3K79A

C38a, c52v cysteine-free variant of rop (rom)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADIAESLHDHADELYRSVLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine-free Rop: a four-helix bundle core mutant has wild-type stability and structure but dramatically different unfolding kinetics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Regulatory protein rop
total genus 27
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k79A00
1B6QA 1NKDA 2IJJA 1ROPA 1GTOA 1RPOA 1PD3A 2GHYA 2IJKA 3K79A 1RPRA 1F4MA 1GMGA 2IJHA 2IJIA 4DO2A 1F4NA
chains in the Genus database with same CATH superfamily
4RAIA 2JS3A 1ZSPA 2Q5ZA 3CXCU 4DV3O 1T5EA 2DJVA 3K5OA 3M7MX 4WFBV 1OCCB 1HNXB 4L8JA 2ZE5A 3D3IA 2D2CB 3FB6C 2XAGA 4LF8O 1NU1H 2RMKB 1FKAO 2YI9A 1OHHG 4I7ZB 4LP8A 2DW4A 3VQXA 1LUWA 3L70H 4LF6B 2Y4UA 5JJEB 2JJ2G 4JI7B 3B09A 4AQYO 1QBZA 1XHXA 3JD3A 1MSDA 1K8AW 4CC6A 3SYQA 3RYCA 3E8BA 3OUFA 4YJ2B 4DR6O 1M57B 4X64B 1Y74A 1VQKV 4MTXA 1OV9A 1QLEC 1W59A 1KU9A 4LCUC 1RSOA 3ZMZA 3I55V 3G67A 4P2ZA 5EBMC 3J7AU 3D3QA 3S3XA 1AJPA 1AB3A 3CX5F 4P9PA 2ZR2A 2WLJA 3UQ8A 3CWBH 1NVPD 3STZC 2IJJA 5L3FA 3JALB 1X59A 1COWG 2BCCH 3GWKC 2FYUH 2YIAA 3W7XA 2JDIG 1S77D 4DR1B 2QM8A 3JAWA 3CHXA 5LGUA 3CJHA 5LGNA 1VQPV 4DR7B 1K9MW 1W0KG 4IL6Z 2CH7A 2DOSA 4RQFA 3ABLB 4LFAO 3JD1A 3JARA 1PNLA 2X6AA 2ARHA 4DR3O 1Z5WA 2GUZB 2CTRA 3VQYA 2GDSA 5JH7A 3FB7C 4CS4A 4QIWF 2Y0PA 3BPZA 4O2BB 5LMUB 2F66C 2UXCB 4JAUA 1GO3F 3ZRWA 1CEZA 2FB5A 2ZQMA 5J2TB 2QWQB 2A0LA 3N2GB 2F4VO 1YI2V 3DSQA 4IT5A 3OMAB 3ASOB 1N8RW 5A9GA 4JV5B 1F4NA 5KMGA 1KMIZ 1NS1A 2VQFO 1VQ9V 2ZXWB 4PI2A 3ZMVA 1QVFU 4IIJA 3E22B 3WB2A 2IW5A 5BMVA 1K92A 2YEVB 4DUZO 1IXBA 2DQ0A 4KUMA 1SS3A 4DR2O 2A79B 5KHGA 1YTFD 2UUCO 2QR4A 3ASNC 4GCZA 3IGAC 3T1HB 3R66A 5KX5B 4O2AB 3OFNG 4FLVA 5FNVB 1X4TA 1W2BU 4PI0A 1MZFA 1Y66A 4J7ZA 2EINB 2UUCB 2E76B 1Q6UA 3CD6V 2M6YA 3H1KH 1R6NA 2DYSB 3S3WA 1J5EB 5IYCO 4JI2O 4X1YA 2P22C 3T2MA 1D2DA 4DRXA 5H6QA 2CTWA 4BIOA 2ILMA 5J2TA 1AR5A 3CCRV 1BL8A 2HEPA 4TQFA 1I94B 3ZHRA 2IU0A 2QA4V 3E8HA 1BSMA 4J7JA 4U7OA 3T4ZA 3BAAA 1GN2A 1KKDA 2DQ3A 3DXRB 3LDCA 2JJ1G 1M93A 3IC7A 3JATA 5DN6G 4WF9V 1SQXH 1AP5A 1V54C 4BW5A 1YDXA 3G71V 4U3JA 2YUAA 1N33B 2CTQA 4WFEA 2JGDB 3HKBB 3SJBC 3ZHSA 1VQOV 2WLLA 5IWAB 3BHPA 2IBZH 5B5EZ 3IFXA 4BIUA 4JI6O 2P06A 1Q43A 4R50A 1K33A 1XREA 4EFBA 1JQ0A 2P5OA 1FPOA 1JPXA 5B1AC 2ZNJA 2VRZA 1J5EO 3N2KB 1XMQB 2YS8A 1K3EA 2YEVA 5CMUA 2FMLA 4O4HB 2ADPA 2KKWA 4IIJB 4X65O 4X9QA 3ZHUA 4DV2O 3T1HO 1KB9F 5LBQA 5KMGB 4YY3B 2KB1A 1YVWA 4JYYA 3TGUH 5EZYA 2LGWA 1AI7A 2NN4A 2V1DA 1WN7A 2AZ2A 1WB7A 5LP6B 1JFFA 3ABMB 3CPWU 4UCOA 3JAKB 3SJAC 1ZL8B 2CGNA 1SZTA 1QCEA 2WAMA 4X1KB 1V55B 4PJ0Z 1N0JA 4GX2A 2R72A 3JATB 5BZBA 4FLTA 2UUBB 4X20B 4K0KO 2P7TC 1AP6A 4D7TA 4O4JB 2JS5A 2BTOA 2LFRA 5KAIZ 4O2BA 4L87A 3LSQA 1FXKB 4PDRA 2Q73A 1F7YA 3CC4V 5J9PC 5JH7B 3OMIB 4E2LA 1CPYA 1Y4MA 3UM7A 1NR1A 2HHHO 4UCRA 2RCVA 1ZWIC 3SYCA 2QDOA 5L3BA 5B1BC 1KC8W 2B9ZA 1ROPA 5IYBO 4PDVA 4X65B 2EIMB 3FB5C 4KHPO 1LNQA 4I55A 2HJDA 4U7NA 4H37A 1ENVA 3CXHF 2IJKA 4LC1A 1SC5B 5LA6B 2ZDIC 2ADQB 3HKDB 4IYHA 5L3GA 3N2GA 1Q86W 3J80N 4B3MB 4MTOA 4PA7A 1GK9A 1VF7A 5CB4B 3A0BZ 2UXDB 2XHBA 3OM3B 3K5LA 3FB8C 4MW8A 1MZEA 2H3OA 1R6KA 4G2KA 4DV0O 5IWAO 2H94A 1G4YB 4TV9A 3HPLC 2DWDC 3B2EE 5HFMA 3U11A 4JASA 3JSNA 3BFRA 4TT3G 2UU9O 3ZBHA 4I0XB 4ZBMA 3SPIA 3G6EV 1WJZA 2QKSA 4GKKB 2QTOA 4JI6B 4TQDA 4KXRA 5CA1A 5IYZB 4X62B 4NB5A 2EILC 2OT5A 2G38A 1JFFB 1K4CC 3C3TA 2JEUA 3RVZA 4DV2B 4ASUG 3ZRVA 2JRIA 2BTQB 1IURA 4C7UA 3BVOA 2VQFB 4TUYA 3LNMB 1EN5A 3RWRD 2Q7GA 4FVMA 3OW2U 1WAZA 3HKCA 3RFRA 4GYCB 1RM1C 3K03A 5KAFZ 1AJQA 1N32O 4YIPA 2XT9A 1RP3B 2R9AA 2N74A 4HYOA 3JAMN 1OZ0A 1HNWB 2CTPA 3O9OA 2B5UA 5EBWC 3ABLC 2IJIA 1M56B 1GH6A 4MTGA 1A32A 3CE2A 3ZMTA 1GN3A 3CRCA 4NTXA 4OPAA 1OCCC 3K59A 2DYSC 4LF4B 4JYAB 1QNMA 2A9HA 4DO2A 1ZX3A 2IM9A 3L72H 4ZIBA 1MNGA 2Q9LA 4JPRA 3PN1A 4LF5O 4JV5O 1SKVA 1K5SA 3OAAG 1GRJA 2EINC 2A3QA 2PY5A 2LP7A 5GTIZ 4ZOLB 2AHYA 4O4LA 1YIJV 3CMEV 1BZKA 5JJJB 3OUSA 2VQEB 4LF7O 5IDJA 3CCMV 2UXBO 5BR8O 1XNRB 5K1XA 2XOKG 4OGQB 1Y76B 1TUBB 3J81N 2XUMA 4NTYA 1YITV 4OX9O 2YC0A 1G1XB 2CAZC 4UVCA 2DE0X 1HP8A 1EN4A 3ETDA 4B3MO 1K7DA 5EBLC 1M56C 4DV7B 3B8NA 5FL7G 4DK1A 3BRCA 3JD4A 3JCZA 4FLUA 3AG3B 1YJ9V 5KHIA 1QLNA 1VQ5V 3ZJZA 1NTKH 1EZVH 5LL6Y 5LGTA 5BXZA 1DF5A 3K08A 2VWJA 4Z1VA 4DK0A 5HFLA 4LNUB 4H13B 3L71H 1CXZB 2MK3A 4J9YB 2N04A 3WFVA 4CH3A 3FX7A 3IAYA 1FS0G 3HKCB 4R6ZA 3MHSC 2YDEA 4PDLA 4UCTA 1VQLV 4UCUA 4FJCC 2ZR3A 3D36A 1H2LA 3AG4B 1Q7YW 2H8PC 1YJNV 4DV0B 5ITZB 4PA6A 4J41A 1Q81W 2HP8A 1EN6A 1MMMA 3W7TA 1OCRC 3SYAA 2Y0IA 2PZSA 5KA5A 1AROP 4DR6B 3FAVB 1LUVA 3L74H 5KHKA 4I9WA 4LFBO 3AEIA 2Q68A 4MVOA 5LOVA 2EIKC 2EULA 4I0XA 2Q0AA 1HR0B 1B04A 5JWPA 3K5MA 4DV4O 3K04A 3AG3C 1F4MA 5LHHA 3TXQA 5CBGA 2WLIB 3CRMA 3OE7G 1N36B 4OX9B 1RPOA 3DC5A 3VQWA 2C2AA 4ABMA 5D5PA 4O4JA 4DUYO 4GKJO 1IXMA 1HNXO 1AI5A 4RQEA 5L3EA 4JI7O 3EHBB 4DYLA 5LXTA 2RJZA 3H01A 4J11A 5KUMA 3UO2A 2YXYA 2HKOA 2Y48A 2WLMA 2B1GA 4I4TA 4DV3B 3H9VA 5GW7A 4FLZA 1NVPB 2CUGA 3P3NA 5JQGA 1N34O 3ZHVA 3VOUA 5GONA 4NXNB 3SGIA 3K79A 1JJOA 3DC6A 2LJ2A 4NKGB 3HKEB 2OTJV 1V55C 1FXKC 3ABTA 5B1AB 2Z3YA 2F4VB 4FM0A 4K35A 2QKCA 4H33A 2GV9A 2F23A 2PGGA 1IX9A 2X6BA 4ZI7B 4HNAB 1NBMG 1P49A 2QKAA 3ETEA 1Z2GA 3VBBA 4JZ2A 3ZEDA 3JYCA 2LW1A 1N36O 2VWKA 2BE3A 2BOCC 5IJ9B 4FZ0A 4JF3A 1Q6HA 2EZOA 4QNHB 1VQNV 1NI8A 4DV6B 3CCQV 1PD3A 4DV4B 2QTSA 1NTMH 1IVSA 5IE9A 5CA0B 1Y6XA 2GTAA 4IHJA 1XNQO 2O57A 3SJCC 2XAJA 1VF6C 3M8AA 1SF9A 4F6EA 1WNSA 1JCHA 1NKDA 1GMGA 4GKKO 1URFA 4B7EA 4MW3A 1KBHA 4JZGA 4GUNA 1WPBA 3SJQC 2ZIMA 3MDSA 5GONB 2XAFA 3ZN0A 1B06A 4Q6GA 4DRXB 4QPJA 3B77A 4KFMA 1KECA 3OGCC 3T1YO 3HR0A 4UB8Z 5A2QN 4KP4A 2ZXWC 1Q5OA 1O9GA 4DUYB 2XASA 4CS2A 4LNUA 2IJHA 3K9SA 4NTWA 4LFBB 4K8XA 1FFXA 3WB1A 1EFRG 1L1FA 1FJGO 2JEXA 5B1NA 4X62O 2XAQA 1H2GA 1WP7A 1YCIA 3CB2A 3ABKC 3I5DA 1Y74B 3UT5B 4DR5O 3SPCA 1WP8A 4LBEC 2HFEC 5LA6A 3F7VC 1YF2A 2WA4A 4CH4A 3ZMUA 5CB4A 2AGAA 4I9QA 1ZTEA 1I5XA 4UB6Z 1P4RA 4O2AA 4WBNB 2Y4TA 2GHYA 4O4HA 1BS3A 3NR7A 3HB3B 1J95A 4AI8A 4ZKIA 1XOUA 1JA8A 1KD1W 4MVQA 3H1IH 3GVMA 1DTOA 4LR3A 3CP1A 1GM7A 4D6TH 5LOVB 2PI4A 4ZOLA 1H2NA 1RPRA 2Q69A 2QWRB 3E89A 4B7KA 2ETNA 2HVKC 2LW7A 2RDCA 3QF7A 1G6UA 2A7WA 5KX5A 1TUEB 1LR1A 1M5IA 1H8EG 5FLXN 3JALA 2UXBB 5CN0A 2WA3A 1KQSU 1S72V 2EBOA 1MSWD 1Q90D 5J2UB 1SA0A 3OT7A 3RN4A 1PPJH 4ZHQB 1PNKA 2Q7EA 4FFBA 1V54B 4WFFA 4ICGA 4F6RA 1FXKA 1HNZO 3ZRWB 2UUAB 4LF9O 2JK5C 3ETQA 3O65A 4JAVA 2GTSA 4W4LA 2PYLA 1DK1A 3VQVA 1N33O 1U97A 2K9PA 1NH2D 5AG2A 5B1OA 3R65A 1VQ4V 4IYIA 4MTFA 1YHQV 2Y69B 1TGOA 3W7SA 2LQTA 4X1IA 4LF4O 3AK3A 3T1CA 2XTAA 5LYJB 3RYCB 5CA3A 2DYRC 2FTKA 3DGEA 5IJ9A 3OGIB 4DW1A 4BWAA 4DR4O 2WLLB 1SRYA 2V7QG 1I94O 4EKWA 4U3FH 3E8FA 1EBOA 1Y76A 2L35A 3L73H 5JVDA 4J7KA 4YHHO 3L75H 2PI5A 1K34A 4AHCA 4XBFA 4JI2B 1TA8A 4TV9B 2JIZG 4O4LB 1YSCA 1IBKO 2CH7B 2YXLA 4MT8A 1R3KC 1M57C 1AILA 2BSKA 2YIDA 5JQGB 4WBNA 1QR8A 4TOIA 4P9OA 3E83A 1S76D 2PYJA 3F5WC 3ZHTA 4I4TB 1XEQA 5IJ0A 1HWYA 2EZPA 2E3CA 4DR2B 1K73W 4BR6A 2ZCEA 3KCYA 5H9CA 2W6JG 2CDYA 4ZHQA 4PELA 1KP2A 3CEIA 4FFBB 1OCZC 1NJIW 4YXWG 1SETA 1N34B 1UPGA 2X0LA 3APQA 1FFTB 5TISZ 4B3SB 4TV8A 1WA8B 2JVDA 3CMAV 1K4DC 5D5QA 3TETA 2OTLV 2PF4E 1HNZB 3AG2C 4ZI7A 3BCCH 3KCXA 5E79Z 1HDJA 4CBCA 4Q20A 2X6CA 4QGPA 4QE7A 1OCOB 4FLYA 3K3WA 2ZE6A 1R1BA 4DR5B 3DXRA 3UKMA 5JVDB 2HJFC 4F4LA 3K0GA 2BOBC 3OTOB 3SDLA 3RBZA 2P67A 2FKXA 4J80A 3ABKB 4JI5O 1BQZA 1BCCH 1Q6IA 4IHJB 5LP6C 3APOA 3K5NA 2EIJB 2WSSG 4X1KA 1SZXA 3P30A 3WG7C 4A5UB 3E22A 3LSUA 3U10A 4O4IA 4YIOA 2NR5A 2F1MA 2P4VA 5LP6A 2RN9A 2NLJC 2HR3A 4FLXA 2GUZA 4MVUA 1RSOB 4PDMA 3WU2Z 4B3SO 1TVKA 3TXSA 4QPKA 4O4IB 3W7UA 3RYIB 4NYKA 2WLIA 1GM9A 2YIBA 5B3SC 1VARA 4JGSA 3B40A 4BAYA 1FAFA 1F51A 5BY1A 5L3DA 4DV7O 1GM8A 2NNUA 1MA1A 1SESA 1IBMB 1IBLO 2VS0A 4MSWC 1B3QA 2Q7HA 1CP9A 4FM1A 1US6A 1JMKC 4JTCB 4TV8B 1VQMV 1XBLA 4X64O 3E2EA 1BQ0A 3DTUB 1UFIA 3PJSK 1FYJA 3SPHA 2W0XA 1Y67A 5IYDO 3ETGA 1SQQH 1GN6A 5E1AC 3LNNA 4U3JB 1VQ6V 1AI4A 2IH1C 5BMVB 2P4KA 2AZ0A 4GLXA 3FKSG 5DEDA 1R3JC 3JSLA 4EEQA 1GKFA 4RO2A 4LF5B 4CH6A 5BR8B 2QM4A 5CA0A 1R3IC 1RFYA 4YJ2A 2Q6AA 2QWNB 1WLEA 3GB7C 3E35A 2EIKB 1SQFA 2ZE7A 3IJ4A 3ZRSA 3FAVA 1OCOC 4I55B 2AHZA 1TUBA 2HG5C 2X7RB 1E1QG 1KUQA 4TWKA 5FPOA 1F23A 1L0NH 4I50A 5JCOC 4JYAO 4UUJC 4JI3B 5CA1B 5IYZA 3H1LH 4UCSA 1XMOB 4R8CA 2KG7A 3X2QB 3OMNB 5IT9N 5IY5B 1PL4A 3JARB 4I5SA 3RYHB 4LWSA 1JJ2U 5EC2C 1AI6A 4AQYB 1N32B 3QVNA 2BTQA 4QE9A 1E79G 4NXMO 4YHHB 1TVKB 1XQ8A 2ITDC 2UXNA 3B4SA 1PP9H 1HNWO 4G28B 4JTAB 1P84F 5LHGA 4X66B 1BT8A 5KUKA 3AG7A 2CK3G 1FD9A 4LH7A 2XAHA 4JI0B 1M4UA 5H6RA 3LDDA 3NXSA 4JI1B 4CZZA 3AK1A 3ABUA 3X2QC 2Q4PA 4WCEV 3OTFA 1XMOO 3EFFK 2OYQA 1VEWA 1RM1B 2ITCC 5KA6A 2E5LB 1H2MA 1XILA 1ORQC 2K1EA 4DR4B 4HNAA 1JX9A 5K1PA 3AG4C 1VF6A 1NT2B 4PA4A 3T4DA 1P7BA 2DMXA 1NR7A 5GTHZ 1BMFG 1DLBA 1NH2B 4JI8B 1VIBA 1OCRB 3C90A 4YJ3B 2UU9B 3CCSV 4PA3A 3HKEA 3RYFB 4H44B 5C8YB 1D5NA 4GKJB 3TK1A 1M9NA 1V9PA 3SPJA 1ZAUA 4X88A 1BHAA 1DGSA 2PUSA 2QM7A 3OR7C 3CJHB 3CCVV 1ZLZA 5ITZA 2KSDA 2L6LA 3P3PA 4I50B 2UXDO 5CBHA 4H0LB 5LYJA 5IY5C 4FK5C 4BIZA 1VQ7V 1GTOA 3E8GA 3RYHA 1R73A 1ZUQA 3ICXA 3CCJV 3ZIAG 3CC7V 5H2FZ 5B1BB 3QO5A 3G6BA 3MD0A 2KG7B 3A2FA 2JGUA 5LMNB 2BSKB 2ZM6B 4DR7O 4B3RB 1IDSA 1DF4A 1KKCA 2QGNA 4FM2A 3A0HZ 3GWOA 2OIEA 1E1RG 1SA0B 2UXXA 4GZRB 5LHIA 3ABMC 1KP3A 3AK2A 1PM9A 1YTFB 3ZRXA 5JCOA 1I08A 1I5YA 4WFGA 4RUEA 2FL4A 1D5AA 2ZT9B 1IBMO 2UUAO 2OCHA 4PA9A 5C8YA 3RT3C 5EIBD 3T1YB 1S5LZ 2WLHA 2ZM6O 3IC9A 3SR2C 4FZ1A 2ZD9A 1BGYH 2KQXA 2XNDG 1YJWV 4JI4O 5KLVH 3I56V 2JGDA 1FFXB 3HKBA 3ZS8C 4YJ3A 4PD4F 3JASB 3UO3A 1IZ3A 3EVKA 3BABA 1QU7A 4KHPB 4B3TO 1FXHA 2W6IG 3LSSA 1N4CA 4HZ3A 3OTOO 3SYPA 3CRAA 1PKXA 3K0DA 2DWEC 5FPRA 4LFCB 2LO1A 4CH5A 2ZINA 1VQ8V 3TJTA 1ZL8A 2F93B 4UXNA 3KZIZ 1AJNA 2EIJC 4RUFA 4JI5B 1NZ6A 1K5QA 1GAXA 2M7WA 1SQGA 3CC2V 3ASNB 2V4DA 2OCCC 3CRQA 1XI1A 1Q8IA 1M90W 4W4KA 2UUBO 3BY6A 3F7YC 2OWOA 3AG1B 4BW9A 3M99B 1QHTA 1XNQB 2AW9A 1THZA 4X1YB 1Q3EA 4RWUA 5F2VO 5FNVA 3L9DA 2YI8A 4UV8A 2F95B 3SPGA 3D8CA 4UFZA 1H2SB 4TSFG 3H1HH 4WFAV 4X8AA 1NQTA 2ZE8A 1I0HA 1OJHA 2Q0OC 2WLKA 2E5LO 3FYEB 2HVJC 4B08A 3JCUZ 4WFHA 1R6TA 4MVZA 1XL4A 1IBKB 1UJWB 1KYOF 4JI1O 3A0RA 1QQCA 2Z0AA 4CS3A 2R9RB 5KHJA 4EB6A 5B3SB 1P7GA 3RW0A 3WG7B 3OR6C 2UXCO 3BA9A 3FFQA 4GX1A 4LF8B 4LFCO 3RGBA 4PV1B 3CS5A 4QJFB 1K97A 3Q4HA 3CCLV 3QO7A 3Q4HB 4EB6B 4OPHA 1IBLB 1TAEA 1N0NA 3AG1C 4DXWA 2YXHA 4UVBA 4DUZB 4DR3B 1L0LH 1AR1B 3SYOA 3JASA 3LUTB 1VMGA 3K58A 2DYRB 1AR4A 2OCCB 3KG2A 3E86A 1O9HA 4JI4B 4OXSA 1GN4A 2EIMC 1SQVH 5LMUO 1W0JG 1S0VA 4E4EA 4EFEA 3JAWB 3TCUA 4N21A 4HBNA 4LF9B 3MAQA 4FPPA 4J42A 3D36C 4KL1A 4K0KB 4MVSA 3OD4A 4D7SA 4FLWA 4N23A 4LWSB 3ASOC 1XL6A 4X89A 3C3SA 2GSMB 2R70A 1WB8A 4TUYB 2EJ7A 1EM1A 3FD9A 1AVMA 1YEWA 1BE3H 2QWPB 2WWWA 3BA8A 3QNEA 1PV0A 4HAMA 2HLDG 2ZNIA 1I7FA 1VP7A 4GX0A 3QTCA 3K57A 4B3RO 4B3TB 4LH6A 5LMNO 4F6RB 3STLC 5LXTB 4DR1O 3KKYA 4NXMB 4Z2WA 1EZJA 2ZKOA 2QWOB 5L3CA 4X20A 2EJRA 1PNMA 2P6JA 5EC1C 2F43G 3K9AA 5CBFA 5EYPB 2HHHB 2E74B 2B1IA 5EYPA 4UCVA 4P30A 4JI3O 2CE4A 3OEHG 4LFAB 3U0ZA 3P32A 2P90A 2ODMA 1XMQO 5H5NA 4MVMA 1XUQA 2IU3A 3UCSC 3UT5A 3W7WA 4DV1O 1BHBA 1JVMA 3FYIB 4JTDB 2EX3A 4DV5O 3BEHA 4CC5A 2LGQA 3B8MA 1MOFA 4UVAA 1WPXA 1MG1A 2PTMA 5DM6V 2ZIOA 1H2KA 2Y69C 3HKDA 1XHZA 5KHHA 4G27B 4DV5B 5JJNB 2E75B 3F5TA 5EK0A 4MVRA 1Z5VA 1S5HC 4J10A 1SQPH 2EILB 4JI8O 2N05A 2RQ6A 1YXBA 4DV1B 1FJGB 3RYFA 1G8MA 1SERA 1S3JA 2Q8VA 1VF5B 1XDCA 3H1JH 2D3OW 1XNRO 3ZHQA 3JAKA 4PHZA 2AXTZ 3ML0A 4FIPC 2DN9A 2QE7G 3THOA 2WPDG 3ZMSA 3ZCCA 3MHHC 4LF6O 5EZYB 2GBOA 2MW2B 1OCZB 1H38A 5IJ0B 1HW7A 4XDKA 3RYIA 1B6QA 1M1KW 3G80A 4X66O 1WA8A 2RNBA 3ZN1A 3AG2B 3RVYA 2CGOA 1U96A 2LFSA 1L8DA 4GT1A 5J2UA 2YICA 2WLNA 3CRRA 4JYCA 1Q82W 2QSAA 3CCUV 4NR1A 4NVPA 3WB0A 1R3LC 4GX5A 4YY3O 4Z1MG 4XDLA 3CCEV 2R9IA 3G4SV 4R7CA 3JD2A 3EXAA 4UV9A 1QVGU 1YZBA 3A8TA 1PL0A 2Z5UA 4AILC 2W0FC 2QJ1A 3QO8A 4X1IB 3ZX6A 5EIBC 4XDJA 1NTZH 2QEXV 5C93A 2IH3C 1FXVA 1SQBH 4JYBA 4FFKA 4JI0O 3N2KA 3QG5A 2A06H 3LDEA 5DECA 1QLEB 5B66Z 4MS2A 3CSXA 2YSUB 2VQEO 2ATKC 4LF7B 2YIBD 4JAAA 4FMTA 3N27A 3JD0A 1QR9A 4IGGA 4DV6O 4J9ZB 3CYOA 4K3AA 1HR0O 2ZDIA 1H8HG 4NXNO 3K06A 2OIGA 4DW0A 3OEEG 1S5JA 1JOYA 1JR9A 4K8ZA 1MABG 2Q67A
chains in the Genus database with same CATH topology
1H8EG 4RAIA 3LNMB 3CXCU 3GWOA 5CN0A 1KQSU 1S72V 2EBOA 1E1RG 1MSWD 2UXXA 3OW2U 5LHIA 3ABMC 1RM1C 1KP3A 3K03A 4WFBV 1PNKA 1AJQA 1YTFB 1V54B 4WFFA 1OCCB 3ZRXA 1I5YA 4WFGA 1FXKA 3D3IA 4RUEA 3FB6C 3ZRWB 2XAGA 4HYOA 1OZ0A 2JK5C 1OHHG 4PA9A 4JAVA 2B5UA 5EBWC 2WLHA 4LP8A 2DW4A 2ZD9A 3ABLC 2XNDG 1YJWV 2IJIA 1NH2D 1M56B 2JJ2G 5B1OA 3I56V 3R65A 1VQ4V 4MTFA 1QBZA 3JD3A 4MTGA 1YHQV 2Y69B 1K8AW 3ZMTA 3W7SA 1OCCC 3SYQA 2DYSC 3T1CA 3E8BA 3OUFA 5CA3A 2A9HA 2DYRC 4DO2A 1M57B 2FTKA 3DGEA 1FXHA 2W6IG 3LSSA 1VQKV 4MTXA 4HZ3A 3SYPA 1QLEC 1PKXA 3K0DA 2WLLB 1SRYA 4LCUC 2DWEC 2V7QG 3ZMZA 3I55V 4JPRA 4P2ZA 5EBMC 4EKWA 1AJPA 3E8FA 1VQ8V 1EBOA 1K5SA 3OAAG 2ZR2A 4P9PA 2EINC 2WLJA 2LP7A 2PI5A 1K34A 4XBFA 1NVPD 3STZC 2AHYA 4UXNA 2IJJA 1YIJV 3CMEV 2JIZG 1AJNA 5L3FA 2EIJC 3OUSA 4RUFA 1COWG 5IDJA 1YSCA 1K5QA 3CCMV 2M7WA 4MT8A 3CC2V 3ASNB 3W7XA 1R3KC 2XOKG 1M57C 2JDIG 2OCCC 1S77D 1M90W 2QM8A 5LGUA 1YITV 1QR8A 5LGNA 1VQPV 4P9OA 3E83A 1K9MW 4UVCA 1S76D 1W0KG 3BY6A 3F7YC 3ETDA 3F5WC 4RQFA 1K7DA 5EBLC 1M56C 3AG1B 3M99B 2EZPA 1HWYA 3ABLB 3B8NA 1K73W 5FL7G 3JD1A 5H9CA 2W6JG 1PNLA 2X6AA 1THZA 4PELA 1KP2A 3JD4A 1OCZC 3JCZA 3AG3B 1YJ9V 1NJIW 4UV8A 4YXWG 1SETA 1QLNA 1VQ5V 3SPGA 3ZJZA 4TSFG 2X0LA 4WFAV 1FFTB 3FB7C 1NQTA 4X8AA 5LGTA 1DF5A 3K08A 4QIWF 2WLKA 5HFLA 3CMAV 3FYEB 2HVJC 1K4DC 3TETA 4JAUA 2OTLV 1GO3F 4WFHA 3ZRWA 1CEZA 2MK3A 2ZQMA 4MVZA 1XL4A 3AG2C 4J9YB 1UJWB 2A0LA 3A0RA 3WFVA 4CBCA 4Q20A 1YI2V 2X6CA 1FS0G 1OCOB 2R9RB 4QE7A 4R6ZA 3OMAB 3ASOB 3MHSC 5B3SB 1N8RW 4PDLA 1VQLV 3K3WA 4FJCC 2ZR3A 1F4NA 3RW0A 3D36A 3UKMA 3AG4B 3WG7B 1Q7YW 3OR6C 2H8PC 2HJFC 4F4LA 2Q67A 3K0GA 1YJNV 2BOBC 1VQ9V 2ZXWB 4PA6A 1Q81W 4GX1A 3ZMVA 1QVFU 3W7TA 3RBZA 1K97A 1OCRC 2P67A 3SYAA 4QJFB 3ABKB 3CCLV 3QO7A 5KA5A 1AROP 2IW5A 1K92A 3AG1C 4DXWA 4I9WA 3AEIA 2Q68A 2EIJB 4MVOA 4UVBA 2EIKC 2WSSG 2YEVB 2DQ0A 1AR1B 3P30A 4KUMA 3SYOA 3K04A 3LUTB 3AG3C 3WG7C 1F4MA 2A79B 2DYRB 1YTFD 2OCCB 3KG2A 3E86A 5CBGA 5LHHA 2WLIB 3ASNC 4GCZA 4OXSA 3OE7G 2EIMC 3IGAC 2NLJC 1W0JG 1S0VA 3OFNG 2HR3A 1RPOA 3TCUA 4N21A 4MVUA 1W2BU 4PDMA 1Y66A 4FPPA 4QPKA 2C2AA 2EINB 4MVSA 3W7UA 3CD6V 2WLIA 4N23A 1GM9A 1IXMA 3ASOC 5B3SC 1AI5A 1R6NA 2DYSB 5L3EA 4RQEA 5IYCO 4JGSA 1XL6A 4X89A 3EHBB 2GSMB 3T2MA 4BAYA 5H6QA 3H01A 5KUMA 1F51A 5L3DA 2HKOA 2Y48A 3CCRV 2WLMA 1BL8A 2B1GA 1GM8A 2IU0A 2QA4V 2NNUA 2WWWA 3E8HA 1SESA 3QNEA 4HAMA 4MSWC 5GW7A 2HLDG 1CP9A 4U7OA 4JTCB 4GX0A 1VQMV 1NVPB 3T4ZA 3E2EA 3DTUB 1KKDA 2DQ3A 3LDCA 3STLC 2JJ1G 3VOUA 3PJSK 3IC7A 3K79A 3SPHA 1EZJA 5DN6G 4WF9V 2OTJV 5L3CA 5IYDO 2EJRA 1PNMA 2P6JA 1V55C 3ETGA 1FXKC 2F43G 3K9AA 3ABTA 1V54C 5EC1C 5B1AB 5E1AC 4BW5A 5CBFA 3G71V 2B1IA 2Z3YA 4P30A 3OEHG 1VQ6V 1AI4A 2IH1C 3P32A 2P90A 4WFEA 4H33A 4MVMA 2IU3A 3FKSG 2X6BA 1R3JC 3W7WA 1BHBA 1JVMA 1VQOV 2WLLA 1GKFA 4RO2A 3IFXA 1NBMG 4BIUA 3ETEA 1R3IC 3VBBA 3FYIB 2Q6AA 4JTDB 1K33A 4R50A 3JYCA 1JQ0A 3BEHA 1JPXA 2BOCC 1MOFA 3B8MA 1WPXA 2EZOA 4JF3A 4UVAA 5B1AC 1MG1A 1WLEA 4QNHB 5DM6V 3GB7C 2Y69C 1K3EA 2YEVA 3E35A 3CCQV 5CMUA 2EIKB 4G27B 1PD3A 3ZRSA 5EK0A 4MVRA 1OCOC 1S5HC 2EILB 2AHZA 2XAJA 2HG5C 2X7RB 5LBQA 1E1QG 4TWKA 1JCHA 2KB1A 1NKDA 1F23A 1G8MA 1GMGA 1AI7A 2V1DA 1SERA 1S3JA 4UUJC 2D3OW 4MW3A 4R8CA 3OMNB 3ABMB 3X2QB 3CPWU 5IY5B 3ML0A 4FIPC 4I5SA 2QE7G 1JJ2U 2WPDG 5EC2C 3ZMSA 1AI6A 1SZTA 3SJQC 3ZCCA 1QCEA 2WAMA 3MHHC 4QE9A 1V55B 1E79G 2XAFA 4GX2A 3ZN0A 4QPJA 5BZBA 1OCZB 3B77A 1H38A 2ITDC 4KFMA 2P7TC 2UXNA 4XDKA 1B6QA 1KECA 4G28B 4JTAB 2LFRA 1M1KW 3OGCC 5LHGA 4L87A 3LSQA 3AG2B 1FXKB 2ZXWC 4KP4A 2CK3G 3RVYA 3ZN1A 2XAHA 5KUKA 4PDRA 3CC4V 5J9PC 5H6RA 2LFSA 3LDDA 3NXSA 4GT1A 4CZZA 3OMIB 3ABUA 3X2QC 4E2LA 2WLNA 1CPYA 2XASA 4WCEV 1Y4MA 3EFFK 3UM7A 1NR1A 2IJHA 1RM1B 4JYCA 1Q82W 1VQNV 2ITCC 1ZWIC 3SYCA 5KA6A 3CCUV 5L3BA 5B1BC 1ORQC 1R3LC 4GX5A 4Z1MG 2K1EA 1KC8W 1EFRG 1JX9A 1ROPA 4XDLA 1L1FA 3CCEV 3AG4C 2JEXA 4PA4A 3T4DA 1P7BA 5B1NA 4PDVA 5IYBO 1NR7A 2R9IA 2EIMB 3FB5C 2XAQA 3G4SV 1H2GA 1LNQA 4R7CA 3JD2A 1BMFG 1DLBA 1NH2B 4UV9A 3ABKC 1QVGU 1OCRB 4U7NA 4H37A 1ENVA 1PL0A 2Z5UA 3SPCA 2IJKA 4LC1A 3CCSV 2W0FC 2ZDIC 4PA3A 3QO8A 2HFEC 4LBEC 5L3GA 3F7VC 1Q86W 4MTOA 4PA7A 3ZMUA 1GK9A 4XDJA 3TK1A 1M9NA 2QEXV 5C93A 2IH3C 3SPJA 3OM3B 1FXVA 3FB8C 4X88A 4MW8A 4JYBA 1BHAA 2QM7A 1R6KA 1I5XA 4G2KA 1P4RA 3OR7C 2H94A 2GHYA 3LDEA 3CCVV 1G4YB 1QLEB 4MS2A 3HPLC 2DWDC 2YSUB 3HB3B 1J95A 2ATKC 5CBHA 4ZKIA 5IY5C 1KD1W 4MVQA 4FMTA 3JD0A 4FK5C 4BIZA 1VQ7V 1QR9A 1GTOA 3E8GA 5HFMA 1DTOA 4JASA 3CP1A 1R73A 1GM7A 4TT3G 2PI4A 4J9ZB 3CYOA 4ZBMA 1RPRA 2ZDIA 3SPIA 2Q69A 1H8HG 3ZIAG 3G6EV 3CCJV 3E89A 2QKSA 3CC7V 3K06A 2QTOA 5B1BB 2HVKC 3OEEG 3QO5A 2EILC 2OT5A 3MD0A 1JOYA 1K4CC 2JEUA 3RVZA 4ASUG 1TUEB 3ZRVA 1MABG 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6Q A;  1NKD A;  2IJJ A;  1ROP A;  1GTO A;  1RPO A;  1PD3 A;  2GHY A;  2IJK A;  3K79 A;  1RPR A;  1F4M A;  1GMG A;  2IJH A;  2IJI A;  4DO2 A;  1F4N A; 
#chains in the Genus database with same CATH topology
 4RAI A;  2JS3 A;  1ZSP A;  2Q5Z A;  3CXC U;  4DV3 O;  1T5E A;  2DJV A;  3K5O A;  3M7M X;  4WFB V;  1OCC B;  1HNX B;  4L8J A;  2ZE5 A;  3D3I A;  2D2C B;  3FB6 C;  2XAG A;  4LF8 O;  1NU1 H;  2RMK B;  1FKA O;  2YI9 A;  1OHH G;  4I7Z B;  4LP8 A;  2DW4 A;  3VQX A;  1LUW A;  3L70 H;  4LF6 B;  2Y4U A;  5JJE B;  2JJ2 G;  4JI7 B;  3B09 A;  4AQY O;  1QBZ A;  1XHX A;  3JD3 A;  1MSD A;  1K8A W;  4CC6 A;  3SYQ A;  3RYC A;  3E8B A;  3OUF A;  4YJ2 B;  4DR6 O;  1M57 B;  4X64 B;  1Y74 A;  1VQK V;  4MTX A;  1OV9 A;  1QLE C;  1W59 A;  1KU9 A;  4LCU C;  1RSO A;  3ZMZ A;  3I55 V;  3G67 A;  4P2Z A;  5EBM C;  3J7A U;  3D3Q A;  3S3X A;  1AJP A;  1AB3 A;  3CX5 F;  4P9P A;  2ZR2 A;  2WLJ A;  3UQ8 A;  3CWB H;  1NVP D;  3STZ C;  2IJJ A;  5L3F A;  3JAL B;  1X59 A;  1COW G;  2BCC H;  3GWK C;  2FYU H;  2YIA A;  3W7X A;  2JDI G;  1S77 D;  4DR1 B;  2QM8 A;  3JAW A;  3CHX A;  5LGU A;  3CJH A;  5LGN A;  1VQP V;  4DR7 B;  1K9M W;  1W0K G;  4IL6 Z;  2CH7 A;  2DOS A;  4RQF A;  3ABL B;  4LFA O;  3JD1 A;  3JAR A;  1PNL A;  2X6A A;  2ARH A;  4DR3 O;  1Z5W A;  2GUZ B;  2CTR A;  3VQY A;  2GDS A;  5JH7 A;  3FB7 C;  4CS4 A;  4QIW F;  2Y0P A;  3BPZ A;  4O2B B;  5LMU B;  2F66 C;  2UXC B;  4JAU A;  1GO3 F;  3ZRW A;  1CEZ A;  2FB5 A;  2ZQM A;  5J2T B;  2QWQ B;  2A0L A;  3N2G B;  2F4V O;  1YI2 V;  3DSQ A;  4IT5 A;  3OMA B;  3ASO B;  1N8R W;  5A9G A;  4JV5 B;  1F4N A;  5KMG A;  1KMI Z;  1NS1 A;  2VQF O;  1VQ9 V;  2ZXW B;  4PI2 A;  3ZMV A;  1QVF U;  4IIJ A;  3E22 B;  3WB2 A;  2IW5 A;  5BMV A;  1K92 A;  2YEV B;  4DUZ O;  1IXB A;  2DQ0 A;  4KUM A;  1SS3 A;  4DR2 O;  2A79 B;  5KHG A;  1YTF D;  2UUC O;  2QR4 A;  3ASN C;  4GCZ A;  3IGA C;  3T1H B;  3R66 A;  5KX5 B;  4O2A B;  3OFN G;  4FLV A;  5FNV B;  1X4T A;  1W2B U;  4PI0 A;  1MZF A;  1Y66 A;  4J7Z A;  2EIN B;  2UUC B;  2E76 B;  1Q6U A;  3CD6 V;  2M6Y A;  3H1K H;  1R6N A;  2DYS B;  3S3W A;  1J5E B;  5IYC O;  4JI2 O;  4X1Y A;  2P22 C;  3T2M A;  1D2D A;  4DRX A;  5H6Q A;  2CTW A;  4BIO A;  2ILM A;  5J2T A;  1AR5 A;  3CCR V;  1BL8 A;  2HEP A;  4TQF A;  1I94 B;  3ZHR A;  2IU0 A;  2QA4 V;  3E8H A;  1BSM A;  4J7J A;  4U7O A;  3T4Z A;  3BAA A;  1GN2 A;  1KKD A;  2DQ3 A;  3DXR B;  3LDC A;  2JJ1 G;  1M93 A;  3IC7 A;  3JAT A;  5DN6 G;  4WF9 V;  1SQX H;  1AP5 A;  1V54 C;  4BW5 A;  1YDX A;  3G71 V;  4U3J A;  2YUA A;  1N33 B;  2CTQ A;  4WFE A;  2JGD B;  3HKB B;  3SJB C;  3ZHS A;  1VQO V;  2WLL A;  5IWA B;  3BHP A;  2IBZ H;  5B5E Z;  3IFX A;  4BIU A;  4JI6 O;  2P06 A;  1Q43 A;  4R50 A;  1K33 A;  1XRE A;  4EFB A;  1JQ0 A;  2P5O A;  1FPO A;  1JPX A;  5B1A C;  2ZNJ A;  2VRZ A;  1J5E O;  3N2K B;  1XMQ B;  2YS8 A;  1K3E A;  2YEV A;  5CMU A;  2FML A;  4O4H B;  2ADP A;  2KKW A;  4IIJ B;  4X65 O;  4X9Q A;  3ZHU A;  4DV2 O;  3T1H O;  1KB9 F;  5LBQ A;  5KMG B;  4YY3 B;  2KB1 A;  1YVW A;  4JYY A;  3TGU H;  5EZY A;  2LGW A;  1AI7 A;  2NN4 A;  2V1D A;  1WN7 A;  2AZ2 A;  1WB7 A;  5LP6 B;  1JFF A;  3ABM B;  3CPW U;  4UCO A;  3JAK B;  3SJA C;  1ZL8 B;  2CGN A;  1SZT A;  1QCE A;  2WAM A;  4X1K B;  1V55 B;  4PJ0 Z;  1N0J A;  4GX2 A;  2R72 A;  3JAT B;  5BZB A;  4FLT A;  2UUB B;  4X20 B;  4K0K O;  2P7T C;  1AP6 A;  4D7T A;  4O4J B;  2JS5 A;  2BTO A;  2LFR A;  5KAI Z;  4O2B A;  4L87 A;  3LSQ A;  1FXK B;  4PDR A;  2Q73 A;  1F7Y A;  3CC4 V;  5J9P C;  5JH7 B;  3OMI B;  4E2L A;  1CPY A;  1Y4M A;  3UM7 A;  1NR1 A;  2HHH O;  4UCR A;  2RCV A;  1ZWI C;  3SYC A;  2QDO A;  5L3B A;  5B1B C;  1KC8 W;  2B9Z A;  1ROP A;  5IYB O;  4PDV A;  4X65 B;  2EIM B;  3FB5 C;  4KHP O;  1LNQ A;  4I55 A;  2HJD A;  4U7N A;  4H37 A;  1ENV A;  3CXH F;  2IJK A;  4LC1 A;  1SC5 B;  5LA6 B;  2ZDI C;  2ADQ B;  3HKD B;  4IYH A;  5L3G A;  3N2G A;  1Q86 W;  3J80 N;  4B3M B;  4MTO A;  4PA7 A;  1GK9 A;  1VF7 A;  5CB4 B;  3A0B Z;  2UXD B;  2XHB A;  3OM3 B;  3K5L A;  3FB8 C;  4MW8 A;  1MZE A;  2H3O A;  1R6K A;  4G2K A;  4DV0 O;  5IWA O;  2H94 A;  1G4Y B;  4TV9 A;  3HPL C;  2DWD C;  3B2E E;  5HFM A;  3U11 A;  4JAS A;  3JSN A;  3BFR A;  4TT3 G;  2UU9 O;  3ZBH A;  4I0X B;  4ZBM A;  3SPI A;  3G6E V;  1WJZ A;  2QKS A;  4GKK B;  2QTO A;  4JI6 B;  4TQD A;  4KXR A;  5CA1 A;  5IYZ B;  4X62 B;  4NB5 A;  2EIL C;  2OT5 A;  2G38 A;  1JFF B;  1K4C C;  3C3T A;  2JEU A;  3RVZ A;  4DV2 B;  4ASU G;  3ZRV A;  2JRI A;  2BTQ B;  1IUR A;  4C7U A;  3BVO A;  2VQF B;  4TUY A;  3LNM B;  1EN5 A;  3RWR D;  2Q7G A;  4FVM A;  3OW2 U;  1WAZ A;  3HKC A;  3RFR A;  4GYC B;  1RM1 C;  3K03 A;  5KAF Z;  1AJQ A;  1N32 O;  4YIP A;  2XT9 A;  1RP3 B;  2R9A A;  2N74 A;  4HYO A;  3JAM N;  1OZ0 A;  1HNW B;  2CTP A;  3O9O A;  2B5U A;  5EBW C;  3ABL C;  2IJI A;  1M56 B;  1GH6 A;  4MTG A;  1A32 A;  3CE2 A;  3ZMT A;  1GN3 A;  3CRC A;  4NTX A;  4OPA A;  1OCC C;  3K59 A;  2DYS C;  4LF4 B;  4JYA B;  1QNM A;  2A9H A;  4DO2 A;  1ZX3 A;  2IM9 A;  3L72 H;  4ZIB A;  1MNG A;  2Q9L A;  4JPR A;  3PN1 A;  4LF5 O;  4JV5 O;  1SKV A;  1K5S A;  3OAA G;  1GRJ A;  2EIN C;  2A3Q A;  2PY5 A;  2LP7 A;  5GTI Z;  4ZOL B;  2AHY A;  4O4L A;  1YIJ V;  3CME V;  1BZK A;  5JJJ B;  3OUS A;  2VQE B;  4LF7 O;  5IDJ A;  3CCM V;  2UXB O;  5BR8 O;  1XNR B;  5K1X A;  2XOK G;  4OGQ B;  1Y76 B;  1TUB B;  3J81 N;  2XUM A;  4NTY A;  1YIT V;  4OX9 O;  2YC0 A;  1G1X B;  2CAZ C;  4UVC A;  2DE0 X;  1HP8 A;  1EN4 A;  3ETD A;  4B3M O;  1K7D A;  5EBL C;  1M56 C;  4DV7 B;  3B8N A;  5FL7 G;  4DK1 A;  3BRC A;  3JD4 A;  3JCZ A;  4FLU A;  3AG3 B;  1YJ9 V;  5KHI A;  1QLN A;  1VQ5 V;  3ZJZ A;  1NTK H;  1EZV H;  5LL6 Y;  5LGT A;  5BXZ A;  1DF5 A;  3K08 A;  2VWJ A;  4Z1V A;  4DK0 A;  5HFL A;  4LNU B;  4H13 B;  3L71 H;  1CXZ B;  2MK3 A;  4J9Y B;  2N04 A;  3WFV A;  4CH3 A;  3FX7 A;  3IAY A;  1FS0 G;  3HKC B;  4R6Z A;  3MHS C;  2YDE A;  4PDL A;  4UCT A;  1VQL V;  4UCU A;  4FJC C;  2ZR3 A;  3D36 A;  1H2L A;  3AG4 B;  1Q7Y W;  2H8P C;  1YJN V;  4DV0 B;  5ITZ B;  4PA6 A;  4J41 A;  1Q81 W;  2HP8 A;  1EN6 A;  1MMM A;  3W7T A;  1OCR C;  3SYA A;  2Y0I A;  2PZS A;  5KA5 A;  1ARO P;  4DR6 B;  3FAV B;  1LUV A;  3L74 H;  5KHK A;  4I9W A;  4LFB O;  3AEI A;  2Q68 A;  4MVO A;  5LOV A;  2EIK C;  2EUL A;  4I0X A;  2Q0A A;  1HR0 B;  1B04 A;  5JWP A;  3K5M A;  4DV4 O;  3K04 A;  3AG3 C;  1F4M A;  5LHH A;  3TXQ A;  5CBG A;  2WLI B;  3CRM A;  3OE7 G;  1N36 B;  4OX9 B;  1RPO A;  3DC5 A;  3VQW A;  2C2A A;  4ABM A;  5D5P A;  4O4J A;  4DUY O;  4GKJ O;  1IXM A;  1HNX O;  1AI5 A;  4RQE A;  5L3E A;  4JI7 O;  3EHB B;  4DYL A;  5LXT A;  2RJZ A;  3H01 A;  4J11 A;  5KUM A;  3UO2 A;  2YXY A;  2HKO A;  2Y48 A;  2WLM A;  2B1G A;  4I4T A;  4DV3 B;  3H9V A;  5GW7 A;  4FLZ A;  1NVP B;  2CUG A;  3P3N A;  5JQG A;  1N34 O;  3ZHV A;  3VOU A;  5GON A;  4NXN B;  3SGI A;  3K79 A;  1JJO A;  3DC6 A;  2LJ2 A;  4NKG B;  3HKE B;  2OTJ V;  1V55 C;  1FXK C;  3ABT A;  5B1A B;  2Z3Y A;  2F4V B;  4FM0 A;  4K35 A;  2QKC A;  4H33 A;  2GV9 A;  2F23 A;  2PGG A;  1IX9 A;  2X6B A;  4ZI7 B;  4HNA B;  1NBM G;  1P49 A;  2QKA A;  3ETE A;  1Z2G A;  3VBB A;  4JZ2 A;  3ZED A;  3JYC A;  2LW1 A;  1N36 O;  2VWK A;  2BE3 A;  2BOC C;  5IJ9 B;  4FZ0 A;  4JF3 A;  1Q6H A;  2EZO A;  4QNH B;  1VQN V;  1NI8 A;  4DV6 B;  3CCQ V;  1PD3 A;  4DV4 B;  2QTS A;  1NTM H;  1IVS A;  5IE9 A;  5CA0 B;  1Y6X A;  2GTA A;  4IHJ A;  1XNQ O;  2O57 A;  3SJC C;  2XAJ A;  1VF6 C;  3M8A A;  1SF9 A;  4F6E A;  1WNS A;  1JCH A;  1NKD A;  1GMG A;  4GKK O;  1URF A;  4B7E A;  4MW3 A;  1KBH A;  4JZG A;  4GUN A;  1WPB A;  3SJQ C;  2ZIM A;  3MDS A;  5GON B;  2XAF A;  3ZN0 A;  1B06 A;  4Q6G A;  4DRX B;  4QPJ A;  3B77 A;  4KFM A;  1KEC A;  3OGC C;  3T1Y O;  3HR0 A;  4UB8 Z;  5A2Q N;  4KP4 A;  2ZXW C;  1Q5O A;  1O9G A;  4DUY B;  2XAS A;  4CS2 A;  4LNU A;  2IJH A;  3K9S A;  4NTW A;  4LFB B;  4K8X A;  1FFX A;  3WB1 A;  1EFR G;  1L1F A;  1FJG O;  2JEX A;  5B1N A;  4X62 O;  2XAQ A;  1H2G A;  1WP7 A;  1YCI A;  3CB2 A;  3ABK C;  3I5D A;  1Y74 B;  3UT5 B;  4DR5 O;  3SPC A;  1WP8 A;  4LBE C;  2HFE C;  5LA6 A;  3F7V C;  1YF2 A;  2WA4 A;  4CH4 A;  3ZMU A;  5CB4 A;  2AGA A;  4I9Q A;  1ZTE A;  1I5X A;  4UB6 Z;  1P4R A;  4O2A A;  4WBN B;  2Y4T A;  2GHY A;  4O4H A;  1BS3 A;  3NR7 A;  3HB3 B;  1J95 A;  4AI8 A;  4ZKI A;  1XOU A;  1JA8 A;  1KD1 W;  4MVQ A;  3H1I H;  3GVM A;  1DTO A;  4LR3 A;  3CP1 A;  1GM7 A;  4D6T H;  5LOV B;  2PI4 A;  4ZOL A;  1H2N A;  1RPR A;  2Q69 A;  2QWR B;  3E89 A;  4B7K A;  2ETN A;  2HVK C;  2LW7 A;  2RDC A;  3QF7 A;  1G6U A;  2A7W A;  5KX5 A;  1TUE B;  1LR1 A;  1M5I A;  1H8E G;  5FLX N;  3JAL A;  2UXB B;  5CN0 A;  2WA3 A;  1KQS U;  1S72 V;  2EBO A;  1MSW D;  1Q90 D;  5J2U B;  1SA0 A;  3OT7 A;  3RN4 A;  1PPJ H;  4ZHQ B;  1PNK A;  2Q7E A;  4FFB A;  1V54 B;  4WFF A;  4ICG A;  4F6R A;  1FXK A;  1HNZ O;  3ZRW B;  2UUA B;  4LF9 O;  2JK5 C;  3ETQ A;  3O65 A;  4JAV A;  2GTS A;  4W4L A;  2PYL A;  1DK1 A;  3VQV A;  1N33 O;  1U97 A;  2K9P A;  1NH2 D;  5AG2 A;  5B1O A;  3R65 A;  1VQ4 V;  4IYI A;  4MTF A;  1YHQ V;  2Y69 B;  1TGO A;  3W7S A;  2LQT A;  4X1I A;  4LF4 O;  3AK3 A;  3T1C A;  2XTA A;  5LYJ B;  3RYC B;  5CA3 A;  2DYR C;  2FTK A;  3DGE A;  5IJ9 A;  3OGI B;  4DW1 A;  4BWA A;  4DR4 O;  2WLL B;  1SRY A;  2V7Q G;  1I94 O;  4EKW A;  4U3F H;  3E8F A;  1EBO A;  1Y76 A;  2L35 A;  3L73 H;  5JVD A;  4J7K A;  4YHH O;  3L75 H;  2PI5 A;  1K34 A;  4AHC A;  4XBF A;  4JI2 B;  1TA8 A;  4TV9 B;  2JIZ G;  4O4L B;  1YSC A;  1IBK O;  2CH7 B;  2YXL A;  4MT8 A;  1R3K C;  1M57 C;  1AIL A;  2BSK A;  2YID A;  5JQG B;  4WBN A;  1QR8 A;  4TOI A;  4P9O A;  3E83 A;  1S76 D;  2PYJ A;  3F5W C;  3ZHT A;  4I4T B;  1XEQ A;  5IJ0 A;  1HWY A;  2EZP A;  2E3C A;  4DR2 B;  1K73 W;  4BR6 A;  2ZCE A;  3KCY A;  5H9C A;  2W6J G;  2CDY A;  4ZHQ A;  4PEL A;  1KP2 A;  3CEI A;  4FFB B;  1OCZ C;  1NJI W;  4YXW G;  1SET A;  1N34 B;  1UPG A;  2X0L A;  3APQ A;  1FFT B;  5TIS Z;  4B3S B;  4TV8 A;  1WA8 B;  2JVD A;  3CMA V;  1K4D C;  5D5Q A;  3TET A;  2OTL V;  2PF4 E;  1HNZ B;  3AG2 C;  4ZI7 A;  3BCC H;  3KCX A;  5E79 Z;  1HDJ A;  4CBC A;  4Q20 A;  2X6C A;  4QGP A;  4QE7 A;  1OCO B;  4FLY A;  3K3W A;  2ZE6 A;  1R1B A;  4DR5 B;  3DXR A;  3UKM A;  5JVD B;  2HJF C;  4F4L A;  3K0G A;  2BOB C;  3OTO B;  3SDL A;  3RBZ A;  2P67 A;  2FKX A;  4J80 A;  3ABK B;  4JI5 O;  1BQZ A;  1BCC H;  1Q6I A;  4IHJ B;  5LP6 C;  3APO A;  3K5N A;  2EIJ B;  2WSS G;  4X1K A;  1SZX A;  3P30 A;  3WG7 C;  4A5U B;  3E22 A;  3LSU A;  3U10 A;  4O4I A;  4YIO A;  2NR5 A;  2F1M A;  2P4V A;  5LP6 A;  2RN9 A;  2NLJ C;  2HR3 A;  4FLX A;  2GUZ A;  4MVU A;  1RSO B;  4PDM A;  3WU2 Z;  4B3S O;  1TVK A;  3TXS A;  4QPK A;  4O4I B;  3W7U A;  3RYI B;  4NYK A;  2WLI A;  1GM9 A;  2YIB A;  5B3S C;  1VAR A;  4JGS A;  3B40 A;  4BAY A;  1FAF A;  1F51 A;  5BY1 A;  5L3D A;  4DV7 O;  1GM8 A;  2NNU A;  1MA1 A;  1SES A;  1IBM B;  1IBL O;  2VS0 A;  4MSW C;  1B3Q A;  2Q7H A;  1CP9 A;  4FM1 A;  1US6 A;  1JMK C;  4JTC B;  4TV8 B;  1VQM V;  1XBL A;  4X64 O;  3E2E A;  1BQ0 A;  3DTU B;  1UFI A;  3PJS K;  1FYJ A;  3SPH A;  2W0X A;  1Y67 A;  5IYD O;  3ETG A;  1SQQ H;  1GN6 A;  5E1A C;  3LNN A;  4U3J B;  1VQ6 V;  1AI4 A;  2IH1 C;  5BMV B;  2P4K A;  2AZ0 A;  4GLX A;  3FKS G;  5DED A;  1R3J C;  3JSL A;  4EEQ A;  1GKF A;  4RO2 A;  4LF5 B;  4CH6 A;  5BR8 B;  2QM4 A;  5CA0 A;  1R3I C;  1RFY A;  4YJ2 A;  2Q6A A;  2QWN B;  1WLE A;  3GB7 C;  3E35 A;  2EIK B;  1SQF A;  2ZE7 A;  3IJ4 A;  3ZRS A;  3FAV A;  1OCO C;  4I55 B;  2AHZ A;  1TUB A;  2HG5 C;  2X7R B;  1E1Q G;  1KUQ A;  4TWK A;  5FPO A;  1F23 A;  1L0N H;  4I50 A;  5JCO C;  4JYA O;  4UUJ C;  4JI3 B;  5CA1 B;  5IYZ A;  3H1L H;  4UCS A;  1XMO B;  4R8C A;  2KG7 A;  3X2Q B;  3OMN B;  5IT9 N;  5IY5 B;  1PL4 A;  3JAR B;  4I5S A;  3RYH B;  4LWS A;  1JJ2 U;  5EC2 C;  1AI6 A;  4AQY B;  1N32 B;  3QVN A;  2BTQ A;  4QE9 A;  1E79 G;  4NXM O;  4YHH B;  1TVK B;  1XQ8 A;  2ITD C;  2UXN A;  3B4S A;  1PP9 H;  1HNW O;  4G28 B;  4JTA B;  1P84 F;  5LHG A;  4X66 B;  1BT8 A;  5KUK A;  3AG7 A;  2CK3 G;  1FD9 A;  4LH7 A;  2XAH A;  4JI0 B;  1M4U A;  5H6R A;  3LDD A;  3NXS A;  4JI1 B;  4CZZ A;  3AK1 A;  3ABU A;  3X2Q C;  2Q4P A;  4WCE V;  3OTF A;  1XMO O;  3EFF K;  2OYQ A;  1VEW A;  1RM1 B;  2ITC C;  5KA6 A;  2E5L B;  1H2M A;  1XIL A;  1ORQ C;  2K1E A;  4DR4 B;  4HNA A;  1JX9 A;  5K1P A;  3AG4 C;  1VF6 A;  1NT2 B;  4PA4 A;  3T4D A;  1P7B A;  2DMX A;  1NR7 A;  5GTH Z;  1BMF G;  1DLB A;  1NH2 B;  4JI8 B;  1VIB A;  1OCR B;  3C90 A;  4YJ3 B;  2UU9 B;  3CCS V;  4PA3 A;  3HKE A;  3RYF B;  4H44 B;  5C8Y B;  1D5N A;  4GKJ B;  3TK1 A;  1M9N A;  1V9P A;  3SPJ A;  1ZAU A;  4X88 A;  1BHA A;  1DGS A;  2PUS A;  2QM7 A;  3OR7 C;  3CJH B;  3CCV V;  1ZLZ A;  5ITZ A;  2KSD A;  2L6L A;  3P3P A;  4I50 B;  2UXD O;  5CBH A;  4H0L B;  5LYJ A;  5IY5 C;  4FK5 C;  4BIZ A;  1VQ7 V;  1GTO A;  3E8G A;  3RYH A;  1R73 A;  1ZUQ A;  3ICX A;  3CCJ V;  3ZIA G;  3CC7 V;  5H2F Z;  5B1B B;  3QO5 A;  3G6B A;  3MD0 A;  2KG7 B;  3A2F A;  2JGU A;  5LMN B;  2BSK B;  2ZM6 B;  4DR7 O;  4B3R B;  1IDS A;  1DF4 A;  1KKC A;  2QGN A;  4FM2 A;  3A0H Z;  3GWO A;  2OIE A;  1E1R G;  1SA0 B;  2UXX A;  4GZR B;  5LHI A;  3ABM C;  1KP3 A;  3AK2 A;  1PM9 A;  1YTF B;  3ZRX A;  5JCO A;  1I08 A;  1I5Y A;  4WFG A;  4RUE A;  2FL4 A;  1D5A A;  2ZT9 B;  1IBM O;  2UUA O;  2OCH A;  4PA9 A;  5C8Y A;  3RT3 C;  5EIB D;  3T1Y B;  1S5L Z;  2WLH A;  2ZM6 O;  3IC9 A;  3SR2 C;  4FZ1 A;  2ZD9 A;  1BGY H;  2KQX A;  2XND G;  1YJW V;  4JI4 O;  5KLV H;  3I56 V;  2JGD A;  1FFX B;  3HKB A;  3ZS8 C;  4YJ3 A;  4PD4 F;  3JAS B;  3UO3 A;  1IZ3 A;  3EVK A;  3BAB A;  1QU7 A;  4KHP B;  4B3T O;  1FXH A;  2W6I G;  3LSS A;  1N4C A;  4HZ3 A;  3OTO O;  3SYP A;  3CRA A;  1PKX A;  3K0D A;  2DWE C;  5FPR A;  4LFC B;  2LO1 A;  4CH5 A;  2ZIN A;  1VQ8 V;  3TJT A;  1ZL8 A;  2F93 B;  4UXN A;  3KZI Z;  1AJN A;  2EIJ C;  4RUF A;  4JI5 B;  1NZ6 A;  1K5Q A;  1GAX A;  2M7W A;  1SQG A;  3CC2 V;  3ASN B;  2V4D A;  2OCC C;  3CRQ A;  1XI1 A;  1Q8I A;  1M90 W;  4W4K A;  2UUB O;  3BY6 A;  3F7Y C;  2OWO A;  3AG1 B;  4BW9 A;  3M99 B;  1QHT A;  1XNQ B;  2AW9 A;  1THZ A;  4X1Y B;  1Q3E A;  4RWU A;  5F2V O;  5FNV A;  3L9D A;  2YI8 A;  4UV8 A;  2F95 B;  3SPG A;  3D8C A;  4UFZ A;  1H2S B;  4TSF G;  3H1H H;  4WFA V;  4X8A A;  1NQT A;  2ZE8 A;  1I0H A;  1OJH A;  2Q0O C;  2WLK A;  2E5L O;  3FYE B;  2HVJ C;  4B08 A;  3JCU Z;  4WFH A;  1R6T A;  4MVZ A;  1XL4 A;  1IBK B;  1UJW B;  1KYO F;  4JI1 O;  3A0R A;  1QQC A;  2Z0A A;  4CS3 A;  2R9R B;  5KHJ A;  4EB6 A;  5B3S B;  1P7G A;  3RW0 A;  3WG7 B;  3OR6 C;  2UXC O;  3BA9 A;  3FFQ A;  4GX1 A;  4LF8 B;  4LFC O;  3RGB A;  4PV1 B;  3CS5 A;  4QJF B;  1K97 A;  3Q4H A;  3CCL V;  3QO7 A;  3Q4H B;  4EB6 B;  4OPH A;  1IBL B;  1TAE A;  1N0N A;  3AG1 C;  4DXW A;  2YXH A;  4UVB A;  4DUZ B;  4DR3 B;  1L0L H;  1AR1 B;  3SYO A;  3JAS A;  3LUT B;  1VMG A;  3K58 A;  2DYR B;  1AR4 A;  2OCC B;  3KG2 A;  3E86 A;  1O9H A;  4JI4 B;  4OXS A;  1GN4 A;  2EIM C;  1SQV H;  5LMU O;  1W0J G;  1S0V A;  4E4E A;  4EFE A;  3JAW B;  3TCU A;  4N21 A;  4HBN A;  4LF9 B;  3MAQ A;  4FPP A;  4J42 A;  3D36 C;  4KL1 A;  4K0K B;  4MVS A;  3OD4 A;  4D7S A;  4FLW A;  4N23 A;  4LWS B;  3ASO C;  1XL6 A;  4X89 A;  3C3S A;  2GSM B;  2R70 A;  1WB8 A;  4TUY B;  2EJ7 A;  1EM1 A;  3FD9 A;  1AVM A;  1YEW A;  1BE3 H;  2QWP B;  2WWW A;  3BA8 A;  3QNE A;  1PV0 A;  4HAM A;  2HLD G;  2ZNI A;  1I7F A;  1VP7 A;  4GX0 A;  3QTC A;  3K57 A;  4B3R O;  4B3T B;  4LH6 A;  5LMN O;  4F6R B;  3STL C;  5LXT B;  4DR1 O;  3KKY A;  4NXM B;  4Z2W A;  1EZJ A;  2ZKO A;  2QWO B;  5L3C A;  4X20 A;  2EJR A;  1PNM A;  2P6J A;  5EC1 C;  2F43 G;  3K9A A;  5CBF A;  5EYP B;  2HHH B;  2E74 B;  2B1I A;  5EYP A;  4UCV A;  4P30 A;  4JI3 O;  2CE4 A;  3OEH G;  4LFA B;  3U0Z A;  3P32 A;  2P90 A;  2ODM A;  1XMQ O;  5H5N A;  4MVM A;  1XUQ A;  2IU3 A;  3UCS C;  3UT5 A;  3W7W A;  4DV1 O;  1BHB A;  1JVM A;  3FYI B;  4JTD B;  2EX3 A;  4DV5 O;  3BEH A;  4CC5 A;  2LGQ A;  3B8M A;  1MOF A;  4UVA A;  1WPX A;  1MG1 A;  2PTM A;  5DM6 V;  2ZIO A;  1H2K A;  2Y69 C;  3HKD A;  1XHZ A;  5KHH A;  4G27 B;  4DV5 B;  5JJN B;  2E75 B;  3F5T A;  5EK0 A;  4MVR A;  1Z5V A;  1S5H C;  4J10 A;  1SQP H;  2EIL B;  4JI8 O;  2N05 A;  2RQ6 A;  1YXB A;  4DV1 B;  1FJG B;  3RYF A;  1G8M A;  1SER A;  1S3J A;  2Q8V A;  1VF5 B;  1XDC A;  3H1J H;  2D3O W;  1XNR O;  3ZHQ A;  3JAK A;  4PHZ A;  2AXT Z;  3ML0 A;  4FIP C;  2DN9 A;  2QE7 G;  3THO A;  2WPD G;  3ZMS A;  3ZCC A;  3MHH C;  4LF6 O;  5EZY B;  2GBO A;  2MW2 B;  1OCZ B;  1H38 A;  5IJ0 B;  1HW7 A;  4XDK A;  3RYI A;  1B6Q A;  1M1K W;  3G80 A;  4X66 O;  1WA8 A;  2RNB A;  3ZN1 A;  3AG2 B;  3RVY A;  2CGO A;  1U96 A;  2LFS A;  1L8D A;  4GT1 A;  5J2U A;  2YIC A;  2WLN A;  3CRR A;  4JYC A;  1Q82 W;  2QSA A;  3CCU V;  4NR1 A;  4NVP A;  3WB0 A;  1R3L C;  4GX5 A;  4YY3 O;  4Z1M G;  4XDL A;  3CCE V;  2R9I A;  3G4S V;  4R7C A;  3JD2 A;  3EXA A;  4UV9 A;  1QVG U;  1YZB A;  3A8T A;  1PL0 A;  2Z5U A;  4AIL C;  2W0F C;  2QJ1 A;  3QO8 A;  4X1I B;  3ZX6 A;  5EIB C;  4XDJ A;  1NTZ H;  2QEX V;  5C93 A;  2IH3 C;  1FXV A;  1SQB H;  4JYB A;  4FFK A;  4JI0 O;  3N2K A;  3QG5 A;  2A06 H;  3LDE A;  5DEC A;  1QLE B;  5B66 Z;  4MS2 A;  3CSX A;  2YSU B;  2VQE O;  2ATK C;  4LF7 B;  2YIB D;  4JAA A;  4FMT A;  3N27 A;  3JD0 A;  1QR9 A;  4IGG A;  4DV6 O;  4J9Z B;  3CYO A;  4K3A A;  1HR0 O;  2ZDI A;  1H8H G;  4NXN O;  3K06 A;  2OIG A;  4DW0 A;  3OEE G;  1S5J A;  1JOY A;  1JR9 A;  4K8Z A;  1MAB G;  2Q67 A; 
#chains in the Genus database with same CATH homology
 1H8E G;  4RAI A;  3LNM B;  3CXC U;  3GWO A;  5CN0 A;  1KQS U;  1S72 V;  2EBO A;  1E1R G;  1MSW D;  2UXX A;  3OW2 U;  5LHI A;  3ABM C;  1RM1 C;  1KP3 A;  3K03 A;  4WFB V;  1PNK A;  1AJQ A;  1YTF B;  1V54 B;  4WFF A;  1OCC B;  3ZRX A;  1I5Y A;  4WFG A;  1FXK A;  3D3I A;  4RUE A;  3FB6 C;  3ZRW B;  2XAG A;  4HYO A;  1OZ0 A;  2JK5 C;  1OHH G;  4PA9 A;  4JAV A;  2B5U A;  5EBW C;  2WLH A;  4LP8 A;  2DW4 A;  2ZD9 A;  3ABL C;  2XND G;  1YJW V;  2IJI A;  1NH2 D;  1M56 B;  2JJ2 G;  5B1O A;  3I56 V;  3R65 A;  1VQ4 V;  4MTF A;  1QBZ A;  3JD3 A;  4MTG A;  1YHQ V;  2Y69 B;  1K8A W;  3ZMT A;  3W7S A;  1OCC C;  3SYQ A;  2DYS C;  3T1C A;  3E8B A;  3OUF A;  5CA3 A;  2A9H A;  2DYR C;  4DO2 A;  1M57 B;  2FTK A;  3DGE A;  1FXH A;  2W6I G;  3LSS A;  1VQK V;  4MTX A;  4HZ3 A;  3SYP A;  1QLE C;  1PKX A;  3K0D A;  2WLL B;  1SRY A;  4LCU C;  2DWE C;  2V7Q G;  3ZMZ A;  3I55 V;  4JPR A;  4P2Z A;  5EBM C;  4EKW A;  1AJP A;  3E8F A;  1VQ8 V;  1EBO A;  1K5S A;  3OAA G;  2ZR2 A;  4P9P A;  2EIN C;  2WLJ A;  2LP7 A;  2PI5 A;  1K34 A;  4XBF A;  1NVP D;  3STZ C;  2AHY A;  4UXN A;  2IJJ A;  1YIJ V;  3CME V;  2JIZ G;  1AJN A;  5L3F A;  2EIJ C;  3OUS A;  4RUF A;  1COW G;  5IDJ A;  1YSC A;  1K5Q A;  3CCM V;  2M7W A;  4MT8 A;  3CC2 V;  3ASN B;  3W7X A;  1R3K C;  2XOK G;  1M57 C;  2JDI G;  2OCC C;  1S77 D;  1M90 W;  2QM8 A;  5LGU A;  1YIT V;  1QR8 A;  5LGN A;  1VQP V;  4P9O A;  3E83 A;  1K9M W;  4UVC A;  1S76 D;  1W0K G;  3BY6 A;  3F7Y C;  3ETD A;  3F5W C;  4RQF A;  1K7D A;  5EBL C;  1M56 C;  3AG1 B;  3M99 B;  2EZP A;  1HWY A;  3ABL B;  3B8N A;  1K73 W;  5FL7 G;  3JD1 A;  5H9C A;  2W6J G;  1PNL A;  2X6A A;  1THZ A;  4PEL A;  1KP2 A;  3JD4 A;  1OCZ C;  3JCZ A;  3AG3 B;  1YJ9 V;  1NJI W;  4UV8 A;  4YXW G;  1SET A;  1QLN A;  1VQ5 V;  3SPG A;  3ZJZ A;  4TSF G;  2X0L A;  4WFA V;  1FFT B;  3FB7 C;  1NQT A;  4X8A A;  5LGT A;  1DF5 A;  3K08 A;  4QIW F;  2WLK A;  5HFL A;  3CMA V;  3FYE B;  2HVJ C;  1K4D C;  3TET A;  4JAU A;  2OTL V;  1GO3 F;  4WFH A;  3ZRW A;  1CEZ A;  2MK3 A;  2ZQM A;  4MVZ A;  1XL4 A;  3AG2 C;  4J9Y B;  1UJW B;  2A0L A;  3A0R A;  3WFV A;  4CBC A;  4Q20 A;  1YI2 V;  2X6C A;  1FS0 G;  1OCO B;  2R9R B;  4QE7 A;  4R6Z A;  3OMA B;  3ASO B;  3MHS C;  5B3S B;  1N8R W;  4PDL A;  1VQL V;  3K3W A;  4FJC C;  2ZR3 A;  1F4N A;  3RW0 A;  3D36 A;  3UKM A;  3AG4 B;  3WG7 B;  1Q7Y W;  3OR6 C;  2H8P C;  2HJF C;  4F4L A;  2Q67 A;  3K0G A;  1YJN V;  2BOB C;  1VQ9 V;  2ZXW B;  4PA6 A;  1Q81 W;  4GX1 A;  3ZMV A;  1QVF U;  3W7T A;  3RBZ A;  1K97 A;  1OCR C;  2P67 A;  3SYA A;  4QJF B;  3ABK B;  3CCL V;  3QO7 A;  5KA5 A;  1ARO P;  2IW5 A;  1K92 A;  3AG1 C;  4DXW A;  4I9W A;  3AEI A;  2Q68 A;  2EIJ B;  4MVO A;  4UVB A;  2EIK C;  2WSS G;  2YEV B;  2DQ0 A;  1AR1 B;  3P30 A;  4KUM A;  3SYO A;  3K04 A;  3LUT B;  3AG3 C;  3WG7 C;  1F4M A;  2A79 B;  2DYR B;  1YTF D;  2OCC B;  3KG2 A;  3E86 A;  5CBG A;  5LHH A;  2WLI B;  3ASN C;  4GCZ A;  4OXS A;  3OE7 G;  2EIM C;  3IGA C;  2NLJ C;  1W0J G;  1S0V A;  3OFN G;  2HR3 A;  1RPO A;  3TCU A;  4N21 A;  4MVU A;  1W2B U;  4PDM A;  1Y66 A;  4FPP A;  4QPK A;  2C2A A;  2EIN B;  4MVS A;  3W7U A;  3CD6 V;  2WLI A;  4N23 A;  1GM9 A;  1IXM A;  3ASO C;  5B3S C;  1AI5 A;  1R6N A;  2DYS B;  5L3E A;  4RQE A;  5IYC O;  4JGS A;  1XL6 A;  4X89 A;  3EHB B;  2GSM B;  3T2M A;  4BAY A;  5H6Q A;  3H01 A;  5KUM A;  1F51 A;  5L3D A;  2HKO A;  2Y48 A;  3CCR V;  2WLM A;  1BL8 A;  2B1G A;  1GM8 A;  2IU0 A;  2QA4 V;  2NNU A;  2WWW A;  3E8H A;  1SES A;  3QNE A;  4HAM A;  4MSW C;  5GW7 A;  2HLD G;  1CP9 A;  4U7O A;  4JTC B;  4GX0 A;  1VQM V;  1NVP B;  3T4Z A;  3E2E A;  3DTU B;  1KKD A;  2DQ3 A;  3LDC A;  3STL C;  2JJ1 G;  3VOU A;  3PJS K;  3IC7 A;  3K79 A;  3SPH A;  1EZJ A;  5DN6 G;  4WF9 V;  2OTJ V;  5L3C A;  5IYD O;  2EJR A;  1PNM A;  2P6J A;  1V55 C;  3ETG A;  1FXK C;  2F43 G;  3K9A A;  3ABT A;  1V54 C;  5EC1 C;  5B1A B;  5E1A C;  4BW5 A;  5CBF A;  3G71 V;  2B1I A;  2Z3Y A;  4P30 A;  3OEH G;  1VQ6 V;  1AI4 A;  2IH1 C;  3P32 A;  2P90 A;  4WFE A;  4H33 A;  4MVM A;  2IU3 A;  3FKS G;  2X6B A;  1R3J C;  3W7W A;  1BHB A;  1JVM A;  1VQO V;  2WLL A;  1GKF A;  4RO2 A;  3IFX A;  1NBM G;  4BIU A;  3ETE A;  1R3I C;  3VBB A;  3FYI B;  2Q6A A;  4JTD B;  1K33 A;  4R50 A;  3JYC A;  1JQ0 A;  3BEH A;  1JPX A;  2BOC C;  1MOF A;  3B8M A;  1WPX A;  2EZO A;  4JF3 A;  4UVA A;  5B1A C;  1MG1 A;  1WLE A;  4QNH B;  5DM6 V;  3GB7 C;  2Y69 C;  1K3E A;  2YEV A;  3E35 A;  3CCQ V;  5CMU A;  2EIK B;  4G27 B;  1PD3 A;  3ZRS A;  5EK0 A;  4MVR A;  1OCO C;  1S5H C;  2EIL B;  2AHZ A;  2XAJ A;  2HG5 C;  2X7R B;  5LBQ A;  1E1Q G;  4TWK A;  1JCH A;  2KB1 A;  1NKD A;  1F23 A;  1G8M A;  1GMG A;  1AI7 A;  2V1D A;  1SER A;  1S3J A;  4UUJ C;  2D3O W;  4MW3 A;  4R8C A;  3OMN B;  3ABM B;  3X2Q B;  3CPW U;  5IY5 B;  3ML0 A;  4FIP C;  4I5S A;  2QE7 G;  1JJ2 U;  2WPD G;  5EC2 C;  3ZMS A;  1AI6 A;  1SZT A;  3SJQ C;  3ZCC A;  1QCE A;  2WAM A;  3MHH C;  4QE9 A;  1V55 B;  1E79 G;  2XAF A;  4GX2 A;  3ZN0 A;  4QPJ A;  5BZB A;  1OCZ B;  3B77 A;  1H38 A;  2ITD C;  4KFM A;  2P7T C;  2UXN A;  4XDK A;  1B6Q A;  1KEC A;  4G28 B;  4JTA B;  2LFR A;  1M1K W;  3OGC C;  5LHG A;  4L87 A;  3LSQ A;  3AG2 B;  1FXK B;  2ZXW C;  4KP4 A;  2CK3 G;  3RVY A;  3ZN1 A;  2XAH A;  5KUK A;  4PDR A;  3CC4 V;  5J9P C;  5H6R A;  2LFS A;  3LDD A;  3NXS A;  4GT1 A;  4CZZ A;  3OMI B;  3ABU A;  3X2Q C;  4E2L A;  2WLN A;  1CPY A;  2XAS A;  4WCE V;  1Y4M A;  3EFF K;  3UM7 A;  1NR1 A;  2IJH A;  1RM1 B;  4JYC A;  1Q82 W;  1VQN V;  2ITC C;  1ZWI C;  3SYC A;  5KA6 A;  3CCU V;  5L3B A;  5B1B C;  1ORQ C;  1R3L C;  4GX5 A;  4Z1M G;  2K1E A;  1KC8 W;  1EFR G;  1JX9 A;  1ROP A;  4XDL A;  1L1F A;  3CCE V;  3AG4 C;  2JEX A;  4PA4 A;  3T4D A;  1P7B A;  5B1N A;  4PDV A;  5IYB O;  1NR7 A;  2R9I A;  2EIM B;  3FB5 C;  2XAQ A;  3G4S V;  1H2G A;  1LNQ A;  4R7C A;  3JD2 A;  1BMF G;  1DLB A;  1NH2 B;  4UV9 A;  3ABK C;  1QVG U;  1OCR B;  4U7N A;  4H37 A;  1ENV A;  1PL0 A;  2Z5U A;  3SPC A;  2IJK A;  4LC1 A;  3CCS V;  2W0F C;  2ZDI C;  4PA3 A;  3QO8 A;  2HFE C;  4LBE C;  5L3G A;  3F7V C;  1Q86 W;  4MTO A;  4PA7 A;  3ZMU A;  1GK9 A;  4XDJ A;  3TK1 A;  1M9N A;  2QEX V;  5C93 A;  2IH3 C;  3SPJ A;  3OM3 B;  1FXV A;  3FB8 C;  4X88 A;  4MW8 A;  4JYB A;  1BHA A;  2QM7 A;  1R6K A;  1I5X A;  4G2K A;  1P4R A;  3OR7 C;  2H94 A;  2GHY A;  3LDE A;  3CCV V;  1G4Y B;  1QLE B;  4MS2 A;  3HPL C;  2DWD C;  2YSU B;  3HB3 B;  1J95 A;  2ATK C;  5CBH A;  4ZKI A;  5IY5 C;  1KD1 W;  4MVQ A;  4FMT A;  3JD0 A;  4FK5 C;  4BIZ A;  1VQ7 V;  1QR9 A;  1GTO A;  3E8G A;  5HFM A;  1DTO A;  4JAS A;  3CP1 A;  1R73 A;  1GM7 A;  4TT3 G;  2PI4 A;  4J9Z B;  3CYO A;  4ZBM A;  1RPR A;  2ZDI A;  3SPI A;  2Q69 A;  1H8H G;  3ZIA G;  3G6E V;  3CCJ V;  3E89 A;  2QKS A;  3CC7 V;  3K06 A;  2QTO A;  5B1B B;  2HVK C;  3OEE G;  3QO5 A;  2EIL C;  2OT5 A;  3MD0 A;  1JOY A;  1K4C C;  2JEU A;  3RVZ A;  4ASU G;  1TUE B;  3ZRV A;  1MAB G;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...