3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
1MQ9A 1JV2B 3T3MA 2VDLB 4WJKA 2VDPB 3EGXA 5HJ2A 2VDQA 3K72A 4UM8A 2O7NA 2ODPA 2VC2A 4C29A 1U0NA 3VI4A 4Z7NA 4G1EB 2I6SA 2NUTB 4HQNA 3V4PB 2WINI 5KYWB 5E6SB 2XWBF 1MQ8B 3F74A 2I91A 4WK2A 3T3MB 4WJKB 1PD1A 4G1MA 3ZDXA 5FFGA 2VDQB 3K72B 4UM8B 4MMYA 2VC2B 1TYEA 4UM9A 4Z7NB 1U8CA 3ZE1B 3PPWA 2WW8A 5KYYA 1AO3A 3HXOA 4WK2B 1RRKA 1IDOA 4UM9D 3HI6A 4G1MB 3ZDXB 1PCXA 4HQOA 4XW2A 1JEYB 4UM9B 4DMUB 3F78A 2B2XA 3EOAI 1AUQA 3VI3B 2I6QA 1FNSA 1RTKA 3ZDZA 4IXDA 1RS0A 3BQNB 1IJBA 2M32A 4WK4B 4NENB 3EH1A 3K6SA 3N2NA 3ZQKA 1QC5B 2VDKB 1IDN1 1YVRA 5LN1A 1MJNA 5KYUA 3ZE0A 3NIFB 2NUPB 3ZE1A 3T3PA 1ATZA 1XUOA 4WK0B 3ZDZB 3IBSA 1M2OA 4JDUA 1PD0A 3QA3E 5E6RB 3K6SB 4O02A 1JEYA 2ODQA 5ES4B 1JLMA 5KYUB 4Z7OB 3ZE0B 3VI3A 3TXAA 3NIDA 4BJ3A 3T3PB 4A0QA 2P26A 3BN3A 1LFAA 3GXBA 1NA5A 4WK4A 1OAKA 1FE8A 2VDRA 3M6FA 4NENA 4F1JA 1N9ZA 1QC5A 2VDKA 1ZOPA 4HQKA 4O02B 4CNBA 3TCXB 1PT6A 4MMZA 3NIFA 1YVPA 1QCYA 3NIGA 3NIDB 1IJKA 4WK0A 2VDMB 1N3YA 3PPXA 4HQLA 5HDBA 3EG9A 1SHUX 2VDRB 5E6RA 4MMXA 2VDNB 4Z7OA 4MMZB 3ZE2B 1M1XA 1XDGA 3K71A 2IUEA 3FCSA 3FCUB 3NIGB 1L5GA 5KYNA 5HDBB 3EFOA 2X5NA 3EG9B 3HXQA 2XWJI 4WFQA 4MMXB 4CN9A 3EGXB 5FFOA 1M1XB 2ICAA 3K71B 3EH2A 2VDMA 3FCSB 4Z7QA 1BHQ1 1L5GB 3EOBI 4FX5A 5HGJA 1RD4A 3EFOB 3TVYA 3V4VB 2VDOA 3EGDA 4NEHB 2VDNA 4IHKA 1JEQA 3ZE2A 4HQFA 3FCUA 4C2AA 5KYXB 4M76B 4Z7QB 1M1UA 1CQPA 1MF7A 1T0PA 1Q0PA 1CK4A 1UEXC 2ADFA 1M2VB 3ZDYA 1ZONA 4CN8A 3IJEA 4IRZA 5E6UB 1AOXA 1DZIA 2VDOB 1MHPA 1ZOOA 2XGGA 1BHO1 3EGDB 3PPYA 3PPVA 1JEQB 1T6BY 3TW0A 4PN7A 1U0OC 3BQMB 3Q3GE 4JX0A 3VI4B 1V7PC 1SQ0A 4IGIA 3ZDYB 2NUPA 3V4VA 1DGQA 3IJEB 3RAGA 3E2MA 1JV2A 1MQAA 2VDLA 2VDPA 4C2BA 2NVOA 5BV8A 5KYXA 1SHTX 2QTVA 2NUTA 1TYEB 4G1EA 4MMYB 4F1KA 1M10A 1M2VA 3V4PA 5KYWA 1U8CB 5E6SA 5E6UA 1XDDA 5KYYB
chains in the Genus database with same CATH superfamily
2AGYA 4EUFA 4LXGA 4WFGE 3TBFA 1WA5A 2OCAA 4L72A 1JEAA 4PJEA 3BUBA 1D2RA 2QSCH 2YDXA 1JHOA 3MWFA 1DTEA 3CRW1 4LYJA 3GCGA 4AOFA 3KM1A 2WWKO 4F7MA 1NI4A 1N9PA 2VISB 4N5UA 3ZKWB 2OM6A 4QTHB 5I76B 4K9PA 3GEHA 3LK6A 3QPCA 4Q18A 4HS3B 1I8IA 4B4UA 3T3IA 2N7SA 4D8PA 3KNBA 1BS1A 1YO4A 1FFBA 2VP9A 1KQOA 4ZDWA 1MCDA 4LPYA 5E1GA 5F8RC 5D3MA 5HHMB 2WHQA 3NUKA 1SOKA 2IGLA 3E8UH 4DSYA 1JZ5A 3AEUA 3MSPA 1DVYA 1T22B 4MDIA 3AESA 4ZEWA 3ANTA 3IVGA 5H7XA 2VHUA 5LO7A 4D46A 1E4XL 4YL9A 3GZTB 1H5BA 2ZCJA 2A1UA 3UW1A 4HS9A 4LZAA 4B95C 3NU1A 4E41A 3EVDA 4OQEA 1Q1ZA 2FPRA 4MJ6B 2BCGY 2JLUA 5DU7A 1UR5A 2QTZA 5TGZA 2CRMA 3QA3B 5ADHA 4RS3A 3SZKC 3ULUD 3FQRB 1K06A 3IEMA 1BQHA 2R1UA 4W4OA 3V6ZB 3FTSA 1P60A 1SLXA 3JQAA 1DFXA 2BMKA 4PJIF 4JZJB 3GEWB 3V1YA 2JFFA 3OAZH 1BNCA 3Q40A 3QNUA 4EYKA 2C88A 1OW3B 4KK6D 4D44A 3CHSA 4LP4A 4X7TA 5L88L 1FTSA 4IRSB 3BIBX 4O3FA 3RS3A 4NAMA 4HJXA 1EBUA 1L3NA 5CCEA 4W1TA 2WBJB 5KYYB 1QHYA 1NF3A 3PHSA 5DUBB 1F9AA 2XZAH 4JL1A 1T1XB 3D59A 4DFHA 4LY9A 1MREL 2Y1ZA 5CU5A 3QE4A 3UM9A 2PXAA 3D3VD 4DIMA 2JNZA 4ZHQB 2YZMA 4OXKA 4YQFA 5DC0A 2C58A 2VHQA 1RSZA 3ATAA 1HJBC 3Q2IA 4KDTA 3L3KB 2WQZA 1BZ9A 1JHKH 1EUQA 1GT6A 3C3YA 5H83A 2ATKA 2P46B 1KI7A 3TO4B 4QLRA 4BCCA 1GGMA 5DRYA 4M6WA 2WAXA 1H2YA 5I7EA 5JEDA 4C2TA 3R3SA 1GR1A 1SBIA 3I39X 2I7DA 4LDLB 2QV0A 5KTOA 3HB0A 2R0ZL 1E5ZA 5CDGA 2PUDA 2MT9A 3TA3B 3L1HA 3HJ0A 5EZIL 3ORFA 1TTBA 3EJQA 1LO5B 3L5OA 2XXMB 1D2EA 2LR0A 1T7WA 4DA4A 2DFLA 3ZBTA 2HPOA 3O4OC 1BX1A 1YONA 1ZD8A 3D2LA 3UPUA 3NCJH 1WHOA 1CUCA 5TJ9A 3LT0A 1L1QA 3B20A 5GGRB 2ZJFA 3ML1A 2ZS8A 5IKOA 5LB1A 2LTQC 3RU8L 2WVVB 4A6PA 3WNDA 4DS3A 2E7LC 1T5TA 2R65A 1W4CA 2R1VA 1KUMA 4JG5A 3BRWD 3RFRA 1FU4A 3U4BH 3PDOB 3JQCA 1IEBA 1YDEA 3POCA 5EZLB 5FWXA 3HC3L 1A2KC 1J8HE 3IXLA 2C9OA 1N1DA 4HYTA 5MEPA 4QJ3B 5KOHB 1L8LA 5LP6F 1G7JB 3SDXF 2ODPA 4OGZA 1KGUA 3PWJB 2DOKA 1U0NA 2VXUH 4XWKA 1R0ZA 3FLMA 2JHAA 1X94A 4I4TA 2RAMA 5FB8A 2R47A 3KMDA 1VJ0A 3DEFA 4JT9A 4MRBA 2OBLA 3SD7A 3DBSA 3W11C 3OJMB 3KWFA 1ZY9A 1II0A 1UXIA 2P77A 5DNYB 2EL9A 4P05A 1S9VA 4U6XA 4MKMA 3OGOE 3TLRA 4NKMA 4IQFA 3ZHLA 1KZ4A 3P0VH 3ICEA 4Z0XB 3ILVA 3ZZLA 4URWR 2OGUA 3HJFA 3FUFA 3W5UA 4LJ6A 2Q07A 2B08A 5FTJA 1QD0A 1WVGA 5FPQA 1KBBA 3GSQA 2G4CA 3CU1A 4NZYA 2G0NA 2IXFA 5IT4A 4RF3A 3OHMB 1NLZA 3JVUA 3GSNH 2VXVH 2E9SA 3NIGA 2QL5A 1E9PA 1CJBA 1JZ8A 3F12A 4CBVA 1NXXA 1M74A 2WINB 4OF4A 3RGVB 4M61A 5IB1A 2X5NA 4XWGH 3HB9A 5CG1A 2AN4A 1XR9A 4K3JH 5FGBA 2YWBA 1WB4A 4UB0H 5JORB 4JPIB 5LXTB 4ZVRA 3AETA 5DDHA 1D7FA 3A4MA 2QX7A 3U3XA 1WP6A 4OTXH 1P2VA 3PUYA 1KSFX 4M9QA 1LDYA 3VI4B 3RS0A 3WTYA 4JR0A 1XQ1A 4QRIA 4P5MA 3IHTA 1EUTA 4OCYH 5TJHA 2K70A 1Y5RA 4FW8A 3WSVA 1XMWA 1XCQB 3A27A 3F85A 3T65A 2QQGA 3A9UA 1ZIXA 1T1RA 1K3UB 3RDTD 4J29A 2NP7A 2ZUDA 4JOCA 1I4EB 3FBKA 4BFJA 5MENB 1WW2A 2B5MA 3U0PA 3WLBA 2BNQB 2B30A 4X1OA 2VK8A 2H65A 3CC8A 5DGTA 4UNTA 3ZX5A 2W6OA 4P33A 3P9YA 1HWYA 3O1LA 4HNAB 4I1SA 1JXOA 3WVNA 4GW1A 3LVQE 1PCSA 2WLSA 2X4RA 2M32A 4WK4B 4O8CA 2ZR7A 4BFWA 5KVVA 4X8OA 3UBHA 1ZA1A 1U7OA 1KDPA 4KKNA 3WHXA 3BZ4B 5KHOC 4R7NA 3U9UB 3C74A 3HYSA 2A8YA 3VC1A 3V0WH 5FJJA 4HZLA 5EUOE 3SHQA 1T0OA 2NP6A 2H57A 3MXWH 1HYGA 3RLFA 4X6BA 3M5CA 1J1ZA 3HZYA 4D42A 5AZEL 1SDYA 4UJ5A 1MCCA 3AP3A 1JWUB 1X3LA 3TZKA 4TZKA 1LDBA 3UANA 4KXDA 2M2IA 5EMMB 3OWEA 1XZ0B 1N2IA 2ADYA 1DIBA 1SUPA 4R1OA 1U21A 1K2DA 3MRPA 1SOVA 3L43A 3TVYA 1D7CA 1XAHA 1Q7TA 3AS3A 5EOCJ 3M9LA 4P2OC 4E3WA 4YI5A 5AD1A 3RIKA 2FWOA 4WPGA 1MXGA 5DMGC 3MZLA 1V3JA 3ONFA 1SM3L 3RUFA 3GVXA 1I3GL 5IGXL 3OAAA 3G2OA 1ZNZA 1RP1A 4ZS7L 1T6XA 4XXDB 2KS0A 4GDMA 2SKCA 5TPZA 2B1AH 3U37A 3ODGA 3WE1A 3BFKA 1E4KA 5IBTL 3GNLA 4J0GA 4XYLA 3U7QA 4UREA 4UBJA 5K3AA 4RPHA 4CQMD 1V3VA 3QVAA 2JQAA 2JLXA 1RWQA 5CLFA 2RI0A 4YFVA 4L8CB 5ITBH 2A1WH 3RSCA 5HGAA 2X9XA 1YBVA 3ROLB 3JRWA 3DLIA 3A6ZA 2VLIA 1LWNA 5KOIA 5DK6A 3EEYA 3VU0A 4NICA 4HC1H 1V48A 4HEA1 5EORL 3QWAA 2HKMA 4TV8B 4J1TC 4UOEA 4DK5A 1XPOA 2B4AA 5F72S 3OJFA 2XCRB 2C7QA 1F8TL 1CUBA 4XNXL 3QEKA 2D4DA 2GMWA 1RZVA 3UPTA 2BYTA 3OU6A 2E46A 2PX0A 4U2GA 3RZWA 3RSEC 4YHIB 3LMJL 2RH4A 1JU4A 1WZUA 4L4TD 4P3CH 4NE2A 1YHPA 1FDVA 1FRNA 3N0VA 1N3YA 1CD0A 3CVVA 4O3MA 3C6LA 4X20A 3PGFH 5I7UA 2YRZA 2EZTA 1LJ8A 3O6FB 4IWXA 4UUOA 3QE5A 4NBTA 5I7FA 4UQDA 1K32A 2R00C 4AJYV 3ABMB 4N5LA 3PUUA 4KRNA 1AZSC 4MUJA 3KSAC 1M5RA 4QUIA 4G6FD 3B12A 1O58A 4HALA 5FHRA 5BUAA 4KDVA 3K70C 3CLFL 2K45A 2JLWA 4PBXA 1PWZA 3KXDA 4PSPA 2Z1PA 3N6XA 4FXOA 3MCWA 2YC1A 5KTNA 1W0VA 1EUDB 2ISDA 3C7TA 2EERA 2J1ZA 1R24A 2AJZB 4K3ID 2IYAA 4K3UA 1YYMH 3WN6A 4R97B 1DUIA 2APJA 1OGIA 3SJVA 3EI3A 3SAJA 1ZCAA 5IARA 3WLKX 3HTLX 2J2ZA 2Y1OA 4O2WA 4XUDA 3GUHA 2BVPA 4TVPH 3L0DA 3FO0L 3C9NA 5A2JH 4WK2B 5ALZA 2FETA 4CL8A 3C43A 1RIVL 1MCOH 4X7BA 1G9MC 3U4CA 3TQFA 4KIJA 3D08A 2LD4A 4XGRA 1BEXA 4CGTA 3T95A 3DMTA 4DSZA 3WZ2A 1DU4A 2VRAA 2EBHX 4BZWA 2RHOA 4O1IA 1FZKB 4WGVB 3RBAA 5EEWA 5M29A 3VD0A 1ED3A 2WLHA 5B1CA 3Q43A 4J77A 3V55A 3MINA 4KR0A 43C9A 2A5JA 4F4HA 1CDGA 3OM1A 5B1HA 5FV2A 5I1LA 3FOWA 5JYLA 1HG0A 3BH9A 5JT1A 2IOQA 3MCLL 4FA5D 5T64A 4IRZH 3WCYA 5IUSA 3VXSE 2GK4A 5HVNA 3UBFA 1OKKA 1QV6A 4M9CA 1K8XB 1CICC 1R8SA 2P43B 3QWOB 4EX7A 1ZH2A 2ZKXA 4MV3A 2NY3D 5HHXH 2GTWB 4B3SB 4QQEA 1TF7A 5IW3A 4RIGA 3UK2A 3ESMA 2WJVA 1TJNA 3E9CA 3MWYW 4F9LC 5CZRA 4L5BA 3CRVA 3HBZA 1IOLA 2RJ3A 3M17A 3O6VA 2ZJ7A 2OCKA 1CE1H 2A0KA 1FZMA 1AGNA 3VRIA 4A9AA 4PJCE 3C5JA 4X4YA 2FW8A 5LOVA 1GU0A 1ZT4B 3ZBQA 1PV2A 1BQHG 4DVRL 2IDMA 5T5NF 4CUKA 3MFGB 3OJOA 5TPWA 5FWAA 4RPLA 5F3DA 3FFDA 4B7LA 4OZUA 3KAQA 2V59A 2IEDA 4ONGL 2FX2A 1LI7A 1KIPA 4MQSB 1U8XX 2JXMB 3PG5A 3FB8A 3UJ3X 3ZLUA 1JE1A 4OGXH 3KCWA 4IHOB 4P57B 1SGKA 3E35A 3GEMA 1M2OB 5IV2A 5DZNA 5G1PA 4O8ZA 1FNGA 1OLZA 1IRAY 1NNLA 2B9VA 1GXEA 3EG9A 3HN5A 2LNDA 2VLKB 4UJ3A 2A6KA 3CZAA 1PJLA 2CZCA 4PYJA 4A7GF 4IIJA 1LTHR 3CXFA 3ZUNC 1PWHA 2G3XA 3OPXA 2ORBH 3NPMA 1OF0A 1DCKA 2R5NA 3X1KA 4LLWB 2AH5A 3P9NA 4B96A 4R5HA 4JHNA 1O6SA 4LF3A 5I6XB 2WT9A 4LZOA 4NJMB 4GPTA 1C9JA 4AQEA 1LLUA 3FO9A 1A96A 3D18A 3K5HA 1C7TA 4X6YA 3KQSA 2PD4A 2AXGA 1QNFA 1PJWA 2HXSA 3W77A 1QW9A 5DJDA 4OA5A 1JF5A 4TX1A 2P45B 2BSBA 4KQ1A 3FYIB 1F0KA 2O9JA 2D7DA 3GK8L 2IWKA 1T2NA 3LEXA 2VSDA 5JW4M 2B78A 3WTXA 1DEEB 2Y36H 5JC8A 2G67A 1ITCA 1HCVA 4A08A 4L5FH 2H31A 1QR1B 5CXUA 1NVBA 3SCMD 4V38A 5JCZA 1YJ8A 3KYOB 5JATA 1EVJA 3SBXA 4PC0A 1JUFB 5CN3A 3CX8A 4AK9A 4G5AA 3SHVA 2I60L 5CXCB 3ILPB 1X7WA 2V7NB 2EIBA 1NIBA 2IAMC 3GXDA 1QB7A 4NQCA 1HZZC 3KZMA 4NQEB 3LKZA 4DP8X 1XZEA 1XROA 5KSAC 4XVOA 1EGAA 2PMFA 3PHAA 2XV1A 5EZJA 2YV1A 5LG1A 2Z83A 4POZC 4KGZA 4REOA 1OZUA 3WEBA 1VPTA 1NM9A 2R6AA 3KKZA 1LBTA 2DS4A 3QRWA 4JFRA 3SE8H 5K3FA 1IIBA 5BYJA 3T7SA 5D1NA 4HVLA 3WX0A 4GMFA 3T3GA 4CR8A 4C1BA 3TZVD 4WNYA 2BSAA 1N6FA 4Y9CA 3IEXA 2DEYX 1TTFA 1JB1A 1OBFO 1BEYL 2J56H 3US9A 4DZBA 4LMAA 1EZZA 4AL4A 2WN2A 1N12A 4PY8I 1KE1A 3BXZA 4HUMB 4Y2OA 5BMOA 4P7KA 2NLJB 2BE9A 3TNYA 4F7TA 2ZX8A 4WFFD 4TQHA 4ICXA 4EF5A 2GD0A 3TBKA 3EBOA 1IFHH 1UA6L 3U1PA 2CKMA 4NYLB 4O1QD 4X6CB 3LXMA 1E0SA 2OBBA 2QV2A 2QE6A 2W81C 3ZKQD 4YAEA 3V8PA 4NZRL 4OGKA 2B5IB 3EEQA 3F6RA 4RBNA 2VHCA 4C3ZA 4EBFA 4KG7A 4G43B 3GHPA 4TUJA 1EEUA 4FNGA 2R2CA 4OFXA 2AK4A 3TLGB 2WIMA 3EULA 5FXCH 3DV4B 5JAUA 4M8IA 1GQ2A 2ZOTA 1W48A 1NH6A 5CNHA 3VE0A 4QUKA 5EMKB 2JC3A 1RURL 4G9DA 4QWWA 1A7RH 2YWZA 4MS8D 5IJAA 2VR3A 2XEDA 1WBJB 4P36A 4P53A 4UZFA 1MIHA 2H26B 2PXXA 3ATEA 4FG2A 3CFBB 5ES4B 4TNEA 1MNUH 5BVGB 4FDVA 3CA8A 1BZEA 3RLSA 3ZHVA 2DUWA 5KDLA 1U3HB 1KDTA 4B8YA 3IJHB 4P1ZA 4PFJA 3DL4A 1DJHA 4PS3A 2O26U 4MJJA 5AXAA 5JD3A 2A0YA 4U7WA 2W2PA 4B6SA 5JW4R 4R05A 4G3YH 1RZGA 4U6NA 1D5IH 4HD8A 1V7CA 2DFVA 4N1CA 5CU9A 1Z2PX 2V9RA 1UOWA 2Q28A 4RORA 3FDZB 3S97C 2QT9A 3R7AA 1EJBA 4R2GD 1WF6A 3O8OA 2YQ4A 4ALAC 3K0YA 1RZIA 2Y1DA 3C60D 3QIBD 2IKQA 1KCWA 1Z32X 3EHBB 1OWNA 4KO5A 2VJYA 1WITA 2CBGA 5BNIA 4DY6A 5M5TA 2VZLA 3C6ZA 4C0LA 4PV7A 1NJ6A 2FR1A 3TZ6A 3OB0K 2O7NA 2O5CA 3L4EA 4RGQA 1AF7A 3I3OA 1F4WL 4WQOA 1J00A 1ABBA 3PLRA 4YRJA 1A7QH 1SBYA 1YQDA 3QF7A 1TQUA 1N8SA 3BAYA 5AW7A 3BXXA 2I0FA 2D0IA 2Q9OA 2W6JA 4FFWD 1MAWA 4RF5A 3CH7A 2X14A 2P9RA 1QYGH 3I62A 4ZUVB 4Y9SA 4NZUL 1DXOA 3DX1A 4ZV9A 1IGJA 4JFFD 4WK0B 4PY2A 1Q92A 3VPAA 3V4UL 4JFQA 3AKZA 3OPYB 3TQRA 4H16A 4JHUA 4WU7B 3WFDL 3I9PA 1M34E 2CCJA 3G2JA 4JDEA 4M55A 3W1WA 4PP1C 1VMDA 2ZRNA 1IVTA 2MKWA 3EASA 4FZ3A 2XUPA 4BQEA 3R9WA 2BISA 3P0HA 1F58H 5CVJA 3KGUA 4DK3A 4PPNA 1R1DA 5L95A 1XL4A 1CUDA 3VYVA 3JD4A 4M93C 4EI8A 1L4UA 4L4UA 4CKBA 5GGTH 2G36A 4OGFA 2FR8A 4LRNL 4FEMA 1GUBA 3SPXA 1ECJA 4BU0A 4LNRB 3DBHB 2VLLA 1MCNA 3BH6A 3AXHA 4XPTL 1XL0A 1NCWL 1CK4A 1IHUA 1EFRD 3GP5A 3W6UA 2WP8J 4PYKA 5BY2A 4ZP1A 3LEVL 3QA9A 4GICA 4EOWH 4G0MA 3K5IA 5EUQB 3RJMA 1YMME 1ZOLA 3IN2A 3NJRA 4Q4AA 4TV8F 3CJRA 2GJSA 2CUZA 2QRVA 2AMYA 2WKLA 4JANB 4AEHL 3WGQA 2PW1B 2ID7A 2P3OA 3ILSA 5AZUA 2V8OA 1F0NA 4QOHA 1YN6A 3JV0A 5DZ9A 3VG0H 3IAUA 3A9TA 4HZGA 2XXAA 1CRLA 3WXVL 4LY0A 3QNYA 1E58A 1FNSL 3JZMA 4RMRA 1NFAA 1RHHB 3VXSA 1F8YA 4ZI7A 3F4LA 4PGCB 5IJ0B 2D7MA 5DJAB 4B8WA 4NRYB 3M1BA 2OAGA 3KFLA 4DMUB 3I6QA 3IDNB 4YDLC 2QM7A 5IGQA 3OR7B 5TQ2B 2H5JA 3U81A 2V5TA 2G06A 3KVVA 1J6UA 5T3ZL 4K5LA 4HWRA 2XDAA 2JAWA 4O25A 2NPLX 3SGEI 4BFEA 2G80A 4YHYB 4LLQB 3L41A 4IKJA 4UPVA 5KKCA 2CVZA 1E2KA 3D3QA 2A38A 3WRYA 2P5EE 5TF0A 4KXNA 5KSPA 1Y7LA 3AQIA 5HDQH 1U3GA 3A28A 1SEQH 1U30A 3M45A 4LSUL 4XPBL 2F19H 4X1YA 4G4SP 3M88A 5DJ0A 4GBXB 5BS0E 5CMAB 4IO0A 4GYJA 2VT3A 3LPNA 2EAUA 1P5FA 4BEVA 2E7HA 4IV5A 2VTDA 2O2GA 4H59A 1JZ4A 1Z6QA 1RZRA 4TVKA 4D0CA 2BSXA 1H3TA 2FSFA 2X5KO 1Y3IA 5FA5A 1YDPA 4HJEA 1CD5A 1B9KA 4KPFC 1X1DA 4MW6A 1A4UA 3JD3A 2AI0L 3W2TA 4NPYB 1XZKA 1L1EA 2IJ0C 3QR0A 2R60A 5IHZB 3LS5H 4HHWA 3B9KC 1HOCA 1TQBC 1DSFL 2P9SC 1SVKA 1AKJB 2VK2A 3S96A 5T57A 4YRMA 1TZJA 3QO1A 2HHLA 4F1KA 4QU8A 1R16A 1F13A 1SLWA 2XODA 1LSJA 1KCKA 4FQ1L 2FCRA 1UD6A 3CZ4A 4LEOA 3ADPA 2WP0A 1E7SA 4JSRA 3THXA 2BBOA 2R8SH 1T8TA 1KZ6A 1V6AA 2GEJA 3DKVA 1ZO8A 2AZXA 3BWUC 4P92A 3KPRD 4F3NA 5IEJA 2CE7A 3GMPA 1M6YA 1HZLA 3HUDA 4C0SA 3ULUC 4TL4A 1BFOB 1P4IH 4G1MB 4IEIA 4WNQA 1JEYB 5FP0A 5DXJA 4P2YA 3DBRB 5HHQA 1NHGA 2BIQA 5F76A 4ZDIA 1U2GC 3SU8A 2IVZA 1DBMH 1S0UA 1H8SA 4R0LC 1N36B 3ESNA 4CKXA 1PSZA 2P7HA 2ODQA 3A6CH 4MW5A 3WK7A 2JIMA 1USIA 2RKBA 5IMLA 2KYRA 1YR9A 3CH8A 3Q6FA 3IE1A 4FBLA 1SJVA 1PR0A 4YBZA 3M6MD 2I6FA 4NBXB 5AT1A 4YO0A 3L9EA 3RSGA 1JLRA 3NT4A 4TL8A 3N85H 3PXGA 3ULVL 2G63A 4FX5A 2BSEA 4TPKA 3BE5A 2JI4A 4YXKL 1NJSA 4W8GA 2ZOLB 4OM7A 4NO0A 3N9IA 5LA6B 1Q44A 3O11A 1X9UA 4I46A 5T1LB 2PYFB 3LN5A 1X1AA 2QAGA 1IHPA 1OXTA 3QFGA 4EUSA 4BRUA 2J3KA 4GBMA 3U6KA 5BZDB 4TF4A 4KMQA 1BZ7A 2ZR9A 4QXGH 1OGJA 1ZUNA 3QCVL 1U2CA 5F9WB 3CEAA 1VECA 1BVNP 1KS9A 2PCYA 4IYJA 5TGBB 2JLBA 1HSBA 5E1IA 1GAEO 5GSRA 2GIMA 1U3ZA 3EUDA 2AB0A 1S7VA 4PRIE 3I2CL 1XA0A 3APFA 3F6YA 4AQZA 4LXTA 2HU8A 4LVNA 3GJ5A 4UU9A 1BYNA 3I2YX 3C3JA 3W56A 2WILA 2ZXBA 2YPLD 3VFVB 4CADB 1PY9A 4WI5A 5I48A 3MS7A 4EXPX 4WA8A 1U63A 3V52L 1AA9A 4D9BA 5JDSA 4JJZA 1KGJA 1G8HA 3FCGA 4TNWF 5A62A 5ETUA 5DT1L 3OAUL 3DZIA 3WFBL 1M7IA 3LD8B 1UACH 2ROXA 2JLYA 3DTXB 2UUPA 1RK0A 2OXHA 1T4KA 3DSMA 3CCHA 4KROB 1VOTA 4P3OA 3ZTDC 2BR5A 3DROA 4ETMA 2WZQA 1EXVA 3USZA 3QJOA 1IBKB 2JIZA 4P4KD 3TBTB 2XWSA 4G9BA 1O3YA 2ZUBA 3X1ZA 3HTXA 2VBGA 3FAKA 5LR6A 5IVXE 4KNWA 1MG2C 1SYSA 4GNRA 5GWXA 4ZAFA 2KQUA 4DG8A 5MF6A 2KBGA 3SD5A 4ZO9A 3IKLA 4GOOD 4L2IA 1F41A 4JN6B 1YDMA 1U8PA 1MCHA 3PV6B 3QNFA 1SKUA 3JWNE 3T94A 4OHCA 4RDQF 1IY8A 3OUUA 3SJUA 4KE6A 5ALGA 4X0KB 3I01M 2O5YH 4ATTA 2C4KA 1YL6A 4P8RA 4JFOA 1ZHFA 2QDXA 4EQ6B 4C9BA 4CDRA 3IVRA 1BP3B 4LCVA 2X8LA 1DE4B 1V43A 3ZDXB 5EBLB 5KOJA 1IGCH 4J6RH 5KU1A 4QYTA 4WOKA 4MS1A 2H9GB 1MAJA 3HRZB 4AKEA 1E20A 3IP7A 2IGBA 3MODH 3AB7A 3MRFB 5I9IA 4ZQTA 1I8MA 4RGBA 5C35A 3RWEB 2GF0A 2M6KA 2B2XH 2WNIA 3D06A 2YPKB 4X4KA 2GEKA 4HX5A 1XC7A 1I1FA 4O3TB 1ZLVH 3BCHA 3DB2A 3ETEA 3RF6A 3H16A 3OGCA 1U8JB 4NNPL 1XYYA 4MZIA 3UG5A 4JLAA 3HNTH 3RDTC 3L7FB 3PJSA 4KQCA 1A4AA 1ELOA 3CUTA 3CVCA 5IW6B 4JLJA 5H68A 3AS2A 4KOCA 1NKGA 1T7ZA 3SC2A 1JGDB 1NCGA 3AJ7A 5F7AA 3US0A 4K3DL 4KR6A 3ZCSA 1JEQA 3MGOB 3SO5A 5FLUA 3HBNA 3VFWB 4I13B 3RUAA 1K7CA 5ADOH 1M34A 2NWQA 1TVKB 3O8XC 4IKOA 2VF5X 4U1EI 2VH5H 4Z76A 1IE5A 2IOYA 4GLRH 5E9JA 3FONB 5E2VH 2TMGA 1BF2A 2O59A 4LCYA 4MR8B 4GS5A 4LMRA 3ILYA 4FJ1A 1XTJA 4GH7B 2YN5A 4BZYA 3KV3O 3O2DH 3BQUC 3FYEB 3T3DA 3HS8A 4UTNA 4Y5XC 1EZSA 2P8LB 3HC0A 5L51A 5TIIA 2NYAA 3CFKB 1XZIA 1G0XA 2H16A 2HVJA 4Z6KA 3FCAA 1YLBB 1C3OA 1YMMA 4MJ5A 1M75A 4QAMB 2PKCA 2PCPA 4YK4C 4GGOA 1P6WA 1U8HA 4I5EA 1A3LL 4MR9B 2R7KA 4R1PA 2GASA 1SULA 3QVOA 2NACA 3VMNA 1DBVO 1MW9X 2WT4A 2FFHA 2QIPA 1K6QH 3ZWQA 1CDCA 1RWVA 1UOPA 3BX1A 1WB5A 4GU5A 2F7RA 3ZGHA 2FX5A 3WFEH 2F9MA 3DX8A 5EFZA 3VQTA 2XWRA 2ORWA 1R5OA 3BWZA 1VHTA 4BS9A 4HLUC 5DJYB 1EUCA 3SZMA 3RTAA 3O8LA 2D7QA 1E59A 1MCWM 1E6JL 4MNHB 3E6HA 4M0FA 5JPCA 2DKNA 4Y2PA 3RS9A 2P5EA 2O0KA 1MCQA 1OV8A 1T83C 5IM7B 3QLVA 2VF7A 2WAMA 4TKUA 3O1JC 1E6OL 2QMUA 1H2FA 2JIDA 3RSSA 2YCLA 1X5GA 1PG0A 5CILH 4ICIA 5TH2B 4BRWA 4BMZA 2X1PA 4GIBA 1N6PA 2PF6A 3V7YA 4U1IA 1IC1A 1HYRC 4PZUA 5A4DA 5JS7A 1KJIA 4OZ4B 5I4KA 2GS9A 1P19A 3D6UA 1GTRA 1IN5A 1XAJA 4LHWA 3ASVA 3POHA 4ZYVA 4TMWA 1A1NB 2OPCA 3GLVA 4ZK2A 4LGPB 1CETA 1FFAA 3DS8A 1RUKH 1OHQA 5EMJB 4JFDD 2UU9B 2EL7A 3KU1A 1MJNA 1G6HA 1II9A 1X7QA 4GXUM 1FJHA 2YXLA 2R86A 5YASA 1VJ5A 1DC6A 1OGAB 3HE3A 3HJRA 1DQJB 1EWRA 2RFLA 4R8WH 1RVFL 1V3KA 4RISL 5HPOA 4EG8A 1T91A 1EIWA 1PTZA 3HB3B 1OPGL 4QOKE 3N6YA 2Z91A 1LK5A 5IVNA 3QKRB 2J1YA 3KL5A 4CU7A 3UB2A 3SHTA 1LW7A 1L4MA 4ZQIA 4C56B 4LCIL 1RY7B 3VV2A 1JA1A 3T3EA 1DQLL 4L37A 2ZJSL 5C2VB 3PR3A 2WI8A 3T6QC 1VGKA 2BWIA 1EAPA 5F7WC 2QQ0A 4B3JA 2VTBA 2YAFA 9LDTA 2WD7B 4ZODA 5JSHA 1GUZA 3CBGA 3C3EA 4KWUA 3SGJA 5SY9A 3OLXA 1CXZA 3DCNA 2R4UA 3P3YA 2X0RA 2QN1A 3OHXC 1OX5A 2WLIA 4QRRE 1P7QA 5T1KA 3EOAB 3P19A 3FUMA 4JO3H 4F3TA 3RG1C 1SDAB 2X2FA 5FPYA 2O2CA 3KSUA 5CITA 4QRPB 2I4NA 4DNPA 4LCWE 2CKDA 3A3YB 2Q5IA 4OJAA 1JAHA 1J4AA 3MGBA 2Y27A 2AI3A 2XJ4A 1U7TA 4DJTA 4GAJL 5INCA 5F9MA 3RYFA 2PLAA 1TZIB 3E80A 5EUBA 3W8FA 3QORA 1GAFH 1P5UA 1VL8A 3L7EA 4FLOA 4RD3A 4CWAA 1Z35A 2QNIA 5F52A 2NY3C 4N8PA 4PLVA 2H6KA 4PJAE 3BTOA 3ORRA 2FF7A 3ULSB 5IF0A 3ZE2F 1Q84A 3CVWA 4WAFA 4YBHA 2WA2A 3DSRA 4Y1AE 5ISZD 1B4RA 1TTPB 4L9RA 4DYDA 5F1OA 4PRIA 1IEQA 5D8DA 2MH4A 2H4HA 3PNVA 5J4MA 4GFTB 5EO1A 3A1WA 4KI5F 4C3UA 2DTXA 1RQLA 4NZOA 2JAOA 1I0LA 1QFYA 1VZ3A 4N5EC 1S8OA 4RGMB 2YY6A 1OU4A 1XRLA 4B75A 1YFLA 1E1LA 1EU1A 1OPXA 3SZRA 5ACZA 3ARGB 2MKLC 4EXKA 4GX2A 3IUMA 5LYJB 2HFGH 1RWOA 1G3QA 4FINA 4W9HC 3QI9A 4GL4A 1UMBB 1KO1A 4BJLA 5ANME 2HSDA 3F62A 2EDFA 5FV1L 3RG8A 1DKNA 1MRZA 4NNYB 3D5EA 1X6NA 3VYWA 1MGOA 4CVZB 5J2UF 3MSXA 2PWEA 1BEEA 4XRCB 2XNHA 2VRQA 1B6DA 2B4RO 3WDMA 4N26A 2SODB 2IPTH 1RHRA 4K26A 3F7LA 4L8DA 1DCLA 4XCNB 5AKRA 1ISSA 1C0LA 3PHBE 3UBMA 1WDTA 3ARDD 2FPUA 3I2NA 4HAIA 4QOFA 3E0XA 5KDDA 4B6EA 4Y2XA 3ZY6A 1XR8A 5BYKA 1VLZA 2DP4E 2OXGA 4L9AA 4KHPB 1Q50A 3LK7A 1OANA 1N5RA 4I18C 3CGWA 1L5HA 1MTOA 1JCKA 4BJ3A 2AGJL 3TR0A 3LAWA 3FXAA 4U1HA 2B3TA 3FFXA 3OY2A 2ZRQA 4YXLH 3OV6A 4J73A 4P49A 5IT5A 5HJ7A 1I2MB 5FA3A 4Z2AA 4AY0A 4CV1A 3SDCB 4XT1C 4KRMB 3JSAA 1RQXA 1XMPA 2BVUA 4R3SB 1YPZE 5JXWA 1A4BA 3GLTA 2HFKA 3FUHA 4P23C 4P08A 5C09A 3S88L 4QXUH 4BQ6A 3U0TB 2HFEB 2GYWA 5BSFA 2DQFB 1HYBA 2Z65C 1OF1A 2KZ1B 2NNFA 4WTQA 3CLEH 1G4AE 3RL2A 1KBVA 2O2XA 4OQNA 4J76A 3H04A 3KB2A 4Y7RA 2GJ6D 4DY4A 4KXFB 2J6WA 1U6KA 4CEIA 1SY6H 3KZ1E 4PRKA 3FNHA 3CEMA 4R9VA 2R2GA 2QSZA 3I75B 4WO4B 3IDMB 2CEKA 3FVRA 4G5GA 4DYHA 3HFQA 5I6DA 3JWJA 4HV8A 3S37L 2GSDA 1DLFL 4TRJA 3QRFM 2ZZNA 4R7TA 3RQIA 3WKNA 3UP6A 4YACA 5IJ9A 3D05A 3LPGA 2G60H 3I6GB 2WB4A 1F4YH 4L50A 1BXRB 2PZFA 5C3UA 4WI6A 2B69A 3OTTA 1B3RA 3W8DA 3TZVC 4W1RA 1PJ8A 1XKLA 4XNQB 2PL3A 2FG5A 1GSHA 2C07A 3SDAB 4YAIA 3RM3A 1RXVA 5B2FA 2WWOA 3ZTNH 5CIPB 4IBWA 2Z95A 1Q0UA 4P86A 4D79A 5FDWA 4LI3X 2EYTA 2H4JA 1JWSB 2GSWA 2IU3A 1OYVA 1CJCA 3QBEA 1MF2L 2XV2A 4GE3A 4P4NA 5GGVH 2HREA 3DZBA 1JK8B 1PGRB 1P0CA 2AQ8A 2FLRT 1BQEA 4XMPH 1HILA 3CSPA 1KJZA 1Q14A 2FW0A 3G5TA 3WMFA 3HBQA 1I7ZB 4ES0A 1XXHE 4JQOA 4KXXA 3ADBA 3H5IA 4QYXA 3PUCA 3C6SA 3T4PA 3OG4B 4AF6A 1CXKA 3V7NA 4LNAA 4JUIA 1R37A 3F98A 3AFMA 1K8IB 1NOAA 2YBAA 3ZDXF 1NFQA 3CE9A 5EIAA 4N41A 4BE5A 2X8WA 3H1BA 3IERA 1MDAH 5KJ6A 1DSSG 2ZWIA 3DIDA 2IWFA 2ZRMA 3CMOH 3VHXB 4CIAA 3VD5A 4X6DE 1IUKA 3IUPA 1H2XA 5DWUH 1L9RA 5GM1A 2P8JA 1RZJH 2B4EA 3AUUA 5EZYA 1A6TB 3SE9L 2PJZA 4YV7A 3RKDC 2HA3A 5CLIA 5CPFA 3CRQA 2H1IA 4CG3A 2I6GA 5J1AA 3BP5A 5A3VA 1BGXL 1O95A 2PK3A 4MA4A 5TSDA 3V1MA 1M8JA 4ECEA 2YRBA 1GXSA 1Q19A 2FMIA 1Q9OB 2J6CA 4YA6A 4BNGA 3FTWA 2GRAA 4U00A 4QPEA 3N0PB 3HCPA 3FPEA 2JHPA 1FNSA 5DCUA 1ZWIA 3DEIA 5T6BA 5CA0B 2XUQA 2YAHA 1Y07A 4BQFA 3DMRA 3QJSB 4R2GC 3RPKA 4MQTB 1DDGA 1A9QA 4IINA 3SWSD 4UQOA 2IG2H 2VRWA 3UY4A 2BFVH 3JCZA 3D2UD 3QIBC 5A0VA 3QG6B 2IIQA 2VR8A 2WANA 2AS0A 4PZEA 4L02A 5AM3A 2ESVD 1WXQA 1LWRA 4H6XA 1BD2B 2P41A 3BIJA 5TQ0L 2H9AA 1AO7B 2RK6A 3NWPA 4AZTA 3H97A 2HQSA 4G8IB 5IZ4A 1VPDA 1Y1LA 2YWDA 2YZNA 1CFNA 2CFTA 4EMZA 4UE6A 2ZXAA 4JUSA 1MC4A 1E79D 2ZT6A 1QIKA 3KETA 1YVDA 2D7JA 4FFWC 1DT5A 4FI3F 4FG0A 2R0WL 2XPCA 3GJSA 2X7XA 3C5XA 3UPRA 2ARJQ 4QHUB 3VX1A 2AJ3A 1TXKA 3CGTA 4DSAA 5TS3A 5CB8A 4TLKA 1Q0TA 4A1FA 5J06A 1CGXA 5DEJA 4D80A 4QOKA 1RYYA 1E4EA 5HNKA 3PS6A 2AQNA 4I5BB 4MA8H 2HT2D 1B0GA 2NUTB 3MMZA 1IJFA 4BFCA 2VP3A 2YWCA 2Q20A 2Y1AA 2AGWA 4LPKA 3GHEL 1IXRC 3G7UA 3IV9A 3DA8A 3L0ZA 5HYQB 4I1UA 2R7NA 1N6HA 5EPMA 5AQ0A 4C0AC 4B4KA 4G8BA 1W34A 4CF5A 3HZZA 3DVGB 4WERA 3ZIYA 1Q57A 4JY6A 4CV0A 3H84A 2OJEA 3T06B 1BGVA 5HKKA 3BWBA 1MI5D 4XO9A 4TVPD 3SKNA 1C7IA 2VL5B 3DDFA 4Y6PA 3TH2T 1OQOA 2GH1A 5EWJA 2DY2A 1QE0A 3D0KA 1YB7A 3AREA 3MXTA 5C0GA 4F5CE 1QR4A 4QRRA 1QVOA 4WV1B 4EG4A 2IPLA 3L5WB 3KD2A 3SKOA 4ZAKB 2VMEA 3OE7A 4HIQA 2ZOUA 5I73C 2PTHA 5JAOA 1E4HA 2ICCA 2XA2A 4HUTA 4JPWL 4JRXE 1EDEA 1G1CA 4PGGA 4LCWA 1F9EA 5JO9A 3QXVA 1PJCA 2Q4RA 2YIJA 1NGQL 2P9LC 1NM5C 3PXUA 4HAWA 2P8MB 5HZMA 4FYWA 3HS0B 1Z2DA 3VFPA 1DAFA 1TVDA 2DLGA 4K28A 3SDYL 1CZKA 4LNVA 5KYXB 4P5SA 1RXYA 2IW1A 4PJAA 4XYHA 2YA0A 3D69B 4HSQA 2NSQA 3RUGE 4Y2NA 4Y4HD 3EZ7A 1L8XA 1SVZA 4UYQA 4Y1AA 4R5MA 4XVQA 3Q44A 6TAAA 4AB1A 2ZYSA 4E2YA 3BVUA 5J1TC 1ICTA 3R6TA 3F8SA 4HAKA 3FB1A 3IXAA 2OQJB 2VK1A 2PZGA 4MWEA 3EGIA 1N6QL 3PQDA 2AP2A 2GA8A 4GEKA 5AUMB 4XFJA 4EBBA 4P5PA 3DLTA 4ZCQA 2DICA 4L0YA 3VISA 1FH5H 4AI6A 4R9SA 1WX1A 4CVNA 2RMNA 3TTUA 3IU4L 5DZPA 4YC2C 1U8NA 1IKNA 4GLOA 5ANMA 5AVWB 3IAHA 1AU9A 1P7BA 2C9ZA 1S6YA 3URKA 3OMNB 3OJ0A 4BJ1A 1XMQB 1I9GA 5BRPA 5JO0A 3SOTA 1TMCB 1SHUX 1BD4A 1URLA 2ZTSA 3EYOA 4R2JA 3EEFA 1Z37A 2I3SA 2Y3IA 3P97A 1DOAA 3DTTA 2XYGA 3UAWA 2ZE7A 2C5DC 2PR4L 2IWGA 3HVIA 2OSWA 1I7QB 4YEFA 1KH3A 2KM1A 1PDVA 3IB6A 3RKRA 4K6GA 4U4BA 5HHOD 2HXCA 2ONYA 3GT3A 2YINC 2B8EA 4DTGL 1T9GS 3DDWA 4PJIB 2NYVA 3PWNB 5DNAA 2TRHA 4XP1H 3UAGA 2OKGA 4W81A 3HLKA 3PNRB 5K5EA 4WWKA 3QYMA 3TGWA 5LZ8A 3DECA 4W6QA 5CSZB 2DQJH 3Q7RA 4RA0C 2CJUH 4OVUA 1W2GA 3ZE1F 2DE0X 3GFGA 1CICD 3E58A 4JVPA 1JE6A 2FAXA 4X80H 2G5RA 2UYLA 4JLBA 4M1OA 4A0RA 4C7OA 1OL0A 4D0DA 2DQEL 4K7PX 5SYMA 5AI5A 2YQ2A 2POCA 3TZBA 4U6VH 1WD7A 1VJTA 4G1FA 2WKRA 3FF4A 4A23A 4QUDA 3V6MA 1TMYA 4JE4B 4LESA 3UG4A 1ETJA 1S7RA 5IIEB 3LEYH 5B38A 2Y71A 3U62A 3TIDA 4OHKA 3A58B 1AMYA 1CY6A 3LUPA 1YZTA 3QWHA 3QIUB 2R62A 3QVGA 3ZJUA 3NBNA 2R48A 1R9JA 4HWNA 2VAJA 4DWOA 1K6XA 4F8QA 4C0BA 4GI9A 2J08A 1ISPA 3BMCB 2FO4A 1D7AA 4DQ0A 2O5VA 2VJKA 4J3JA 1RBMA 1P9LA 1GILA 5B8CA 3LUDA 4X44A 2JI2A 2J9ZB 3DT8A 4FYMA 3I9OA 5CK5A 1A5AB 3MVDK 3OT4A 4NNPA 2WZ5A 5A3QA 2D6FA 4Z7QA 2Q1YA 1XAGA 4HOXA 2I67A 1MPAL 4H27A 2DQDL 4XNYL 1PJBA 4P4RB 1GVHA 2ZBFA 3RARA 5B5SA 3H5TA 16PKA 1AKVA 2QVKA 3QFJD 3ZJYA 2AGVA 3MNVB 1KLUA 3JWNG 3NFNA 1U92A 4MWTA 5I1DB 3IHWA 5E0QA 4FQHB 4Q00A 4MPTA 5GJSH 4QJ4B 3IDYB 1R3LB 1QP0A 1OYWA 3LPPA 1XCMA 3TLKA 2OV6A 4G1EB 4HXBL 2RG7A 4TSFD 5JR1L 2O5ZL 2XOTA 3VXMB 3VGFA 3QDJD 4LSDA 4BNVA 5LP6B 4ES6A 5HA5A 4CL2A 1XZCA 5GGYA 5C4MA 1KC5L 2WAYA 1DX6A 4CKQA 1LK3L 4P4KC 4IXWA 3PCTA 3PRJA 3C70A 4GKSA 1ET5A 4O02H 3BPCA 4KHXH 2P8PB 1UG9A 1RJZB 4MLIA 5ERWA 4CFYA 4MAMA 4X6DA 2OHJA 3CNHA 4DN3H 2H4WA 4Y1EA 4XNUL 2FK9A 2WWHA 3H9HB 1SJEB 5J59A 5KWJA 5JPIA 3NPAA 3K7EA 3KKMA 3ZHSA 3PVWB 5BR8B 3P9KA 1H2RS 2MYPA 4FP9A 4EY3A 1ZZGA 2G1UA 2EECA 4HFWA 2PTGA 1GRVA 4YQXH 2Q7YA 5FHBL 5FWQA 1MHEB 3MMNA 1XZLA 1O08A 1QRSA 2OKCA 4JXJA 1IJEA 3LC7O 1BG9A 3EAKA 1OLXA 5L4JA 5E56A 3HLAA 5KSAD 2E27H 4N25A 3SYQA 3VO0A 4D2IA 3FWKA 2YUZA 2XN1A 2GK7A 3A2LA 3K1TA 1P2FA 4CMKA 1E7MA 3QVXA 4KKBD 2AVDA 4WVLA 4FKZA 721PA 2PLNA 3UVLA 1HWGB 3EIWA 3DXAB 1T1ZA 3FRUB 3KJGA 4GXTA 2W6PA 4H3KB 1TZKA 1N6EA 4PWZA 3WTCA 3IKCB 1VFBA 4YJKA 4ENUA 3Q2LA 5EJMA 4GMSL 4OLUH 5GS0L 1RBQA 1ZISA 1A9EB 3H55A 3N0XA 2OY0A 2A84A 2DRUA 4LLMB 4JKNA 2WIJA 2PT5A 2R27A 3U2SB 2W2MA 2H08A 4LNHA 3M81A 3ZU3A 4PJBE 3BT7A 3Q3IA 4OF0A 3O41A 2FECL 2NY0D 1P4JA 4Q9CA 3OJEA 3IVMA 3PFWO 4I87A 2WU4A 3PI6A 4TNWK 2OSVA 2OMWB 2VPIA 3J81k 5FYJU 3ONDA 1C7SA 5CFLA 1VADA 5E9NA 4AENA 1RTTA 5EA2A 4AYTA 2GBPA 2WLTA 2WWVD 5AUQA 1BGWA 1JFTA 5CEEA 4AKIA 3Q2WA 4J5VA 5TE7L 1G9SA 4M7PA 3DTYA 4CKWA 4EJ0A 5F4BA 2YZ8A 3PQ6A 2VP4A 3HMWH 3NEPX 3TBBA 4BWWA 1ESMA 3D39E 4AQAA 5DCWA 1XHMA 4I36A 4AN4A 4BEJA 3T2NL 1WBYA 1QWHA 2BOBB 5DRZB 2QUHA 3OWXA 2Q6WB 4WCFA 2BCJQ 1RWBA 2GBLC 1CG9B 2FEXA 2R9VA 4F5CA 3VR4A 1RXCA 1ZA2A 4CKCA 3NBZC 3NP9A 2ERYA 2OFQA 1E64A 2ALAA 1TYZA 3W0LB 5B6PA 5C5CA 4JRXA 5K4HA 1K85A 2UZIH 3TLCA 2DQCL 3R1GH 1EGJL 2XMRA 1W59A 3UJCA 1BXGA 5D00A 5F3BA 4GGAA 2C5LA 5DW3A 2AJSH 4OBBA 1QAWA 5D1XE 1PZFA 4QMEA 3QZPA 2RH9B 2BVQB 3VRHA 1S5HA 4L16A 1G7PA 1ZAGA 1WHTA 1U8OA 1ZAYA 3MAWA 3AZQA 2PH7A 3UH0A 3GUCA 1BWWA 3RUGA 5BW8A 2EKSA 1GRRA 1W5TA 2REOA 1NFIA 1KCRH 2W0KA 2FUCA 3OIFA 4D97A 1SG9A 1GVIA 5KNBA 3K0FB 5EKXA 2EG5A 3U44A 4IQ8A 3X1DA 5GIRA 4WI9A 4YMHA 5G5DB 1PSDA 1X5IA 2VWPA 3VSUA 1ZPDA 4OIFA 2DR3A 4YCLA 4X41A 4WY8A 2YGVA 3SQRA 1HDYA 3Q8BA 3ZYIA 1JN6B 3PWPD 4TLTA 4IGKA 3QUXD 13PKA 3VKHA 2FX7H 3SQNA 3TECE 5FGCB 1XQ4A 1QLEH 5D2NC 4XGNA 1S2EA 4ZYUA 4Q2ZB 2BHTA 5IP4A 1GJIA 2ENJA 3KE8A 1JJFA 1GCYA 2NU6A 5DK4A 4IEFB 4G8GE 2AS5M 1NUTA 4WZBB 2VJ8A 5E1MA 1YR8A 4NQUA 5TVKA 3MC1A 2ARJA 3PLYA 4N2NA 1GITA 4EO9A 4U1MA 2W6NA 1K8KC 1TRHA 3RY6A 2W18A 1CERA 5JQ6L 3QKUA 2GCYB 3G5MA 1G42A 3H4HA 1Z0DA 2VXOA 1DO6A 4HUQA 1QX3A 3RWFB 3QG7H 4ND8B 2V0GA 2IY8A 3HE7B 3MREA 2X9WA 4NYIQ 4NO5B 1M7GA 5AAMA 3DL2A 2H1LA 3GJ8A 5FKQA 2F1BA 3J80g 1D6JA 4GMTH 3WLFA 2FRDA 2X12A 3BWCA 1B76A 4WDIA 3IXTA 4JGUA 1HEHC 3Q9SA 4XP4H 2WQ6A 2CBXA 5JUWA 1M1NA 3SQBB 2IYSA 1PJZA 1QC5A 5I8CB 2WWYA 4LGVA 3HU1A 1Q9KA 3MLXL 4D3SA 4G24A 1ZVSA 1O87A 3L46A 2IUEA 1L5QA 1FXUA 3MRJA 1AHWB 5AL8A 5LLSA 3OMIB 1O6ZA 3M0EA 4A36A 4N0QA 3U60B 4G9FD 3DXMC 4MWFA 4XZUA 3P9MA 3ORVD 5TLSA 3OJLA 4JJ7A 3D54D 3L48A 3P2DA 4EIZC 1NVEA 3VSCA 3C3DA 3BHIA 4KO9A 1NBZB 4K3EH 1W19A 2SCUA 2AEMA 3QG1A 4HHEA 2VPZA 3JD1A 5ULLA 4H7VA 3VJKA 2AFNA 3EF4A 3HJGA 2KH2B 3ELWA 1XU7A 2ZS9A 1W87A 2I2WA 2PWHA 5SZHB 4NHUB 2DAPA 5KINB 5HHME 3B9KD 3FT4A 1MAVA 1RRGA 3B3FA 4M7OA 2E9JA 1C9NA 2GN4A 1YO6A 1JF1B 1QX1A 1XF1A 3VTMA 2PUFA 1E8WA 2GWHA 5CP3H 3GWJA 4MINA 1ZG3A 1DVZA 3B1YA 1RQPA 2IV8A 3P4OB 4KXUA 3SPIA 5CDSA 2XTJB 1NPJA 1J42A 4URXR 1Q90A 5KUTA 4I9WE 3DXXA 4BO9A 4Q93A 3L6UA 2HUNA 4BNJA 2QSTA 3QA3E 3HNVL 4AUNA 4F7CA 4Q4JB 3MV9B 2ESRA 4DP6X 1OAKA 4ZMOA 4R7LA 3OOSA 1KYTA 3WSTA 1XBRA 2GA9A 3IMTA 4EJSB 1DDHA 1NVGA 3FZUD 1YNLL 1TC1A 3D2BA 4F96A 4HN4B 4J4TA 2KLTA 2B6NA 3TNNB 5EXEA 1FL6A 1F2UA 4WN9A 2NZXA 5LBVA 3UYRH 1GLNA 5FDYA 5K39A 2ZKIA 4M9UA 1BA3A 1CC1S 3CVDA 1B4JL 4X7MA 5LQBL 3DUFB 1KARA 3R3JA 5B38G 1Y6MR 3ARDC 5CJQH 2GIXA 3D7PA 3FRPA 3Q8FA 4J82A 1W85A 1WC7B 2KZKA 3STWA 3MWDA 2PRJA 1N5IA 3UA4A 3WFZA 3QLJA 4JCWA 3NJFA 2F5AL 3PQ8A 4K8RB 3AL3A 3PNWA 2QRHA 4PRBA 3MOBH 2G2NA 1KO8A 1E2MA 2RI6A 3DYIA 4CEJA 4RBPH 1TU2A 3GO4A 1IJ9A 3TL6A 1UADA 2KW5A 4GRLA 4PMFA 4TMTA 2V96A 2NN3C 1SWWA 3ZZ1A 1G66A 3W0WD 2R2HA 2IMNA 2H1FA 4Y7DA 2Q7NA 2R5FA 1AO3A 3U13A 5L8LB 2E8ZA 3FTGA 5J6HB 2FWSA 1SQ5A 3HSSA 1LEGB 2XWTA 1BVZA 4Q3LA 2X53A 3Q6NA 1FLNA 2BUBA 4D6PA 1T1YB 1JQBA 4ZTZB 2ZXQA 4DCNA 5I74B 2F62A 4X9HA 1P1RA 2H0RA 1F0YA 3WIHL 1BMDA 4QUHA 1KJ8A 4W6YB 4WACA 4LPWA 1FRQA 4HW6A 5JDIA 4LGSB 4L8WB 4OHWA 4TNVK 1BRTA 2ZSFA 1YB6A 3R4VA 1COZA 3U5TA 1G4UR 4F86A 2B16A 4KQEA 2EIXA 3RWCA 5GRUL 1ONSA 5TQ0A 3CDYA 3AY0A 4KN9S 4ZOEA 2H17A 2GXUA 3W3AA 5AW8A 2GBGA 1SXJA 3MRQA 3I61A 4PGDA 4MHHG 3QP3A 1YY8A 1QHGA 4NM8H 2R0ZH 4E9LA 3TX2A 4PJBA 2VDPL 5D1QB 4AVHA 4FQLL 2ZG3A 1JR3D 4BNUA 5DXFA 1GSOA 2PCJA 1KKLA 2CE6A 3B7YA 5J56B 4Q7EA 1YR7A 4TUOA 5CBAB 1C7FA 2A7XA 4BKTC 4JBIA 4NC1C 1W88B 4Q3OA 3ZIDA 5GMKn 4DILA 2VO1A 1R5IA 5DM0A 4JT5C 1JKFA 5KTMA 2D2VA 3DUUA 1U90A 3BJZA 1CF8H 2MCG1 1JHTA 4RVGA 3PI7A 4N3GA 2BZSA 3PF8A 2W58A 2W07B 3HC3H 1M3SA 3DTNA 5JMTA 5IB4B 5FO7B 1B0WA 4I6JA 2ECQA 2R8YA 4X5WA 2J0UA 1ZP6A 2XITA 2WFLB 3NBXX 3C9CA 2AIRA 3ZVMA 3LZOA 2NXCA 4FN0A 4KBYA 4KNTA 3HFGA 3P73B 1CU4L 5BOSB 2MU1A 4WESB 5GAJA 5E8NB 1TQ8A 5C7XL 4MV8A 2V33A 3OZUA 1N9GA 3MJEA 5KSVA 4FEYA 3KWUA 2G9ZA 5D1XA 4J12A 5MHSD 3DLAA 2JJSC 2UZYA 5IHHA 2IYEA 3ATFA 1P6FA 4LBEB 3MRMB 3VI4E 2D00A 4NN7B 4BU1A 3H9SD 1GRQA 1GS6X 4RTRA 5TE6L 3ZX1A 1NEXB 4WL0A 4IMRA 3QUYC 3ICWA 4GSXA 3ET4A 3AUJB 5T33L 1Y80A 3O9WA 2XYBA 3JROA 2I87A 3VNQA 1RZQA 1G0YR 2GFBB 5MENE 3TD9A 3E9QA 3TG8A 4DB2A 3E9NA 2BNQE 1LTXA 4TPRL 3WN5B 1PEWA 5C2WB 3KV1A 4B3HA 3Q5GA 3GPBA 2PPVA 3H1AA 3VHRA 2OA9A 1KNOA 1AKRA 2O8BB 1XIWB 4ARZB 3PWTA 3P30L 2WZBA 5JHDD 5CDFE 5FI1B 3O8XD 4J94A 3STXA 1YEHL 4FTVD 1YHNA 1PW7A 1C1EH 2B59A 3U46A 5D1ZB 1SD1A 5GRYA 1IM9B 2CE9A 1ONQB 1KV7A 3U9PL 2QQNH 4G8GA 2V7HA 3QG5A 3SQLA 2WAHA 4QHSA 3KPTA 3BQUD 2Q86B 5HYJD 2GI7A 3C45A 3L0IB 5ICYB 3AEKB 1JLMA 1M8FA 4TKZA 4KTEL 2QVTA 3A22A 3E9MA 3ZWLB 4KNVA 2WSBA 4HWOA 5DP2A 2C92A 5GPBA 1BW9A 3OQMA 5HGXA 1SEVA 1M6WA 3QR2A 2HT2C 4JZOB 4L3CB 4XLTA 5CM8B 3QNWA 3KVQA 4XBPA 2WOJA 3O92A 1Z7EA 1OB2A 3FCTA 1ZRNA 4E9TA 2ALWA 3STTA 1HYQA 3I2IA 3DGGA 1QOZA 1HTTA 3LP5A 3UFBA 2LABA 4TMXA 2MNUA 2JZCA 4YPJA 2AKYA 1OD6A 5D70L 1NY5A 1WWAX 2VIIA 3SY0A 4OWRA 3PPYA 4DVBB 2V2XA 2JIXA 2ZZMA 4F8OA 2POQX 4WH0A 4OUDA 3BEDA 3OZXA 3QJQB 1ADGA 5JLZA 3RNKB 4KTYA 1SPXA 3SDDB 5JCPA 1YQ2A 4O1MA 1IAKB 2ZG6A 4GRIA 4OL0A 2VJBA 4L3OA 4ITUA 4MV7A 3DDHA 4F3CA 4JKOA 1AANA 4EUPA 1LEKB 2YSSB 5L0QC 5LMNB 1JPJA 2WV9A 1U8KB 1S8AA 3E7XA 3TS1A 3UV7A 1MX3A 2PSEA 2VN4A 3FF7A 2PL9A 3DJTA 5B1JA 2AYZA 2YZ1A 3ZXSA 1KXJA 3T7CA 1E69A 4L8GA 1UWYA 1SM3H 3AU1A 1ZNYA 1I3GH 3OKTA 5IGXH 4TVSa 3EIXA 3EYQD 3HCDA 4KVPA 2Z2OA 4ZS7H 3KHQA 2VISA 1BM3H 2BHSA 4QTHA 5I76A 1UBHS 3OZDA 3CMGA 4HS3A 3GGWB 2BZGA 1B0PA 1DFBH 4UT6L 4Y4HC 3UZEA 3S8WA 3IKMB 4F38A 2ATVA 1EB9A 4RLHA 1BDMA 4LAJH 3N7UA 1SOQA 2RONA 3DMDA 4UEQA 3QEQB 5EO9B 3AF5A 5ALTA 4H35A 4Q58C 5EORH 1WPQA 4RMIA 5ERXA 5IMMA 4B9CA 3HL4A 5KG9A 3UKRC 4EVNA 4IOLA 3UZVB 4MNTA 2WNGA 3LMJH 2BFMA 2YFHA 1A9RA 1JR6A 4CGUB 1U9IA 1IX2A 3CFCL 2MCAA 4QYIA 4BNMA 3ECAA 4KNQA 3CFVA 1T0PA 4W82A 4YMUA 3JQPA 5F3WB 4RTOA 4KXAA 3KJNA 4CCWA 3QJRB 2L69A 5F89A 4FHEA 4C76A 3E7DA 1RIUH 4UUQA 2OJYA 2FX8H 4ZVLA 2WHPA 3HYCA 3SOPA 1PNRA 4ZICA 1AH2A 4D7BA 2VF4X 4J23A 1IE4A 2PUWA 5ALJA 5ECDA 3V0HA 1NRIA 5BXFB 1U2DA 3NDRA 3RC1A 4IRSA 4B7XA 3A3OA 2CD9A 5KYYA 2C4FT 5DULA 1PLLA 5DUBA 3ESAA 1XMVA 4YDIL 1UQSB 2IEZA 4C30A 3FHTA 2F1EA 1JP5A 2C7PA 3OKKA 1CY4A 3ZT5A 4Y6QA 1GG8A 2X15A 4AYFA 4PQFA 3PP4H 5AVTB 2D1QA 4MS3B 3WL4A 2EFCB 4GOJA 3WOVA 6FABH 1XA3A 2JAUA 2GM9A 5I6PA 2AXFA 3BQVA 3CZ5A 2QKIA 4NV0A 1A9OA 2HWXA 4FDLA 4B31A 4DWHA 5DRWA 3TO4A 3UPDA 4J4PA 3L7KA 1Z8FA 2W5UA 4GJTB 2OK6A 1CXFA 2H2PC 2C9YA 1RLTA 3LSOA 2FWMX 4CMAA 3TR5A 4MKTA 1B9XA 2A6DA 3WNKA 1SURA 5BT8A 1NDQA 4R4JA 4W9ZA 4MX8A 2JI1A 5GM2A 1LO5A 1HI9A 4QRDA 4HDKB 3JSXA 2DIAA 3LIZH 3WJLC 3FAXA 4YLBA 4JI6B 3DCYA 4XARA 3V8NA 5I47A 6CGTA 2DTDA 3H0TB 4E1AA 2IS4A 3EI4B 1SVBA 5GGRA 4URFA 1IBGH 3MCLH 3JZNA 2WVVA 3LUJA 4A82A 4NXSA 5BO1H 4G41A 4FMPA 2BW0A 4L4VD 4N5ED 3KPLA 4N4YB 3TE7A 4ZU6X 1A65A 3LOPA 1Y0BA 1U31A 3M6DA 2RGDA 1J8HA 3RTQB 3T1TA 2XIIA 3A6EA 3OM3B 3D8SA 3LECA 5EOQL 3NONA 4LSTL 1DMRA 1Z5OA 3AG3B 2JLSA 5ECYA 2R2AA 4A73A 1AGEA 4YP7A 2WSYB 3GNSA 3RVWD 4JNCA 1X8XA 4MJXA 4PM1A 5KOHA 4QJ5B 2Z5FA 3OZAA 1G7JA 1ESZA 3DUSB 2IEYA 3FRPG 4PQYA 3T1HB 3RVLA 1T6VN 1AUQA 3F7RA 4EMTA 2J4FA 4EVIA 3O6ML 3C7KA 3GT7A 5FI3A 4MK4A 2JS7A 3TNMA 4KFRA 3HB5X 4CKYA 3UXMA 4MA5A 2O3QA 4TZTA 4DVRH 5EZ5A 3FOAA 1Z5LA 3T9CA 3WK5A 3WQHA 4MB5A 1JMXA 1SLUA 2XRMA 1PNVA 3MBIA 3GWZA 4Z0XA 2R23A 5HE1B 4CMEC 2ZUWA 2ZNXA 2VHYA 1T5LA 3RFFA 2JKTM 3K0WA 3KRTA 1JRHL 4DT2A 2RGAA 4I3RL 2QMOA 2H13A 4CNIB 3ZOKA 2F08A 1SUIA 2F67A 4OP1A 1HFUA 1NKSA 4FAAB 2XHNA 5CSBA 1UJNA 3RDPA 3I6KA 3QUQA 2BXZA 2WINA 1EFTA 4GHWA 4CHGA 1CN4A 3ADOA 3NOOA 4BUJA 4APQD 3P5SA 2VLBA 5LXTA 4P23D 1T0JB 2XA8H 3LPFA 4Z9XA 3RC9A 2YFQA 2Q3ZA 5E08H 2A4MA 4Z8FL 2BC4B 1R5MA 3VI4A 2MINA 5JASA 2Y6UA 2R85A 5DYNA 1P17A 2XCSB 4ESOA 3F3KA 2HKHL 2ENSA 1EGJA 2W2KB 3CINA 1P1ZB 3NIFF 2H14A 2OWEA 3EK2A 3APMA 5EF1A 3UWKA 3I9LA 1VERA 3UGEA 3QU5A 3GROA 4WECA 2BNQA 4KKBC 2QPEB 1OAAA 3DDSA 1KFEB 5IR1A 3VYNA 2PX3A 2I66A 1U3DA 5HE8A 4WK4A 5I7RA 5B30A 2ZIVB 4HAGA 4C05A 4PUBH 1XEAA 3GO1H 4I08A 3FZYA 5CDFA 2VJPA 3MV8D 4HQLA 1JXKA 5BV0A 4ZAXA 2FI1A 4ARUA 1QUPA 3SXTD 3B6MA 1GVNB 4DW2H 2WVGA 2QLNA 2I60H 5EUOA 2ZJ8A 1Q1QA 2IYZA 3C87A 2J33A 3WBJA 2NSJA 3VFRA 1TPYA 5CZXD 1CLOH 4X6CE 1LBQA 4HC4A 3TSWA 5HRUA 1FMLA 3HMKA 1RRCA 1U2SA 1WA2X 4OREX 4UMSA 1B15A 5EP3A 2VDLH 2OO7A 3HB7A 3DM5A 4EUKA 5EMMA 4FYKA 1XZ0A 4YCJA 4P4GA 4GOND 3P4NB 2NY0C 1O7DC 3OQNA 2GPNA 2UY7A 3D3WB 5LKNA 5KJCA 3KKEA 1GFIA 4PC1A 4FYRA 4DA0A 3FCBA 1KPIA 3ENKA 1BEYH 4LYYA 4N6QA 4G7VL 3G1WA 5C2BL 3CW2A 1M56B 3T1FB 2OM5A 3V4LA 3DQPA 3JTSB 5F33A 2WUWE 3FMGH 4UNNA 3WJ1A 1R9FA 2PNJA 4A8JC 4B34A 4XXDA 1NDMB 2D3VA 4FUTA 4TQUS 3T4AC 3WP1B 2P4AB 4F7KA 4JX8A 3JQDA 1HMYA 1JMZB 4CODB 2R4SL 3C1UA 3SS7X 1QSED 3RKDD 2Q29A 1TM1E 2IC2A 2E76C 4L8CA 3K8ZA 4PR5B 4OHPA 4Z78A 2GZ3A 5EDSA 1WZIA 3T0EB 1BZYA 3HVKA 4GLRI 4Q4HB 2PBFA 5DBEX 4RK7A 1QGED 5ELMA 3MX0A 1G8SA 4IYRA 1NJ5A 1JS1X 3FNKA 4U63A 4MI3A 2P44B 5EA0L 2EH7H 3RREA 4V03A 4YJZL 4YHIA 4U1KA 1T36A 3DYPA 5LZ5A 1N6LA 3TOPA 1M0TA 2XIQA 4PRNA 1AZRA 4BFBD 4IDCA 4ZFFA 1HBJA 4LLUB 1ULVA 4ANFA 2HV8A 4V2BA 4EJ1C 1U2TA 3VW3H 2FAUA 1HL5A 1CR4A 3QHQA 2NNAB 2HCZX 3DZCA 4Y2DB 4L57A 1L9NA 4W9EC 3O2SB 2FSVA 4P2QB 2O8DB 4O4LF 4QNRA 1HNGA 4EL0A 4GPIB 4LX8A 3CE6A 3GOHA 1F5NA 5DZAA 3UKDA 3L0SA 2V4UA 1QI5A 4DNOA 3E8XA 3LN9A 3DX7A 5MERB 5BSUA 4GKBA 3QUXC 1OIWA 4XMWA 2H9YA 2AJZA 1U7WA 4QAJA 2P6NA 4BO7A 3M7OA 3KEOA 3ZY7A 1JBQA 2VPXA 3QPAA 5PGMA 5I3CA 1W0YT 1GLVA 1X7XB 3LRSA 3H1PA 4PHXA 4ZQCB 4WLFA 2YYAA 4KDWA 4WKNA 3I5UA 3N6RA 2G5PA 3R40A 1P2BA 3LPCA 4OQ1A 1L9KA 3PYCA 4EY7A 5B57C 3LVEA 1RYEA 4KVCH 1XPUA 1KBKA 1MFEL 4EUPG 3NFRA 4AS2A 2ZWAA 5ICZA 4R3UC 5KYGA 4EMSA 3V4SA 2Z7UA 4NZUH 3HN3A 4DZZA 1SXZA 3K20A 1PO7A 2J85A 1T0MA 2IO5A 5JJCA 3QOFA 2PTUA 2ADIB 2IUTA 4G25A 2R4RH 2FPKA 4PN3A 1XXDC 3U1SH 4GFDA 5A7EA 1JXMA 2J21A 4XO8A 4RMJA 1A5FH 4BDTA 1OTYA 5GY7A 2GB4A 4RAOA 1BOGA 4LRNH 2DMRA 2BJWA 3W9SA 4HCRH 4G97A 5LMUB 4WAUA 2GTWA 4XPTH 4FWTA 4BBJA 3LEVH 2H1PL 4G6AD 4PS7A 1GTFA 4TKVB 1FFYA 1JX6A 1USKA 3Q2CA 2C9MA 1G17A 2O8EB 1SUHA 4M7RA 3UH1A 4PJCA 4INAA 5IVIA 3FKSA 1BFSA 2DFKB 5HK8A 1XJWA 4ZMLA 4XOBA 3DR5A 2AJ8A 2I6XA 4CMBA 3IO5A 5IUNC 2OQRA 4JDTH 4MAFA 2DQ4A 1PX0A 3B2VL 1FNSH 5EH1A 4RH1A 2AQPA 2TMYA 5B4VA 1XEDA 2K8QA 4Z3KA 2ZX7A 3EFDH 2YK1L 3LHDA 2JXMA 1YR6A 3OZ9H 3V5DA 1E0OB 3NEJA 1Z6JT 1YCDA 5BQOA 3WIHA 2BZ0A 1F4XH 3ZNOA 4ZXBA 1JFVA 3N06B 2WABA 4CGZA 3ZE2B 2WQAA 3Q10A 3ZCUA 5T3ZH 4BXOA 5I2IA 5DK0B 1WWBX 4BBWA 1Q22A 2W2OA 4QHKJ 3NM4A 1OJ7A 3VRLE 1OFHA 4KWCA 2JI9A 3UHFA 4NU8X 4HNTA 3BIWA 5HSFA 1QEXA 3Q6GH 1KOLA 4YWJA 1Z8DA 1WCV1 5FO0A 2H4XA 1UWVA 3B6EA 4Q9KA 5BN5B 2QRNA 4V0QA 3KXKA 3M4ZA 3RAGA 2ODHA 1PL8A 5KU7A 4HDMA 2VDPA 4E51A 1RP7A 1YHZA 3IEKA 2E4XA 1U8IA 3GIZL 4L1HA 2P9TA 5T3XL 4NJMA 3U9LA 3NJGA 3FZUC 3VXUB 2AI0H 5BQ3A 4HPWA 3CDZB 1UATA 1OD7A 1QK3A 5ESDA 4P5TB 2QPUA 4L9WA 4XD7A 4NZ8A 2FR0A 3SPHA 5DHUA 2I7CA 3OZGA 1CZNA 1AKQA 4Q0XH 4YMVA 1I9JH 1OLUA 2FQQA 1L8AA 4BKSC 1DHTA 1Q16A 1F6WA 5EJ5A 1KV3A 1R46A 5J2UB 4OP2A 4OLJA 4O6VA 4IGEA 1DEEA 4XPFH 2FR4A 2HQ1A 4XMLL 3ZQ6A 2V6JA 2XUWA 4BCZA 2REQA 4YIHA 3KYOA 5D7KE 2A9QA 3N42B 4HYYA 1JUFA 2IS2A 4AYID 2YBGA 3VJLA 1UXMA 5HSGA 5T5FL 3F5FA 3LPLA 3ILPA 3DE2X 4P3YA 1F18A 3FMVA 5B7FA 3LTVA 3KS9A 4BN0A 3INGA 3OLIA 4U5QA 3VM5A 3OT1A 2MRYA 4JSTA 5KAPA 1H3WM 3WTUA 1OZHA 2I4LA 1OZGA 5KQMA 4HJ1A 1A9BA 1B14A 4AG6A 3MUZ1 2YKGA 3ZHKA 3Q0HA 3AONB 1SXAA 1XZAA 1ZGZA 1ETHA 1PWYE 4DT1A 3G59A 2NO7A 3STZB 4RNRB 2ZF9A 1UKVY 2D03L 1J0BA 3OESA 1GY1A 3QX8A 3FPXA 1BYOA 2DLCX 2HKIA 4MCAA 3ULVH 2FTKE 4UV4H 4DKEH 1KBGH 2BIFA 4U0KA 1PAZA 1X87A 3UJBA 4NYJQ 3AR5A 2ERJB 3T9EA 2HV9A 2P4QA 1E5XA 4POYA 1ISFA 1ZLSH 1A72A 3QQ4B 3A1EA 4O0LA 5GQSA 2Z58A 4G43A 3RUCA 2SKEA 1UXHA 1D03A 4CZXA 2I3TA 5CKGA 4Q9AA 2H51A 2LGNA 2GRUA 3N7TA 4NCBA 2HB6A 4CLDA 2CGEA 3GU3A 2F9LA 5IBUB 1JDBB 4K3HA 4HDJA 2VWGA 1HHJA 1XT6A 3PRYA 4HTFA 3V8MA 2WKSA 5TS2A 4A38A 3CFBA 5IC5A 5BVGA 4F80A 3N8GA 2YASA 4GP7A 1A4XA 4AGOA 4EZJA 4M3NA 5I18L 1XD0A 1A1MA 1PW3A 3V52H 2J1KA 3RTEA 2NXEA 4QEDA 3LF2A 5D5HA 5E2JA 2Y3AA 3LWNA 1EB8A 2GITA 4TTGA 3WFBH 1I6WA 3L3GB 1SCDA 1O94A 3ERCA 3UMRA 3K9WA 5FXMA 2QVCA 1C9IA 4G7YL 2IDFA 5G0WA 2EQAA 4S1QL 4GDFA 5A05A 2J7PA 1TTHA 5KYWA 3DXKC 1AY1L 3VQ1C 1XCXA 3WIAA 4XWOA 1BYPA 1SBBA 2EX0A 5HCNA 3MQ4A 2I4OA 1MXFA 3IFPB 1EHYA 1R12A 1VHJA 3VI3F 2LZ0A 2FH6A 2ZB4A 2Y1FA 2E55A 3MRRA 1RIHH 1C0PA 4NBZB 4ZC1A 1I3CA 2R7EA 1JJUA 3IP9A 3REVA 4UPDA 3Q6MA 2JKJA 3MJ4A 5TGTA 1GQFA 4QWMA 3SBDA 1CCWA 2D0DA 3NBMA 3TESA 3MUGB 1LDMA 1XLTA 1EJ6A 4NIKB 1XVAA 1QHEA 3A11A 2ZSVB 3GBML 4WLOA 4BV2A 3MGTB 3S35L 3WS3A 1DSWA 2BP5M 4WFJA 3NCFB 2GPWA 4CJXA 2ZM5A 2BIIA 2GSMB 4WK0A 1Y34E 2UV8A 5ABPA 4UT6A 2IZ5A 4BE6A 4OXXA 3GQVA 4WU7A 1E60A 1F2TB 1JQEA 3HJBA 4HAZA 2N9UA 1IB5A 4R90H 3KLSA 2GN2A 1TQHA 5DN6A 4Y5VB 2XZQL 5DSTA 1Y48E 1UKEA 1ZVJA 3BSHA 1PG2A 4TKMA 1RI6A 4QY8A 1YQQA 3C1TA 2HUPA 2J20A 2ZWLT 3I02A 4UNSA 2ODEA 1K5PA 4JQCA 1U80A 4L3ED 4KE8A 3S68A 3L8DA 3KSBC 2FDCA 1IXKA 3R20A 5C7OO 3ZLJA 4LECA 4DP2X 4Q9BA 5HE3B 3T6WA 4GUDA 1UBKS 1XMOB 1Y8AA 4MGYR 4R2HA 3NPSC 5HYFA 3H9EO 3PDIB 2BSCA 1PUIA 2BEJA 1BWQA 4JANA 1ZS9A 1BVYF 4ZAVA 4O5AA 3FZNA 2N0SA 2CNXA 1ID5I 4RVFA 4M7KL 1UM9A 1DIOB 1IDOA 2AVGA 2JK5A 2E9BA 2WLNA 3UBTA 4KJZA 2PWBA 1HCZA 1S01A 4KVNL 2EYSB 3UMSA 1RZ3A 2LFEA 4FKHA 1KK3A 5AM5A 3H3FA 5IJ0A 1V7NH 1FHNA 5DJAA 3ZR5A 4NRYA 1A0QL 1G9NL 4F3KA 2CUTA 4UZUA 5CD1A 3S48A 1HWWA 1P7WA 3L16A 1G21B 4GZMA 3QIWD 3W39B 4DLPA 1XRSB 4LTMA 3UMMA 5TE9A 3V5WB 4AP5A 2ZRJA 1CS0B 4FP8L 3FHEA 3I8OA 2CNOA 1KB5L 4EGCB 3AT1A 1VGVA 2VJAA 5JW6A 4P4UA 1PZHA 4AJLA 1TKCA 1A3LH 3PHOB 3FTUA 4BFVA 4WFHE 4QXTB 3RFVA 4B3DA 1NBQA 3GYGA 2OXIA 5B3KA 4I4LA 3G5ZA 3UN1A 4OW6A 3EYQC 5BS0A 2GXAA 5CMAA 2XVKA 3RRQA 2XG5B 1MWAB 4OVKA 3V4FA 4TVUA 2FV8A 3R0MA 5KBDA 3OKOB 2D1FA 3GZOA 1RI1A 5C8JB 4NPYA 4PB9L 3W9EB 4TL5A 1CE8A 1HX7A 4I77H 2LE9A 5IHZA 2Z7ZA 4C0QC 3FPSA 4ODUB 4QF1A 1A6UL 1U58A 4JC4A 3ZCTA 1QP4A 3Q2VA 3KYIB 2DPHA 3KQMA 4PZLA 4HBCH 3BT0A 4RZKA 1OGAE 4BQ9A 3EGOA 1GZQA 3JATB 3OEHA 2H52A 1P3JA 4U1LB 3N2IA 4QDKA 3HYLA 4ZPTB 7ADHA 5HGDA 4PY7B 1J2UA 2WM8A 5CA1F 1ZJ6A 4MAZA 1S7TB 1RP9A 1XCPA 1JEYA 1PIGA 3JX9A 4DLWA 4KKRA 1LJLA 2W0FA 2QQEA 2CLVB 4Y9RA 3DBVO 4Y19D 4C56E 3GDBA 2PSHA 4WOPA 4DPBX 2RKOA 5I45A 3U30C 5HR5A 3KSMA 1FDTA 2PXYB 3BKML 3BVNA 1JN0A 2O72A 4DUGA 1GD1O 2V55B 3F8WA 4GF5A 2VSXA 1PKQB 3II1A 5J12B 4HLCA 4XGKA 1Z6TA 4W6WB 2PUEA 3JVGC 4MNGB 5T3XE 5HF5A 2AK1L 4MR7B 4KUCF 1E9QB 3X3FH 3THYA 3VGJA 4KRGA 3GJFK 2MYTA 1ZIAA 1UKCA 4F9PC 1E2UA 1JZGA 4M6NL 5K0EA 4JQIH 2O1EA 2UZPA 4LCUA 4EECA 1U1IA 4WADA 4AF7A 4JEMA 2H0JA 1GKIA 4NWIA 3QLUC 3VFOB 1WW8A 2EDHA 2WCSA 3MAGA 3KH3A 3VR4H 3BUYA 3V8CA 1SXHA 1OCRB 1D5MA 1NMYA 1PTKA 1X38A 5BZDA 3COZA 3Q3CA 3K46A 2PPEA 1EYZA 1GA1A 1YRHA 5KTKA 5HJGA 2YOGA 1BAWA 5FYJH 5EOTB 2CUNA 1SHSA 3ZE1B 4HH3C 4UATA 1QP7A 4B5EA 5JCXA 5AFU3 1N2CB 1SUAA 4H8HA 3H42B 4JQVC 3WNBA 4PG9B 3F3YA 2V4ZA 4TNVF 1IPFA 2F7SA 2YUIA 5EZSA 4BN5A 1I51A 3OHSX 1UGNA 4CY1A 1HLDA 4M6OL 2VK4A 1R5BA 1N3IA 1UDAA 1JVSA 5DGIA 4E1BA 4NUJA 1K86A 4BE9A 3SLGA 4BQ8A 4QRHA 4FXKB 2FBJL 2Y5EA 3LV8A 3VFVA 3NAAH 1V54B 3RIHA 3TRKA 4CY3A 1ST2A 1TZOA 3OVMA 1T5WB 4B9YA 2DH2A 1CR9H 2W6IA 3PNOA 3B9AA 3Q12A 1V1RB 2P9KC 1H3VA 2UYYA 2ODTX 5IN4A 3WHE0 2XT0A 3RVWC 2EFGA 3CN7A 3FRHA 1P4AA 1PQZB 4P7FA 2ZBGA 2HGZA 1KWGA 4AQ8A 3J7AC 1AV7A 5J3HC 1ES0B 1TEFA 3PFUA 2Y66A 1U7ZA 4CY2A 1SN7A 2E18A 3TBSB 4L5IA 3UA3A 3PC8A 4NO3B 3UTSB 3BAJA 3SGDH 3PWVA 2IPUG 5JH7B 3EYWA 4XQ9A 2Y2WA 5IVXA 2ZCKL 2PEYA 3ZRCC 3VQ2C 5F23A 1BAGA 4PG2C 1PMYA 3N42F 4N2LA 5CCJA 1UL1X 1C3XA 4AWAA 4B3XA 4D8YA 4PRPB 1IZJA 3U2IA 2PKRA 1YNOA 3H2JA 3SK0A 5REQB 4EPVA 2ZYWX 4UIKL 5DSXA 4HNHA 3PV6A 1IM3B 1NDTA 2Q2EB 1M1ZA 5K9OB 5JSZB 4UQBA 4PC6A 1KYUA 1CYEA 3TMAA 2OYLA 2BERA 2V9PA 4DA6A 4RA3A 3KZXA 2Y5QA 4MVJE 2QL1A 3N50A 3FA2A 1KXQE 4EQ6A 4TLBA 4ZOXA 1KTVA 2G17A 2WICA 4RTLA 4AIOA 4APQC 3ZT6A 1I5RA 2WOOA 3HRZA 5I0YA 4RE5A 3NKFA 4BNLA 3HNSH 3B89A 1AIPA 1DZBA 3MRFA 2K6ZA 4XZ4A 2OYRA 4MP6A 3FGOA 5E95B 4W4OC 4LKXB 4UTBA 4NHCL 3EFHA 4ZPVB 3AJ9A 2VDOL 3EXEB 4PZ9A 4RXTA 4TSAL 1I80A 4L9DA 3L40A 5DEGA 2OMYA 1RZJC 2C5EA 1O4WA 1J2YA 4GOKA 4DNQA 3WLTA 3F7KA 4GC5A 3WISA 5IW6A 3DLCA 1MVFA 5BW7C 5AIBA 4GO9A 4C88A 4NFLA 2WTRB 1WXXA 4MYSA 2BWDA 1MEJA 5AW4B 2L18A 2EF1A 2VLJE 1DBAL 3K8OE 2R3SA 4QYWA 4ROTA 2P5WB 4U1NA 5C0CB 5CM2Z 3MGOA 1M6UA 2IBBA 4QDZA 4A2GA 1U0JA 2NY6B 4HZIA 2YMUA 3VFWA 3S88H 2NUPB 4RL6A 3TLMA 2HCBA 2WN3A 3GUYA 4JBSA 3E9YA 4F2PA 3AP2A 1OAKL 5I1AB 4G67A 4KDTC 4OD2B 2YN3A 1HXHA 3EPJA 4ZVQA 3FONA 1NONA 3SX2A 3OAYH 5CZXC 4HCFA 3T77A 1L6RA 4FKKA 4UM9B 2VYVD 3UJ7A 4H77A 3H8NA 5HYIA 3IBFA 2G8LA 3QUZB 3UO1H 4IH9A 1E7WA 3OM9A 4NESA 1K1EA 3COPA 1DVFD 1X7YB 3LH8A 4E54A 1ZR2A 1JNJA 1NT2A 2QVBA 3PHQA 3RHZA 2VUYA 2JKZA 2QG9A 3TTXA 3RIEA 3KYDA 1SOUA 4HGZA 1L5WA 2NTFA 2X58A 3WD5L 4JKPH 3QPWA 5LIRA 4IJWA 4FIDA 4Q7DA 3E15A 1KMHB 4L4XA 5C0ND 2L17A 1ORSB 2VPYA 2F3PA 5GZ3A 3CQPA 1Z4MA 2ASEA 2E7MA 3ZJVA 2V74B 3VMOA 1CK0L 4FXGB 2EIZB 3IPYA 5M95B 3VZQA 4ES9A 5EU3B 5BSHA 3BPLB 4X7PA 3OMZA 3KWTA 1PWXA 2BXYA 2XPYA 4UDTB 3KB1A 5JEEA 2QE7D 1BHO1 3AMLA 4XNMB 1QAMA 2WD9A 3X12A 1RRVA 4ND7A 4YRGA 3BRGC 3B6IA 4JKMA 3QUYD 1ZPUA 5CGBA