 3OFNA 1JHKL 1U8LB 3NTVA 3X2QB 4MQ4A 2H6PA 1J5DA 1EXGA 5DNYB 4JUDX 1G5RA 2O30A 5IC7A 1YHZA 1VGKA 2BV3A 4X4ME 2COQA 3IMSA 4L95C 1O54A 2AZUA 2PIDA 3SBWC 5DDIP 1DB3A 4XBGA 4AJEA 5E0QA 1Q84A 1W36C 3UICA 3FQTB 1E8ZA 2BJWA 1J0KA 3OFVA 1DBBH 1DRJA 3RHFA 3SCMC 1ZAGA 3Q5EA 2JGAA 3VZDA 2X88A 3D5EA 2H06A 3KPSD 4MV8A 1GG9A 4TLAA 1V25A 2LU4A 4ZANA 43CAA 4WFGD 3T2NL 4HZLA 2GC7C 3WIIH 4HS8H 2C4FU 1WV1A 4MYRA 1DVYA 3AF1A 1OAQL 1EFRD 1I75A 4QXTB 2GBLC 3GJ4A 5FTKA 3W4IA 4XQCA 4ZIRB 3QEJA 5KSVA 3RU2A 1SKQA 5AJWA 4IL5A 2O61B 2V7GA 3SEZA 2Q6LA 4FXOA 2FL5B 5C6TL 4UAOB 2VN5A 4WI6A 2GCPA 5DLPA 3TIVA 3SEAA 1JG3A 3B56A 1PG5A 4EYGA 3ZIMA 4UQIM 4TZ0A 4ZAKD 4KROD 1XDBA 3GI9H 4HRXA 5AQ0A 2X6UA 3MV7E 1ZZEA 2HG0A 2XJ4A 3DAFA 3WYDA 3O4OC 4BNKA 1LLDA 5CP8A 3WNZA 4FS0A 2H16A 2CO7B 1OVMA 1WXWA 3WGGA 1RLTA 1DBML 2HJBA 1JN6A 1SVKA 1T2XA 5CNMA 3O2DH 2FX8L 2OR8A 3UPDA 1RI5A 5FOXA 2K8MA 4RC9A 1YEDA 1B8OA 2XUFA 4ECNA 2H8PA 4G0ZA 3FF7A 5E6IC 2VHWA 1EJOL 3K1DA 3ARGC 3FAKA 2JGKA 3K9CA 3S35L 4M0MA 1M1YB 1YBMA 3WISA 4K94C 2PT7A 4FFWC 2QVKA 3TNNA 5HE3B 5ANME 3FBWA 2W6ZA 2RSLA 3FFDA 3NTQA 4ESHA 3FU6A 1DJXA 3OT1B 5DNCA 3HMQA 3QBTB 4OM1L 1PW3A 5EFOA 3SBEA 2D06A 2Y0DA 1H85A 4EX7A 5SWSA 3U2JA 1PJLA 4BTVA 3C60C 1JPST 5B39G 2VJXA 4NQUA 3ALXA 1GZPA 3JAWA 2M2DA 3KPPB 1YOVB 3MMSA 1EEZB 2CIKB 2WBJB 5TQ2B 3E70C 3PENA 3NJHA 1OGTA 1GZ3A 3GLGB 3M6MD 2DL2A 3FUFA 4KVZA 2EVWX 3K9GA 5FXMA 1S7XB 4ZOLF 3I34X 4CHGA 3QZWA 3HGTA 1XZ8A 3KUDA 2PV0A 3K92A 3Q13A 2OCGA 1NKGA 1YRQA 1DCKA 3R0XA 4RAUB 5EWMA 2CUTA 5IH3A 1UACL 3L9RA 4U6XB 5IRCD 1IVTA 1TSRA 4MI6A 2WANA 1R3IH 4IILA 4Y8VA 1DWPA 4BWVA 3TRDA 3DDWA 1SVWA 4QYMA 1YQVL 3BM5A 3FA2A 4KVPA 4K9NA 4JM2C 4JVUA 4RFLA 3ER8A 2E1PA 1BGXH 3SJCA 3WFBL 3E15A 5D2CA 4MJ7A 3FTYA 4V0SA 3U7QB 5H16A 4YHOL 2PSFA 5K1CC 4OCWL 4K07A 2D7NA 5CMAB 1JHRA 3LUKA 1ZHHA 1IXZA 5CD5C 2KPNA 1MO4A 1OFUX 2G9RA 3H2PA 2PM8A 3U56A 5C9JA 4PAOA 2O54A 2CE7A 4LCCA 3AT1A 5GZNA 3IE2A 3T77A 5AVWB 5BRJA 5AI4A 4JPKH 2JPDA 1VDGA 5CN1A 5JQGF 1RK0A 5D1XE 1Z0JA 2R48A 1P7YA 4FJ6A 1KZ6A 2HA6A 1FGVL 2YFKA 2R4SH 1B93A 4TWRA 4UMVA 1KCWA 2Q7AA 5JYCA 1QK5A 4H6PA 1YDMA 4Y9CA 4P3WA 2JFWA 5DTQA 1FEZA 3ULSA 1DEAA 4R3NA 2IKSA 1I94B 1JMVA 3AEXA 1BQLH 1CFTB 4D92A 4O2BB 4F7PB 4TTTS 3N2LA 1N57A 1OEZW 4NC4A 4ATNA 1BHSA 4HU2A 3KQVA 3MBOA 4PYMA 5ALIA 3D7NA 3FCSB 2VZUA 5JJ5A 2CYAA 2J9ZB 5IJ9A 2WDPA 3CDCA 5F7EL 3BQMB 1YE5A 1WS8A 1EZ1A 1QYDA 3BMNB 3CRMA 1VSUA 4PPFA 5J40A 3QUCA 1J25A 4OYLA 4UD6A 4AKSA 5EXPA 2OAAA 5CT5A 1S1CA 2QPSA 4PGDA 4JKOA 3EAKA 5E6RB 3VFPA 5E9DA 3ZNOA 2X0VA 4AV0A 1ZH0A 3HZKA 3V0IA 3IDGB 1RM5A 2IFFH 4P3KA 2XQJA 3B9RA 2PTUA 3VDQA 2O5ZH 1T2QH 2EBFX 1KCVL 3WXBA 4FRWA 1QCZA 4RKEA 3QEBZ 1ZLWH 3QXVA 4JFVA 4Y9EA 3IHWA 1XRMA 4BP3A 2HH0H 2WYWA 1VYHA 5FD8A 2XRAL 3WHXA 4X4YA 2B4YA 3BXNA 4WO4D 2WXFA 1T04A 1K8KC 4ZQTA 2OXRA 4HH9B 4P2YA 3GB9A 4RY8A 2IH5A 1T0IA 3IUBA 1WCBA 2DQIH 4WI8A 1RWOA 3JTSB 5JW3H 3F4LA 4DG8A 2MSNA 4FHBD 3GFTA 1CJKC 3EG6A 4MVJA 3FKJA 5BQ7B 5DUJA 4PU2A 4DLXA 3OZUA 2ZUQC 3NRJA 1BJ1J 4UQ3B 2NYYC 3FGNA 1CXLA 4EEEA 5GJWC 5C3IA 2QT6A 5E51A 2LCFA 4A2QA 5HGHB 2KQUA 4PJ5D 3VFGH 4XCEA 3B2NA 3BBPA 5KJCA 1UJ2A 3D9AL 1T2EA 3PUVA 4BWUA 3HCBA 5IMMB 2Q1XA 1YNLH 2WQ8A 2WIIA 4LGMA 1D5CA 1IEQA 5IG2A 1KBQA 3X44A 4E5NA 4K73A 4ZX4A 4ZK6A 3RRNA 4LPTA 1L9XA 5DJ0A 3FH8A 1M8KA 5ACMA 4GS7B 4UV7H 1GYVA 3DUSA 5BN3B 4BHUA 5J4MA 2JDIA 3QVSA 4FQ8A 4FQXD 4L22A 4XX0B 1AHPA 3MRJA 2E55A 4MGHA 4QLBA 3DSMA 2G5RA 3KWLA 2YR0A 4P4SA 2XQVA 4JNXA 3JTTA 5CZVH 1JAXA 1YIDA 4YAWA 1U9JA 3L1GA 4BMZA 3Q3GA 4GOXA 3NEEA 3QI9D 4M5SA 4MA1C 4ZNCD 3U61B 3P2DA 4OZFA 3GJ0A 1XEDA 4X0NA 1CI5A 5IARA 3C6SB 5DR5L 1BS9A 4LU5L 4RS3A 2BNQE 4OTXL 2PNFA 3LNHA 4AVJA 1GPH1 1H8NA 1YU9A 2GTIA 3F6SA 5CG1A 5BXQC 1YE8A 5EUBA 5FOSA 3UYRL 1QZNA 5CJQL 2O3TA 1AGFB 3E6HB 5DD6B 3MCAA 3S1AB 2PS1A 4A6DA 4C56A 2YYSA 3C5ZB 2V4MA 5JHDB 2XVBA 3DFZA 3N2ZB 1OB1A 3FGBA 1Q15A 3RABA 4MI9A 5CYFA 2ZXEA 4BH7B 4JN6B 2A6IA 1NGPL 4GZ8A 1KJ3L 3C1AA 3ZKNC 3RDTC 1H3UA 1TJGH 4M56A 2YNMA 3R23A 2DTMH 2G3MA 1UXGA 1HILB 4DP8X 1NJ8A 2BVPA 5K0JA 3N87A 4IIJB 4ZV9A 2I5PO 4W5TA 4HNHA 5IREA 2AC0A 1E1CB 5GPRA 5IJCC 1FLDA 5TE4H 1OWLA 1AY1H 2XY2A 1MDTA 4OJKA 4OGXH 1P2UA 1KAHA 1IH8A 1NR7A 1P7HL 1IPHA 4PO3X 4LXUA 4Y2OB 2B1OA 2A6JA 3RUGB 2OX5B 1QR1B 1LQTA 3GV0A 1J8KA 1OI3A 4Q9QH 2FE4A 1OF2A 2CK3D 5DRWA 3PHQB 1US8B 1SU4A 1X77A 2OFFA 1L5LA 4JFFE 2PUGA 5JBNA 1BA3A 2H1CA 4MQ7A 4HBCH 2A6PA 1A7NL 3I1FA 1KJZA 4MQMA 1JGDB 1D9KD 3P4OA 4CADB 2FFQA 3L0SA 4DG5A 4FOMA 3SJAA 4L3CB 2IUYA 1UVQB 5F9JB 3GSWA 4K9EH 1IMHC 3BTUA 3W5VA 4EO9A 1UA6L 1YS4A 3QTLA 1EZSA 4DCVA 4IYRA 3X0DA 3VPBA 3OPUA 1N5KA 1QYVA 4M37A 1QGED 4IWXA 1G9MC 2YXMA 2I6QA 3GC3A 5EGNA 2AFIB 2GUGA 1PFQA 4XO5A 1UM8A 4OD1H 3UGEA 1QNZL 2VQ1B 2X0IA 2X5XA 1ZH4A 4P6VF 4JHWH 5KHAA 3GD5A 2DQ4A 4BK5A 3QVUA 2H5UA 1OE0A 3I62A 4WI2A 3P0EA 1GJIA 4INPA 4WI0B 1MOSA 1F90L 5G40A 1DQPA 2AQIA 4D3XA 4I4WB 4JQYA 4AIOA 3CC5B 4O9HL 5FCUH 2CHUA 1CUGA 1XTZA 1XH1A 4E11A 5DRXA 1TVKB 3B6ZA 3CLHA 2W00A 1TEGA 4J8PA 3U36B 3JV6A 2W6NA 5F6HJ 4I4TA 1I30A 1C9KA 4X0KA 2J41A 5BW5A 3DBIA 3O6LL 3M9WA 2HMUA 4NMLA 2G36A 3JQ9C 3QXUA 4FL4B 5KYWA 4XUGB 3CJRA 5KVEE 2EBHX 2VDWB 2H7VA 3LS4L 4ZMNA 3INUH 1DQZA 1XZDA 4LRNL 5EU5B 4OZHB 2QSCL 4OZ4A 5EC2A 2CBXA 3VR5H 1P74A 3WZLA 1N0LB 5AM2A 1P2CA 1Z6YA 4TZTA 4X9HA 3ISTA 4WFJA 1MAVA 5EC8A 4J7CA 1OKKD 1G5FA 1GPJA 3LUFA 5KVMC 2A5GA 2ZPAA 4WESA 4EWLA 4KFMA 3BUYA 1TETH 4TM8A 3UAEA 2XQIA 4FMBB 5AMXA 3VDBA 4UDTA 4JM2F 3G23A 3BKJL 1ZIPA 1MHEA 1IN5A 4OFDA 5CBPA 3K73O 5DNEA 1WWWX 5EAPA 3WEXA 3CT6A 2BOBB 4N7JA 4RCAA 1Q11A 2FG5A 3LM8A 1VEOA 3WL5A 1KY6A 4BVKA 2LOEA 3W2IA 1SD2A 4B79A 1A6UH 3HPLA 4KNTA 5ERWB 2WSPA 5G4OA 1JTPA 4JFEE 3ST7A 1KMIY 1CP3A 4ZJPA 4Z4EA 1BG1A 4JI2B 3NTRA 4S11A 2OZ4H 4BMOB 4DR6B 5BNZA 3L8EA 1XXHB 2PEYA 3QXTA 1PIFA 4LA4A 4EITA 1BD2A 2PP7A 4ZARA 1MV8A 2IHZA 2JIXD 1QB8A 3I50L 1M0SA 2O93L 1IGFH 3UJTH 2XTJD 3EW7A 1KCRL 3HJCA 1RI6A 2XQBL 4QTZA 3AREB 3BIXA 3IAPA 1WBJB 5D7JA 2EF1A 3ZLTA 3EASA 3T0FA 5K45A 1EAOA 4M1ZA 4G0UA 1CFNB 2IO5A 3OVMA 4RF2A 3FNEA 2I67A 4DNUA 4ZT6A 4P46B 4UAUA 1E2BA 2DQKA 5DS2A 2KBGA 1B3JA 1YR2A 4O58H 3RNOA 4C3ZA 2J6IA 4PJXB 4BP1A 3MO1B 1QLFA 2BFVL 3KTAB 2J1XA 3G5ZA 3B52X 3MGBA 2ZI3A 1TO6A 4TNVF 4Z7QB 1AA9A 2QMEA 2HWZH 1AKMA 1S9WB 1GGNA 1T2DA 1N92A 3W11D 4L3EB 5KHLB 1NMEA 2WP3T 5KSWB 4K0OA 5EC1B 4LHEA 3STUA 1YFQA 4K7FB 2PBIB 4PBRA 4QXAA 3U9LA 2NQ3A 5SYMA 4HAUA 2PCXA 2XOKD 1JZ8A 2R0WH 1JZ7A 4MLSA 1JHOA 5KTYA 3TRKA 4AY0A 4IBSA 4M1GH 3CLTD 3FFCE 4OI4A 4L0YA 1AZBA 2D03H 1XLTA 4X7DC 2BTQB 1IYZA 5FM5M 4DBLE 4ML3A 3FHEA 1SXNA 3ECUA 3TH4T 4I81A 2AQ3A 3DKKA 4NXKA 3BQVA 4OFQA 4N0UE 1F3DJ 2CL0X 4RIIA 3TG2A 2GSMB 3EXJA 1YVLA 1SBQA 4MAYA 3A21A 3FCUB 4R7NA 2AAVA 4AXWB 3LUBA 3S7TA 5J2UB 3PUZA 2YXWA 4R1UA 3CLVA 1GHFH 1UT9A 5A0FA 4P9HL 5AKEA 1QGZA 3U2QA 4ZHQA 4O2FB 3KEHA 4MWOA 3B3GA 2WBWB 3ZTTA 5FTJA 1CY2A 3VZSA 4CT0A 5CZRA 3ZJYA 1XIVA 5BN4B 3DXFA 2BP8B 2PIAA 4FQHA 1LQBC 4F7CB 5SWZA 5LP6B 2G88A 3U31A 5ENVA 1UH3A 1F3OA 3SYQA 3WI7A 4M9RA 4PV8B 4H7JA 5CR8A 5EGSA 4MS1A 4S10A 3G5YA 4PIRF 4X5LA 1TQ2A 4L8BA 2HMIC 2XNCA 4YP6A 4F91B 4X6CA 3WV5A 4URZR 3T7CA 2AC4A 4MVJF 2I65A 3MOBL 5EZIL 4NCKA 2WHEA 2ZICA 5EPOA 3VPFA 2NTEA 3HCNA 4IDGA 4BH8B 1DBKL 3UM9A 4X63B 2GJ6B 3L5XL 4TSCL 2MTBA 4JFXB 3QA3A 1IBFA 1MVNA 3C09B 3T4AC 3RRMC 2HQRA 1X8JA 4OQLA 1CEQA 1IIRA 4E22A 4HH3C 4URYR 3REVB 5I7SA 2A5DA 2PX0A 3UXMA 1H5BC 3DV6A 2D5CA 4WKZA 5DHEA 5T67A 3NAAH 2IY8A 2QUKA 5E0KB 4JSNC 1K06A 2SECE 1POWA 3SGKA 1PG2A 1PUXA 4PJ9D 5B8CB 2AK2A 3Q5TA 5D4QA 2HYEA 2BUCA 1HSAA 4G0WA 3NFPA 4N5IX 4NHEA 4MB5A 4E9TA 1VYTA 4GLJA 1RZIA 2EZ0C 5DGDA 2I7TA 3CG0A 5DIFA 1K6XA 2B2NA 1CQIB 1P4GA 4ZALA 3Q11A 4OX9Y 4IX1A 5MN6A 1E9EA 2VDRB 1I7TB 4HWBA 2UZ1A 5ICZA 4GM3A 4JS0A 5TF2A 5B4MC 5AKJA 4ESOA 4RDXA 1JSCA 3GQBB 1DIAA 2CSXA 3KJEA 4TTJA 1B73A 1GUZA 2WU8A 1UBEA 2XUGA 2XB8A 1H0KA 1BEUB 3BK7A 5HWSA 1KQ3A 4ZOVA 4ZO9A 1V7NL 1HLFA 2OFPA 5EIXA 2Q3FA 4MROA 3Q2KA 1O5PA 4GX1A 5BUZA 2QD3A 3CFDA 3K26A 5IEBA 2CJXA 5EYPB 2DH5A 3BHIA 1DRKA 1A9VA 1JL8A 1C3EA 4OZIA 2JNWA 5GXBB 4IEIA 4OQ4A 3U6XA 5DM60 2E0PA 1XFAA 3STZA 2QN1A 1L0QA 1BCIA 5TDOB 4U6SA 3FPGA 4TVSA 4MINA 3RWBA 2NY6B 1A12A 5DNWA 3CJQA 2QBYB 4RK4A 4GMSH 2BKUA 4KXFB 5T1MB 4M8UA 2CC2A 4AZUA 4XGKA 5MEND 4J6FA 2WZAA 3M2PA 4DR5B 4IV8A 4CVXA 2GK6A 4ZCIA 2P8LA 2CCVA 2W71A 3NIFB 3W06A 4MAUL 2FDBP 2VS1A 4GBXD 1C14A 4I0PC 1TAUA 5EIBC 5LYJA 4F5YA 4XP4L 1M9WA 3GD1I 5K8IA 4DDKA 5IG7B 1Y1KE 1SUWA 3DEAA 2J55H 2EBUA 4BO8A 4YDMA 1AN9A 3HUDA 1VJ5A 4PJ8A 3PGVA 5B7MA 1PV4A 3NSJA 4R4NC 4CJXA 5CFRA 2IDZA 1ETZA 1YAJA 4UIMB 1Z0IA 5CDTA 3LQQA 3CW8X 1WX1A 3T5PA 5CBKA 5J12B 4E4RA 3KSUA 4IGBB 1EUYA 1O9WA 3FOCA 4N6NA 3L9YA 1HV8A 5EDSA 2YJ3A 4RSYA 4MPJA 1SCNE 5DC0A 1RK1B 3P9QA 3D25B 2ZZNA 3FUDA 1FNAA 1AR1C 4IIQA 1GR1A 2AK1L 1T35A 4APXA 3KJFA 5H3CA 2WHVA 4RHTA 2V0NA 3IP3A 5IK3A 1O94A 5GS2D 4YHHB 1ECFA 3SCYA 1JWSB 2VUYA 3H9UA 1IKFL 5K0NA 1BA9A 1NI5A 1VLXA 5AAMA 5K0GA 3WO4B 2VWPA 5A2FA 2H4JA 2VTDA 4G9FB 1ZL2A 2H8GA 3G5XB 2GR9A 1OZFA 1C81A 1I1YA 1FRGH 3ILDA 4EJ2A 1SVNA 4BAUA 4R8KA 4MRAA 4PB9L 4IJKA 2EYRA 3ZCTA 2RFXA 3N8IA 2HDOA 4MGZR 3F2VA 3JTEA 3OI7A 4I4TF 3HG7A 3KYAA 3FDZA 2AR7A 4YHNA 2GPBA 4NNPH 3ZZ0A 2J8HA 3LO5A 1RZJL 2YRLA 3DKPA 4CBZA 4U7GA 2W4MA 3MM4A 3AP2A 2HYMA 1YC2A 4B6EA 3JWHA 4YSEA 1OXVA 5B53A 2XUQA 3LRTA 1G2QA 3VYPA 2O4CA 1MORA 1N5YL 4L4RA 4KQFA 4W9LC 4II3A 3L48A 3O45B 4QLOA 3RVSA 3DLAA 1MELA 4ZAVA 1WC7A 4ZYVA 1U28C 3I8CA 2O2EA 1ZISA 1A8PA 1SMAA 2LTQC 4HGKC 4ZXFA 4KREA 1DUZA 3GCZA 5HDBA 1EBPA 5F4BA 1KBGL 3P0IA 4Z78B 4OJFH 1M2FA 4H6XA 3R40A 2YEZB 5CKAA 1WIWA 2AF3C 5IAGA 1C0IA 2LT9A 5ICEA 1EVQA 5AAMC 1COBA 2ID9A 4L05A 1EGVB 1W72A 2QMOA 3BISA 4LV6A 3QI2A 3V4FA 4FYHA 1DJMA 5CNJA 3EVTA 5T6BA 1I9RH 1JFQL 4P4KC 4PHGA 2AG0A 5CTJA 1QRDA 1Q95A 4NLAA 3P2OA 5CBEB 1JNLH 2WWFA 3TL6A 5AB9A 4LCUA 2QUIA 3I1IA 2GH1A 1MFAH 1KDRA 4KJQD 4RSRA 4N2MA 1XKTA 4H1TA 3BERA 2DKOA 1Y7PA 3A9CA 2G0AA 4EVSA 3LZOA 3FSOA 2ED7A 5IKCA 4HGWA 3G9AB 4DFDA 3RVXC 2FEXA 1C7FA 4Z6KA 3IVAA 5AI9A 1OB5A 4R7AB 3NDIA 3BKYL 3FSEA 4HFJA 4IU3B 4TMWA 3OWEA 2GM4A 1JKJA 3AAZA 1VM6A 2HCRA 1SXJB 2KZBA 4HZIA 4LARH 1QFUL 1LSUA 5LBIA 3MGOB 1A7QL 1IL1A 3G8YA 3VFMB 4XCFH 4XSHA 1ZVSB 1DV2A 4UBJA 2DIAA 2F7QA 4AJOA 4BX0A 1BXKA 4PBXA 5EBLB 4B8WA 1MCDA 1XU4A 2MHCA 1FNSH 1DZIA 4PZLA 4WU7B 5KVQA 4X6YA 2HTKC 3FVQA 4PJCE 5BW4A 4B4KA 4M1SA 5L4MA 3TZCA 3HFJA 5FA4B 1GAFH 5TNXA 3ROZA 1MDAA 4QATA 5AZEH 5LDGA 1ONNA 5D4HA 4X5WA 1T89C 2QL1A 1ONSA 2VQ3A 2WBJD 2NSJA 1D4FA 1IBGL 3WS7A 4OJEH 2LVBA 5E0OA 3NT4A 4LV5B 3I9PA 3RBXA 4DW2L 1RCYA 2V6MA 3MX0A 3QDGB 4I6EA 4YECA 4FQJL 2BVNA 1RWXA 4OLVH 1NXSA 3LQYA 4XHJD 2I3ZA 4XPGL 4BKRA 1HHJB 3PDUA 1OFUA 1JK9A 1TAGA 1HT0A 2O8DA 4JQSA 2C82A 1U8UA 4CIAA 2HV9A 5HDQH 3Q7SA 1ZGZA 3MJSA 2WSYB 1RFDH 3CSFA 4HPHA 5CFHA 1K4CA 3H4VA 2NZXA 3AF5A 4LRIA 2H48A 3NDPA 3ETGA 3H1BA 4YT4A 2OMTB 4LCWE 4E9SA 4TOYH 5AVRB 3KPOA 2VTBB 5J4VA 1BFTA 2PXYA 1WE2A 2C9YA 5IJ0B 1I4FB 3BUIA 1MJUL 1B0RA 1B8PA 2CDNA 2BSQA 1KK3A 2V8BA 4G0YA 4YHKL 2H9AA 1E27A 3AHDA 2HSWA 1XSOA 3MKKA 1MWAH 4B7ZA 2HN9A 1L7DA 3I28A 1JTEA 5BQOA 3VISA 1ADQH 5JOFB 5HF6A 3D6TB 2BUBA 3SBXA 5BWBA 1I2DA 2ZSAA 4ZHQF 5JAIA 5D7IE 3LL4A 4G1EB 4PX2A 3OKCA 5L2KD 4LDZA 4F21A 5A2AA 5ELMA 4IXTA 2D7DA 3GDBA 4KHXH 1ENYA 5L40A 2Z43A 3MCLL 1EM8B 4C8XA 1NCJA 3F3KA 4BDVA 3D5OF 3U13A 4XVJL 4X9IA 3VFWA 4AU1A 2CJPA 1H6EA 3LIPA 4PAGA 2VJCA 4OLBA 2UUOA 1E5XA 2NAFA 5D51S 5HHXL 4CRPA 3NJGA 3EFHA 1LEKB 1KEWA 4L85A 4X6CF 4A8JA 2D62A 1KJ2L 3BP4B 3TAHA 1EFCA 1E67A 3CFEA 5I1LB 3CWZA 2ZX5A 1TTPB 2FUG6 3LB6C 3GUZA 2YQGA 3N40F 3LXCA 1QHSA 2WP3O 5IBUG 1XTKA 1LV8A 3P5BA 2GUOA 2QN2A 4QRJA 3A6EA 1ZIOA 3UMRA 4P9HC 4PSUA 4WFGE 3HA3A 3MB5A 2XZQL 4LVOA 3EO0A 1SOAA 3FSZA 1HQ4A 1JJIA 3Q44A 2NPLX 3U1BA 4NCJA 1ENZA 3O0RL 1TXKA 4CTNA 2OT3B 4U2DA 2VRKA 3WI9A 3ZHOA 1JF1B 2I9TA 4P80A 5F7FA 2CN3A 4XDYA 4JIMA 4U6QA 3RAJL 5HHMB 5C7XH 3SSMA 1I2MB 4YFDB 1F7UA 1QFMA 1P7CA 5JQWA 7CGTA 2REQA 2NY0D 4FFZA 4PO8A 2CKMA 1T8RA 4Y1AA 3M3HA 4E1VA 2XWSA 2JB6A 5DFAA 2QHXA 3F9IA 1T1EA 1HQKA 1FTWA 5KVDE 1I8IB 4PJAE 2IXTA 1WFOA 4NUGL 1WDMA 4RK5A 3I39X 3L8MA 1D03A 1WF6A 3U3RA 4II2A 1JLSA 4UTVA 4LDQA 1MGOA 3HCDA 4BYGA 3OG9A 2PUQT 4WUTA 3H2IA 4HIIA 4FB4A 5HTKA 1J5XA 1SVZA 4B6GA 2P75A 3BZ4B 4I85A 5KNBD 2A6KA 4D2NA 5AWNH 3HM9A 1ZQ1A 1A8IA 1SY7A 3QUZA 2GK4A 4C14A 1FDSA 3NGXA 5MHTA 3LQ4A 1MUUA 1CULC 1U8ZA 1WYJA 5I1EL 1AXSB 2GT9A 2YR3A 4OZIF 4FABL 1G6Q1 4KBGA 2E9SA 1Y0LA 3FTVA 5C0FA 4L0DA 2V8MA 3KEDA 2I2BA 3I01M 4QSMA 5GJVC 3GX1A 1UC5B 3MJEA 2KZWA 3DBXA 1JGUL 4HD5A 1R0ZA 4L7QA 1XMWA 4X5XA 3F7YB 1YS2X 3TO4B 2YPLE 1W0JD 3FVRA 3O2NA 3RKUA 4JPVH 3P2JA 4IG4A 3K6KA 3TLJA 1L7NA 4QPPA 1BVNT 4RYLA 3MLYH 3V9CA 3SYRA 3CX8A 4U1MA 5JW5A 1MB9A 1S9DA 5IFJB 1LNZA 1OR8A 1LD3A 4IXMA 3NAMA 4IMLA 5E4EB 4AUJA 1CSEE 1BYOA 1S7UB 4GG8A 3NV9A 3WY2A 1XCWA 1IG0A 1TNNA 3UXHA 1TRKA 4BO6A 4DLNA 2FJFA 3CHSA 1ZSYA 1AO7A 4QRQA 2V3VA 1F5WA 3ORQA 3C5ZD 4WEMB 3WIHH 5JHDD 3X1KA 1N1EA 2VJBA 1MKFA 1ZOPA 4EF5A 4GKJB 3ELYA 4UT7L 3WG9A 5IYZA 1P0PA 3OAAA 2PGXA 4LGSB 3ZE2B 2C03A 4EZEA 1WDWB 5FKRA 3BSHA 4W7HA 3MLPA 3HPJB 3SPGA 5DHRA 1AF4A 1QRTA 1ZK5A 4BP8A 2XV1A 1KPGA 2R6R1 2OGTA 2XI4A 2W0FA 3BUQA 2XY1A 3AI2A 3UWDA 1G291 4GXFA 5GPBA 3NHRA 4ODUB 4GXQA 3BP7A 2JI7A 3UTTE 3W1ZA 1KVSA 2J31A 3AP3A 2OQRA 3D85B 4LEEA 5E7FA 2OMNA 2R1ZA 3RVJA 3GFVA 5GV8A 3IETA 2ORIA 3LEXB 2ODAA 3R7FA 2ZOKA 2AV1A 7TAAA 2HWYA 4M1DL 5IJKA 5BQ3A 4P06A 5D5MA 1B6TA 1I3VA 1WMEA 4HG4J 4QAMA 1NAML 4DPMA 1DUYB 3TJHC 3OX1A 1QV7A 4MYPA 3E23A 3OIVA 4JO1L 2ORBH 3BWBA 3SZ3A 4YMHA 1Z6XA 3I0NA 3MZ0A 4P7BA 3FGZA 1KYOK 1XH3B 1ZEAH 3PEFA 4HUWA 4HBZA 4LRSB 4QHTA 1ZK2A 3BWMA 5DSXA 5LOVA 4V24A 5ALJA 3ESMA 1YRWA 3BD9A 3OAZK 5KVFE 4CSZA 3SCMB 3GDWA 1LJ8A 3WTUA 4O2CB 3GHEL 2VXUH 2F9FA 4RQBA 1MCIA 4MB2A 3WXWH 4BSVA 3ZZNA 1OAOA 4OAWA 5KBMA 4MUBA 3SVTA 3PITA 1THMA 4ZCRA 1X4ZA 3NEYA 4D4GA 4BQFA 5I7FA 4KN6A 2BN4A 4RWYH 3GSRB 3X13B 2RAMA 2QMHA 3DE0X 2DRUA 3FQUA 5HDBF 1W0VB 2A9ML 1QYXA 4RJIA 4JZKA 5CCKL 5CSZB 2VLKD 5C0RL 3OWOA 4IJUA 4LOJA 4BFXA 5BPHA 4ZU1X 5JOQA 3WRYA 4RLHA 1V0JA 2Q3LA 3WB0A 3AS3A 2PSEA 1CDOA 4Y7DA 1UJMA 5BMOA 3KV1A 2D9QB 5H70A 1EHLH 5DFTA 4ZK2A 5AHXA 4FG6D 1YEKH 3WLIA 4DR1B 1W48A 1QCCA 2GJZA 1RQ7A 1B41A 4EZBA 4OJMX 3HZ3A 4PPQA 1AHWB 3F9CA 1RZJC 1MIHA 2ZE6A 4OU5A 1EFAA 3S9DB 3RC3A 3LZQA 2CNWD 2FWRA 1L9RA 1QHFA 3ZU4A 3NBXX 5LIRA 4AENA 1Z2CA 1Q1ZA 3QK0A 3D4CA 3TO5A 2IADA 3G6DL 3A4VA 4D9CA 5L8KB 3TCNA 1P7PA 1JTFA 4TQEH 1OBCA 3JVDA 2Y2YA 5FHQA 4ONGH 3PXSD 5AG9A 3H4MA 1KAOA 3MUNA 3OZLA 3P2EA 3DUUA 5I8EB 3RZWA 1KQPA 2N3JA 4KDEA 3SWSD 3ARGB 4WENB 4JXXA 4NV3A 4GU5A 4YUAA 2R0ZL 4AUNA 4BUCA 1UMDA 2XB6A 2XA9A 4FI6A 5FYJL 3GUVA 5AM1A 4GW4B 3DRQB 1U3GA 4UQPA 2D0IA 2GM3A 2D1RA 3I2GA 2JTYA 4XCYA 1W0KA 3G9XA 3K81A 4CIWA 1RE0A 4WXPA 5B4TA 5AW1B 4Y8DC 4NBKA 3T6ZA 5E8RA 4PGAA 4ARAA 1P22A 2DFLA 5C0BD 4L02A 3GJFH 3HFML 2VDLL 3C60B 2WUEA 4YSQA 4ZHSA 5EMMA 2AF4C 2ZJ2A 4P2OB 2ODIA 2CLRB 4POAA 4EGFA 4ES9A 3AG3B 4Z4QA 4C4OA 1VKJA 1R5IA 2Q10A 2VDNL 3OCXA 3T65B 4KIWA 5K9ZA 2QQQA 5HS4A 2L17A 3ARED 4Q1VA 4X24A 1EFXA 3FRJA 4NUJA 4I0CC 3SC6A 2CVOA 4PVBA 3F6BX 3VCLA 1E42A 3GC6A 3E22A 4EIGB 4JEIA 1MEXH 5KYTA 5HGXA 4LN1A 3LMJL 1PY4A 4DLPA 1P5VB 4GO9A 4G3XA 4QUGA 4NVRA 3KVRA 1Y8QB 2RBLA 4P46D 4GT1A 5DX0A 4NARA 3UAJA 4FR0A 3PIQA 3L1EA 4J1QA 5FP0A 4IKOA 5C0CD 1E40A 2HMWA 3PHIA 4UT9L 4K1LA 2AFHA 1IQ0A 4TMTA 3L17A 4GINA 3BIBX 3TX2A 3M86A 3NIGF 1Z5UA 3VR4D 4KBPA 3BC9A 1Q5PA 5HYJB 4Y9DA 1RYBA 3T0DA 3ZE1A 4ZFQA 3FB8A 4CTJA 1QG3A 1GQYA 1JRLA 4LYJA 1TLFA 4RU1A 4YT5A 4JDZB 1AZTA 2OSBA 2WAOA 4O3FA 3ARRA 1FDIA 4I7ZC 2O6PA 1WAPA 3W3BA 3PGFL 4ZT1A 2O3UA 2YV2A 2PCFA 4AITA 1SM3H 4JAMB 2D4AA 1MB4A 3K1AB 1OTSC 1OAYL 4JY4A 5DHYA 3FQ2A 1UQRA 4J3OF 2D2VA 1ZA6B 2ERXA 2P1YA 5AENA 2FJGA 1XBDA 4BUJA 3DP9A 1C3OA 5DU2A 1WUZA 1JKXA 3STVA 1IGMH 2AJVL 1LYQA 1V9CA 4NSXA 1ZIAA 5BMFL 1AY0A 2TMGA 4TV8B 5BV1A 3UENA 2D8MA 3FB4A 3G04B 1SOVA 4I1IA 3D7KA 1N9KA 1AD9A 2P5WD 2FNBA 1IK4A 5HQ3B 5F21B 4ZUTB 5ULLA 2G0KA 3IOBA 2VITA 2JLVA 3EF4A 4TMKA 3MG9A 1WCWA 4AGOA 3JXEA 1LC3A 1XWVA 3NR2A 1NVVR 3KRXB 3L6DA 3DX8B 4KRNA 4IKPA 3FTSA 3QUML 3TWOA 4EPWA 3LN5A 3W57A 1XP8A 4PGBB 3R7RA 2H9MA 3SSNA 5G0TA 1QG4A 5DISB 5AW9B 3H11B 4JVPA 2FRGP 5L8LB 3O6MH 3V8VA 3EGEA 3TTVA 1FX1A 2H9GA 4CUJA 1PU0A 1SWWA 4KMQA 4P53A 3GUFA 1V16A 3A7EA 4DV3B 1IL0A 4PTYA 2O48X 5GS2H 5KTOA 4YYZA 2B3RA 3N1UA 4QO7A 2GG1A 3ATAA 3CPEA 4LE0A 1KBVA 4DR4B 4V1CB 4JS7A 3SGEH 4I89A 4HPOL 4G4IA 1A2YA 1RZRA 1JI0A 3KQWA 3TLKA 4QOKB 1E4WL 3HJNA 4GUCA 4TRJA 1RIVL 2HJHA 5JAQA 1DTEA 2AJ8A 4LRTB 3HC7A 4IGFA 5T5FA 2HTFA 1UOEA 3IPLA 4AZWA 4BDSA 5J6SA 1R9MA 4AG5A 5DJ6A 3R8FA 3NZHH 2PKCA 3BPOC 4RBPK 3LSTA 2DQJH 1IQDB 2GJ6D 1EA5A 1ITZA 1KS9A 3UFXA 5T5NG 3RR2A 3CHOA 4PRPE 2Y07H 3V7MA 1TLTA 4R81A 3NTCH 2BBOA 3FO1A 1F8TL 4OLHA 4CKWA 2FLRT 2A78A 4G8GB 3C8UA 3E1SA 4DZBB 3T3PA 1N8ZB 1TENA 4US1R 3BG5A 5DLMH 2CJSA 1YNSA 4BA8A 2I4OA 4QOSA 3SPJA 2AI3A 5I7HA 1IRIA 2B1IA 1DL5A 3CEAA 3F3PA 1WHSA 3CXRA 3UJIL 1IFHL 5FAAA 2QDWA 2X2EA 1KN4H 4RH0A 2VQSA 1G4AE 5D01A 4HH8A 1RAHA 3MBXH 3TLZA 5AW3A 3C12A 4DMRA 4HFUH 2VWHA 1SUIA 3L8HA 5ALKA 2Q8AL 4CEIB 3KE9A 4PBSA 2HT3C 3EYOA 3G2MA 2O8BA 2E7CA 4MA1B 4P5TC 1DIRA 1QNIA 1A9XA 4QRBA 4O2LA 2OCIA 5DNVA 4YDVB 3QVMA 3K1KC 1Z6GA 3LHKA 4G1MB 4OLWL 1R6TA 4KG7A 4KC0A 2L7QA 3MV9A 1M6VB 2E47A 5GGUB 1WJGA 1VHDA 2XTJE 3LN4B 2HW8A 5JLJA 4ALMA 4X20B 3VGBA 4BEWA 1U8QA 2W60B 5FF6B 1YU6A 2RMKA 5CHEA 3A0FA 3A6LA 4OQQA 2D3VA 4WI4A 5SXMA 4P5DA 3ZEIA 4TYUA 2XA8L 4P2QD 1EIWA 2VLMD 4G01B 2QR2A 1PS3A 1Z29A 3VSVA 5HJ7A 3OXSB 5C46F 3RDTB 2BWJA 2NY6D 1ROCA 4HISA 2VZEA 4S35A 3WYFA 3PQCA 3VZPA 1TQUA 1VKZA 3RL2A 1WF3A 4LHJB 1ACYL 4HAXA 1CUHA 4FQ2H 3F97A 4XA8A 4AT6B 2AJ3A 5CCHE 1IMJA 1NCDH 3EXG2 4Q1CA 5C07B 2X7JA 2XNJA 4JKPH 3DWGA 2C94A 2C0QA 1YKGA 1XEXB 4D8UA 4BNTA 4I88A 1DHTA 1K8RA 3EI4A 5KSBF 2GIMA 2JD0A 1FLAA 5JTTA 5HGBB 2C7BA 2ZYUX 4MEBA 1P53A 4YPOA 1N2IA 2WJIA 3GA5A 4EHLA 3FWHA 3BEVA 4MXQD 4LCIL 5C0GB 4HXEB 4L5YA 4WWKC 4J0WA 1NYQA 4PY2A 1N5RA 2ZRPA 3WKDA 1IHOA 2BWQA 1RJCA 5D5MF 3H7IA 2P5TB 1RBZA 4UBKA 1ZOLA 2KLBA 2EDOA 3HUTA 4M8SA 2MMCA 4S2SB 5HJ2A 2E27L 4XBPB 2CZCA 2EFYA 1EDQA 2CRIA 2B5MA 4INZA 4YRQA 1R3HA 5J6GA 5AOAA 3ZXIA 4JFYA 1KB5L 2QJDA 3L4BA 5FWDA 2IHNA 3W5AA 3WBDA 2VN6A 3HCWA 2GTZB 1D6JA 4BFIB 5LCVA 3AM4A 5C5EA 1D07A 1A66A 2SBTA 4K71B 3QORD 3O3BB 3EXHA 4GGCA 1KZYC 1QG0A 3QPKA 5D1ZC 4RY0A 1B6GA 5AEAA 2YAMA 1X7SA 4N14A 4JZJA 4JL2A 1OGIA 1ZLUH 3QITA 1N2JA 3DFUA 4PZ9A 3VRIB 1T9KA 4A11B 2QTFA 3CMCO 5J5CA 3SJVB 2IEBA 2G9VA 3MXWL 1O4WA 3BXZA 3TBSA 4EZMA 3IKKA 4W5HA 1I1FB 3U4QA 4NKIL 3RG1C 2JFNA 2QX4A 1RULL 2PETA 4KKBC 1EDBA 3KYMA 1VBKA 3AH8A 1FL9A 3O3AA 1K8DA 3CFJB 2IODA 5I6OA 1M6YA 1U95B 3S5LB 2YC1A 4GSDH 3RJ9A 4K94L 2HHHB 3I2HA 3QUXC 4BCDA 3GLQA 2HT4C 4BO2A 3PAUA 1I9JL 3WIEA 1SZPA 4BGLA 2OTUB 4AWXA 5A3IC 1KPUA 3CY6A 2XZPA 4NH4A 5ABAA 1I3UA 2RTTA 3B6EA 1Z3RA 2E59A 2WLSA 1KI2A 3DOFA 1L5RA 4FHDA 2N1MA 4HIHA 4UOEA 1ZXBA 4HSAC 1V5GA 2QMJA 5BW7C 1IC1A 4LVHC 3VYNA 4OT1L 2I24N 4YRRA 5A4AA 4XASA 1GOHA 1ZIYA 3WYGA 3TZLA 2OA9A 2QTBA 4OB8A 3DTVA 4HFWA 3QIUC 5DJXB 3I5XA 5GJTH 4NE7A 1JYEA 3FPHA 3PUCA 2NU8B 3CZLA 5AH0A 4TUYB 5EOCJ 1AQYA 2GI4A 5C9ZB 1NE2A 1QZTA 4HIEA 2BW0A 2CLIB 1E4KC 3CLUD 1OSZA 4A23A 3Q9UA 2X6AA 1REQB 1XF4B 5E7MA 1DR9A 1G8JA 4FE3A 1DVRA 1JJVA 2DD8H 1GSOA 3JWEA 2DHEA 3GOQA 2RC6A 4N90E 2OXGA 2HWWA 4AUUA 3QDJE 3O1LA 2PGAA 4K3GA 2X3UA 3BJLA 3SFTA 4D9GA 4Z8XA 4AEIL 4L6CA 5EBMA 3IJHA 1YUKB 5LL6P 4ORGA 3VWKA 2W70A 1CLCA 3MDJA 3IUJA 3RLMD 3H8NA 2DQCH 2N4IA 4KGJA 4DMGA 4Z7JA 3UO8B 4PJIE 2ERJB 4BNZA 2GSIA 1JHVA 1T4KA 3AW5A 3ZGIA 1QO0A 2XRFA 3PC8A 5C08A 3R6TA 2ZRCA 2GAJA 4J0KA 1M7DA 4G5FA 4DV7B 4R2XA 4QRPA 1KTVA 3PXHA 5BY2A 3KDMB 2FR8A 4XWOD 1XGTA 1LDBA 5FJIA 1T5XA 4O5AA 2PZLA 1OANA 4UTNA 2HBZA 4X91A 3ZE1F 2YOAA 4C6TA 2QL6A 4JY5H 1L2TA 5MENE 3DE3X 3RGVA 3PQDA 1EINA 2XQGA 4K5QA 4MMXC 1YVRA 4GQ2P 5IAOA 4RH4A 2H9NA 4XMKH 4XVUA 1JGVH 1JYXA 3P69A 3MFFB 2VSQA 4JHAH 4GM8A 2DQTL 2X77A 1YEGL 4XPTH 1XGYH 2FATH 1ONPA 1SYVB 5C80A 4IGEA 3UG5A 3UBXG 1PUIA 3HDJA 1DANT 1GTZA 4PGFA 2A35A 2O5XH 3EPLA 1KTDA 1G63A 2ITCB 1HC1A 5HXMA 1KNXA 4HWEH 1QU2A 1FVDB 2JFPA 4AYSA 5AXCA 2B7CA 2UZIH 1R5VA 3DO8A 3ZGHA 3VWKC 1F8YA 4YZFF 3K6SA 3BAEH 1LE5A 1R9NA 4J2OA 3VR5D 3FOEC 4Z5XA 3LS5H 1BM7A 4HDMA 2PYEE 4HBGA 4FC7A 3PL6D 1YNTA 1PAUA 4AF6A 1P7QB 2E8YA 5DE3A 4OATA 4Z7OB 2R1VB 4U3HA 4CR6A 4XGNA 2ZJAA 3ZW3A 2H2FA 5TJHA 2VISB 4BK4A 1F86A 3KKNA 4BB6A 32C2B 4ZOBA 4UM8B 4GI3A 5GGYA 4ILEA 4MZRA 3QEQD 1WZLA 2X1OA 1UADC 3FGOA 5L4SA 2P6NA 4HH1A 2V58A 2OSYA 5HKKD 2I99A 2JJSA 2X1MA 2P2NA 4JRXA 3UGXA 1YCFA 3ICVA 3FYUC 3FONA 3EJQA 3HZVA 1Z4QA 2JTDA 2CR3A 3KKOA 2NNCA 2P8MA 4Y8AA 3SVWD 4CUKA 3ICWA 5GISL 1IVSA 2QLVB 4Q3KA 2AEQL 4X4XB 1CVRA 4EEKA 4G6JL 3GEWB 2WWYA 5I5EA 3VR3A 4JFDA 1OPRA 2JZCA 5BVGA 4G42B 1W6WA 3GP5A 4YS4A 3C85A 3TLMA 5ALCH 1AQKL 2FY8A 3B9QA 4CN8A 4GNKB 1FBNA 3KVNA 4ZAYA 3Q6FA 2OL4A 4Z7UB 4JYPA 1TW2A 1IUKA 5C4GB 4TVUA 4WCYL 5T4BA 3T4AB 2AVGA 1SMKA 5AW8A 5DUPH 3MRGA 1QG2A 3BVNA 1URIA 1JDNA 2CEAA 5F1PA 5FO0A 4MQEB 1U9IA 1AQ6A 4DN3H 4OSUL 5CYGA 1H5BB 1AQHA 3T3PF 1MLDA 3QVWA 1QYIA 4UHCA 3G68A 4BK8A 3OZGA 1NKTA 1YEJH 3GZJA 3PHHA 1I7PA 1J2RA 2V5TA 4CC9A 3Q43A 3PICA 2J7LA 3OP4A 1L5GB 5ECGA 4UM9B 4YSAA 2XQFA 3NESA 2ZOTA 3NFSH 1P77A 4OQEA 3MLXL 3BT0A 1YYML 1XD1A 2HHLA 1UP4A 2V9UA 1JZTA 2WIAA 1CF1A 2NUTB 4TT3A 4N0CC 4FHKA 5IM7B 2YD7A 2F1IA 4BDTA 5CIQA 1RE1A 4XVRA 3ESVF 4X3EA 3PNQA 1E5ZA 1U2CA 3E8XA 4JB2A 2J4WL 2IYUA 1EQWA 1G7HB 2MDTA 1XG5A 1AQJA 4U7FA 2WLYA 1JRHL 2JA2A 2H7XA 4H4CA 1BVLA 3LDFA 4L5FE 4ZQKB 5FH9A 1GGEA 1PLCA 5T4FA 3IFNL 3FC8A 5I2IB 4PWYA 5I9LA 3JRXA 4KVCH 4DRXA 2DPMA 1SEQH 2YW9A 1T21A 4L8GA 1VAHA 5H2BB 1U2DA 4DSNA 3KKLA 2I7CA 4BE9A 3VXKA 4GRLA 4MHOA 3GP3A 2HX1A 5IAEA 4M7KL 1GRRA 2OENG 2XTLA 1N2CB 4PQYA 2X5NA 3EVCA 4NNXB 3JWNH 1L3BA 4FYVA 1GNLA 1TTFA 2MR6A 5KYXA 5JSZA 4V0QA 4BQPA 2Z64C 1FP7A 4DLTA 4WY8A 1LDMA 1GVHA 1L8XA 1QIKA 2GZHA 5JSQA 1QF9A 5LZ9A 2FO4A 2Y1DA 2CHWA 3W8NA 4ZW5A 2NADA 2I54A 3FDIA 2BVTA 4G4SP 1WFJA 4ZMAT 2PZAA 1WITA 1V26A 1ORVA 1G9NL 3QDMB 4J4BA 2FD6H 2DUJA 4AIXA 4DWHA 4I0PB 2WKQA 3T0BA 1BECA 3K70D 5GRJH 2RI0A 2F1BA 3RU3A 4UQBA 4K3VA 3BDYH 2DHQA 4J9VA 2QR0A 4YEDA 1NAIA 4IK6A 1TKWB 4X1IB 4DNFA 3VR6A 4YBQD 4BFZA 2FBJH 2VO5A 2ZSIA 3DPBB 2YQZA 3ETNA 4QUDA 3ZYOA 4X4ZA 4NQDE 4GYYA 5B1CA 1T03H 3P2IA 2FR0A 3VVLA 1KNQA 1V54B 1ZOOA 4JHXA 5EBWB 4NQED 5TDNA 4WW0A 4GMHA 3CFMA 3KYIB 3X1EA 4HDNA 2A14A 3IJ9A 1ZGLA 2IHKA 3R4VA 4MJXA 4IJ5A 1QSED 1ECGA 2PKDA 2OLJA 3S37H 3TDMA 2GZSA 4PTLA 2O2DA 1TM2A 1LLUA 1CIVA 4I5BB 4PJDE 3LY9A 1NGZA 4RCZA 1T2NA 2IYWA 2QVZX 5FUCC 4P0PB 3EXFA 2PA3A 4Y6PA 3Q7JA 1G5GA 3TCLB 2ATCA 3TT3L 4ZVTA 5ITVA 5IB4B 2AQKA 3BWCA 2F1AA 1TADA 1VPTA 3T15A 2JGDA 3VR4H 3KPTA 4J8QA 3PCRB 3PABA 3LQAC 5JSKA 3US9A 1J99A 3H5LA 4JG0H 1NVAA 3D6HA 5C31A 5IVZB 2V7NB 1U8MB 2N1KA 3L3KB 3P77B 3MYZA 1NJGA 3QF4B 4RSHA 4FLFA 3MRBB 4AMXA 1DBJL 4LY3A 4J94A 4NQTA 1PZ5A 1NT4A 1GXEA 2A7QA 1DMSA 5IHPA 3X1FA 4JY7A 5JCPA 1K7XB 1I7ZB 5CEZD 2HU5A 3U7YH 1U5CA 5CJOH 2FJ0A 1E79A 1Y7TA 2EEFA 1BROA 5KC8A 2IYNA 1PCSA 4Q9JA 5DYOA 7AT1A 2EVGA 1A3QA 5FR1A 1ZQ9A 3AZOA 2GBGA 2BOVA 2AKRB 2Z2XA 2FH5B 4TMPA 3KNBB 1VMDA 5FL7A 5KTTA 3W0WD 2LTQB 1WOYA 5C35A 4MKGA 2IWGA 4HXAH 5BNXD 4ZUWA 2AGLA 1AAJA 4ZOQI 1IAII 2X9LA 1EUCB 3UABA 1GD1O 3FG9A 5FB8B 2IG2H 2QMQA 3VWJD 2FB4L 2QYOA 5K01A 4YDIH 2H0FA 4GRAA 1ODSA 4TNEA 4BE6A 1IZ8A 4N5LA 2ALAA 2P48B 4OLJA 4MQXD 1YC8A 2ZP8A 4KPHL 1DDGA 3GLTA 3HK2A 1NW3A 3G2IA 5FT9A 2BOLA 1OAXH 4WTWA 5LA6A 2EXYD 4ZDHB 3LQZB 2NUAA 1QQ5A 1KY3A 5DXAA 3BSZA 2FQ1A 1UP7A 4EQ3A 4ODIA 2HI0A 3NJ8A 4Q9BA 3WFZA 2HJVA 4JSRA 2X1LA 3O8QA 4Y3UA 4ZI7A 4U1LA 5J47A 3HXMA 5SX5H 2CNYA 3NQIA 2CKBL 1VHWA 3DC2A 1KDZA 2R60A 1GU7A 3DNPA 3L7LA 1EGHA 5EEHA 5HVFB 3CYFA 4FYPA 2P6PA 1VPEA 4BNDA 2QQLH 1U80A 4NMMA 1CL7H 2BKLA 3N8DA 4BX3A 3VXUA 5G4MA 4KXBA 4WKGA 1SF5A 5E2TL 4ERYA 2UYGA 3ZY5A 3N43F 3CQPA 1GVIA 3UB2A 4TS6A 1OWNA 1KG0B 2L82A 3VM7A 2EZ8A 3IQFA 4G80A 1AS0A 1R4NB 4YSUA 1BQ4A 4PLKC 3GROA 4FS3A 4WCVA 1N8KA 2ADGB 3B2VH 1ZBDA 5D1HA 2DTSA 1M2EA 2X2JA 1UXWB 2GB2A 4Y16D 3I32A 5IXSA 4EMUA 4P2OD 2OBNA 2OY0A 1SRDA 2ZDHA 4JO3H 4ALAH 4QRAA 4GSRA 5EFZA 3PNLA 4MS8C 2VPXA 1A4JB 3I72A 2AJYH 4NP9A 1P2TA 3VSTA 4O3UB 1VOTA 2VDJA 1T6XA 4JFRA 4AKEA 3UXYA 3I6GB 3GXDA 1ADJA 1HYQA 3FYDA 2JFQA 3O3DA 1RKUA 2BLFA 4MV1A 4IJ3C 3LW7A 3P4MB 3ZQUA 1P75A 3OM1A 1M10A 2VDRH 4XIFA 2E9BA 4F1JA 4L51A 1R37A 3ZKXB 3ZHYA 3HZHA 2VHEA 3JROA 1T26A 3JTMA 4HRAA 1CYGA 2PL1A 3ZDXA 5EKXA 4LO9A 4NO2A 4UC0A 3LYRA 4PAMA 1EFLA 4Z77A 2WMNB 2CV2A 2G71A 1FDWA 3MR9B 2FJPA 4N2EA 4HLDA 3D8MA 4QI3A 3GK8H 5HYJD 2AK4B 3NDBB 1ZEMA 4MP8A 1YNTF 1WJ3A 1CF4A 2ET6A 1D3AA 4AGNA 3NCWA 3PWPB 2C34A 3Q5GA 2GK0A 2YRZA 3D50A 1ZA1A 4LSRL 4NHCL 4GG6A 3PWNB 4Y67A 3S2EA 1DX6A 3U09A 1QQAA 2NN3C 4U1HA 3GUTA 1ZKDA 1HT6A 3BC1A 5ALUA 1I8TA 3FN9A 1ZHBA 4R4BA 9CGTA 3SJZA 1KELH 3W34A 1BPLB 2MR5A 2ZSWB 2W83A 3PX3A 4NAMA 1AKWA 3FFAA 1ZGCA 2PN1A 2Y0PA 1FI8C 3KL2A 3MS4A 4EVNA 2J87A 1PFCA 4LCCC 5GZNC 5C5DA 5AW0A 3LMKA 4AVIA 2OV6A 4MDHA 1PGUA 1I3MA 1VG9B 1U9CA 3W8RA 4FNSA 3ARDD 4DE5A 4M7LL 1NN5A 3P9WB 3I9OA 1E63A 4NO5A 5F23A 2XQYK 1XUOA 3ZHVA 4LYDA 1L0YA 1GIGL 5I1AA 1ZT7B 4ONEA 2ZAIA 2XWBB 2XUIA 3ETTA 4FCCA 1XCQB 3JQ7B 3KVDD 2AGWA 2E6PA 1QS0B 1STOA 4KO8A 5E8OB 1E9QA 1FZJB 3T5TA 2WI8A 3HHPA 3D0LB 1E7QA 1A3RH 3PVUB 4ABTA 1BF2A 5I1JH 2OXTA 1BXRB 2XSZD 2C2OA 3EO9L 2L7EA 5AOZA 5HIKA 3GMOA 3RD5A 2H85A 2VLKE 2WMYA 3ETHA 1M34B 1Q94A 5AD0A 1CZOA 2R3SA 1CG9B 3K2BA 3PWKA 5TPWB 2CXQA 3QE9Y 2BJHA 1EWYA 2DC1A 1OLSA 4PAWA 5TY0A 3ZYJA 3WK4A 4MA3B 3BEDA 4F6LA 2GK2A 3A67H 2EZTA 1W16A 4R5MA 3IDXH 1Z2NX 1LP9E 1IWBB 1HYRC 3PGXA 2XETA 1XQ6A 4TKVB 4BZWA 3RJOA 2HWKA 4QDJA 5C6PB 5KANI 3E81A 3DA8A 3AR2A 4FQ7A 2IBGA 5HCIA 4R9NA 1K5NB 1VYHC 4DSYA 2I27N 4KU4A 3FT3A 3ORYA 3U0WL 2XBLA 3JWNE 2GM9A 5JIHA 3BOVA 1WBYB 2XA1A 1RLWA 3KVPA 5TQ0A 3ILXA 1MC8A 3GFCA 3ZTCC 2VP6A 4R7GA 2HZHA 4HWBL 3NWBA 1K3UB 4ENSA 4L3GD 4KVNH 5T3XD 3GGDA 3EOBB 5IHZB 2ZKHL 4O02H 1SCBA 4MA0A 4XJXA 3T8XA 3VRJB 1SQGA 2WVAA 1S9XB 1VLMA 1YHNA 5C0BE 4NOKA 2YWFA 4AGLA 1BBDL 1R5NA 3MVEA 2JCCA 3O74A 4YR6B 4A7UA 4V11A 5EZOL 3L0BA 4PLHA 3BPCA 3DHVA 4I3RL 3UAYA 4M36A 4WN9A 2XTAA 3CNQS 1EUDB 3L1KA 3SQRA 2JCSA 1GTMA 3EYVB 2NNXA 4XIGS 5K8CA 3VGJA 1Y1UA 2W9EL 1A2OA 3ML1A 1QD0A 3ICPA 2A4MA 4MRRA 4EDXA 3ZU6A 4MV3A 3VSQA 3O9WD 3VO8A 1IIBA 4ZFFB 4N85A 4NUQA 3OQMA 3BIKB 1W9HA 4YAUA 4FDWA 2I22A 2A1TR 2WJAA 3ZDAA 5IF9A 3JV0A 3K72A 3VXTB 5T1KD 1Q72L 4MNQE 2HTEA 2I2FA 3VFOB 3RBAA 5JZVA 5FPKA 2WLKA 1CFSB 3GHBH 5KOVC 2R00A 1SOWA 1WWAX 3R0MA 1B9ZA 3FNKA 2CNXA 3HV2A 4PPYA 4YQXH 3EI3B 5JISA 2BFNA 5TV2A 2E18A 5DI3A 2X9NA 2GTHA 4X64B 2BP0B 2XG4A 3DXZA 2VAAB 1FAIH 5IWLA 3ZVMA 4H1LH 1G9NC 4M76B 4PW9A 2BBKH 3OGOE 4IAOA 3FUKA 3K4QA 1M42A 5F5NA 2OAEA 2QA5A 1B2WL 1ZT4B 2FPKA 1BOGA 2NR6D 4NP4H 1G1KA 5I8PA 3BAKA 4LAQL 5J3HC 4UVGA 4YJ3A 1QORA 2YVQA 4JY6B 4L3WA 2KKQA 1BIHA 5K9OA 2YNMC 5GSAA 2Z0UA 1PFGA 1CZLA 5BS0A 5FPSA 4IZOA 4QYSA 3NETA 3OG4B 2P5YA 4ISCA 3GKWL 3ARBA 4EUFA 4JREC 4DPRA 5E6SA 3RU7A 4JLBA 5F3RA 1X7YA 2P2LA 5KN5A 4BV3A 2O5EA 1U8KB 4JT2A 1VG0B 4D9EA 2ZULA 1BTOA 1TQBC 4A7QA 4II7A 3HHMA 2GCYA 3PNWA 4UBDC 4I46A 1F2VA 4J3SA 1A9YA 1SXHA 1KNOA 3U60B 1GPOL 1AK2A 3AUTA 5ANRB 4YJ2A 2P5WE 3IP9A 1VLHA 4KQ3H 3DCNA 3MV11 3ZZ1A 3KJXA 4MDRA 1QYGL 1R12A 5EE9A 2AJSH 3O6FA 2OCPA 1EFPA 1IBRA 1ZPUA 4JK0D 1IC6A 4Y2RA 4KK4A 1JJAA 1T3HA 1MI5A 2XWRA 5F1NB 1ODCA 3QTTA 5D1QD 1AZVA 2ZTMA 1YNOA 3S99A 4FKKA 2PUJA 5JHLA 3IBEA 4TVKA 4F72A 3O4FA 1JPSL 2VYND 5KCMA 1RZ3A 3OD1A 3GS4A 5ALWA 1E62A 5ENZA 3GXNA 3EGIA 1MO5A 1PLGL 2DEYX 5CA1A 1Z5LB 4YQFA 3OT5A 3WGOA 2V7BA 3HG1A 5AVSB 3NYQA 4BK5C 3ZWCA 5JATA 3QFDB 1PF3A 3TBYA 1GRVA 4CAGA 2DLHA 4JPSA 4TTDC 3VO1A 5LA6F 4F37F 3DXMC 2XVKA 4NIKB 3VB9A 2QX6A 3MQ2A 4EUPA 4NPJA 1D0SA 1LV7A 3Q8FA 2Y1VA 1JYWA 1W72L 2NTSP 4H16A 1QWSA 1O89A 4ALLA 3B9KA 2V65A 3UZVB 3BBLA 3ZTEA 3URMA 4GKLA 4H35A 2UZIR 4P8RA 3UTZB 2EDMA 3GI8L 4G8EB 4H13C 4DZ8A 1T4CB 1ZDSA 3OCCA 4ZYKB 4DVRH 3WD5H 1T3SA 5FTLA 2VLRD 3NFNA 4ZOAA 2IZZA 4BYMA 5A7EA 4Q0XH 4KO7A 5F2KA 4JL8A 2J0QA 2H6EA 3N2KA 4Y9TA 2QUZA 2VKQA 1S8DB 4QKXB 1XX9C 3DHPA 2WHXA 1OP5H 1AN0A 1WEJL 5J59A 4D96A 3FT1A 1E0JA 3CR3C 1J8RA 3REQB 4UFPA 3OB0K 1E28A 2NXZD 2UZAA 4PTUB 4J3XA 1PNTA 1G7MB 1S2DA 4CDRA 2IY7A 1YKFA 1CGXA 4GI8A 4NR0A 5JIMA 5H82A 1LDPL 1NFRA 4E7OA 3JZDA 2VDPL 5GRUH 2Q0XA 4MITA 3CIOA 1G9XA 4KX9A 2VWEC 1UWGH 3QXDB 1ZCAA 2VSFA 3PJDA 1J8DA 5IF0A 5IMBA 1ZI8A 2WSSD 1UODA 3QB7C 2VCYA 1MLBB 2H26B 1B4RA 2ZUUA 3UA4A 5HJDA 4CF5A 3ARPA 4D9RD 3LZFL 3DOJA 4N4AA 4YUZA 3CU7A 4X84A 2C4UA 5I9QB 2NZ2A 5REQA 5BOSA 1BXUA 5T57A 4YNBA 4P2QE 5LU9A 2R65A 2KMLA 2CJUH 4A2DA 4WBNA 3Q12A 2VLME 1ZUNB 3P9PA 4MK0B 1M2HA 4Y9UA 2IGFL 1CR9H 1J2EA 2WD8A 2J6EH 4BINA 2FQGA 2XZOA 3ZL1A 5D7JC 3EPPA 1R8JA 5KVGL 4FWTA 3IT1A 4AIZB 3VNBA 4QYOB 2RI1A 3VSBA 2DUWA 5FWYB 4S24A 4Y19D 1MFDH 1QTNA 1OL0A 1CTNA 1WXQA 4OJQA 2FX7H 4GG6F 4X9GA 3DI3B 4IG9A 1QTRA 3AFOA 4PRHA 4DCCA 2AL7A 2JB5L 3QNXB 2K4WA 3Q2IA 3X1XA 1YL6A 4I7EA 1NBZA 4P3DA 4IIDA 5SZHB 3OZCA 3MCUA 1NQWA 4FD2A 2PUDA 4K05A 1A1NA 3ZDZE 1RSZA 5K2OA 1A7AA 1DJLA 2YDXA 1DVTA 4OD0A 1C7ZA 5JXEA 1DRWA 2NY3D 2X4SB 1XHLA 1NDMB 3RI5F 1KFAL 5DO2D 2O4UX 1T25A 3K1JA 1NVDA 2RHTA 1MCPH 3JQ8B 4JXJA 3N3EA 1QW9A 1W0WA 4DC0A 2F8SA 4Q19A 1HE2A 1DP4A 4ZI2A 1DXQA 5JH7A 4W8GA 3UKUC 3VI4A 4GAJL 5JZOA 3G2PA 4GQPH 3MAJA 1QZZA 2CHFA 5B2ZA 2NT1A 4E9QA 4M0DA 2HUNA 3UUGA 2OMZA 1VRCA 3HCOA 1DC3A 3NEPX 4KY1L 1A5FH 2J48A 3TE6A 1VPOL 3IR7A 3IMGA 4Z2AA 2RHEA 2IQAA 4NWUL 2ETVA 3ZCRA 1LL1A 3JWNG 1V3JA 4JWKA 1NQXA 2CVPA 4KDWA 1FP2A 1OVZA 4MAFA 3BT2L 1WXIA 5GINE 4PQGA 1XLTC 5F0JB 1N3YA 5M2QA 5FGRA 4POOA 1ZA3A 4HEHA 4S1RH 5DEFB 1RHKA 4MAYC 4LLWA 1Q1BA 1BMTA 4IRXA 1AYRA 4BVGA 2B9EA 4FFYH 1L8AA 3WY1A 4Z7WE 1SXZA 4OP2A 5CIPH 3BN3B 1GCYA 4M0FA 2XX1A 4L4ZA 3CUPB 2W6JD 1KJ2B 1RI2A 3GSQB 1CXHA 4JQVA 3AEKA 3BPOB 3ZJAA 4NSNA 3TUIC 2BFFA 4QTTB 4DTIA 3K2IA 1D6SA 3HY4A 1I1AA 2FUQA 2J9YB 1F2TB 2ZUBA 4EUNA 2MCMA 1RWQA 2ZB4A 3GARA 4P4UA 5T1DL 2WJ3A 3DE4X 4CKYA 2CNZA 4GKZA 4QO1A 3B3BA 1WHTB 2EOAA 2WWOA 5CEZH 2NDGA 1GV0A 2Q3DA 4FFZL 5JD6A 4TN1A 1CUUA 5BNWA 3BE8A 3STLA 3CVVA 3C3JA 1WD8A 3WRWA 1JZIA 3JY6A 4PONA 4M4RB 1X0VA 3ANXA 5A03A 3I12A 4OR1A 3LNCA 5E7JA 4DK5A 4OGFA 4UM9D 2DQMA 3KXDA 1AIFA 4AQ1A 3L45A 5CGQB 4XRCB 2TRCB 1DTUA 4ZSOA 1E4XH 4DGYL 1I31A 1QUFA 1GN9A 1J0XO 4ZPXA 4N1HB 5HFNA 3SDXA 4JM0A 5AB2A 2JCCF 3QNMA 5TT1A 4DUXA 1OC4A 4RA3A 3PKZA 4N68A 1KH3A 2HMTA 2VRCD 4P5RA 3USES 2ZQZA 2RGBA 3RDJA 2VDQB 4EI5A 1KMQA 1QHQA 1DVSA 4N49A 4IXNA 4FYMA 3SX4A 1DFBH 4RX4D 3SY6A 4A2GA 2J4DA 3SGKC 2PH5A 4XOIA 5L0QC 3CZQA 2Q29A 2QN6A 1MEEA 1LEGB 4QPNA 4IGKA 1BDMA 4QXUL 1AKPA 3C8ZA 1KJIA 4KUGA 3V6ZB 1QCYA 3C9NB 4Z5RB 4AEHH 4ZICA 4I8DA 3OJDA 1EE9A 1RP8A 3TO2B 4Z7NE 1RQPA 4YROA 4F4IA 1ZINA 4I3HA 4YDSA 2DQHH 3HDHA 4W5WA 1MGPA 2XMGA 1F4PA 5JXAL 4L1MA 1I5RA 2W92A 3FT9A 3P73B 2FW0A 3FB5A 2A1TS 3HC0A 3BF8A 3C70A 4X6FA 1G7PB 2COUA 3IDAA 5D9SB 1E9RA 4DIFA 4FZEH 1BIFA 2BW5A 3FB7B 3BMQB 4CZ2A 3U3DA 4Y4FA 3WIDA 2F1JA 1YF3A 3RNLA 2B2XA 1LS1A 4OD3H 3U9PL 4NOJA 4E41B 3EZXA 4QOIA 3KCWA 2WK2A 5F89A 4DQAA 2ZBDA 4JFPA 4F6CA 4QTIL 5E00A 4LL1A 1NOFA 1HE5A 5B3JE 2NP7A 4PGGA 3GXOA 2X8BA 4YJ3F 3WP0A 1MJ8H 5FM5O 1POXA 4O4YL 2B1AH 4WWKB 1CDGA 4CMEA 2EKBA 1FPMA 1P9WA 1KAMA 4EI5C 1IGCH 4E15A 3FQ1A 2NU6A 4L29B 3A27A 4PS8A 4C55A 4Q00A 2FQQA 1GN8A 2AEIT 3EXG1 1V8DA 2EKSA 1BF5A 2DT5A 4S04A 1DYZA 1N2EA 5KW9H 4XR8C 3KR3L 4CL2A 5TMPA 5SV4A 4YL4A 1BH2A 3OZ7A 4GKNB 4TKWA 4NZRH 3WMWA 2C5DC 2IYTA 1SKBA 4CY5A 1FMCA 1RLIA 1X7ZB 5DF0A 1KUMA 4PJ8C 5DMIL 4J84A 3HN8A 3HMWL 3K4HA 3HKBB 2E7MA 2PK3A 3BGVA 1I7RB 2PXAA 3RWGB 5HHQA 1Y8RB 5D1ZB 5E6YA 4WW1A 1PWHA 4QYTA 4J78A 4DCOA 2CNDA 1NJ9B 5CW1A 1JWUB 1DDTA 3PK0A 4LF6B 1NSTA 3C2SA 4IIQC 2P68A 3NGBC 1R18A 5BYKA 1NAMB 4IFBA 2NVBA 4OOEA 3DX7A 3TF7C 3QEQE 1OQAA 3A47A 3AUVA 1O94C 5CA1F 5EVCA 2NYZA 4LJRA 4XWYA 4DANA 3BB3A 1VCIA 1UOOA 1CS0B 2V2WB 3VX1A 2I07A 1H8OA 1B0ZA 1JLHA 5G5DB 4NFLA 2V9TA 5AK4A 4FMFA 4G6ML 3Q88A 1GARA 1N6DA 3AVEA 1IGYA 3AL3A 5TQJA 3MSXA 4YTEA 4MGIR 2OKGA 3NV7A 3RTAA 5K9KA 4F9LA 1YNKH 2NZUG 1N18A 2OMVB 3OC8A 1CQZA 4PLYA 3DZ8A 2VK1A 1FP6A 1SUJA 4X9BA 1VGQA 3I8XA 4LXHA 1ISGA 3N85L 1DELA 1OE2A 3QCVH 4M1CD 1DQJB 3HUEA 1K7FB 3DMYA 2PQ6A 4TRRA 5ISMA 3QIUB 4X5PA 1GZQA 1L4EA 2YOGA 1YRBA 2EYSA 3THRA 3MF4A 1S9VA 3JVEA 3TOXA 3CEPB 3SKNA 2VTEA 1AC5A 2G99A 3UTSE 1TTBA 4N8VB 4CW1A 1QVRA 5EUOA 4ZC8A 1E3EA 2HRGA 3P11L 1LDGA 3GMPA 3DV0A 2KI6A 2Z0BA 2MCAA 1P4UA 3V2AR 1YDWA 2O6HA 4GXNA 4GP7A 3ASYA 2FQXA 2D1YA 4U00A 2XWPA 4GGAA 3DUFA 1SUHA 5B4WA 3W2GA 3CRNA 2JSFA 4HVAA 3TG8A 2H00A 4YPFA 2RQ8A 3KW8A 3MA7A 4QPDA 1T6BX 1YJDH 3OICA 4ME6A 4JJEA 3X1WA 4F11A 4DC1A 4R41A 4EG1A 1DS6A 4WBNF 1A9SA 3X14A 5FI1B 3VUEA 1DAMA 2VDLB 2A9OA 3KKPA 4DJFC 1HL4A 5ID0A 3E18A 3I6KA 1BKDR 2CLKB 1U8OA 1NC2B 4I9HA 3UPUA 2LAGB 2WKPA 4DT2A 3TIEB 4MUJA 2H1IA 3NJVA 2VDNB 3BZWA 2YCLA 1JPGA 3TZEA 2QQEA 3MXOA 4XH9B 1P6FA 5T3XH 1G1CA 1S7GA 4EG7A 3ARFB 2VSNA 3WIVA 3THOA 3L1OH 2G30A 4BQOA 2O8CA 3SE8L 2VXYA 1CHNA 1ZBQA 1B8VA 5TDHB 5E4FA 4F3KA 2H1OA 2IPUG 2WZ0A 3S34H 2BGKA 3O4LA 4ZMYA 2VK4A 3GJXC 2X6MA 5HKAA 4DKEH 4F97A 1PI6A 1QFYA 3OKKB 3BGWA