3K79A

C38a, c52v cysteine-free variant of rop (rom)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADIAESLHDHADELYRSVLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein rop
publication title Cysteine-free Rop: a four-helix bundle core mutant has wild-type stability and structure but dramatically different unfolding kinetics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 27
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k79A00
2IJJA 1NKDA 1F4MA 1ROPA 1GMGA 1RPRA 3K79A 1GTOA 1PD3A 1RPOA 2GHYA 1B6QA 4DO2A 2IJKA 2IJHA 2IJIA 1F4NA
chains in the Genus database with same CATH superfamily
2JGDA 1AJNA 4WF9V 4DUYB 4J41A 2Q69A 2ADPA 3EFFK 1FFXA 4YHHO 4X62B 1SZTA 2DN9A 1G1XB 1QU7A 4OGQB 4QGPA 1XNQB 5KLVH 1S5JA 4MVSA 3HPLC 2BSKA 3A8TA 3DTUB 3H1IH 3HKEB 2YUAA 4CH3A 3ASNB 4XDJA 4UFZA 3T1HB 5KHGA 4PDLA 1Z5WA 3M7MX 2JS3A 4MTOA 3JD0A 1BQZA 4DR3O 2NN4A 2V7QG 4F6RA 4ZBMA 1B3QA 5H6QA 2B9ZA 1K34A 3E8FA 4AI8A 1PL0A 4JYCA 2WLMA 1OCRB 4NKGB 5CA3A 1MSDA 1BHAA 2Y0IA 4FLZA 3PJSK 3AG2B 1F4MA 1N0JA 1YSCA 3E8BA 3EXAA 3N2GA 3CD6V 1V54C 2AW9A 2Y4UA 2WLNA 3CC7V 2OIEA 5BMVA 3OMNB 3CRCA 4UCRA 2B1IA 2Y69C 4I50B 4FLUA 1KC8W 3CXCU 3QF7A 1L0LH 4FPPA 1K97A 1MA1A 2Z0AA 2AGAA 1H2LA 2YIBA 2ITCC 2XASA 5IY5C 1OCZB 2Q6AA 4HZ3A 1VQOV 4GX5A 3P30A 3L73H 2YXHA 2YSUB 2JIZG 3JCUZ 3OTOO 2YXLA 3W7WA 1ZSPA 4GZRB 1QLEB 3QO5A 3L75H 3X2QB 5EYPB 3JATB 3K9AA 1XNRB 3DC6A 1TUEB 2YICA 2JJ1G 3CCLV 1L0NH 4FJCC 1NH2B 1D5NA 3RYHB 1WP8A 2NR5A 1WAZA 2E3CA 3M8AA 4H37A 4U7NA 1S5LZ 4GCZA 1EN4A 4B3SB 2QM7A 2YS8A 3FKSG 1R1BA 4WFFA 1QBZA 4W4LA 1PM9A 1N36B 5LOVA 1N8RW 3APOA 5L3DA 3HKBA 4JTCB 1FXKC 1GH6A 2A0LA 4RUFA 2CH7B 4DW0A 1IBLO 4X64O 5B1AC 3HKDA 1SETA 3DXRA 1JX9A 2OIGA 2MW2B 3RBZA 5JQGA 3RT3C 1SQPH 1XHXA 4JI5B 1VIBA 2P7TC 4X20A 2EJ7A 4DR5O 4LF8B 4B3TB 5ITZB 5EIBD 4K8XA 1IBMB 4I55A 3RVZA 4DR6B 4FVMA 4X65O 1SQFA 1HR0B 4PI0A 1B6QA 1NVPB 3CB2A 4O4JA 4UV8A 3O9OA 5LMUO 1DGSA 2YDEA 1HNZB 3VBBA 1WPBA 4I0XA 1JFFB 2R9RB 5CB4B 3SJQC 3ABTA 4LF6B 3LDDA 2CE4A 2UUAO 1TVKA 2XTAA 2X6AA 1VQ4V 1LR1A 5FLXN 4I4TA 4JI0B 2P67A 4FIPC 2NNUA 4H13B 1OZ0A 2P06A 4Z1MG 4DRXA 2WLLB 1YJ9V 3ASOB 4TV8B 4EFBA 3LSSA 1K5SA 1I0HA 4QPJA 1TUBB 2JRIA 2YEVB 2F93B 4TT3G 2FKXA 3L71H 2XAHA 5CA0A 3AK1A 4PV1B 4TUYB 2KKWA 2LW7A 2M6YA 1WA8B 2CGOA 2WPDG 3CCVV 4O4LB 2ZDIC 3T2MA 1QLNA 2BOBC 2Y48A 2FL4A 3OD4A 4J7ZA 2UXDO 5L3BA 3MAQA 4WFBV 1KYOF 4B08A 1KBHA 2A7WA 2RMKB 4UV9A 3SGIA 1N34O 1I94O 2JK5C 4NXNB 3GWOA 4DW1A 4MVOA 4BWAA 5GTIZ 1PNMA 1HNXB 4B3MB 4GX0A 1BL8A 4GLXA 3H1LH 1M56B 2K1EA 3W7TA 1G6UA 4O4IA 3IFXA 2WLHA 3A0HZ 1M57C 4FZ1A 2M7WA 3ZJZA 4DV5B 1R3IC 2AZ2A 4XDKA 2IU0A 3H1KH 4I5SA 1M93A 3L70H 4I9WA 2BTOA 3CMAV 1AROP 1Q43A 1P7GA 1RM1C 3CJHA 1K4CC 3EVKA 4YHHB 1H8HG 2EIMC 2ZKOA 5KMGB 1AI5A 4MTXA 3P3PA 2LGWA 1JOYA 1F23A 2ZR2A 4E4EA 4GX2A 5JVDB 3NXSA 5CN0A 2FYUH 4Z2WA 2JGDB 3JSNA 4DR3B 2UXNA 3UKMA 3JD4A 2VS0A 4YXWG 1FFXB 4NTXA 5L3EA 1IXBA 2CTWA 2EZPA 4PA7A 1BQ0A 2HHHO 1VF7A 2ZT9B 2Q7EA 1FPOA 4WCEV 1WLEA 5A9GA 3ZMTA 1F4NA 1KECA 5CMUA 5LGUA 4P2ZA 5LA6A 2H3OA 5LBQA 4RO2A 2FMLA 4MVZA 1VARA 3BFRA 4NR1A 1J5EO 4F6RB 2YI8A 4F4LA 2W6IG 1XQ8A 4BW9A 5KHKA 1I5YA 1NTMH 5IYBO 4DK1A 2A3QA 1E1RG 1F51A 4LH6A 5KHJA 3ZMUA 5EC1C 3L9DA 4JI7O 3G6EV 1DTOA 4RWUA 3RYIA 1YHQV 2DW4A 3OTOB 2ZCEA 3G71V 1Q7YW 1NR1A 3OR7C 5B3SC 3HR0A 5JH7A 4UCUA 5GONA 4JYBA 5FNVA 1MG1A 2QM4A 1H38A 1M90W 3IC9A 1EZJA 1IZ3A 1GN2A 2ZIMA 4O2BA 5B1NA 2A9HA 4UCTA 1V9PA 2PI4A 3BA9A 4B7EA 3L72H 2RNBA 2Y0PA 4JAUA 1RSOA 5IDJA 5JCOC 4DV3O 5K1XA 3BRCA 3U11A 4WBNA 1VQ5V 3ZN1A 1US6A 4EEQA 1IBLB 4X64B 4OPAA 3SR2C 5B1OA 4IT5A 3SPHA 2ZQMA 2ATKC 2VRZA 1COWG 3RFRA 1TGOA 1VQPV 4DR5B 4DR2O 4E2LA 1V55B 5LP6C 3P32A 1B06A 3AG1C 4MVQA 4R7CA 1URFA 3LUTB 2QDOA 4H33A 1FXVA 3BY6A 4X65B 4CZZA 5LOVB 1AJPA 3HKBB 1U96A 2MK3A 3CRAA 5JJJB 2YC0A 5LMUB 2FTKA 4O2AB 3TGUH 3C3TA 3HKDB 5DECA 3DXRB 3G67A 3AK2A 2Q9LA 3T4ZA 4FMTA 2EJRA 5JQGB 1GO3F 3S3XA 5K1PA 2UUAB 4X20B 4R8CA 2GHYA 4Q6GA 3BPZA 4I55B 4FLVA 4Z1VA 3KZIZ 1J95A 3ML0A 4CC6A 5B1BC 4DYLA 2VWKA 3SPJA 2WLJA 1XBLA 2LO1A 4O4JB 4PA6A 1PPJH 1OCCC 3O65A 3K04A 1R6NA 4G27B 2N74A 4K3AA 5BY1A 4I0XB 1XI1A 1Q6UA 2UU9O 4DV0O 1K3EA 4KFMA 3TCUA 1NTKH 1XOUA 1YF2A 2OCCC 1TVKB 2PF4E 1NZ6A 4I4TB 4YJ2A 2UXDB 1Q86W 1K5QA 3HKCA 3K03A 4DRXB 5D5QA 1PNLA 2XHBA 1ZUQA 1SQQH 1I94B 1N34B 1M9NA 1P49A 2ZXWC 3DSQA 5AG2A 4TQFA 3E8GA 4ZI7A 5CA0B 3H9VA 2BCCH 2KSDA 3K79A 3WFVA 3CWBH 1XILA 2IJIA 1FKAO 4OPHA 1H2MA 2DOSA 3TETA 2Q0AA 2DJVA 1GKFA 1FD9A 5LXTA 3AG3B 1Q6IA 3SYAA 2B1GA 3D36C 3CRMA 4X66O 2DYRC 3T4DA 3D3QA 1JQ0A 2PI5A 1B04A 3ZX6A 3KCXA 1BZKA 2EIJC 1VF6C 4UUJC 5KX5A 2RCVA 2K9PA 3P3NA 3ABKB 1YJWV 1KP2A 5DEDA 3QO8A 1THZA 3ASNC 3IJ4A 2LJ2A 4BR6A 2KB1A 1KUQA 3ICXA 4O4IB 4CC5A 4DK0A 1U97A 3CRQA 4TV9B 3VQXA 2BE3A 4BAYA 1XL4A 3K59A 3ETDA 2XNDG 3JAKA 4YY3O 1OCRC 2OT5A 1QVFU 3AG2C 1RFYA 3CJHB 2OCHA 3CCJV 1NU1H 4F6EA 4AQYO 2HHHB 2N05A 4QE9A 1MNGA 2A79B 3OTFA 1UPGA 2GTAA 2DE0X 1ZL8A 3ETGA 4JI8O 1MZFA 4CS4A 3ABMC 4MT8A 1J5EB 2GBOA 3B8NA 4PA3A 3OGCC 4FM2A 1N33O 2QWNB 3TXSA 2IJKA 3PN1A 1G4YB 5EZYA 4WFHA 3ZRVA 1P4RA 3SJCC 2RJZA 3RN4A 2QKSA 3VQYA 1PD3A 2ZE5A 4JI7B 3U0ZA 3T1YO 2XAGA 2PTMA 4QIWF 5EBWC 3BAAA 4LNUB 3R65A 3SPIA 2C2AA 1MABG 4PD4F 4I7ZB 1HWYA 2Y69B 3LDEA 5LA6B 1L1FA 2UUCO 3JD1A 4ZIBA 3K58A 3LSUA 4AHCA 2WAMA 2GSMB 4RUEA 4JYAO 5IY5B 5C93A 4NTYA 2Q73A 2YIAA 1KKDA 4LC1A 1R3JC 2YI9A 3RVYA 2OTLV 1XMOO 1OCOC 3D8CA 3CCSV 3RYIB 5EIBC 5JCOA 3FYIB 4P30A 2XAQA 4NB5A 2Q8VA 1NH2D 1I5XA 1PV0A 4DV1B 4DV3B 5IE9A 5JH7B 4O2AA 1YCIA 2HFEC 1YJNV 3J81N 5GONB 4UVBA 4R6ZA 4GYCB 5FNVB 1R6KA 3CSXA 4U3JA 3Q4HA 5LP6A 4O2BB 3H1HH 4DR2B 4LH7A 1EM1A 3FYEB 4D6TH 2RDCA 3B40A 2XAFA 3K0GA 3BCCH 5DN6G 4PDVA 4AILC 1NT2B 1RSOB 2UXXA 4GX1A 4PA4A 3VOUA 5IYZA 1SESA 4H0LB 1Q90D 2CUGA 4K8ZA 1YI2V 2H8PC 4GKKO 2EILB 1QR8A 2ZNJA 5B1AB 3S3WA 4WBNB 4X89A 2QGNA 4IIJA 5H5NA 4UXNA 1ZLZA 2AXTZ 4PDMA 2KQXA 1CP9A 1NVPD 4JYYA 1GN3A 5JWPA 1XMQO 4OX9O 1BHBA 4N23A 3A0RA 3UCSC 2IH3C 5IWAO 2QSAA 3THOA 5IYDO 4FLXA 4FZ0A 1MSWD 1HDJA 3TJTA 2QKAA 2BTQA 1GMGA 2UU9B 4DV0B 2EINC 4MVRA 1YITV 3CP1A 5H9CA 4PDRA 4MTFA 4YIPA 1RPOA 5KAIZ 1FFTB 1XREA 1FAFA 1GTOA 2WLKA 2PYLA 2CTRA 2HG5C 2WSSG 3E86A 3GB7C 4ZKIA 4FFBA 5H6RA 3JAWB 4HNAA 4J10A 3FB8C 5J9PC 1O9HA 4X1IA 1I7FA 1QNMA 2JJ2G 2CGNA 2OYQA 4JI4O 3QVNA 3HB3B 2XUMA 3LNMB 1VQLV 5KUKA 4TV9A 3QNEA 4YJ2B 1Y67A 1HP8A 3HKCB 5CA1A 4LFBO 4X66B 3C3SA 1D5AA 4NTWA 4CBCA 4CS3A 1S72V 1VF6A 1ENVA 3K0DA 2WLIA 4XBFA 4ZI7B 1NBMG 2JVDA 3MHHC 3ZHTA 3FB7C 3K9SA 3CE2A 3ZMSA 5J2TA 1W0KG 3IAYA 1VQ6V 5LXTB 4X9QA 4FK5C 2IBZH 3FX7A 5KHHA 2Q5ZA 4UCOA 2IJHA 4U3FH 5TISZ 4JI3O 4YY3B 1RM1B 4JI2O 4ICGA 1SQXH 2IJJA 4WFGA 2P22C 5DM6V 2E76B 3CCMV 2DQ0A 2EZOA 5KX5B 1H2SB 1YIJV 3C90A 5KAFZ 4DR7O 1YTFB 3DGEA 1TA8A 4AQYB 4JTDB 1IBKO 1CPYA 2G38A 1RP3B 3SDLA 4JGSA 4LNUA 1VQNV 1VMGA 3B2EE 2DQ3A 2GUZA 2UUBO 1NJIW 2Q0OC 5E1AC 4JI8B 5LGTA 3JAKB 4OXSA 5D5PA 3OEEG 5BZBA 1SQVH 2EX3A 1W2BU 2P4VA 2QKCA 1N33B 1CEZA 3K57A 1H2GA 3RWRD 3I5DA 1VQKV 3WG7B 4KUMA 5CBGA 3BHPA 2GTSA 3B8MA 4I9QA 4O4HA 3N2KA 3ZCCA 3T1YB 3IGAC 1L8DA 3F5WC 3E89A 5J2UA 2PZSA 1ZL8B 1TAEA 3TK1A 1H2NA 4CH6A 2HP8A 4LWSA 3M99B 1EZVH 4FLTA 2UUCB 1K7DA 3APQA 1WP7A 2LW1A 1K92A 1GM8A 4JYAB 3MD0A 4BIZA 5EZYB 3UT5A 3AG4B 3ZRWA 4LF9O 4CH5A 4TWKA 2DYSC 1AI4A 2DWEC 4BIOA 1XMOB 1R73A 1XEQA 4GUNA 5FPRA 1R3KC 2QEXV 1JPXA 2ILMA 3OMAB 4QJFB 2HKOA 1FXKA 2YIBD 3ABLB 1WNSA 2EIKC 1V55C 2CAZC 2ODMA 4TSFG 1K8AW 5LGNA 1ZTEA 2XOKG 3OGIB 3QO7A 4FFKA 3CEIA 2ZD9A 3SPGA 1NR7A 2UXBO 5CBFA 4IYHA 1FXHA 4MVUA 1AI6A 1IXMA 2R9IA 4QNHB 4X1KA 3ZHQA 3ZHRA 4EFEA 4GKKB 5LMNO 5BR8O 4LF8O 2F4VO 1GN6A 1MOFA 4K0KO 5C8YA 1P7BA 3ZRSA 5FPOA 1EN6A 4LFAO 2JS5A 4MSWC 3CCQV 5L3FA 4U3JB 3CC2V 3Q4HB 5LP6B 2QWRB 3AG1B 4MS2A 1BMFG 1UFIA 1WB8A 1XMQB 4OX9B 2KG7A 2V1DA 5KUMA 1S76D 3ZEDA 1DF5A 3WB0A 5IYZB 5IWAB 3I56V 3JAWA 4RQEA 4LCUC 1YEWA 5IYCO 2W0XA 1T5EA 3ETQA 1WJZA 2E5LO 1K9MW 4IIJB 2ZDIA 3OW2U 4UVCA 3RYCA 5KHIA 1G8MA 4H44B 1N4CA 5KA6A 2ZIOA 2VQEO 1WPXA 3F7YC 5B1BB 3F5TA 2F43G 1JA8A 1ZX3A 3W7UA 4JI6O 2HJDA 3KCYA 3ZS8C 4HBNA 3AG3C 5L3GA 2BTQB 2GDSA 4FM0A 4DV4O 1DLBA 4RQFA 2ZR3A 1PKXA 2LFRA 2OCCB 4IGGA 1AR4A 3JCZA 2HJFC 4JI4B 4UCSA 2R9AA 3EHBB 1Y74A 3OFNG 3JARA 4NXMO 4N21A 4LFBB 1FYJA 1WN7A 4JPRA 5LYJA 1E1QG 2QR4A 2ZXWB 4HAMA 3JYCA 3AK3A 3JD2A 1JR9A 4FFBB 3SYQA 1NQTA 4PA9A 4UB6Z 3H01A 2N04A 4HNAB 1Q8IA 4DV2O 2Q7HA 3ZMVA 4X1IB 4X1YA 4EB6A 1MZEA 3CPWU 5EK0A 4LFCO 2CK3G 3ABUA 3ZMZA 3I55V 1N32O 1LNQA 1SKVA 3L74H 1SF9A 3VQVA 2IW5A 2DYRB 3UQ8A 3RYFA 5CA1B 1XUQA 4B3RO 2F95B 1RPRA 4JI1O 5EBLC 4JI3B 2ZM6O 4JI2B 4BW5A 2EIJB 4CS2A 4DUZO 5H2FZ 2WLIB 3N27A 1AR5A 4NYKA 2FB5A 4ASUG 4DV7O 4EKWA 4DR7B 1KP3A 1IBKB 3CS5A 1QCEA 5J2TB 1W0JG 4B7KA 2HEPA 1W59A 5E79Z 2JDIG 3FAVA 3OUSA 3STLC 2Q68A 3FB5C 2UUBB 2DWDC 1D2DA 5IJ0A 1Z2GA 5B66Z 5CBHA 1OCZC 2P6JA 3G6BA 4HYOA 3NR7A 3B77A 4IHJA 3RW0A 3JASA 1FJGO 3CCRV 5LHIA 1X4TA 1Y76A 4X88A 1V54B 5HFMA 2QM8A 3SPCA 1VQ9V 2PYJA 2QE7G 1QLEC 2LFSA 3K3WA 2QA4V 2V4DA 1SERA 1KMIZ 3X2QC 3ZRXA 2GUZB 2GV9A 2YXYA 2VQFO 4DR1O 3E83A 3B4SA 3ABMB 1Q82W 4KHPO 2ITDC 4JASA 3ZHSA 1H2KA 1NS1A 2AHZA 4U7OA 4JTAB 1M4UA 2Y4TA 1OHHG 1KU9A 5LHGA 4LF9B 5IJ9A 1X59A 4O4HB 1JMKC 3N2KB 2CTPA 1SQGA 3JAMN 3AEIA 1YDXA 4C7UA 5J2UB 3K5NA 5GTHZ 3R66A 2YIDA 1ROPA 3CXHF 4PJ0Z 1O9GA 4KP4A 4LWSB 4DO2A 2LGQA 3OT7A 3E22A 3UO3A 4DR4O 4UCVA 1A32A 2E75B 2RN9A 5KA5A 3KG2A 3ZN0A 1HNWO 2HR3A 2X6CA 3UT5B 1QR9A 4J9ZB 3ZRWB 4JV5O 4ABMA 4ZHQA 2UXCO 4P9PA 3W7SA 2OWOA 1JJOA 4GKJO 1KB9F 2UXBB 1OCOB 1E79G 1M5IA 4NVPA 2EILC 1FXKB 1VEWA 1Y66A 3D3IA 1Q81W 1ZWIC 5LMNB 2ZE8A 5BR8B 2F4VB 4K0KB 1YVWA 2JEXA 4MW3A 2AZ0A 1F7YA 3SJAC 3ASOC 4LFAB 1Q5OA 3GWKC 4KL1A 1FS0G 1ORQC 3BEHA 2XT9A 3CCUV 1YXBA 3SYOA 1IURA 1AB3A 5L3CA 2LQTA 4YJ3A 4DV6O 3J80N 4D7SA 3OM3B 4X1KB 2R70A 2W0FC 1PNKA 3LDCA 1AP6A 4LF7O 2PY5A 4JZGA 5C8YB 2IH1C 1S77D 2E5LB 1H8EG 3DC5A 2W6JG 1BSMA 3OMIB 5LL6Y 2VQEB 1K33A 4FLYA 3JD3A 4FM1A 2XAJA 3LNNA 2KG7B 1PL4A 1SA0A 5FL7G 1VQ8V 1EN5A 1CXZB 1AI7A 1M56C 3CHXA 4JI6B 2VWJA 4G2KA 4JZ2A 4LF5O 1OJHA 4WFAV 2EINB 4LP8A 4IYIA 1GM9A 4DV4B 2ZNIA 2RQ6A 4QPKA 1I08A 3RYCB 1S5HC 3D36A 4NXMB 3FB6C 4PELA 2WA3A 2QWQB 1R3LC 3G80A 1P84F 2X0LA 2L6LA 1S0VA 1K73W 3E2EA 3JALB 3HKEA 4LF4O 3UM7A 5A2QN 1BS3A 1JCHA 1BGYH 4ZOLB 4DV2B 2AHYA 4Q20A 4L8JA 4LFCB 4J80A 1KKCA 3K08A 1M57B 4DUYO 2NLJC 1N0NA 1N32B 1VQMV 1Y74B 2ZE7A 3JARB 3QTCA 1Y4MA 4X62O 4WFEA 4B3RB 2P4KA 5LYJB 4JI1B 3K06A 3J7AU 3H1JH 3WU2Z 1XNQO 4J9YB 1EFRG 3CYOA 2ZM6B 2Q67A 1SZXA 3WB2A 4J42A 3SJBC 4DUZB 2EIMB 1NI8A 2F66C 3U10A 4DV7B 3T1HO 1K4DC 1AJQA 3B09A 4X1YB 4EB6B 3STZC 4BIUA 4I50A 5EC2C 5JJEB 3JSLA 4JF3A 4UB8Z 2Z3YA 4D7TA 3RYFB 1UJWB 1YTFD 2R72A 2CDYA 1DK1A 1SQBH 2ARHA 3WG7C 3MDSA 2HVJC 2EBOA 3SYCA 1Q6HA 2HVKC 2BSKB 1LUWA 3OR6C 3FD9A 3G4SV 1Z5VA 1QVGU 1IX9A 1IDSA 2H94A 1FJGB 2F23A 3A0BZ 4TOIA 5IT9N 4FLWA 2QWPB 2X7RB 5EYPA 3JATA 1JVMA 4PHZA 3FAVB 3RYHA 2VQFB 1VF5B 3CRRA 4DR1B 5IJ0B 3BABA 3WB1A 1XHZA 4KHPB 3AG4C 4JAVA 3E8HA 1AR1B 3K5OA 3N2GB 1BT8A 1SC5B 4IHJB 3OUFA 3CX5F 5BMVB 3W7XA 4KXRA 3JASB 2IU3A 2CTQA 1Y76B 3ABLC 4K35A 4PI2A 2CH7A 2B5UA 1OV9A 1SS3A 4QE7A 4L87A 1GN4A 1PP9H 2ZE6A 1XNRO 5B3SB 2QWOB 3OE7G 1IVSA 1MMMA 1QHTA 4B3SO 5ITZA 4DR4B 1XL6A 1WB7A 2WA4A 3ETEA 3QG5A 1HNWB 1N36O 1AP5A 2DYSB 2ETNA 4MW8A 4JV5B 2UXCB 5B5EZ 4DV1O 3OEHG 4GKJB 2QJ1A 4LBEC 5IJ9B 2F1MA 2Z5UA 1HW7A 5F2VO 5HFLA 3ZHVA 4J11A 4J7JA 1JFFA 4MTGA 4R50A 5CB4A 2JEUA 5BXZA 4LR3A 4JI5O 2WWWA 3A2FA 2EIKB 4IL6Z 3FFQA 3UO2A 1AVMA 5LHHA 1ZAUA 2QTSA 1EBOA 4B3TO 1YZBA 3E22B 1JJ2U 4W4KA 3ZHUA 2WLLA 1IBMO 1VP7A 4YIOA 4G28B 4TV8A 4DR6O 4A5UB 1HR0O 1TUBA 4ZHQB 2YEVA 2ADQB 2QTOA 4UVAA 1HNZO 4TUYA 5EBMC 4DV6B 1GM7A 4LF6O 1WA8A 1DF4A 2X6BA 2HLDG 4O4LA 1R6TA 2P90A 3AG7A 3VQWA 3BVOA 4JI0O 3K5LA 4LF7B 4MVMA 3CC4V 1VQ7V 2A06H 3T1CA 3MHSC 3ZIAG 4CH4A 2PGGA 5JJNB 2PUSA 2O57A 2E74B 3F7VC 1M1KW 1Y6XA 3GVMA 1BE3H 2L35A 2P5OA 2D3OW 2Q7GA 4YJ3B 1KD1W 1GAXA 3SYPA 3JALA 1OCCB 4XDLA 1BCCH 2ZINA 3CMEV 1AILA 3TXQA 3ZBHA 2JGUA 4LF5B 4GT1A 1Q3EA 4ZOLA 2Q4PA 3IC7A 1GK9A 4J7KA 2D2CB 2LP7A 1LUVA 2DMXA 1NTZH 1NKDA 3CCEV 3OAAG 4NXNO 4RAIA 1KQSU 3KKYA 3K5MA 5GW7A 1SRYA 1HNXO 4B3MO 4X8AA 2EULA 1GRJA 3ABKC 5KMGA 1XDCA 1SA0B 3LSQA 4JAAA 3BA8A 4TQDA 4LF4B 1S3JA 2BOCC 5JVDA 1QQCA 3E35A 4P9OA 4DV5O 3RGBA 4DXWA 2IM9A 2OTJV
chains in the Genus database with same CATH topology
4XBFA 5KA5A 3KG2A 1AJNA 1NBMG 4WF9V 3ZN0A 1VQ5V 2HR3A 2Q69A 2X6CA 3ZN1A 1QR9A 4J9ZB 3ZRWB 3MHHC 4P9PA 5B1OA 3W7SA 3EFFK 3SPHA 2ZQMA 3FB7C 2ATKC 1COWG 1OCOB 1E79G 1SZTA 3ZMSA 1W0KG 2EILC 1VQPV 1VQ6V 4FK5C 4E2LA 1V55B 3P32A 4MVSA 3HPLC 3AG1C 1FXKB 4MVQA 4R7CA 3DTUB 3LUTB 2IJHA 1Y66A 3D3IA 1Q81W 1ZWIC 4H33A 1FXVA 3ASNB 3BY6A 4XDJA 1RM1B 4PDLA 4CZZA 2IJJA 4WFGA 1AJPA 5DM6V 2JEXA 4MW3A 2MK3A 4MTOA 3CCMV 2DQ0A 3JD0A 2EZOA 1YIJV 2FTKA 3ASOC 1YTFB 1FS0G 2V7QG 3DGEA 1ORQC 3BEHA 4JTDB 4ZBMA 3CCUV 5H6QA 3T4ZA 1K34A 4FMTA 2EJRA 3E8FA 3SYOA 1GO3F 1PL0A 1CPYA 4JYCA 2WLMA 1OCRB 5CA3A 5L3CA 1BHAA 4R8CA 4JGSA 2GHYA 1VQNV 2DQ3A 3PJSK 3AG2B 3OM3B 1F4MA 2W0FC 1PNKA 1YSCA 3E8BA 3LDCA 1NJIW 3CD6V 1V54C 5E1AC 5LGTA 5BZBA 1J95A 4OXSA 2WLNA 3ML0A 3OEEG 5B1BC 3CC7V 3SPJA 2WLJA 3OMNB 2IH1C 1S77D 2B1IA 1W2BU 4PA6A 1OCCC 1CEZA 1H8EG 2Y69C 3K04A 1R6NA 4G27B 3CXCU 1KC8W 1H2GA 1VQKV 3WG7B 4FPPA 4KUMA 5CBGA 1K97A 2W6JG 1K3EA 4KFMA 3OMIB 3TCUA 3B8MA 1K33A 2OCCC 3ZCCA 2ITCC 3IGAC 2XASA 3JD3A 5IY5C 1OCZB 3F5WC 2Q6AA 4HZ3A 1VQOV 4GX5A 2XAJA 3E89A 1Q86W 3P30A 1K5QA 5FL7G 1VQ8V 3K03A 1AI7A 1M56C 3TK1A 2YSUB 1PNLA 4G2KA 2JIZG 3M99B 4WFAV 1M9NA 2ZXWC 1K7DA 2EINB 4LP8A 1GM9A 3E8GA 1K92A 3W7WA 4QPKA 1GM8A 3MD0A 4BIZA 3AG4B 1QLEB 1S5HC 3K79A 3WFVA 3ZRWA 3D36A 4TWKA 2DYSC 3QO5A 1AI4A 2IJIA 3FB6C 3X2QB 3K9AA 2DWEC 1TUEB 4PELA 3TETA 2JJ1G 3CCLV 1NH2B 4FJCC 1R73A 1GKFA 1R3LC 3AG3B 1R3KC 2X0LA 4H37A 1S0VA 4U7NA 3SYAA 1K73W 3E2EA 2QEXV 1JPXA 2B1GA 4GCZA 3OMAB 4QJFB 2QM7A 2HKOA 1FXKA 2DYRC 3ABLB 3FKSG 4WFFA 3T4DA 3UM7A 1QBZA 1JQ0A 2PI5A 1JCHA 2AHYA 2EIKC 4Q20A 1N8RW 5L3DA 1V55C 2EIJC 3K08A 1FXKC 1M57B 4JTCB 4UUJC 1YJWV 3ABKB 2A0LA 4RUFA 1KP2A 4TSFG 1K8AW 5LGNA 2NLJC 2XOKG 1VQMV 3QO8A 1THZA 5B1AC 3ASNC 3QO7A 1SETA 1JX9A 2KB1A 2ZD9A 3SPGA 1Y4MA 1NR7A 5CBFA 3RBZA 4WFEA 1FXHA 2P7TC 4MVUA 3K06A 1AI6A 1IXMA 2R9IA 4J9YB 4QNHB 1EFRG 3CYOA 2Q67A 4BAYA 1XL4A 2EIMB 3RVZA 3ETDA 2XNDG 1MOFA 1OCRC 1K4DC 2OT5A 1QVFU 1AJQA 1P7BA 1B6QA 3STZC 4BIUA 1NVPB 3ZRSA 3AG2C 5EC2C 4UV8A 3CCJV 3VBBA 4JF3A 4MSWC 3CCQV 5L3FA 3CC2V 2Z3YA 2R9RB 3AG1B 3SJQC 3ABTA 4MS2A 3LDDA 1BMFG 1UJWB 1YTFD 4QE9A 2A79B 2X6AA 1VQ4V 3WG7C 2V1DA 2HVJC 5KUMA 1S76D 1DF5A 2P67A 4FIPC 2EBOA 2NNUA 3SYCA 1OZ0A 2HVKC 4Z1MG 3ETGA 3I56V 2WLLB 3OR6C 4RQEA 3G4SV 4LCUC 1YJ9V 3ASOB 1QVGU 5IYCO 3LSSA 3ABMC 4MT8A 1K5SA 4QPJA 3B8NA 4PA3A 3OGCC 1K9MW 2YEVB 2H94A 4TT3G 2IJKA 2XAHA 2ZDIA 3OW2U 1G4YB 4UVCA 4WFHA 3ZRVA 1P4RA 1G8MA 5KA6A 2X7RB 2QKSA 1PD3A 1JVMA 2WPDG 3CCVV 2XAGA 4QIWF 2ZDIC 1WPXA 3F7YC 5B1BB 5EBWC 3T2MA 1QLNA 2BOBC 2Y48A 3AG4C 3R65A 3SPIA 2C2AA 1MABG 5L3BA 2F43G 4WFBV 1HWYA 2Y69B 3LDEA 4JAVA 3W7UA 1L1FA 3E8HA 1AR1B 4UV9A 3OUFA 2JK5C 3AG3C 3JD1A 5L3GA 3GWOA 3W7XA 2IU3A 4MVOA 1DLBA 4RQFA 1PNMA 2ZR3A 1PKXA 2LFRA 2WAMA 2OCCB 2GSMB 4RUEA 3ABLC 3JCZA 4GX0A 5IY5B 1BL8A 2HJFC 5C93A 2B5UA 3EHBB 1KKDA 3OFNG 4QE7A 4L87A 4LC1A 4N21A 1R3JC 1M56B 1KD1W 2K1EA 5B3SB 3W7TA 3RVYA 2OTLV 3IFXA 3OE7G 2WLHA 1M57C 1OCOC 4JPRA 3CCSV 2M7WA 1E1QG 4HAMA 2ZXWB 3ZJZA 3FYIB 4P30A 2XAQA 1R3IC 3JYCA 4XDKA 3JD2A 2IU0A 1NH2D 4I5SA 1I5XA 4I9WA 1XL6A 3SYQA 1NQTA 4PA9A 3H01A 3CMAV 1AROP 3ETEA 2DYSB 2HFEC 4MW8A 1YJNV 3ZMVA 4UVBA 1RM1C 3CPWU 4R6ZA 5EK0A 3OEHG 1K4CC 2CK3G 3ABUA 4LBEC 3ZMZA 1R6KA 2Z5UA 1H8HG 2EIMC 3I55V 1LNQA 5HFLA 2IW5A 1AI5A 4MTXA 4MTGA 4R50A 2JEUA 2DYRB 3FYEB 1JOYA 1F23A 2ZR2A 2XAFA 3K0GA 2WWWA 4GX2A 1RPRA 5EBLC 5DN6G 2EIKB 4PDVA 5LHHA 2UXXA 4GX1A 4PA4A 3NXSA 5CN0A 3VOUA 1EBOA 4BW5A 1JJ2U 1SESA 2EIJB 2WLIB 1YI2V 2H8PC 2WLLA 4G28B 4ASUG 2EILB 1QR8A 5B1AB 4EKWA 4X89A 2UXNA 3UKMA 1KP3A 3JD4A 2YEVA 4YXWG 5L3EA 2QTOA 4UVAA 4UXNA 1QCEA 2EZPA 4PA7A 4PDMA 1W0JG 1CP9A 5EBMC 1NVPD 4WCEV 1GM7A 1DF4A 1WLEA 2JDIG 3OUSA 2X6BA 3STLC 2Q68A 2HLDG 3FB5C 2DWDC 2P90A 3ZMTA 5CBHA 1F4NA 1BHBA 1KECA 5CMUA 5LGUA 4N23A 1OCZC 3A0RA 2P6JA 4MVMA 2IH3C 3CC4V 4P2ZA 1VQ7V 5LBQA 4HYOA 4RO2A 4MVZA 5IYDO 3B77A 3T1CA 1MSWD 3RW0A 3MHSC 3ZIAG 1GMGA 4F4LA 2EINC 2W6IG 4MVRA 5LHIA 3CCRV 1I5YA 3F7VC 4X88A 5IYBO 1M1KW 1V54B 5HFMA 1E1RG 1YITV 2QM8A 1F51A 2D3OW 3SPCA 1VQ9V 3ZMUA 2QE7G 3CP1A 1QLEC 2LFSA 3K3WA 4PDRA 4MTFA 5EC1C 5H9CA 2QA4V 3SYPA 1OCCB 1SERA 1RPOA 3X2QC 3ZRXA 4XDLA 1FFTB 3G6EV 1DTOA 3E83A 3CMEV 3ABMB 1YHQV 1Q82W 2DW4A 4GT1A 1GTOA 2ITDC 4JASA 2WLKA 3G71V 1Q7YW 2WSSG 2HG5C 3E86A 3GB7C 4ZKIA 1NR1A 3IC7A 2AHZA 3OR7C 1GK9A 5B3SC 5H6RA 2LP7A 4JTAB 4U7OA 1NKDA 3CCEV 3OAAG 3FB8C 5J9PC 4RAIA 1OHHG 1KQSU 4JYBA 5LHGA 2JJ2G 5GW7A 1SRYA 1MG1A 1H38A 4X8AA 3HB3B 3ABKC 3LNMB 1M90W 1EZJA 1VQLV 5KUKA 3AEIA 3QNEA 5B1NA 2A9HA 3LSQA 1ROPA 2PI4A 1S3JA 2BOCC 4KP4A 4CBCA 3E35A 4P9OA 4JAUA 4DO2A 1S72V 5IDJA 4DXWA 1ENVA 3K0DA 2WLIA 2OTJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJJ A;  1NKD A;  1F4M A;  1ROP A;  1GMG A;  1RPR A;  3K79 A;  1GTO A;  1PD3 A;  1RPO A;  2GHY A;  1B6Q A;  4DO2 A;  2IJK A;  2IJH A;  2IJI A;  1F4N A; 
#chains in the Genus database with same CATH topology
 2JGD A;  1AJN A;  4WF9 V;  4DUY B;  4J41 A;  2Q69 A;  2ADP A;  3EFF K;  1FFX A;  4YHH O;  4X62 B;  1SZT A;  2DN9 A;  1G1X B;  1QU7 A;  4OGQ B;  4QGP A;  1XNQ B;  5KLV H;  1S5J A;  4MVS A;  3HPL C;  2BSK A;  3A8T A;  3DTU B;  3H1I H;  3HKE B;  2YUA A;  4CH3 A;  3ASN B;  4XDJ A;  4UFZ A;  3T1H B;  5KHG A;  4PDL A;  1Z5W A;  3M7M X;  2JS3 A;  4MTO A;  3JD0 A;  1BQZ A;  4DR3 O;  2NN4 A;  2V7Q G;  4F6R A;  4ZBM A;  1B3Q A;  5H6Q A;  2B9Z A;  1K34 A;  3E8F A;  4AI8 A;  1PL0 A;  4JYC A;  2WLM A;  1OCR B;  4NKG B;  5CA3 A;  1MSD A;  1BHA A;  2Y0I A;  4FLZ A;  3PJS K;  3AG2 B;  1F4M A;  1N0J A;  1YSC A;  3E8B A;  3EXA A;  3N2G A;  3CD6 V;  1V54 C;  2AW9 A;  2Y4U A;  2WLN A;  3CC7 V;  2OIE A;  5BMV A;  3OMN B;  3CRC A;  4UCR A;  2B1I A;  2Y69 C;  4I50 B;  4FLU A;  1KC8 W;  3CXC U;  3QF7 A;  1L0L H;  4FPP A;  1K97 A;  1MA1 A;  2Z0A A;  2AGA A;  1H2L A;  2YIB A;  2ITC C;  2XAS A;  5IY5 C;  1OCZ B;  2Q6A A;  4HZ3 A;  1VQO V;  4GX5 A;  3P30 A;  3L73 H;  2YXH A;  2YSU B;  2JIZ G;  3JCU Z;  3OTO O;  2YXL A;  3W7W A;  1ZSP A;  4GZR B;  1QLE B;  3QO5 A;  3L75 H;  3X2Q B;  5EYP B;  3JAT B;  3K9A A;  1XNR B;  3DC6 A;  1TUE B;  2YIC A;  2JJ1 G;  3CCL V;  1L0N H;  4FJC C;  1NH2 B;  1D5N A;  3RYH B;  1WP8 A;  2NR5 A;  1WAZ A;  2E3C A;  3M8A A;  4H37 A;  4U7N A;  1S5L Z;  4GCZ A;  1EN4 A;  4B3S B;  2QM7 A;  2YS8 A;  3FKS G;  1R1B A;  4WFF A;  1QBZ A;  4W4L A;  1PM9 A;  1N36 B;  5LOV A;  1N8R W;  3APO A;  5L3D A;  3HKB A;  4JTC B;  1FXK C;  1GH6 A;  2A0L A;  4RUF A;  2CH7 B;  4DW0 A;  1IBL O;  4X64 O;  5B1A C;  3HKD A;  1SET A;  3DXR A;  1JX9 A;  2OIG A;  2MW2 B;  3RBZ A;  5JQG A;  3RT3 C;  1SQP H;  1XHX A;  4JI5 B;  1VIB A;  2P7T C;  4X20 A;  2EJ7 A;  4DR5 O;  4LF8 B;  4B3T B;  5ITZ B;  5EIB D;  4K8X A;  1IBM B;  4I55 A;  3RVZ A;  4DR6 B;  4FVM A;  4X65 O;  1SQF A;  1HR0 B;  4PI0 A;  1B6Q A;  1NVP B;  3CB2 A;  4O4J A;  4UV8 A;  3O9O A;  5LMU O;  1DGS A;  2YDE A;  1HNZ B;  3VBB A;  1WPB A;  4I0X A;  1JFF B;  2R9R B;  5CB4 B;  3SJQ C;  3ABT A;  4LF6 B;  3LDD A;  2CE4 A;  2UUA O;  1TVK A;  2XTA A;  2X6A A;  1VQ4 V;  1LR1 A;  5FLX N;  4I4T A;  4JI0 B;  2P67 A;  4FIP C;  2NNU A;  4H13 B;  1OZ0 A;  2P06 A;  4Z1M G;  4DRX A;  2WLL B;  1YJ9 V;  3ASO B;  4TV8 B;  4EFB A;  3LSS A;  1K5S A;  1I0H A;  4QPJ A;  1TUB B;  2JRI A;  2YEV B;  2F93 B;  4TT3 G;  2FKX A;  3L71 H;  2XAH A;  5CA0 A;  3AK1 A;  4PV1 B;  4TUY B;  2KKW A;  2LW7 A;  2M6Y A;  1WA8 B;  2CGO A;  2WPD G;  3CCV V;  4O4L B;  2ZDI C;  3T2M A;  1QLN A;  2BOB C;  2Y48 A;  2FL4 A;  3OD4 A;  4J7Z A;  2UXD O;  5L3B A;  3MAQ A;  4WFB V;  1KYO F;  4B08 A;  1KBH A;  2A7W A;  2RMK B;  4UV9 A;  3SGI A;  1N34 O;  1I94 O;  2JK5 C;  4NXN B;  3GWO A;  4DW1 A;  4MVO A;  4BWA A;  5GTI Z;  1PNM A;  1HNX B;  4B3M B;  4GX0 A;  1BL8 A;  4GLX A;  3H1L H;  1M56 B;  2K1E A;  3W7T A;  1G6U A;  4O4I A;  3IFX A;  2WLH A;  3A0H Z;  1M57 C;  4FZ1 A;  2M7W A;  3ZJZ A;  4DV5 B;  1R3I C;  2AZ2 A;  4XDK A;  2IU0 A;  3H1K H;  4I5S A;  1M93 A;  3L70 H;  4I9W A;  2BTO A;  3CMA V;  1ARO P;  1Q43 A;  1P7G A;  1RM1 C;  3CJH A;  1K4C C;  3EVK A;  4YHH B;  1H8H G;  2EIM C;  2ZKO A;  5KMG B;  1AI5 A;  4MTX A;  3P3P A;  2LGW A;  1JOY A;  1F23 A;  2ZR2 A;  4E4E A;  4GX2 A;  5JVD B;  3NXS A;  5CN0 A;  2FYU H;  4Z2W A;  2JGD B;  3JSN A;  4DR3 B;  2UXN A;  3UKM A;  3JD4 A;  2VS0 A;  4YXW G;  1FFX B;  4NTX A;  5L3E A;  1IXB A;  2CTW A;  2EZP A;  4PA7 A;  1BQ0 A;  2HHH O;  1VF7 A;  2ZT9 B;  2Q7E A;  1FPO A;  4WCE V;  1WLE A;  5A9G A;  3ZMT A;  1F4N A;  1KEC A;  5CMU A;  5LGU A;  4P2Z A;  5LA6 A;  2H3O A;  5LBQ A;  4RO2 A;  2FML A;  4MVZ A;  1VAR A;  3BFR A;  4NR1 A;  1J5E O;  4F6R B;  2YI8 A;  4F4L A;  2W6I G;  1XQ8 A;  4BW9 A;  5KHK A;  1I5Y A;  1NTM H;  5IYB O;  4DK1 A;  2A3Q A;  1E1R G;  1F51 A;  4LH6 A;  5KHJ A;  3ZMU A;  5EC1 C;  3L9D A;  4JI7 O;  3G6E V;  1DTO A;  4RWU A;  3RYI A;  1YHQ V;  2DW4 A;  3OTO B;  2ZCE A;  3G71 V;  1Q7Y W;  1NR1 A;  3OR7 C;  5B3S C;  3HR0 A;  5JH7 A;  4UCU A;  5GON A;  4JYB A;  5FNV A;  1MG1 A;  2QM4 A;  1H38 A;  1M90 W;  3IC9 A;  1EZJ A;  1IZ3 A;  1GN2 A;  2ZIM A;  4O2B A;  5B1N A;  2A9H A;  4UCT A;  1V9P A;  2PI4 A;  3BA9 A;  4B7E A;  3L72 H;  2RNB A;  2Y0P A;  4JAU A;  1RSO A;  5IDJ A;  5JCO C;  4DV3 O;  5K1X A;  3BRC A;  3U11 A;  4WBN A;  1VQ5 V;  3ZN1 A;  1US6 A;  4EEQ A;  1IBL B;  4X64 B;  4OPA A;  3SR2 C;  5B1O A;  4IT5 A;  3SPH A;  2ZQM A;  2ATK C;  2VRZ A;  1COW G;  3RFR A;  1TGO A;  1VQP V;  4DR5 B;  4DR2 O;  4E2L A;  1V55 B;  5LP6 C;  3P32 A;  1B06 A;  3AG1 C;  4MVQ A;  4R7C A;  1URF A;  3LUT B;  2QDO A;  4H33 A;  1FXV A;  3BY6 A;  4X65 B;  4CZZ A;  5LOV B;  1AJP A;  3HKB B;  1U96 A;  2MK3 A;  3CRA A;  5JJJ B;  2YC0 A;  5LMU B;  2FTK A;  4O2A B;  3TGU H;  3C3T A;  3HKD B;  5DEC A;  3DXR B;  3G67 A;  3AK2 A;  2Q9L A;  3T4Z A;  4FMT A;  2EJR A;  5JQG B;  1GO3 F;  3S3X A;  5K1P A;  2UUA B;  4X20 B;  4R8C A;  2GHY A;  4Q6G A;  3BPZ A;  4I55 B;  4FLV A;  4Z1V A;  3KZI Z;  1J95 A;  3ML0 A;  4CC6 A;  5B1B C;  4DYL A;  2VWK A;  3SPJ A;  2WLJ A;  1XBL A;  2LO1 A;  4O4J B;  4PA6 A;  1PPJ H;  1OCC C;  3O65 A;  3K04 A;  1R6N A;  4G27 B;  2N74 A;  4K3A A;  5BY1 A;  4I0X B;  1XI1 A;  1Q6U A;  2UU9 O;  4DV0 O;  1K3E A;  4KFM A;  3TCU A;  1NTK H;  1XOU A;  1YF2 A;  2OCC C;  1TVK B;  2PF4 E;  1NZ6 A;  4I4T B;  4YJ2 A;  2UXD B;  1Q86 W;  1K5Q A;  3HKC A;  3K03 A;  4DRX B;  5D5Q A;  1PNL A;  2XHB A;  1ZUQ A;  1SQQ H;  1I94 B;  1N34 B;  1M9N A;  1P49 A;  2ZXW C;  3DSQ A;  5AG2 A;  4TQF A;  3E8G A;  4ZI7 A;  5CA0 B;  3H9V A;  2BCC H;  2KSD A;  3K79 A;  3WFV A;  3CWB H;  1XIL A;  2IJI A;  1FKA O;  4OPH A;  1H2M A;  2DOS A;  3TET A;  2Q0A A;  2DJV A;  1GKF A;  1FD9 A;  5LXT A;  3AG3 B;  1Q6I A;  3SYA A;  2B1G A;  3D36 C;  3CRM A;  4X66 O;  2DYR C;  3T4D A;  3D3Q A;  1JQ0 A;  2PI5 A;  1B04 A;  3ZX6 A;  3KCX A;  1BZK A;  2EIJ C;  1VF6 C;  4UUJ C;  5KX5 A;  2RCV A;  2K9P A;  3P3N A;  3ABK B;  1YJW V;  1KP2 A;  5DED A;  3QO8 A;  1THZ A;  3ASN C;  3IJ4 A;  2LJ2 A;  4BR6 A;  2KB1 A;  1KUQ A;  3ICX A;  4O4I B;  4CC5 A;  4DK0 A;  1U97 A;  3CRQ A;  4TV9 B;  3VQX A;  2BE3 A;  4BAY A;  1XL4 A;  3K59 A;  3ETD A;  2XND G;  3JAK A;  4YY3 O;  1OCR C;  2OT5 A;  1QVF U;  3AG2 C;  1RFY A;  3CJH B;  2OCH A;  3CCJ V;  1NU1 H;  4F6E A;  4AQY O;  2HHH B;  2N05 A;  4QE9 A;  1MNG A;  2A79 B;  3OTF A;  1UPG A;  2GTA A;  2DE0 X;  1ZL8 A;  3ETG A;  4JI8 O;  1MZF A;  4CS4 A;  3ABM C;  4MT8 A;  1J5E B;  2GBO A;  3B8N A;  4PA3 A;  3OGC C;  4FM2 A;  1N33 O;  2QWN B;  3TXS A;  2IJK A;  3PN1 A;  1G4Y B;  5EZY A;  4WFH A;  3ZRV A;  1P4R A;  3SJC C;  2RJZ A;  3RN4 A;  2QKS A;  3VQY A;  1PD3 A;  2ZE5 A;  4JI7 B;  3U0Z A;  3T1Y O;  2XAG A;  2PTM A;  4QIW F;  5EBW C;  3BAA A;  4LNU B;  3R65 A;  3SPI A;  2C2A A;  1MAB G;  4PD4 F;  4I7Z B;  1HWY A;  2Y69 B;  3LDE A;  5LA6 B;  1L1F A;  2UUC O;  3JD1 A;  4ZIB A;  3K58 A;  3LSU A;  4AHC A;  2WAM A;  2GSM B;  4RUE A;  4JYA O;  5IY5 B;  5C93 A;  4NTY A;  2Q73 A;  2YIA A;  1KKD A;  4LC1 A;  1R3J C;  2YI9 A;  3RVY A;  2OTL V;  1XMO O;  1OCO C;  3D8C A;  3CCS V;  3RYI B;  5EIB C;  5JCO A;  3FYI B;  4P30 A;  2XAQ A;  4NB5 A;  2Q8V A;  1NH2 D;  1I5X A;  1PV0 A;  4DV1 B;  4DV3 B;  5IE9 A;  5JH7 B;  4O2A A;  1YCI A;  2HFE C;  1YJN V;  3J81 N;  5GON B;  4UVB A;  4R6Z A;  4GYC B;  5FNV B;  1R6K A;  3CSX A;  4U3J A;  3Q4H A;  5LP6 A;  4O2B B;  3H1H H;  4DR2 B;  4LH7 A;  1EM1 A;  3FYE B;  4D6T H;  2RDC A;  3B40 A;  2XAF A;  3K0G A;  3BCC H;  5DN6 G;  4PDV A;  4AIL C;  1NT2 B;  1RSO B;  2UXX A;  4GX1 A;  4PA4 A;  3VOU A;  5IYZ A;  1SES A;  4H0L B;  1Q90 D;  2CUG A;  4K8Z A;  1YI2 V;  2H8P C;  4GKK O;  2EIL B;  1QR8 A;  2ZNJ A;  5B1A B;  3S3W A;  4WBN B;  4X89 A;  2QGN A;  4IIJ A;  5H5N A;  4UXN A;  1ZLZ A;  2AXT Z;  4PDM A;  2KQX A;  1CP9 A;  1NVP D;  4JYY A;  1GN3 A;  5JWP A;  1XMQ O;  4OX9 O;  1BHB A;  4N23 A;  3A0R A;  3UCS C;  2IH3 C;  5IWA O;  2QSA A;  3THO A;  5IYD O;  4FLX A;  4FZ0 A;  1MSW D;  1HDJ A;  3TJT A;  2QKA A;  2BTQ A;  1GMG A;  2UU9 B;  4DV0 B;  2EIN C;  4MVR A;  1YIT V;  3CP1 A;  5H9C A;  4PDR A;  4MTF A;  4YIP A;  1RPO A;  5KAI Z;  1FFT B;  1XRE A;  1FAF A;  1GTO A;  2WLK A;  2PYL A;  2CTR A;  2HG5 C;  2WSS G;  3E86 A;  3GB7 C;  4ZKI A;  4FFB A;  5H6R A;  3JAW B;  4HNA A;  4J10 A;  3FB8 C;  5J9P C;  1O9H A;  4X1I A;  1I7F A;  1QNM A;  2JJ2 G;  2CGN A;  2OYQ A;  4JI4 O;  3QVN A;  3HB3 B;  2XUM A;  3LNM B;  1VQL V;  5KUK A;  4TV9 A;  3QNE A;  4YJ2 B;  1Y67 A;  1HP8 A;  3HKC B;  5CA1 A;  4LFB O;  4X66 B;  3C3S A;  1D5A A;  4NTW A;  4CBC A;  4CS3 A;  1S72 V;  1VF6 A;  1ENV A;  3K0D A;  2WLI A;  4XBF A;  4ZI7 B;  1NBM G;  2JVD A;  3MHH C;  3ZHT A;  3FB7 C;  3K9S A;  3CE2 A;  3ZMS A;  5J2T A;  1W0K G;  3IAY A;  1VQ6 V;  5LXT B;  4X9Q A;  4FK5 C;  2IBZ H;  3FX7 A;  5KHH A;  2Q5Z A;  4UCO A;  2IJH A;  4U3F H;  5TIS Z;  4JI3 O;  4YY3 B;  1RM1 B;  4JI2 O;  4ICG A;  1SQX H;  2IJJ A;  4WFG A;  2P22 C;  5DM6 V;  2E76 B;  3CCM V;  2DQ0 A;  2EZO A;  5KX5 B;  1H2S B;  1YIJ V;  3C90 A;  5KAF Z;  4DR7 O;  1YTF B;  3DGE A;  1TA8 A;  4AQY B;  4JTD B;  1IBK O;  1CPY A;  2G38 A;  1RP3 B;  3SDL A;  4JGS A;  4LNU A;  1VQN V;  1VMG A;  3B2E E;  2DQ3 A;  2GUZ A;  2UUB O;  1NJI W;  2Q0O C;  5E1A C;  4JI8 B;  5LGT A;  3JAK B;  4OXS A;  5D5P A;  3OEE G;  5BZB A;  1SQV H;  2EX3 A;  1W2B U;  2P4V A;  2QKC A;  1N33 B;  1CEZ A;  3K57 A;  1H2G A;  3RWR D;  3I5D A;  1VQK V;  3WG7 B;  4KUM A;  5CBG A;  3BHP A;  2GTS A;  3B8M A;  4I9Q A;  4O4H A;  3N2K A;  3ZCC A;  3T1Y B;  3IGA C;  1L8D A;  3F5W C;  3E89 A;  5J2U A;  2PZS A;  1ZL8 B;  1TAE A;  3TK1 A;  1H2N A;  4CH6 A;  2HP8 A;  4LWS A;  3M99 B;  1EZV H;  4FLT A;  2UUC B;  1K7D A;  3APQ A;  1WP7 A;  2LW1 A;  1K92 A;  1GM8 A;  4JYA B;  3MD0 A;  4BIZ A;  5EZY B;  3UT5 A;  3AG4 B;  3ZRW A;  4LF9 O;  4CH5 A;  4TWK A;  2DYS C;  1AI4 A;  2DWE C;  4BIO A;  1XMO B;  1R73 A;  1XEQ A;  4GUN A;  5FPR A;  1R3K C;  2QEX V;  1JPX A;  2ILM A;  3OMA B;  4QJF B;  2HKO A;  1FXK A;  2YIB D;  3ABL B;  1WNS A;  2EIK C;  1V55 C;  2CAZ C;  2ODM A;  4TSF G;  1K8A W;  5LGN A;  1ZTE A;  2XOK G;  3OGI B;  3QO7 A;  4FFK A;  3CEI A;  2ZD9 A;  3SPG A;  1NR7 A;  2UXB O;  5CBF A;  4IYH A;  1FXH A;  4MVU A;  1AI6 A;  1IXM A;  2R9I A;  4QNH B;  4X1K A;  3ZHQ A;  3ZHR A;  4EFE A;  4GKK B;  5LMN O;  5BR8 O;  4LF8 O;  2F4V O;  1GN6 A;  1MOF A;  4K0K O;  5C8Y A;  1P7B A;  3ZRS A;  5FPO A;  1EN6 A;  4LFA O;  2JS5 A;  4MSW C;  3CCQ V;  5L3F A;  4U3J B;  3CC2 V;  3Q4H B;  5LP6 B;  2QWR B;  3AG1 B;  4MS2 A;  1BMF G;  1UFI A;  1WB8 A;  1XMQ B;  4OX9 B;  2KG7 A;  2V1D A;  5KUM A;  1S76 D;  3ZED A;  1DF5 A;  3WB0 A;  5IYZ B;  5IWA B;  3I56 V;  3JAW A;  4RQE A;  4LCU C;  1YEW A;  5IYC O;  2W0X A;  1T5E A;  3ETQ A;  1WJZ A;  2E5L O;  1K9M W;  4IIJ B;  2ZDI A;  3OW2 U;  4UVC A;  3RYC A;  5KHI A;  1G8M A;  4H44 B;  1N4C A;  5KA6 A;  2ZIO A;  2VQE O;  1WPX A;  3F7Y C;  5B1B B;  3F5T A;  2F43 G;  1JA8 A;  1ZX3 A;  3W7U A;  4JI6 O;  2HJD A;  3KCY A;  3ZS8 C;  4HBN A;  3AG3 C;  5L3G A;  2BTQ B;  2GDS A;  4FM0 A;  4DV4 O;  1DLB A;  4RQF A;  2ZR3 A;  1PKX A;  2LFR A;  2OCC B;  4IGG A;  1AR4 A;  3JCZ A;  2HJF C;  4JI4 B;  4UCS A;  2R9A A;  3EHB B;  1Y74 A;  3OFN G;  3JAR A;  4NXM O;  4N21 A;  4LFB B;  1FYJ A;  1WN7 A;  4JPR A;  5LYJ A;  1E1Q G;  2QR4 A;  2ZXW B;  4HAM A;  3JYC A;  3AK3 A;  3JD2 A;  1JR9 A;  4FFB B;  3SYQ A;  1NQT A;  4PA9 A;  4UB6 Z;  3H01 A;  2N04 A;  4HNA B;  1Q8I A;  4DV2 O;  2Q7H A;  3ZMV A;  4X1I B;  4X1Y A;  4EB6 A;  1MZE A;  3CPW U;  5EK0 A;  4LFC O;  2CK3 G;  3ABU A;  3ZMZ A;  3I55 V;  1N32 O;  1LNQ A;  1SKV A;  3L74 H;  1SF9 A;  3VQV A;  2IW5 A;  2DYR B;  3UQ8 A;  3RYF A;  5CA1 B;  1XUQ A;  4B3R O;  2F95 B;  1RPR A;  4JI1 O;  5EBL C;  4JI3 B;  2ZM6 O;  4JI2 B;  4BW5 A;  2EIJ B;  4CS2 A;  4DUZ O;  5H2F Z;  2WLI B;  3N27 A;  1AR5 A;  4NYK A;  2FB5 A;  4ASU G;  4DV7 O;  4EKW A;  4DR7 B;  1KP3 A;  1IBK B;  3CS5 A;  1QCE A;  5J2T B;  1W0J G;  4B7K A;  2HEP A;  1W59 A;  5E79 Z;  2JDI G;  3FAV A;  3OUS A;  3STL C;  2Q68 A;  3FB5 C;  2UUB B;  2DWD C;  1D2D A;  5IJ0 A;  1Z2G A;  5B66 Z;  5CBH A;  1OCZ C;  2P6J A;  3G6B A;  4HYO A;  3NR7 A;  3B77 A;  4IHJ A;  3RW0 A;  3JAS A;  1FJG O;  3CCR V;  5LHI A;  1X4T A;  1Y76 A;  4X88 A;  1V54 B;  5HFM A;  2QM8 A;  3SPC A;  1VQ9 V;  2PYJ A;  2QE7 G;  1QLE C;  2LFS A;  3K3W A;  2QA4 V;  2V4D A;  1SER A;  1KMI Z;  3X2Q C;  3ZRX A;  2GUZ B;  2GV9 A;  2YXY A;  2VQF O;  4DR1 O;  3E83 A;  3B4S A;  3ABM B;  1Q82 W;  4KHP O;  2ITD C;  4JAS A;  3ZHS A;  1H2K A;  1NS1 A;  2AHZ A;  4U7O A;  4JTA B;  1M4U A;  2Y4T A;  1OHH G;  1KU9 A;  5LHG A;  4LF9 B;  5IJ9 A;  1X59 A;  4O4H B;  1JMK C;  3N2K B;  2CTP A;  1SQG A;  3JAM N;  3AEI A;  1YDX A;  4C7U A;  5J2U B;  3K5N A;  5GTH Z;  3R66 A;  2YID A;  1ROP A;  3CXH F;  4PJ0 Z;  1O9G A;  4KP4 A;  4LWS B;  4DO2 A;  2LGQ A;  3OT7 A;  3E22 A;  3UO3 A;  4DR4 O;  4UCV A;  1A32 A;  2E75 B;  2RN9 A;  5KA5 A;  3KG2 A;  3ZN0 A;  1HNW O;  2HR3 A;  2X6C A;  3UT5 B;  1QR9 A;  4J9Z B;  3ZRW B;  4JV5 O;  4ABM A;  4ZHQ A;  2UXC O;  4P9P A;  3W7S A;  2OWO A;  1JJO A;  4GKJ O;  1KB9 F;  2UXB B;  1OCO B;  1E79 G;  1M5I A;  4NVP A;  2EIL C;  1FXK B;  1VEW A;  1Y66 A;  3D3I A;  1Q81 W;  1ZWI C;  5LMN B;  2ZE8 A;  5BR8 B;  2F4V B;  4K0K B;  1YVW A;  2JEX A;  4MW3 A;  2AZ0 A;  1F7Y A;  3SJA C;  3ASO C;  4LFA B;  1Q5O A;  3GWK C;  4KL1 A;  1FS0 G;  1ORQ C;  3BEH A;  2XT9 A;  3CCU V;  1YXB A;  3SYO A;  1IUR A;  1AB3 A;  5L3C A;  2LQT A;  4YJ3 A;  4DV6 O;  3J80 N;  4D7S A;  3OM3 B;  4X1K B;  2R70 A;  2W0F C;  1PNK A;  3LDC A;  1AP6 A;  4LF7 O;  2PY5 A;  4JZG A;  5C8Y B;  2IH1 C;  1S77 D;  2E5L B;  1H8E G;  3DC5 A;  2W6J G;  1BSM A;  3OMI B;  5LL6 Y;  2VQE B;  1K33 A;  4FLY A;  3JD3 A;  4FM1 A;  2XAJ A;  3LNN A;  2KG7 B;  1PL4 A;  1SA0 A;  5FL7 G;  1VQ8 V;  1EN5 A;  1CXZ B;  1AI7 A;  1M56 C;  3CHX A;  4JI6 B;  2VWJ A;  4G2K A;  4JZ2 A;  4LF5 O;  1OJH A;  4WFA V;  2EIN B;  4LP8 A;  4IYI A;  1GM9 A;  4DV4 B;  2ZNI A;  2RQ6 A;  4QPK A;  1I08 A;  3RYC B;  1S5H C;  3D36 A;  4NXM B;  3FB6 C;  4PEL A;  2WA3 A;  2QWQ B;  1R3L C;  3G80 A;  1P84 F;  2X0L A;  2L6L A;  1S0V A;  1K73 W;  3E2E A;  3JAL B;  3HKE A;  4LF4 O;  3UM7 A;  5A2Q N;  1BS3 A;  1JCH A;  1BGY H;  4ZOL B;  4DV2 B;  2AHY A;  4Q20 A;  4L8J A;  4LFC B;  4J80 A;  1KKC A;  3K08 A;  1M57 B;  4DUY O;  2NLJ C;  1N0N A;  1N32 B;  1VQM V;  1Y74 B;  2ZE7 A;  3JAR B;  3QTC A;  1Y4M A;  4X62 O;  4WFE A;  4B3R B;  2P4K A;  5LYJ B;  4JI1 B;  3K06 A;  3J7A U;  3H1J H;  3WU2 Z;  1XNQ O;  4J9Y B;  1EFR G;  3CYO A;  2ZM6 B;  2Q67 A;  1SZX A;  3WB2 A;  4J42 A;  3SJB C;  4DUZ B;  2EIM B;  1NI8 A;  2F66 C;  3U10 A;  4DV7 B;  3T1H O;  1K4D C;  1AJQ A;  3B09 A;  4X1Y B;  4EB6 B;  3STZ C;  4BIU A;  4I50 A;  5EC2 C;  5JJE B;  3JSL A;  4JF3 A;  4UB8 Z;  2Z3Y A;  4D7T A;  3RYF B;  1UJW B;  1YTF D;  2R72 A;  2CDY A;  1DK1 A;  1SQB H;  2ARH A;  3WG7 C;  3MDS A;  2HVJ C;  2EBO A;  3SYC A;  1Q6H A;  2HVK C;  2BSK B;  1LUW A;  3OR6 C;  3FD9 A;  3G4S V;  1Z5V A;  1QVG U;  1IX9 A;  1IDS A;  2H94 A;  1FJG B;  2F23 A;  3A0B Z;  4TOI A;  5IT9 N;  4FLW A;  2QWP B;  2X7R B;  5EYP A;  3JAT A;  1JVM A;  4PHZ A;  3FAV B;  3RYH A;  2VQF B;  1VF5 B;  3CRR A;  4DR1 B;  5IJ0 B;  3BAB A;  3WB1 A;  1XHZ A;  4KHP B;  3AG4 C;  4JAV A;  3E8H A;  1AR1 B;  3K5O A;  3N2G B;  1BT8 A;  1SC5 B;  4IHJ B;  3OUF A;  3CX5 F;  5BMV B;  3W7X A;  4KXR A;  3JAS B;  2IU3 A;  2CTQ A;  1Y76 B;  3ABL C;  4K35 A;  4PI2 A;  2CH7 A;  2B5U A;  1OV9 A;  1SS3 A;  4QE7 A;  4L87 A;  1GN4 A;  1PP9 H;  2ZE6 A;  1XNR O;  5B3S B;  2QWO B;  3OE7 G;  1IVS A;  1MMM A;  1QHT A;  4B3S O;  5ITZ A;  4DR4 B;  1XL6 A;  1WB7 A;  2WA4 A;  3ETE A;  3QG5 A;  1HNW B;  1N36 O;  1AP5 A;  2DYS B;  2ETN A;  4MW8 A;  4JV5 B;  2UXC B;  5B5E Z;  4DV1 O;  3OEH G;  4GKJ B;  2QJ1 A;  4LBE C;  5IJ9 B;  2F1M A;  2Z5U A;  1HW7 A;  5F2V O;  5HFL A;  3ZHV A;  4J11 A;  4J7J A;  1JFF A;  4MTG A;  4R50 A;  5CB4 A;  2JEU A;  5BXZ A;  4LR3 A;  4JI5 O;  2WWW A;  3A2F A;  2EIK B;  4IL6 Z;  3FFQ A;  3UO2 A;  1AVM A;  5LHH A;  1ZAU A;  2QTS A;  1EBO A;  4B3T O;  1YZB A;  3E22 B;  1JJ2 U;  4W4K A;  3ZHU A;  2WLL A;  1IBM O;  1VP7 A;  4YIO A;  4G28 B;  4TV8 A;  4DR6 O;  4A5U B;  1HR0 O;  1TUB A;  4ZHQ B;  2YEV A;  2ADQ B;  2QTO A;  4UVA A;  1HNZ O;  4TUY A;  5EBM C;  4DV6 B;  1GM7 A;  4LF6 O;  1WA8 A;  1DF4 A;  2X6B A;  2HLD G;  4O4L A;  1R6T A;  2P90 A;  3AG7 A;  3VQW A;  3BVO A;  4JI0 O;  3K5L A;  4LF7 B;  4MVM A;  3CC4 V;  1VQ7 V;  2A06 H;  3T1C A;  3MHS C;  3ZIA G;  4CH4 A;  2PGG A;  5JJN B;  2PUS A;  2O57 A;  2E74 B;  3F7V C;  1M1K W;  1Y6X A;  3GVM A;  1BE3 H;  2L35 A;  2P5O A;  2D3O W;  2Q7G A;  4YJ3 B;  1KD1 W;  1GAX A;  3SYP A;  3JAL A;  1OCC B;  4XDL A;  1BCC H;  2ZIN A;  3CME V;  1AIL A;  3TXQ A;  3ZBH A;  2JGU A;  4LF5 B;  4GT1 A;  1Q3E A;  4ZOL A;  2Q4P A;  3IC7 A;  1GK9 A;  4J7K A;  2D2C B;  2LP7 A;  1LUV A;  2DMX A;  1NTZ H;  1NKD A;  3CCE V;  3OAA G;  4NXN O;  4RAI A;  1KQS U;  3KKY A;  3K5M A;  5GW7 A;  1SRY A;  1HNX O;  4B3M O;  4X8A A;  2EUL A;  1GRJ A;  3ABK C;  5KMG A;  1XDC A;  1SA0 B;  3LSQ A;  4JAA A;  3BA8 A;  4TQD A;  4LF4 B;  1S3J A;  2BOC C;  5JVD A;  1QQC A;  3E35 A;  4P9O A;  4DV5 O;  3RGB A;  4DXW A;  2IM9 A;  2OTJ V; 
#chains in the Genus database with same CATH homology
 4XBF A;  5KA5 A;  3KG2 A;  1AJN A;  1NBM G;  4WF9 V;  3ZN0 A;  1VQ5 V;  2HR3 A;  2Q69 A;  2X6C A;  3ZN1 A;  1QR9 A;  4J9Z B;  3ZRW B;  3MHH C;  4P9P A;  5B1O A;  3W7S A;  3EFF K;  3SPH A;  2ZQM A;  3FB7 C;  2ATK C;  1COW G;  1OCO B;  1E79 G;  1SZT A;  3ZMS A;  1W0K G;  2EIL C;  1VQP V;  1VQ6 V;  4FK5 C;  4E2L A;  1V55 B;  3P32 A;  4MVS A;  3HPL C;  3AG1 C;  1FXK B;  4MVQ A;  4R7C A;  3DTU B;  3LUT B;  2IJH A;  1Y66 A;  3D3I A;  1Q81 W;  1ZWI C;  4H33 A;  1FXV A;  3ASN B;  3BY6 A;  4XDJ A;  1RM1 B;  4PDL A;  4CZZ A;  2IJJ A;  4WFG A;  1AJP A;  5DM6 V;  2JEX A;  4MW3 A;  2MK3 A;  4MTO A;  3CCM V;  2DQ0 A;  3JD0 A;  2EZO A;  1YIJ V;  2FTK A;  3ASO C;  1YTF B;  1FS0 G;  2V7Q G;  3DGE A;  1ORQ C;  3BEH A;  4JTD B;  4ZBM A;  3CCU V;  5H6Q A;  3T4Z A;  1K34 A;  4FMT A;  2EJR A;  3E8F A;  3SYO A;  1GO3 F;  1PL0 A;  1CPY A;  4JYC A;  2WLM A;  1OCR B;  5CA3 A;  5L3C A;  1BHA A;  4R8C A;  4JGS A;  2GHY A;  1VQN V;  2DQ3 A;  3PJS K;  3AG2 B;  3OM3 B;  1F4M A;  2W0F C;  1PNK A;  1YSC A;  3E8B A;  3LDC A;  1NJI W;  3CD6 V;  1V54 C;  5E1A C;  5LGT A;  5BZB A;  1J95 A;  4OXS A;  2WLN A;  3ML0 A;  3OEE G;  5B1B C;  3CC7 V;  3SPJ A;  2WLJ A;  3OMN B;  2IH1 C;  1S77 D;  2B1I A;  1W2B U;  4PA6 A;  1OCC C;  1CEZ A;  1H8E G;  2Y69 C;  3K04 A;  1R6N A;  4G27 B;  3CXC U;  1KC8 W;  1H2G A;  1VQK V;  3WG7 B;  4FPP A;  4KUM A;  5CBG A;  1K97 A;  2W6J G;  1K3E A;  4KFM A;  3OMI B;  3TCU A;  3B8M A;  1K33 A;  2OCC C;  3ZCC A;  2ITC C;  3IGA C;  2XAS A;  3JD3 A;  5IY5 C;  1OCZ B;  3F5W C;  2Q6A A;  4HZ3 A;  1VQO V;  4GX5 A;  2XAJ A;  3E89 A;  1Q86 W;  3P30 A;  1K5Q A;  5FL7 G;  1VQ8 V;  3K03 A;  1AI7 A;  1M56 C;  3TK1 A;  2YSU B;  1PNL A;  4G2K A;  2JIZ G;  3M99 B;  4WFA V;  1M9N A;  2ZXW C;  1K7D A;  2EIN B;  4LP8 A;  1GM9 A;  3E8G A;  1K92 A;  3W7W A;  4QPK A;  1GM8 A;  3MD0 A;  4BIZ A;  3AG4 B;  1QLE B;  1S5H C;  3K79 A;  3WFV A;  3ZRW A;  3D36 A;  4TWK A;  2DYS C;  3QO5 A;  1AI4 A;  2IJI A;  3FB6 C;  3X2Q B;  3K9A A;  2DWE C;  1TUE B;  4PEL A;  3TET A;  2JJ1 G;  3CCL V;  1NH2 B;  4FJC C;  1R73 A;  1GKF A;  1R3L C;  3AG3 B;  1R3K C;  2X0L A;  4H37 A;  1S0V A;  4U7N A;  3SYA A;  1K73 W;  3E2E A;  2QEX V;  1JPX A;  2B1G A;  4GCZ A;  3OMA B;  4QJF B;  2QM7 A;  2HKO A;  1FXK A;  2DYR C;  3ABL B;  3FKS G;  4WFF A;  3T4D A;  3UM7 A;  1QBZ A;  1JQ0 A;  2PI5 A;  1JCH A;  2AHY A;  2EIK C;  4Q20 A;  1N8R W;  5L3D A;  1V55 C;  2EIJ C;  3K08 A;  1FXK C;  1M57 B;  4JTC B;  4UUJ C;  1YJW V;  3ABK B;  2A0L A;  4RUF A;  1KP2 A;  4TSF G;  1K8A W;  5LGN A;  2NLJ C;  2XOK G;  1VQM V;  3QO8 A;  1THZ A;  5B1A C;  3ASN C;  3QO7 A;  1SET A;  1JX9 A;  2KB1 A;  2ZD9 A;  3SPG A;  1Y4M A;  1NR7 A;  5CBF A;  3RBZ A;  4WFE A;  1FXH A;  2P7T C;  4MVU A;  3K06 A;  1AI6 A;  1IXM A;  2R9I A;  4J9Y B;  4QNH B;  1EFR G;  3CYO A;  2Q67 A;  4BAY A;  1XL4 A;  2EIM B;  3RVZ A;  3ETD A;  2XND G;  1MOF A;  1OCR C;  1K4D C;  2OT5 A;  1QVF U;  1AJQ A;  1P7B A;  1B6Q A;  3STZ C;  4BIU A;  1NVP B;  3ZRS A;  3AG2 C;  5EC2 C;  4UV8 A;  3CCJ V;  3VBB A;  4JF3 A;  4MSW C;  3CCQ V;  5L3F A;  3CC2 V;  2Z3Y A;  2R9R B;  3AG1 B;  3SJQ C;  3ABT A;  4MS2 A;  3LDD A;  1BMF G;  1UJW B;  1YTF D;  4QE9 A;  2A79 B;  2X6A A;  1VQ4 V;  3WG7 C;  2V1D A;  2HVJ C;  5KUM A;  1S76 D;  1DF5 A;  2P67 A;  4FIP C;  2EBO A;  2NNU A;  3SYC A;  1OZ0 A;  2HVK C;  4Z1M G;  3ETG A;  3I56 V;  2WLL B;  3OR6 C;  4RQE A;  3G4S V;  4LCU C;  1YJ9 V;  3ASO B;  1QVG U;  5IYC O;  3LSS A;  3ABM C;  4MT8 A;  1K5S A;  4QPJ A;  3B8N A;  4PA3 A;  3OGC C;  1K9M W;  2YEV B;  2H94 A;  4TT3 G;  2IJK A;  2XAH A;  2ZDI A;  3OW2 U;  1G4Y B;  4UVC A;  4WFH A;  3ZRV A;  1P4R A;  1G8M A;  5KA6 A;  2X7R B;  2QKS A;  1PD3 A;  1JVM A;  2WPD G;  3CCV V;  2XAG A;  4QIW F;  2ZDI C;  1WPX A;  3F7Y C;  5B1B B;  5EBW C;  3T2M A;  1QLN A;  2BOB C;  2Y48 A;  3AG4 C;  3R65 A;  3SPI A;  2C2A A;  1MAB G;  5L3B A;  2F43 G;  4WFB V;  1HWY A;  2Y69 B;  3LDE A;  4JAV A;  3W7U A;  1L1F A;  3E8H A;  1AR1 B;  4UV9 A;  3OUF A;  2JK5 C;  3AG3 C;  3JD1 A;  5L3G A;  3GWO A;  3W7X A;  2IU3 A;  4MVO A;  1DLB A;  4RQF A;  1PNM A;  2ZR3 A;  1PKX A;  2LFR A;  2WAM A;  2OCC B;  2GSM B;  4RUE A;  3ABL C;  3JCZ A;  4GX0 A;  5IY5 B;  1BL8 A;  2HJF C;  5C93 A;  2B5U A;  3EHB B;  1KKD A;  3OFN G;  4QE7 A;  4L87 A;  4LC1 A;  4N21 A;  1R3J C;  1M56 B;  1KD1 W;  2K1E A;  5B3S B;  3W7T A;  3RVY A;  2OTL V;  3IFX A;  3OE7 G;  2WLH A;  1M57 C;  1OCO C;  4JPR A;  3CCS V;  2M7W A;  1E1Q G;  4HAM A;  2ZXW B;  3ZJZ A;  3FYI B;  4P30 A;  2XAQ A;  1R3I C;  3JYC A;  4XDK A;  3JD2 A;  2IU0 A;  1NH2 D;  4I5S A;  1I5X A;  4I9W A;  1XL6 A;  3SYQ A;  1NQT A;  4PA9 A;  3H01 A;  3CMA V;  1ARO P;  3ETE A;  2DYS B;  2HFE C;  4MW8 A;  1YJN V;  3ZMV A;  4UVB A;  1RM1 C;  3CPW U;  4R6Z A;  5EK0 A;  3OEH G;  1K4C C;  2CK3 G;  3ABU A;  4LBE C;  3ZMZ A;  1R6K A;  2Z5U A;  1H8H G;  2EIM C;  3I55 V;  1LNQ A;  5HFL A;  2IW5 A;  1AI5 A;  4MTX A;  4MTG A;  4R50 A;  2JEU A;  2DYR B;  3FYE B;  1JOY A;  1F23 A;  2ZR2 A;  2XAF A;  3K0G A;  2WWW A;  4GX2 A;  1RPR A;  5EBL C;  5DN6 G;  2EIK B;  4PDV A;  5LHH A;  2UXX A;  4GX1 A;  4PA4 A;  3NXS A;  5CN0 A;  3VOU A;  1EBO A;  4BW5 A;  1JJ2 U;  1SES A;  2EIJ B;  2WLI B;  1YI2 V;  2H8P C;  2WLL A;  4G28 B;  4ASU G;  2EIL B;  1QR8 A;  5B1A B;  4EKW A;  4X89 A;  2UXN A;  3UKM A;  1KP3 A;  3JD4 A;  2YEV A;  4YXW G;  5L3E A;  2QTO A;  4UVA A;  4UXN A;  1QCE A;  2EZP A;  4PA7 A;  4PDM A;  1W0J G;  1CP9 A;  5EBM C;  1NVP D;  4WCE V;  1GM7 A;  1DF4 A;  1WLE A;  2JDI G;  3OUS A;  2X6B A;  3STL C;  2Q68 A;  2HLD G;  3FB5 C;  2DWD C;  2P90 A;  3ZMT A;  5CBH A;  1F4N A;  1BHB A;  1KEC A;  5CMU A;  5LGU A;  4N23 A;  1OCZ C;  3A0R A;  2P6J A;  4MVM A;  2IH3 C;  3CC4 V;  4P2Z A;  1VQ7 V;  5LBQ A;  4HYO A;  4RO2 A;  4MVZ A;  5IYD O;  3B77 A;  3T1C A;  1MSW D;  3RW0 A;  3MHS C;  3ZIA G;  1GMG A;  4F4L A;  2EIN C;  2W6I G;  4MVR A;  5LHI A;  3CCR V;  1I5Y A;  3F7V C;  4X88 A;  5IYB O;  1M1K W;  1V54 B;  5HFM A;  1E1R G;  1YIT V;  2QM8 A;  1F51 A;  2D3O W;  3SPC A;  1VQ9 V;  3ZMU A;  2QE7 G;  3CP1 A;  1QLE C;  2LFS A;  3K3W A;  4PDR A;  4MTF A;  5EC1 C;  5H9C A;  2QA4 V;  3SYP A;  1OCC B;  1SER A;  1RPO A;  3X2Q C;  3ZRX A;  4XDL A;  1FFT B;  3G6E V;  1DTO A;  3E83 A;  3CME V;  3ABM B;  1YHQ V;  1Q82 W;  2DW4 A;  4GT1 A;  1GTO A;  2ITD C;  4JAS A;  2WLK A;  3G71 V;  1Q7Y W;  2WSS G;  2HG5 C;  3E86 A;  3GB7 C;  4ZKI A;  1NR1 A;  3IC7 A;  2AHZ A;  3OR7 C;  1GK9 A;  5B3S C;  5H6R A;  2LP7 A;  4JTA B;  4U7O A;  1NKD A;  3CCE V;  3OAA G;  3FB8 C;  5J9P C;  4RAI A;  1OHH G;  1KQS U;  4JYB A;  5LHG A;  2JJ2 G;  5GW7 A;  1SRY A;  1MG1 A;  1H38 A;  4X8A A;  3HB3 B;  3ABK C;  3LNM B;  1M90 W;  1EZJ A;  1VQL V;  5KUK A;  3AEI A;  3QNE A;  5B1N A;  2A9H A;  3LSQ A;  1ROP A;  2PI4 A;  1S3J A;  2BOC C;  4KP4 A;  4CBC A;  3E35 A;  4P9O A;  4JAU A;  4DO2 A;  1S72 V;  5IDJ A;  4DXW A;  1ENV A;  3K0D A;  2WLI A;  2OTJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...