3K7AK

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3k7aK00
1HQMA 4G7HA 4A3EC 2CW0A 5IYCC 3GTOK 2Y0SL 4BY7C 3S1MK 4XSZA 4QJVB 2WAQD 1K83C 2E2IK 3S17K 1I6HC 5M3MK 2R7ZC 1WCMK 1YNJA 4NOIA 4A3KC 4YG2A 4A3CC 5C4XC 1I50C 3GTPK 1I3QK 4KN7A 1BDFA 2WAQL 1TWCC 5C44K 4Y7NK 3HOVK 3M3YK 2YU9C 4KN4A 3GTGK 2NVXC 4MQ9A 4Y52K 1IW7A 3K7AK 2NVYK 3S1NK 1R9TC 5IYBC 3HOXK 4LK0A 3HOWC 3S1RC 2B63K 4A3GK 4A3LC 4LJZA 3RZOK 4YFNA 4AYBD 4YFXA 3I4MK 4BXXK 4LK1A 2Y0SD 4C3JK 3S1QC 4GZYA 2JA6K 5IYDK 2JA7C 3M4OC 4A3BK 4MEXA 3FKIK 5IP9K 5M3FK 5IP7K 4A3JK 4A3FC 4A93C 4AYBL 3EQLA 3H0GK 1Y1WC 4Q5SA 2PA8D 4BY1K 3GTJC 3I4NC 3S16K 4KMUA 3WODA 3PO3K 2E2HK 4X6AK 5C4JK 3S2DC 3H3VD 4BBRK 4QIWL 2PA8L 5D4DA 4A3IK 5FLMK 3GTMC 3S15K 3GTKK 2E2JC 4OIPA 5TMCA 1TWHK 2NVTK 2JA5K 4OIQA 3S2HC 2PMZD 2JA8C 2E2IC 3S17C 3S1MC 3H3VL 2NVQC 4JK1A 2VUMK 3S14C 2O5IA 1WCMC 4C2MK 5C3EK 2O5JA 3GTPC 3HOUK 1I3QC 3HOVC 4Y7NC 5C44C 2PMZL 3M3YC 3GTGC 2R7ZK 1TWGC 4Y52C 4Q4ZA 3K7AC 2NVYC 3GTQK 1TWCK 3S1NC 3HOXC 3GTLK 4LLGA 3HOYC 2A6EA 2YU9K 2R93K 1Y1VC 1TWFC 2B63C 4A3GC 3RZOC 4ZH4A 2A69A 4QIWD 3HOZK 4A3DK 4BBSK 3CQZK 5IYBK 4BXXC 1ZYRA 4MEYA 4A3MC 1SFOK 4A3LK 2R92C 5TMFA 3PO2K 4A3BC 3FKIC 5IP9C 3RZDK 1TWAK 3HKZD 3GTOC 4C3HK 3DXJA 3M4OK 4OIRA 1XPPA 3S16C 3PO3C 4XLNA 5C4JC 4A3EK 5IYCK 1Y1WK 3HKZL 4YFKA 3GTJK 4BY7K 4A3IC 3I4NK 3S15C 5FLMC 4BBSC 1K83K 3GTKC 1I6HK 1TWHC 5M5WK 2JA5C 2NVTC 3S2DK 2BE5A 4A3KK 4QJVA 2VUMC 5C4XK 1I50K 5M5XK 3GTMK 4A3CK 2E2JK 5C3EC 3S2HK 3HOUC 2JA8K 2A68A 2NVXK 2NVQK 3S14K 1SMYA 2A6HA 4OIOA 4XSXA 1R9TK 3HOWK 3I4MC 2PPBA 4OINA 1I6VA 5FJ8K 3S1RK 3GTQC 1YNNA 3GTLC 2R93C 5IYDC 2JA6C 4A3JC 1TWGK 5IP7C 3H0GC 3HOZC 3S1QK 4BY1C 2WB1D 3CQZC 4A3DC 5M5YK 3HOYK 2JA7K 4G7ZA 1Y1VK 1TWFK 4A93K 4A3FK 1SFOC 2E2HC 4X6AC 3PO2C 3RZDC 4BBRC 1TWAC 2WB1L 4A3MK 4XLPA 4C3IK 4G7OA 2R92K
chains in the Genus database with same CATH superfamily
1B4BA 3GTQA 4G7HA 4QJVB 1K83C 1USOA 2RH6A 4NOIA 1O26A 4BBSK 1TWAA 5JFEA 3S1NK 3A8JA 2ZFZA 2B63K 4A3GK 5IOQA 3A8IA 5IOTA 2R7ZA 3L4KA 3S0XA 1O28A 1ZQ1C 5IYDK 3M4OC 4A3BK 2V6TA 4A93C 2CFAB 1IBAA 4Q5SA 3GTJC 4RMFA 3I4NC 4KMUA 3WODA 3ERED 3HXAA 1EI6A 1X31C 5D4DA 2PA8L 3GTMC 5TMCA 3AQPA 1TWHK 2NVTK 2E2IC 3S17C 3H3VL 2NVQC 4JK1A 2JA7A 4G0WA 1EK8A 4C2MK 5C3EK 2O5JA 3HOUK 3HOVC 2PMZL 3AH5A 3M3YC 1WQFA 2V6SA 2W7VA 1V5VA 1UV7A 3A8KA 4KM8A 3VA7A 2NVYC 3GTQK 1TWCK 4KARA 1Y1VC 2A69A 4QIWD 4A3DK 4AH6A 4C3JC 4MEYA 3IPJA 4C3IC 1R9TA 2R92C 1DD5A 2GAGC 3PO2K 1TWAK 3GTGA 1TWGA 3DXJA 1B4AA 2FQOA 1WQGA 2GSOA 1EFWA 1Y1WK 3HKZL 3LAJA 5FLMC 1XZPB 4ILDA 5M5WK 3TTGA 2JA5C 1J6WA 3SZZA 4QJVA 3TFJA 1I50K 4GTAA 4GT9A 1YX2A 4KB4A 2P8TA 4G0UA 4OINA 1I6VA 3S1RK 1YNNA 3FHZA 1YCLA 2JA6C 1WSVA 3GTKA 3T02A 1KQ4A 1XXBA 4BY1C 2VUMA 3BUEA 2JA7K 1IL2A 1BJTA 3RZDC 4BBRC 1J6XA 4XLPA 4C3HC 3LPXA 4P5BA 2R93A 4A3EC 2CW0A 3GTOK 3T00A 2Y0SL 4XSZA 1VJEA 3CQZA 5M3MK 1SFOA 4KM9A 4A3KC 4A3CC 4Y7NK 2YU9C 4KN4A 3GTGK 2NVXC 5CHPA 4Y52K 4GTCA 1IW7A 1R9TC 5IYBC 3HOXK 4A3LC 5TJ3A 1BGWA 4KMAA 4P5AA 4GZYA 1XXAA 3CAGA 4A3JK 1TWCA 5IP7K 3H0GK 2PA8D 3S16K 1EQRA 1IS1A 2XCOA 2E2HK 3H3VD 1PJ6A 3S15K 3GTKK 2E2JC 2PMZD 1F9NA 4FM9A 3MMLB 2VUMK 3S14C 4GTEA 2O5IA 3GDZA 5IOSA 1Y1WA 5JVOA 1JQWA 4Q4ZA 1VRQC 4O2DA 1ZBSA 3S1NC 2R93K 1I50A 2A6EA 1TWFC 2B63C 4A3GC 4BLBA 1ZVUA 4ZH4A 3HOZK 3CQZK 1WCMA 5EGEA 1SFOK 3GTPA 1VGXA 5TMFA 1I3QA 2Y3PA 4A3BC 1INNA 3HKZD 4LOWA 3M4OK 4OIRA 1XPPA 1PJ7A 5IYCK 3GTJK 4BY7K 3I4NK 3TFIA 4GTLA 3OPFA 5CJ9A 1I6HK 1VH2A 1TWHC 2NVTC 1O2BA 1EH1A 3GTMK 3FKIA 5C4XK 4KB2A 4C2MC 5C3EC 3GTOA 4DDQA 3HOUC 2A68A 4KMDA 1WOPA 3OEPA 2NVQK 1JOEA 1F7VA 3HOWK 3I4MC 5FJ8K 2KWAA 3N3YA 1F7UA 3GTQC 4KASA 2FQTA 4G0VA 3S1QK 4A3DC 4KATA 1Y1VK 1XZQB 4A3FK 4X6AC 3BP8C 3PO2C 1TWAC 1O2AA 2WB1L 4C3IK 2R92K 1PJ5A 1HQMA 4KAWX 3GTLA 4C45A 3GSIA 3S1MK 3H0GA 1IQ0A 2E2HA 2R7ZC 4GTBA 1WCMK 1VLOA 4YG2A 1I50C 3GTPK 1I3QK 2WAQL 5C44K 1WOOA 4MQ9A 5L46A 3K7AK 1GE9A 3S1RC 2D6FC 2PHCB 3ADAC 4YFNA 1K83A 3RZOK 4YFXA 4BXXK 1O27A 4PABA 4BLAA 1RU0A 2CFAA 2JA6K 2JA7C 3FKIK 5IP9K 4AYBL 1WQHA 4BY1K 3PO3K 5HL8A 5C4JK 1O29A 3S2DC 4BBRK 3AD7C 4QIWL 4A3IK 1WIHA 3TFHA 3S2HC 1WSRA 2JA8C 3GTJA 4Y7NC 2GSUA 3GTGC 1TWGC 4Y52C 3HOXC 3GTLK 4LLGA 3HOYC 3GTMA 2YU9K 2E2IA 4LQYA 4PAAA 1C0AA 5IYBK 1ZYRA 4GTFA 4A3MC 3SZYA 4A3LK 4WJ3M 4WJ4A 3GIRA 4M1XA 2V6UA 1O2FB 2EBBA 2NVYA 3S16C 4XLNA 3GEIA 1Y1VA 1XZPA 1ISEA 3S15C 4BBSC 1K83K 3GTKC 2P5MA 3JSTA 2R92A 4KMHA 2VUMC 3LAPA 2E2JK 3FOEA 3BP3A 4KC6A 3AQOA 1JVIA 3S14K 4XSXA 4J3NA 3G4CA 2R93C 3AD9C 5IYDC 2JA5A 1WOSA 3HOZC 1XXCA 2WB1D 3CQZC 1TWFK 4A93K 1SFOC 1WORA 2ZUEA 2ZUFA 2JA6A 1O25A 1IE0A 5IYCC 3GEHA 1L0WA 3NUHA 4BY7C 2WAQD 2E2IK 3S17K 1I6HC 3GEEA 1YNJA 5C4XC 3HOVK 4KN7A 1BDFA 1O24A 1TWCC 3M3YK 4KDDA 3OREA 2NVYK 4P9SA 3HOWC 1BS2A 4LK0A 1USMA 4LJZA 2XCRB 4AYBD 3I4MK 4LK1A 2Y0SD 4C3JK 3S1QC 3Q3QA 4MEXA 5M3FK 4A3FC 2YU9A 3EQLA 3AD8C 1Y1WC 2NVXA 2XCQA 2RGRA 4X6AK 4GFQA 3N0CA 5FLMK 5EGHA 4WILA 4OIPA 3S1MC 1J98A 2JA5K 3L4JA 4OIQA 3QX3A 1WCMC 3GTPC 1I3QC 5C44C 4BKWA 4XCHA 2R7ZK 3FOFA 3K7AC 1G51A 1DCHA 3RZOC 5E68A 4BXXC 1F93A 4GTDA 3FKIC 5IP9C 3RZDK 5IORA 3GTOC 4C3HK 2JH3A 3G4AA 3PO3C 2GSNA 4LR2A 5C4JC 4A3EK 1TWFA 1ZXOA 4YFKA 2B63A 4FZBA 4A3IC 3S2DK 2BE5A 4A3KK 4A3CK 5M5XK 3S2HK 2JA8K 3V4GA 1DCPA 2NVXK 1SMYA 1HI9A 2A6HA 1J6VA 4OIOA 1R9TK 2PPBA 3GTLC 3T01A 4A3JC 1TWGK 1TWHA 5IP7C 3H0GC 1XZQA 1DCOA 5M5YK 3HOYK 2GAHC 4G7ZA 2E2HC 3N0BA 1AB4A 4A3MK 4G7OA
chains in the Genus database with same CATH topology
1HQMA 4G7HA 4A3EC 2CW0A 5IYCC 3GTOK 2Y0SL 4BY7C 3S1MK 4XSZA 4QJVB 2WAQD 1K83C 2E2IK 3S17K 1I6HC 5M3MK 2R7ZC 1WCMK 1YNJA 4NOIA 4A3KC 4YG2A 4A3CC 5C4XC 1I50C 3GTPK 1I3QK 4KN7A 1BDFA 2WAQL 1TWCC 5C44K 4Y7NK 3HOVK 3M3YK 2YU9C 4KN4A 3GTGK 2NVXC 4MQ9A 4Y52K 1IW7A 3K7AK 2NVYK 3S1NK 1R9TC 5IYBC 3HOXK 4LK0A 3HOWC 3S1RC 2B63K 4A3GK 4A3LC 4LJZA 3RZOK 4YFNA 4AYBD 4YFXA 3I4MK 4BXXK 4LK1A 2Y0SD 4C3JK 3S1QC 4GZYA 2JA6K 5IYDK 2JA7C 3M4OC 4A3BK 4MEXA 3FKIK 5IP9K 5M3FK 5IP7K 4A3JK 4A3FC 4A93C 4AYBL 3EQLA 3H0GK 1Y1WC 4Q5SA 2PA8D 4BY1K 3GTJC 3I4NC 3S16K 4KMUA 3WODA 3PO3K 2E2HK 4X6AK 5C4JK 3S2DC 3H3VD 4BBRK 4QIWL 2PA8L 5D4DA 4A3IK 5FLMK 3GTMC 3S15K 3GTKK 2E2JC 4OIPA 5TMCA 1TWHK 2NVTK 2JA5K 4OIQA 3S2HC 2PMZD 2JA8C 2E2IC 3S17C 3S1MC 3H3VL 2NVQC 4JK1A 2VUMK 3S14C 2O5IA 1WCMC 4C2MK 5C3EK 2O5JA 3GTPC 3HOUK 1I3QC 3HOVC 4Y7NC 5C44C 2PMZL 3M3YC 3GTGC 2R7ZK 1TWGC 4Y52C 4Q4ZA 3K7AC 2NVYC 3GTQK 1TWCK 3S1NC 3HOXC 3GTLK 4LLGA 3HOYC 2A6EA 2YU9K 2R93K 1Y1VC 1TWFC 2B63C 4A3GC 3RZOC 4ZH4A 2A69A 4QIWD 3HOZK 4A3DK 4BBSK 3CQZK 5IYBK 4BXXC 1ZYRA 4MEYA 4A3MC 1SFOK 4A3LK 2R92C 5TMFA 3PO2K 4A3BC 3FKIC 5IP9C 3RZDK 1TWAK 3HKZD 3GTOC 4C3HK 3DXJA 3M4OK 4OIRA 1XPPA 3S16C 3PO3C 4XLNA 5C4JC 4A3EK 5IYCK 1Y1WK 3HKZL 4YFKA 3GTJK 4BY7K 4A3IC 3I4NK 3S15C 5FLMC 4BBSC 1K83K 3GTKC 1I6HK 1TWHC 5M5WK 2JA5C 2NVTC 3S2DK 2BE5A 4A3KK 4QJVA 2VUMC 5C4XK 1I50K 5M5XK 3GTMK 4A3CK 2E2JK 5C3EC 3S2HK 3HOUC 2JA8K 2A68A 2NVXK 2NVQK 3S14K 1SMYA 2A6HA 4OIOA 4XSXA 1R9TK 3HOWK 3I4MC 2PPBA 4OINA 1I6VA 5FJ8K 3S1RK 3GTQC 1YNNA 3GTLC 2R93C 5IYDC 2JA6C 4A3JC 1TWGK 5IP7C 3H0GC 3HOZC 3S1QK 4BY1C 2WB1D 3CQZC 4A3DC 5M5YK 3HOYK 2JA7K 4G7ZA 1Y1VK 1TWFK 4A93K 4A3FK 1SFOC 2E2HC 4X6AC 3PO2C 3RZDC 4BBRC 1TWAC 2WB1L 4A3MK 4XLPA 4C3IK 4G7OA 2R92K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  4G7H A;  4A3E C;  2CW0 A;  5IYC C;  3GTO K;  2Y0S L;  4BY7 C;  3S1M K;  4XSZ A;  4QJV B;  2WAQ D;  1K83 C;  2E2I K;  3S17 K;  1I6H C;  5M3M K;  2R7Z C;  1WCM K;  1YNJ A;  4NOI A;  4A3K C;  4YG2 A;  4A3C C;  5C4X C;  1I50 C;  3GTP K;  1I3Q K;  4KN7 A;  1BDF A;  2WAQ L;  1TWC C;  5C44 K;  4Y7N K;  3HOV K;  3M3Y K;  2YU9 C;  4KN4 A;  3GTG K;  2NVX C;  4MQ9 A;  4Y52 K;  1IW7 A;  3K7A K;  2NVY K;  3S1N K;  1R9T C;  5IYB C;  3HOX K;  4LK0 A;  3HOW C;  3S1R C;  2B63 K;  4A3G K;  4A3L C;  4LJZ A;  3RZO K;  4YFN A;  4AYB D;  4YFX A;  3I4M K;  4BXX K;  4LK1 A;  2Y0S D;  4C3J K;  3S1Q C;  4GZY A;  2JA6 K;  5IYD K;  2JA7 C;  3M4O C;  4A3B K;  4MEX A;  3FKI K;  5IP9 K;  5M3F K;  5IP7 K;  4A3J K;  4A3F C;  4A93 C;  4AYB L;  3EQL A;  3H0G K;  1Y1W C;  4Q5S A;  2PA8 D;  4BY1 K;  3GTJ C;  3I4N C;  3S16 K;  4KMU A;  3WOD A;  3PO3 K;  2E2H K;  4X6A K;  5C4J K;  3S2D C;  3H3V D;  4BBR K;  4QIW L;  2PA8 L;  5D4D A;  4A3I K;  5FLM K;  3GTM C;  3S15 K;  3GTK K;  2E2J C;  4OIP A;  5TMC A;  1TWH K;  2NVT K;  2JA5 K;  4OIQ A;  3S2H C;  2PMZ D;  2JA8 C;  2E2I C;  3S17 C;  3S1M C;  3H3V L;  2NVQ C;  4JK1 A;  2VUM K;  3S14 C;  2O5I A;  1WCM C;  4C2M K;  5C3E K;  2O5J A;  3GTP C;  3HOU K;  1I3Q C;  3HOV C;  4Y7N C;  5C44 C;  2PMZ L;  3M3Y C;  3GTG C;  2R7Z K;  1TWG C;  4Y52 C;  4Q4Z A;  3K7A C;  2NVY C;  3GTQ K;  1TWC K;  3S1N C;  3HOX C;  3GTL K;  4LLG A;  3HOY C;  2A6E A;  2YU9 K;  2R93 K;  1Y1V C;  1TWF C;  2B63 C;  4A3G C;  3RZO C;  4ZH4 A;  2A69 A;  4QIW D;  3HOZ K;  4A3D K;  4BBS K;  3CQZ K;  5IYB K;  4BXX C;  1ZYR A;  4MEY A;  4A3M C;  1SFO K;  4A3L K;  2R92 C;  5TMF A;  3PO2 K;  4A3B C;  3FKI C;  5IP9 C;  3RZD K;  1TWA K;  3HKZ D;  3GTO C;  4C3H K;  3DXJ A;  3M4O K;  4OIR A;  1XPP A;  3S16 C;  3PO3 C;  4XLN A;  5C4J C;  4A3E K;  5IYC K;  1Y1W K;  3HKZ L;  4YFK A;  3GTJ K;  4BY7 K;  4A3I C;  3I4N K;  3S15 C;  5FLM C;  4BBS C;  1K83 K;  3GTK C;  1I6H K;  1TWH C;  5M5W K;  2JA5 C;  2NVT C;  3S2D K;  2BE5 A;  4A3K K;  4QJV A;  2VUM C;  5C4X K;  1I50 K;  5M5X K;  3GTM K;  4A3C K;  2E2J K;  5C3E C;  3S2H K;  3HOU C;  2JA8 K;  2A68 A;  2NVX K;  2NVQ K;  3S14 K;  1SMY A;  2A6H A;  4OIO A;  4XSX A;  1R9T K;  3HOW K;  3I4M C;  2PPB A;  4OIN A;  1I6V A;  5FJ8 K;  3S1R K;  3GTQ C;  1YNN A;  3GTL C;  2R93 C;  5IYD C;  2JA6 C;  4A3J C;  1TWG K;  5IP7 C;  3H0G C;  3HOZ C;  3S1Q K;  4BY1 C;  2WB1 D;  3CQZ C;  4A3D C;  5M5Y K;  3HOY K;  2JA7 K;  4G7Z A;  1Y1V K;  1TWF K;  4A93 K;  4A3F K;  1SFO C;  2E2H C;  4X6A C;  3PO2 C;  3RZD C;  4BBR C;  1TWA C;  2WB1 L;  4A3M K;  4XLP A;  4C3I K;  4G7O A;  2R92 K; 
#chains in the Genus database with same CATH topology
 1B4B A;  3GTQ A;  4G7H A;  4QJV B;  1K83 C;  1USO A;  2RH6 A;  4NOI A;  1O26 A;  4BBS K;  1TWA A;  5JFE A;  3S1N K;  3A8J A;  2ZFZ A;  2B63 K;  4A3G K;  5IOQ A;  3A8I A;  5IOT A;  2R7Z A;  3L4K A;  3S0X A;  1O28 A;  1ZQ1 C;  5IYD K;  3M4O C;  4A3B K;  2V6T A;  4A93 C;  2CFA B;  1IBA A;  4Q5S A;  3GTJ C;  4RMF A;  3I4N C;  4KMU A;  3WOD A;  3ERE D;  3HXA A;  1EI6 A;  1X31 C;  5D4D A;  2PA8 L;  3GTM C;  5TMC A;  3AQP A;  1TWH K;  2NVT K;  2E2I C;  3S17 C;  3H3V L;  2NVQ C;  4JK1 A;  2JA7 A;  4G0W A;  1EK8 A;  4C2M K;  5C3E K;  2O5J A;  3HOU K;  3HOV C;  2PMZ L;  3AH5 A;  3M3Y C;  1WQF A;  2V6S A;  2W7V A;  1V5V A;  1UV7 A;  3A8K A;  4KM8 A;  3VA7 A;  2NVY C;  3GTQ K;  1TWC K;  4KAR A;  1Y1V C;  2A69 A;  4QIW D;  4A3D K;  4AH6 A;  4C3J C;  4MEY A;  3IPJ A;  4C3I C;  1R9T A;  2R92 C;  1DD5 A;  2GAG C;  3PO2 K;  1TWA K;  3GTG A;  1TWG A;  3DXJ A;  1B4A A;  2FQO A;  1WQG A;  2GSO A;  1EFW A;  1Y1W K;  3HKZ L;  3LAJ A;  5FLM C;  1XZP B;  4ILD A;  5M5W K;  3TTG A;  2JA5 C;  1J6W A;  3SZZ A;  4QJV A;  3TFJ A;  1I50 K;  4GTA A;  4GT9 A;  1YX2 A;  4KB4 A;  2P8T A;  4G0U A;  4OIN A;  1I6V A;  3S1R K;  1YNN A;  3FHZ A;  1YCL A;  2JA6 C;  1WSV A;  3GTK A;  3T02 A;  1KQ4 A;  1XXB A;  4BY1 C;  2VUM A;  3BUE A;  2JA7 K;  1IL2 A;  1BJT A;  3RZD C;  4BBR C;  1J6X A;  4XLP A;  4C3H C;  3LPX A;  4P5B A;  2R93 A;  4A3E C;  2CW0 A;  3GTO K;  3T00 A;  2Y0S L;  4XSZ A;  1VJE A;  3CQZ A;  5M3M K;  1SFO A;  4KM9 A;  4A3K C;  4A3C C;  4Y7N K;  2YU9 C;  4KN4 A;  3GTG K;  2NVX C;  5CHP A;  4Y52 K;  4GTC A;  1IW7 A;  1R9T C;  5IYB C;  3HOX K;  4A3L C;  5TJ3 A;  1BGW A;  4KMA A;  4P5A A;  4GZY A;  1XXA A;  3CAG A;  4A3J K;  1TWC A;  5IP7 K;  3H0G K;  2PA8 D;  3S16 K;  1EQR A;  1IS1 A;  2XCO A;  2E2H K;  3H3V D;  1PJ6 A;  3S15 K;  3GTK K;  2E2J C;  2PMZ D;  1F9N A;  4FM9 A;  3MML B;  2VUM K;  3S14 C;  4GTE A;  2O5I A;  3GDZ A;  5IOS A;  1Y1W A;  5JVO A;  1JQW A;  4Q4Z A;  1VRQ C;  4O2D A;  1ZBS A;  3S1N C;  2R93 K;  1I50 A;  2A6E A;  1TWF C;  2B63 C;  4A3G C;  4BLB A;  1ZVU A;  4ZH4 A;  3HOZ K;  3CQZ K;  1WCM A;  5EGE A;  1SFO K;  3GTP A;  1VGX A;  5TMF A;  1I3Q A;  2Y3P A;  4A3B C;  1INN A;  3HKZ D;  4LOW A;  3M4O K;  4OIR A;  1XPP A;  1PJ7 A;  5IYC K;  3GTJ K;  4BY7 K;  3I4N K;  3TFI A;  4GTL A;  3OPF A;  5CJ9 A;  1I6H K;  1VH2 A;  1TWH C;  2NVT C;  1O2B A;  1EH1 A;  3GTM K;  3FKI A;  5C4X K;  4KB2 A;  4C2M C;  5C3E C;  3GTO A;  4DDQ A;  3HOU C;  2A68 A;  4KMD A;  1WOP A;  3OEP A;  2NVQ K;  1JOE A;  1F7V A;  3HOW K;  3I4M C;  5FJ8 K;  2KWA A;  3N3Y A;  1F7U A;  3GTQ C;  4KAS A;  2FQT A;  4G0V A;  3S1Q K;  4A3D C;  4KAT A;  1Y1V K;  1XZQ B;  4A3F K;  4X6A C;  3BP8 C;  3PO2 C;  1TWA C;  1O2A A;  2WB1 L;  4C3I K;  2R92 K;  1PJ5 A;  1HQM A;  4KAW X;  3GTL A;  4C45 A;  3GSI A;  3S1M K;  3H0G A;  1IQ0 A;  2E2H A;  2R7Z C;  4GTB A;  1WCM K;  1VLO A;  4YG2 A;  1I50 C;  3GTP K;  1I3Q K;  2WAQ L;  5C44 K;  1WOO A;  4MQ9 A;  5L46 A;  3K7A K;  1GE9 A;  3S1R C;  2D6F C;  2PHC B;  3ADA C;  4YFN A;  1K83 A;  3RZO K;  4YFX A;  4BXX K;  1O27 A;  4PAB A;  4BLA A;  1RU0 A;  2CFA A;  2JA6 K;  2JA7 C;  3FKI K;  5IP9 K;  4AYB L;  1WQH A;  4BY1 K;  3PO3 K;  5HL8 A;  5C4J K;  1O29 A;  3S2D C;  4BBR K;  3AD7 C;  4QIW L;  4A3I K;  1WIH A;  3TFH A;  3S2H C;  1WSR A;  2JA8 C;  3GTJ A;  4Y7N C;  2GSU A;  3GTG C;  1TWG C;  4Y52 C;  3HOX C;  3GTL K;  4LLG A;  3HOY C;  3GTM A;  2YU9 K;  2E2I A;  4LQY A;  4PAA A;  1C0A A;  5IYB K;  1ZYR A;  4GTF A;  4A3M C;  3SZY A;  4A3L K;  4WJ3 M;  4WJ4 A;  3GIR A;  4M1X A;  2V6U A;  1O2F B;  2EBB A;  2NVY A;  3S16 C;  4XLN A;  3GEI A;  1Y1V A;  1XZP A;  1ISE A;  3S15 C;  4BBS C;  1K83 K;  3GTK C;  2P5M A;  3JST A;  2R92 A;  4KMH A;  2VUM C;  3LAP A;  2E2J K;  3FOE A;  3BP3 A;  4KC6 A;  3AQO A;  1JVI A;  3S14 K;  4XSX A;  4J3N A;  3G4C A;  2R93 C;  3AD9 C;  5IYD C;  2JA5 A;  1WOS A;  3HOZ C;  1XXC A;  2WB1 D;  3CQZ C;  1TWF K;  4A93 K;  1SFO C;  1WOR A;  2ZUE A;  2ZUF A;  2JA6 A;  1O25 A;  1IE0 A;  5IYC C;  3GEH A;  1L0W A;  3NUH A;  4BY7 C;  2WAQ D;  2E2I K;  3S17 K;  1I6H C;  3GEE A;  1YNJ A;  5C4X C;  3HOV K;  4KN7 A;  1BDF A;  1O24 A;  1TWC C;  3M3Y K;  4KDD A;  3ORE A;  2NVY K;  4P9S A;  3HOW C;  1BS2 A;  4LK0 A;  1USM A;  4LJZ A;  2XCR B;  4AYB D;  3I4M K;  4LK1 A;  2Y0S D;  4C3J K;  3S1Q C;  3Q3Q A;  4MEX A;  5M3F K;  4A3F C;  2YU9 A;  3EQL A;  3AD8 C;  1Y1W C;  2NVX A;  2XCQ A;  2RGR A;  4X6A K;  4GFQ A;  3N0C A;  5FLM K;  5EGH A;  4WIL A;  4OIP A;  3S1M C;  1J98 A;  2JA5 K;  3L4J A;  4OIQ A;  3QX3 A;  1WCM C;  3GTP C;  1I3Q C;  5C44 C;  4BKW A;  4XCH A;  2R7Z K;  3FOF A;  3K7A C;  1G51 A;  1DCH A;  3RZO C;  5E68 A;  4BXX C;  1F93 A;  4GTD A;  3FKI C;  5IP9 C;  3RZD K;  5IOR A;  3GTO C;  4C3H K;  2JH3 A;  3G4A A;  3PO3 C;  2GSN A;  4LR2 A;  5C4J C;  4A3E K;  1TWF A;  1ZXO A;  4YFK A;  2B63 A;  4FZB A;  4A3I C;  3S2D K;  2BE5 A;  4A3K K;  4A3C K;  5M5X K;  3S2H K;  2JA8 K;  3V4G A;  1DCP A;  2NVX K;  1SMY A;  1HI9 A;  2A6H A;  1J6V A;  4OIO A;  1R9T K;  2PPB A;  3GTL C;  3T01 A;  4A3J C;  1TWG K;  1TWH A;  5IP7 C;  3H0G C;  1XZQ A;  1DCO A;  5M5Y K;  3HOY K;  2GAH C;  4G7Z A;  2E2H C;  3N0B A;  1AB4 A;  4A3M K;  4G7O A; 
#chains in the Genus database with same CATH homology
 1HQM A;  4G7H A;  4A3E C;  2CW0 A;  5IYC C;  3GTO K;  2Y0S L;  4BY7 C;  3S1M K;  4XSZ A;  4QJV B;  2WAQ D;  1K83 C;  2E2I K;  3S17 K;  1I6H C;  5M3M K;  2R7Z C;  1WCM K;  1YNJ A;  4NOI A;  4A3K C;  4YG2 A;  4A3C C;  5C4X C;  1I50 C;  3GTP K;  1I3Q K;  4KN7 A;  1BDF A;  2WAQ L;  1TWC C;  5C44 K;  4Y7N K;  3HOV K;  3M3Y K;  2YU9 C;  4KN4 A;  3GTG K;  2NVX C;  4MQ9 A;  4Y52 K;  1IW7 A;  3K7A K;  2NVY K;  3S1N K;  1R9T C;  5IYB C;  3HOX K;  4LK0 A;  3HOW C;  3S1R C;  2B63 K;  4A3G K;  4A3L C;  4LJZ A;  3RZO K;  4YFN A;  4AYB D;  4YFX A;  3I4M K;  4BXX K;  4LK1 A;  2Y0S D;  4C3J K;  3S1Q C;  4GZY A;  2JA6 K;  5IYD K;  2JA7 C;  3M4O C;  4A3B K;  4MEX A;  3FKI K;  5IP9 K;  5M3F K;  5IP7 K;  4A3J K;  4A3F C;  4A93 C;  4AYB L;  3EQL A;  3H0G K;  1Y1W C;  4Q5S A;  2PA8 D;  4BY1 K;  3GTJ C;  3I4N C;  3S16 K;  4KMU A;  3WOD A;  3PO3 K;  2E2H K;  4X6A K;  5C4J K;  3S2D C;  3H3V D;  4BBR K;  4QIW L;  2PA8 L;  5D4D A;  4A3I K;  5FLM K;  3GTM C;  3S15 K;  3GTK K;  2E2J C;  4OIP A;  5TMC A;  1TWH K;  2NVT K;  2JA5 K;  4OIQ A;  3S2H C;  2PMZ D;  2JA8 C;  2E2I C;  3S17 C;  3S1M C;  3H3V L;  2NVQ C;  4JK1 A;  2VUM K;  3S14 C;  2O5I A;  1WCM C;  4C2M K;  5C3E K;  2O5J A;  3GTP C;  3HOU K;  1I3Q C;  3HOV C;  4Y7N C;  5C44 C;  2PMZ L;  3M3Y C;  3GTG C;  2R7Z K;  1TWG C;  4Y52 C;  4Q4Z A;  3K7A C;  2NVY C;  3GTQ K;  1TWC K;  3S1N C;  3HOX C;  3GTL K;  4LLG A;  3HOY C;  2A6E A;  2YU9 K;  2R93 K;  1Y1V C;  1TWF C;  2B63 C;  4A3G C;  3RZO C;  4ZH4 A;  2A69 A;  4QIW D;  3HOZ K;  4A3D K;  4BBS K;  3CQZ K;  5IYB K;  4BXX C;  1ZYR A;  4MEY A;  4A3M C;  1SFO K;  4A3L K;  2R92 C;  5TMF A;  3PO2 K;  4A3B C;  3FKI C;  5IP9 C;  3RZD K;  1TWA K;  3HKZ D;  3GTO C;  4C3H K;  3DXJ A;  3M4O K;  4OIR A;  1XPP A;  3S16 C;  3PO3 C;  4XLN A;  5C4J C;  4A3E K;  5IYC K;  1Y1W K;  3HKZ L;  4YFK A;  3GTJ K;  4BY7 K;  4A3I C;  3I4N K;  3S15 C;  5FLM C;  4BBS C;  1K83 K;  3GTK C;  1I6H K;  1TWH C;  5M5W K;  2JA5 C;  2NVT C;  3S2D K;  2BE5 A;  4A3K K;  4QJV A;  2VUM C;  5C4X K;  1I50 K;  5M5X K;  3GTM K;  4A3C K;  2E2J K;  5C3E C;  3S2H K;  3HOU C;  2JA8 K;  2A68 A;  2NVX K;  2NVQ K;  3S14 K;  1SMY A;  2A6H A;  4OIO A;  4XSX A;  1R9T K;  3HOW K;  3I4M C;  2PPB A;  4OIN A;  1I6V A;  5FJ8 K;  3S1R K;  3GTQ C;  1YNN A;  3GTL C;  2R93 C;  5IYD C;  2JA6 C;  4A3J C;  1TWG K;  5IP7 C;  3H0G C;  3HOZ C;  3S1Q K;  4BY1 C;  2WB1 D;  3CQZ C;  4A3D C;  5M5Y K;  3HOY K;  2JA7 K;  4G7Z A;  1Y1V K;  1TWF K;  4A93 K;  4A3F K;  1SFO C;  2E2H C;  4X6A C;  3PO2 C;  3RZD C;  4BBR C;  1TWA C;  2WB1 L;  4A3M K;  4XLP A;  4C3I K;  4G7O A;  2R92 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...