3K7AK

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3k7aK00
2R93C 1TWAK 4ZH4A 5IYDK 2B63C 3GTKC 2WB1D 4QJVA 3S16K 4KN4A 4C3IK 1K83C 2NVYK 1I3QC 2A6EA 5IYBC 5C3EC 2E2JK 3GTQK 3H0GC 4C3JK 4OIPA 4Y7NC 3RZOC 3HKZD 4BBRK 1Y1WC 5M5WK 1TWFK 3EQLA 3GTGC 3GTLC 2NVTK 3HOVK 4G7OA 3DXJA 1SFOC 1SMYA 4OINA 3S1MC 5TMFA 5TMCA 4BY7K 3H3VD 5IP7C 4BXXC 3S1QK 3HOYC 2A69A 5C4XK 5M5XK 4QJVB 4Y7NK 4MEXA 2NVQC 3PO3C 2R7ZK 2O5JA 3WODA 1YNJA 3FKIC 2BE5A 2JA8C 3HOUK 4NOIA 1SFOK 2E2IC 2PPBA 2YU9C 2NVQK 3HOWC 3PO2K 2R92K 1TWAC 3S15C 4OIRA 3S17C 2R92C 4A93C 4A3GK 3PO2C 1I6HK 5IP9C 1TWGC 1I3QK 4JK1A 1K83K 2NVYC 2VUMC 3S2HK 4Q5SA 4QIWL 4A3FC 4A3JC 5C44C 4G7HA 3I4MK 4A3DK 5IYDC 4BBSK 3GTLK 3GTGK 4XSXA 4C2MK 1TWHK 2CW0A 3HKZL 4Y52C 5FLMC 3RZDC 4XLPA 3GTPK 3S2DK 2E2JC 1TWHC 5C3EK 2PA8L 4YFNA 4BY7C 2JA6K 4A3MK 4A3IK 3GTJK 5C44K 1R9TC 2B63K 4A3JK 4A3CK 4A3FK 3S2HC 1TWFC 4LJZA 1WCMK 4YG2A 2NVXC 3H0GK 3GTPC 3S2DC 1Y1VC 3HOXC 4LLGA 2WAQL 4XSZA 5FJ8K 3HOZK 3S1RC 3S1NC 2E2IK 3GTJC 3GTKK 1HQMA 1I6VA 4YFXA 2JA8K 2JA6C 3HOUC 3HOZC 4GZYA 3CQZC 4MQ9A 3M3YC 4X6AK 1XPPA 2O5IA 5C4JK 3M4OK 4A93K 4A3GC 5M5YK 4OIQA 3K7AC 2A68A 4LK1A 1TWCC 2A6HA 2Y0SL 3S15K 2YU9K 3HOWK 3S14K 4MEYA 1IW7A 5M3FK 5D4DA 5M3MK 1BDFA 4A3EK 3GTOK 3PO3K 2PMZD 5IP9K 1I6HC 4BY1C 4A3KK 3GTMC 4A3BK 2R93K 4QIWD 1Y1WK 2PMZL 4YFKA 3K7AK 2JA5C 4Y52K 5C4XC 2PA8D 4A3KC 3GTMK 5C4JC 4BY1K 3M4OC 4OIOA 4A3BC 4A3LC 5IYBK 2E2HK 3FKIK 2WAQD 4AYBD 2R7ZC 2VUMK 2E2HC 3S14C 2WB1L 3I4NC 2NVTC 3HOVC 4KMUA 1YNNA 3HOXK 2JA5K 1Y1VK 4C3HK 3I4NK 3GTQC 3M3YK 5IP7K 4BXXK 4AYBL 5IYCC 4G7ZA 3S1MK 4A3LK 4A3MC 4A3CC 1TWCK 2JA7C 3H3VL 1I50K 3HOYK 5FLMK 1WCMC 3RZDK 3S1QC 1I50C 4X6AC 2JA7K 3CQZK 4Q4ZA 4A3EC 3GTOC 3S16C 3I4MC 1R9TK 4BBSC 4A3DC 4A3IC 3S1RK 3S1NK 2Y0SD 5IYCK 4KN7A 4BBRC 1TWGK 4XLNA 3RZOK 2NVXK 1ZYRA 4LK0A 3S17K
chains in the Genus database with same CATH superfamily
4C3IC 5IYDK 1VRQC 3OREA 2CFAB 1G51A 3S16K 1I3QC 5IYBC 3H0GC 4C3JK 5JVOA 4Y7NC 4M1XA 4BBRK 3L4KA 5M5WK 3TFIA 3A8KA 1EK8A 2JA7A 2P5MA 1J98A 1TWHA 5IP7C 1WOPA 4FM9A 5L46A 5M5XK 1YNJA 2JA8C 4NOIA 3NUHA 1SFOK 2YU9C 2KWAA 1TWAC 4KM9A 3S17C 4G0VA 5JFEA 3LAJA 3PO2C 5IP9C 4A3JC 4G7HA 2JH3A 3S2DK 4KARA 2PA8L 4A3MK 5C44K 1R9TC 4A3JK 1VJEA 2Y3PA 3GEHA 1Y1WA 1TWFC 1SFOA 4YG2A 4KAWX 3IPJA 3S1RC 1VH2A 2RH6A 3S1NC 2JA8K 4KMAA 4MQ9A 2W7VA 1XPPA 4FZBA 5TJ3A 5M5YK 4LK1A 3GTLA 1O29A 4C45A 4MEYA 1XZQB 1XZPB 4ILDA 1O2FB 4C3HC 4A3KK 2V6SA 4A3BK 4Y52K 4YFKA 4XCHA 4A3KC 4A3BC 4BY1K 4OIOA 2WAQD 2VUMK 2RGRA 2WB1L 2NVXA 3GTKA 1TWAA 3G4AA 3VA7A 4C3JC 4C3HK 3TFJA 4AYBL 2NVYA 3HXAA 4GTCA 3S1MK 4A3CC 2CFAA 1C0AA 4P5BA 1BGWA 1JQWA 3HOYK 1WCMC 3S1QC 3AD8C 4A3EC 5IORA 5IYCK 3RZOK 2NVXK 4LK0A 2FQTA 1XXBA 3FOEA 1IE0A 4QJVA 1WSRA 3GSIA 4KN4A 1K83C 3G4CA 2A6EA 5C3EC 1B4AA 4PABA 3RZOC 3HKZD 1F7UA 4G7OA 1JVIA 1F93A 5TMCA 1O28A 3H3VD 4BXXC 3S1QK 2A69A 1TWGA 3L4JA 1L0WA 2R7ZK 1YX2A 1DD5A 1XXAA 3OEPA 1WSVA 3T01A 3GTQA 2R92C 2FQOA 3BP3A 1UV7A 1I3QK 1K83K 4KASA 2VUMC 4Q5SA 4QIWL 5C44C 1PJ7A 4BBSK 5IYDC 3GTGK 3HKZL 3BUEA 3RZDC 2YU9A 3GTOA 4BY7C 2JA6K 4A3CK 2XCQA 2R93A 1EQRA 4KB4A 1WCMK 1BJTA 3GTPC 4GTDA 3T02A 2D6FC 1Y1VC 2GSNA 3FKIA 1O26A 4LLGA 4C2MC 2WAQL 2E2HA 3HOZK 3GTJC 2ZUFA 1I6VA 3HOZC 4DDQA 2JA5A 3S0XA 4X6AK 5C4JK 4A93K 4A3GC 4KATA 3GTGA 1IQ0A 3N0BA 3HOWK 5M3MK 3GTOK 3PO3K 1WOOA 2JA6A 1ISEA 1I6HC 4BY1C 2R93K 2PMZL 5HL8A 5C4XC 3GTMK 5C4JC 1R9TA 3H0GA 5IYBK 2E2HK 4AYBD 2R7ZC 3S14C 3AQPA 2NVTC 5CJ9A 4KMUA 2JA5K 1Y1VK 3I4NK 3GTQC 4BXXK 3FHZA 4A3MC 1TWCK 4GFQA 4AH6A 3RZDK 3LAPA 1I50C 1J6WA 1X31C 3CQZK 2JA7K 4Q4ZA 3GTOC 3GTMA 4BBSC 1R9TK 4P5AA 3AD7C 4KN7A 4BBRC 3A8JA 4XLNA 1ZYRA 3LPXA 3S17K 1IL2A 1IBAA 4KB2A 1Y1VA 1VGXA 2B63C 2WB1D 4LOWA 3GTKC 2E2JK 2GAHC 4OIPA 1TWCA 1Y1WC 3GTLC 1USMA 3EQLA 3HOVK 2NVTK 4G0WA 1SFOC 1SMYA 3S1MC 5TMFA 4BY7K 1AB4A 3CAGA 3HOYC 1V5VA 4QJVB 4MEXA 3PO3C 3HOUK 2E2IC 2NVQK 2PPBA 3HOWC 3S15C 1J6VA 3OPFA 4OIRA 2GSOA 4A93C 4A3GK 1I6HK 4JK1A 4KDDA 3S2HK 1USOA 2XCRB 1PJ6A 3JSTA 3GTLK 1TWHK 2CW0A 4Y52C 3GTPK 1TWHC 1XZPA 1WQHA 4A3IK 3GTJK 4A3FK 3S2HC 3T00A 2ZFZA 3AH5A 4O2DA 5FJ8K 4G0UA 3N0CA 3GTKK 4KM8A 4YFXA 3HOUC 2JA6C 2PHCB 3CQZC 3SZZA 1DCOA 4OIQA 2A6HA 1BS2A 3S15K 3GTPA 4A3EK 1BDFA 2PMZD 3TFHA 5IP9K 3GTJA 1WQGA 1O2AA 3AQOA 1Y1WK 1ZVUA 1ZQ1C 3K7AK 2JA5C 1WQFA 2PA8D 1EI6A 3AD9C 3I4NC 3HOVC 5IOTA 3HOXK 5EGHA 3M3YK 4BKWA 5IP7K 1EH1A 4LQYA 4P9SA 1HI9A 3GEEA 2JA7C 1J6XA 1O2BA 1GE9A 3SZYA 3ADAC 4A3IC 2Y0SD 1JOEA 2VUMA 1TWGK 4PAAA 4WJ3M 4WJ4A 2R7ZA 1TWAK 1DCPA 1VLOA 4ZH4A 1PJ5A 3BP8C 2R92A 1KQ4A 4C3IK 2NVYK 4GT9A 4GTAA 1IS1A 3GTQK 1F7VA 3N3YA 3GTGC 1TWFK 3DXJA 5IOSA 4OINA 1DCHA 5EGEA 1O24A 5C4XK 3V4GA 4GTBA 4Y7NK 2NVQC 5IOQA 4GTEA 2O5JA 4KC6A 3WODA 3FKIC 2BE5A 1WCMA 3FOFA 3PO2K 2R92K 1WOSA 3QX3A 1TWGC 2NVYC 1TWFA 4A3FC 1RU0A 4BLBA 3I4MK 3ERED 1YCLA 4A3DK 4XSXA 4C2MK 1EFWA 1WIHA 5FLMC 4XLPA 2E2JC 5C3EK 4YFNA 2B63K 1WORA 1XZQA 4LJZA 4BLAA 3S2DC 2NVXC 3H0GK 3HOXC 1ZXOA 2XCOA 4XSZA 2E2IK 4GZYA 1B4BA 1HQMA 1I3QA 1K83A 3M3YC 4KMHA 2O5IA 1ZBSA 3M4OK 4GTLA 3K7AC 2A68A 1TWCC 2V6UA 2Y0SL 2YU9K 2V6TA 3S14K 2GSUA 1IW7A 4WILA 5M3FK 5D4DA 2EBBA 1INNA 1I50A 2B63A 4RMFA 1XXCA 3GTMC 4QIWD 3CQZA 5CHPA 2R93C 3M4OC 4KMDA 4A3LC 3FKIK 4LR2A 3GDZA 3MMLB 2E2HC 5E68A 2E2IA 1F9NA 1YNNA 3Q3QA 4GTFA 1O25A 5IYCC 4J3NA 4G7ZA 4A3LK 3H3VL 1I50K 3A8IA 3GIRA 5FLMK 2P8TA 3TTGA 4X6AC 3S16C 3I4MC 4A3DC 3S1RK 3S1NK 1O27A 2ZUEA 2GAGC 3GEIA
chains in the Genus database with same CATH topology
2R93C 1TWAK 4ZH4A 5IYDK 2B63C 3GTKC 2WB1D 4QJVA 3S16K 4KN4A 4C3IK 1K83C 2NVYK 1I3QC 2A6EA 5IYBC 5C3EC 2E2JK 3GTQK 3H0GC 4C3JK 4OIPA 4Y7NC 3RZOC 3HKZD 4BBRK 1Y1WC 5M5WK 1TWFK 3EQLA 3GTGC 3GTLC 2NVTK 3HOVK 4G7OA 3DXJA 1SFOC 1SMYA 4OINA 3S1MC 5TMFA 5TMCA 4BY7K 3H3VD 5IP7C 4BXXC 3S1QK 3HOYC 2A69A 5C4XK 5M5XK 4QJVB 4Y7NK 4MEXA 2NVQC 3PO3C 2R7ZK 2O5JA 3WODA 1YNJA 3FKIC 2BE5A 2JA8C 3HOUK 4NOIA 1SFOK 2E2IC 2PPBA 2YU9C 2NVQK 3HOWC 3PO2K 2R92K 1TWAC 3S15C 4OIRA 3S17C 2R92C 4A93C 4A3GK 3PO2C 1I6HK 5IP9C 1TWGC 1I3QK 4JK1A 1K83K 2NVYC 2VUMC 3S2HK 4Q5SA 4QIWL 4A3FC 4A3JC 5C44C 4G7HA 3I4MK 4A3DK 5IYDC 4BBSK 3GTLK 3GTGK 4XSXA 4C2MK 1TWHK 2CW0A 3HKZL 4Y52C 5FLMC 3RZDC 4XLPA 3GTPK 3S2DK 2E2JC 1TWHC 5C3EK 2PA8L 4YFNA 4BY7C 2JA6K 4A3MK 4A3IK 3GTJK 5C44K 1R9TC 2B63K 4A3JK 4A3CK 4A3FK 3S2HC 1TWFC 4LJZA 1WCMK 4YG2A 2NVXC 3H0GK 3GTPC 3S2DC 1Y1VC 3HOXC 4LLGA 2WAQL 4XSZA 5FJ8K 3HOZK 3S1RC 3S1NC 2E2IK 3GTJC 3GTKK 1HQMA 1I6VA 4YFXA 2JA8K 2JA6C 3HOUC 3HOZC 4GZYA 3CQZC 4MQ9A 3M3YC 4X6AK 1XPPA 2O5IA 5C4JK 3M4OK 4A93K 4A3GC 5M5YK 4OIQA 3K7AC 2A68A 4LK1A 1TWCC 2A6HA 2Y0SL 3S15K 2YU9K 3HOWK 3S14K 4MEYA 1IW7A 5M3FK 5D4DA 5M3MK 1BDFA 4A3EK 3GTOK 3PO3K 2PMZD 5IP9K 1I6HC 4BY1C 4A3KK 3GTMC 4A3BK 2R93K 4QIWD 1Y1WK 2PMZL 4YFKA 3K7AK 2JA5C 4Y52K 5C4XC 2PA8D 4A3KC 3GTMK 5C4JC 4BY1K 3M4OC 4OIOA 4A3BC 4A3LC 5IYBK 2E2HK 3FKIK 2WAQD 4AYBD 2R7ZC 2VUMK 2E2HC 3S14C 2WB1L 3I4NC 2NVTC 3HOVC 4KMUA 1YNNA 3HOXK 2JA5K 1Y1VK 4C3HK 3I4NK 3GTQC 3M3YK 5IP7K 4BXXK 4AYBL 5IYCC 4G7ZA 3S1MK 4A3LK 4A3MC 4A3CC 1TWCK 2JA7C 3H3VL 1I50K 3HOYK 5FLMK 1WCMC 3RZDK 3S1QC 1I50C 4X6AC 2JA7K 3CQZK 4Q4ZA 4A3EC 3GTOC 3S16C 3I4MC 1R9TK 4BBSC 4A3DC 4A3IC 3S1RK 3S1NK 2Y0SD 5IYCK 4KN7A 4BBRC 1TWGK 4XLNA 3RZOK 2NVXK 1ZYRA 4LK0A 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 C;  1TWA K;  4ZH4 A;  5IYD K;  2B63 C;  3GTK C;  2WB1 D;  4QJV A;  3S16 K;  4KN4 A;  4C3I K;  1K83 C;  2NVY K;  1I3Q C;  2A6E A;  5IYB C;  5C3E C;  2E2J K;  3GTQ K;  3H0G C;  4C3J K;  4OIP A;  4Y7N C;  3RZO C;  3HKZ D;  4BBR K;  1Y1W C;  5M5W K;  1TWF K;  3EQL A;  3GTG C;  3GTL C;  2NVT K;  3HOV K;  4G7O A;  3DXJ A;  1SFO C;  1SMY A;  4OIN A;  3S1M C;  5TMF A;  5TMC A;  4BY7 K;  3H3V D;  5IP7 C;  4BXX C;  3S1Q K;  3HOY C;  2A69 A;  5C4X K;  5M5X K;  4QJV B;  4Y7N K;  4MEX A;  2NVQ C;  3PO3 C;  2R7Z K;  2O5J A;  3WOD A;  1YNJ A;  3FKI C;  2BE5 A;  2JA8 C;  3HOU K;  4NOI A;  1SFO K;  2E2I C;  2PPB A;  2YU9 C;  2NVQ K;  3HOW C;  3PO2 K;  2R92 K;  1TWA C;  3S15 C;  4OIR A;  3S17 C;  2R92 C;  4A93 C;  4A3G K;  3PO2 C;  1I6H K;  5IP9 C;  1TWG C;  1I3Q K;  4JK1 A;  1K83 K;  2NVY C;  2VUM C;  3S2H K;  4Q5S A;  4QIW L;  4A3F C;  4A3J C;  5C44 C;  4G7H A;  3I4M K;  4A3D K;  5IYD C;  4BBS K;  3GTL K;  3GTG K;  4XSX A;  4C2M K;  1TWH K;  2CW0 A;  3HKZ L;  4Y52 C;  5FLM C;  3RZD C;  4XLP A;  3GTP K;  3S2D K;  2E2J C;  1TWH C;  5C3E K;  2PA8 L;  4YFN A;  4BY7 C;  2JA6 K;  4A3M K;  4A3I K;  3GTJ K;  5C44 K;  1R9T C;  2B63 K;  4A3J K;  4A3C K;  4A3F K;  3S2H C;  1TWF C;  4LJZ A;  1WCM K;  4YG2 A;  2NVX C;  3H0G K;  3GTP C;  3S2D C;  1Y1V C;  3HOX C;  4LLG A;  2WAQ L;  4XSZ A;  5FJ8 K;  3HOZ K;  3S1R C;  3S1N C;  2E2I K;  3GTJ C;  3GTK K;  1HQM A;  1I6V A;  4YFX A;  2JA8 K;  2JA6 C;  3HOU C;  3HOZ C;  4GZY A;  3CQZ C;  4MQ9 A;  3M3Y C;  4X6A K;  1XPP A;  2O5I A;  5C4J K;  3M4O K;  4A93 K;  4A3G C;  5M5Y K;  4OIQ A;  3K7A C;  2A68 A;  4LK1 A;  1TWC C;  2A6H A;  2Y0S L;  3S15 K;  2YU9 K;  3HOW K;  3S14 K;  4MEY A;  1IW7 A;  5M3F K;  5D4D A;  5M3M K;  1BDF A;  4A3E K;  3GTO K;  3PO3 K;  2PMZ D;  5IP9 K;  1I6H C;  4BY1 C;  4A3K K;  3GTM C;  4A3B K;  2R93 K;  4QIW D;  1Y1W K;  2PMZ L;  4YFK A;  3K7A K;  2JA5 C;  4Y52 K;  5C4X C;  2PA8 D;  4A3K C;  3GTM K;  5C4J C;  4BY1 K;  3M4O C;  4OIO A;  4A3B C;  4A3L C;  5IYB K;  2E2H K;  3FKI K;  2WAQ D;  4AYB D;  2R7Z C;  2VUM K;  2E2H C;  3S14 C;  2WB1 L;  3I4N C;  2NVT C;  3HOV C;  4KMU A;  1YNN A;  3HOX K;  2JA5 K;  1Y1V K;  4C3H K;  3I4N K;  3GTQ C;  3M3Y K;  5IP7 K;  4BXX K;  4AYB L;  5IYC C;  4G7Z A;  3S1M K;  4A3L K;  4A3M C;  4A3C C;  1TWC K;  2JA7 C;  3H3V L;  1I50 K;  3HOY K;  5FLM K;  1WCM C;  3RZD K;  3S1Q C;  1I50 C;  4X6A C;  2JA7 K;  3CQZ K;  4Q4Z A;  4A3E C;  3GTO C;  3S16 C;  3I4M C;  1R9T K;  4BBS C;  4A3D C;  4A3I C;  3S1R K;  3S1N K;  2Y0S D;  5IYC K;  4KN7 A;  4BBR C;  1TWG K;  4XLN A;  3RZO K;  2NVX K;  1ZYR A;  4LK0 A;  3S17 K; 
#chains in the Genus database with same CATH topology
 4C3I C;  5IYD K;  1VRQ C;  3ORE A;  2CFA B;  1G51 A;  3S16 K;  1I3Q C;  5IYB C;  3H0G C;  4C3J K;  5JVO A;  4Y7N C;  4M1X A;  4BBR K;  3L4K A;  5M5W K;  3TFI A;  3A8K A;  1EK8 A;  2JA7 A;  2P5M A;  1J98 A;  1TWH A;  5IP7 C;  1WOP A;  4FM9 A;  5L46 A;  5M5X K;  1YNJ A;  2JA8 C;  4NOI A;  3NUH A;  1SFO K;  2YU9 C;  2KWA A;  1TWA C;  4KM9 A;  3S17 C;  4G0V A;  5JFE A;  3LAJ A;  3PO2 C;  5IP9 C;  4A3J C;  4G7H A;  2JH3 A;  3S2D K;  4KAR A;  2PA8 L;  4A3M K;  5C44 K;  1R9T C;  4A3J K;  1VJE A;  2Y3P A;  3GEH A;  1Y1W A;  1TWF C;  1SFO A;  4YG2 A;  4KAW X;  3IPJ A;  3S1R C;  1VH2 A;  2RH6 A;  3S1N C;  2JA8 K;  4KMA A;  4MQ9 A;  2W7V A;  1XPP A;  4FZB A;  5TJ3 A;  5M5Y K;  4LK1 A;  3GTL A;  1O29 A;  4C45 A;  4MEY A;  1XZQ B;  1XZP B;  4ILD A;  1O2F B;  4C3H C;  4A3K K;  2V6S A;  4A3B K;  4Y52 K;  4YFK A;  4XCH A;  4A3K C;  4A3B C;  4BY1 K;  4OIO A;  2WAQ D;  2VUM K;  2RGR A;  2WB1 L;  2NVX A;  3GTK A;  1TWA A;  3G4A A;  3VA7 A;  4C3J C;  4C3H K;  3TFJ A;  4AYB L;  2NVY A;  3HXA A;  4GTC A;  3S1M K;  4A3C C;  2CFA A;  1C0A A;  4P5B A;  1BGW A;  1JQW A;  3HOY K;  1WCM C;  3S1Q C;  3AD8 C;  4A3E C;  5IOR A;  5IYC K;  3RZO K;  2NVX K;  4LK0 A;  2FQT A;  1XXB A;  3FOE A;  1IE0 A;  4QJV A;  1WSR A;  3GSI A;  4KN4 A;  1K83 C;  3G4C A;  2A6E A;  5C3E C;  1B4A A;  4PAB A;  3RZO C;  3HKZ D;  1F7U A;  4G7O A;  1JVI A;  1F93 A;  5TMC A;  1O28 A;  3H3V D;  4BXX C;  3S1Q K;  2A69 A;  1TWG A;  3L4J A;  1L0W A;  2R7Z K;  1YX2 A;  1DD5 A;  1XXA A;  3OEP A;  1WSV A;  3T01 A;  3GTQ A;  2R92 C;  2FQO A;  3BP3 A;  1UV7 A;  1I3Q K;  1K83 K;  4KAS A;  2VUM C;  4Q5S A;  4QIW L;  5C44 C;  1PJ7 A;  4BBS K;  5IYD C;  3GTG K;  3HKZ L;  3BUE A;  3RZD C;  2YU9 A;  3GTO A;  4BY7 C;  2JA6 K;  4A3C K;  2XCQ A;  2R93 A;  1EQR A;  4KB4 A;  1WCM K;  1BJT A;  3GTP C;  4GTD A;  3T02 A;  2D6F C;  1Y1V C;  2GSN A;  3FKI A;  1O26 A;  4LLG A;  4C2M C;  2WAQ L;  2E2H A;  3HOZ K;  3GTJ C;  2ZUF A;  1I6V A;  3HOZ C;  4DDQ A;  2JA5 A;  3S0X A;  4X6A K;  5C4J K;  4A93 K;  4A3G C;  4KAT A;  3GTG A;  1IQ0 A;  3N0B A;  3HOW K;  5M3M K;  3GTO K;  3PO3 K;  1WOO A;  2JA6 A;  1ISE A;  1I6H C;  4BY1 C;  2R93 K;  2PMZ L;  5HL8 A;  5C4X C;  3GTM K;  5C4J C;  1R9T A;  3H0G A;  5IYB K;  2E2H K;  4AYB D;  2R7Z C;  3S14 C;  3AQP A;  2NVT C;  5CJ9 A;  4KMU A;  2JA5 K;  1Y1V K;  3I4N K;  3GTQ C;  4BXX K;  3FHZ A;  4A3M C;  1TWC K;  4GFQ A;  4AH6 A;  3RZD K;  3LAP A;  1I50 C;  1J6W A;  1X31 C;  3CQZ K;  2JA7 K;  4Q4Z A;  3GTO C;  3GTM A;  4BBS C;  1R9T K;  4P5A A;  3AD7 C;  4KN7 A;  4BBR C;  3A8J A;  4XLN A;  1ZYR A;  3LPX A;  3S17 K;  1IL2 A;  1IBA A;  4KB2 A;  1Y1V A;  1VGX A;  2B63 C;  2WB1 D;  4LOW A;  3GTK C;  2E2J K;  2GAH C;  4OIP A;  1TWC A;  1Y1W C;  3GTL C;  1USM A;  3EQL A;  3HOV K;  2NVT K;  4G0W A;  1SFO C;  1SMY A;  3S1M C;  5TMF A;  4BY7 K;  1AB4 A;  3CAG A;  3HOY C;  1V5V A;  4QJV B;  4MEX A;  3PO3 C;  3HOU K;  2E2I C;  2NVQ K;  2PPB A;  3HOW C;  3S15 C;  1J6V A;  3OPF A;  4OIR A;  2GSO A;  4A93 C;  4A3G K;  1I6H K;  4JK1 A;  4KDD A;  3S2H K;  1USO A;  2XCR B;  1PJ6 A;  3JST A;  3GTL K;  1TWH K;  2CW0 A;  4Y52 C;  3GTP K;  1TWH C;  1XZP A;  1WQH A;  4A3I K;  3GTJ K;  4A3F K;  3S2H C;  3T00 A;  2ZFZ A;  3AH5 A;  4O2D A;  5FJ8 K;  4G0U A;  3N0C A;  3GTK K;  4KM8 A;  4YFX A;  3HOU C;  2JA6 C;  2PHC B;  3CQZ C;  3SZZ A;  1DCO A;  4OIQ A;  2A6H A;  1BS2 A;  3S15 K;  3GTP A;  4A3E K;  1BDF A;  2PMZ D;  3TFH A;  5IP9 K;  3GTJ A;  1WQG A;  1O2A A;  3AQO A;  1Y1W K;  1ZVU A;  1ZQ1 C;  3K7A K;  2JA5 C;  1WQF A;  2PA8 D;  1EI6 A;  3AD9 C;  3I4N C;  3HOV C;  5IOT A;  3HOX K;  5EGH A;  3M3Y K;  4BKW A;  5IP7 K;  1EH1 A;  4LQY A;  4P9S A;  1HI9 A;  3GEE A;  2JA7 C;  1J6X A;  1O2B A;  1GE9 A;  3SZY A;  3ADA C;  4A3I C;  2Y0S D;  1JOE A;  2VUM A;  1TWG K;  4PAA A;  4WJ3 M;  4WJ4 A;  2R7Z A;  1TWA K;  1DCP A;  1VLO A;  4ZH4 A;  1PJ5 A;  3BP8 C;  2R92 A;  1KQ4 A;  4C3I K;  2NVY K;  4GT9 A;  4GTA A;  1IS1 A;  3GTQ K;  1F7V A;  3N3Y A;  3GTG C;  1TWF K;  3DXJ A;  5IOS A;  4OIN A;  1DCH A;  5EGE A;  1O24 A;  5C4X K;  3V4G A;  4GTB A;  4Y7N K;  2NVQ C;  5IOQ A;  4GTE A;  2O5J A;  4KC6 A;  3WOD A;  3FKI C;  2BE5 A;  1WCM A;  3FOF A;  3PO2 K;  2R92 K;  1WOS A;  3QX3 A;  1TWG C;  2NVY C;  1TWF A;  4A3F C;  1RU0 A;  4BLB A;  3I4M K;  3ERE D;  1YCL A;  4A3D K;  4XSX A;  4C2M K;  1EFW A;  1WIH A;  5FLM C;  4XLP A;  2E2J C;  5C3E K;  4YFN A;  2B63 K;  1WOR A;  1XZQ A;  4LJZ A;  4BLA A;  3S2D C;  2NVX C;  3H0G K;  3HOX C;  1ZXO A;  2XCO A;  4XSZ A;  2E2I K;  4GZY A;  1B4B A;  1HQM A;  1I3Q A;  1K83 A;  3M3Y C;  4KMH A;  2O5I A;  1ZBS A;  3M4O K;  4GTL A;  3K7A C;  2A68 A;  1TWC C;  2V6U A;  2Y0S L;  2YU9 K;  2V6T A;  3S14 K;  2GSU A;  1IW7 A;  4WIL A;  5M3F K;  5D4D A;  2EBB A;  1INN A;  1I50 A;  2B63 A;  4RMF A;  1XXC A;  3GTM C;  4QIW D;  3CQZ A;  5CHP A;  2R93 C;  3M4O C;  4KMD A;  4A3L C;  3FKI K;  4LR2 A;  3GDZ A;  3MML B;  2E2H C;  5E68 A;  2E2I A;  1F9N A;  1YNN A;  3Q3Q A;  4GTF A;  1O25 A;  5IYC C;  4J3N A;  4G7Z A;  4A3L K;  3H3V L;  1I50 K;  3A8I A;  3GIR A;  5FLM K;  2P8T A;  3TTG A;  4X6A C;  3S16 C;  3I4M C;  4A3D C;  3S1R K;  3S1N K;  1O27 A;  2ZUE A;  2GAG C;  3GEI A; 
#chains in the Genus database with same CATH homology
 2R93 C;  1TWA K;  4ZH4 A;  5IYD K;  2B63 C;  3GTK C;  2WB1 D;  4QJV A;  3S16 K;  4KN4 A;  4C3I K;  1K83 C;  2NVY K;  1I3Q C;  2A6E A;  5IYB C;  5C3E C;  2E2J K;  3GTQ K;  3H0G C;  4C3J K;  4OIP A;  4Y7N C;  3RZO C;  3HKZ D;  4BBR K;  1Y1W C;  5M5W K;  1TWF K;  3EQL A;  3GTG C;  3GTL C;  2NVT K;  3HOV K;  4G7O A;  3DXJ A;  1SFO C;  1SMY A;  4OIN A;  3S1M C;  5TMF A;  5TMC A;  4BY7 K;  3H3V D;  5IP7 C;  4BXX C;  3S1Q K;  3HOY C;  2A69 A;  5C4X K;  5M5X K;  4QJV B;  4Y7N K;  4MEX A;  2NVQ C;  3PO3 C;  2R7Z K;  2O5J A;  3WOD A;  1YNJ A;  3FKI C;  2BE5 A;  2JA8 C;  3HOU K;  4NOI A;  1SFO K;  2E2I C;  2PPB A;  2YU9 C;  2NVQ K;  3HOW C;  3PO2 K;  2R92 K;  1TWA C;  3S15 C;  4OIR A;  3S17 C;  2R92 C;  4A93 C;  4A3G K;  3PO2 C;  1I6H K;  5IP9 C;  1TWG C;  1I3Q K;  4JK1 A;  1K83 K;  2NVY C;  2VUM C;  3S2H K;  4Q5S A;  4QIW L;  4A3F C;  4A3J C;  5C44 C;  4G7H A;  3I4M K;  4A3D K;  5IYD C;  4BBS K;  3GTL K;  3GTG K;  4XSX A;  4C2M K;  1TWH K;  2CW0 A;  3HKZ L;  4Y52 C;  5FLM C;  3RZD C;  4XLP A;  3GTP K;  3S2D K;  2E2J C;  1TWH C;  5C3E K;  2PA8 L;  4YFN A;  4BY7 C;  2JA6 K;  4A3M K;  4A3I K;  3GTJ K;  5C44 K;  1R9T C;  2B63 K;  4A3J K;  4A3C K;  4A3F K;  3S2H C;  1TWF C;  4LJZ A;  1WCM K;  4YG2 A;  2NVX C;  3H0G K;  3GTP C;  3S2D C;  1Y1V C;  3HOX C;  4LLG A;  2WAQ L;  4XSZ A;  5FJ8 K;  3HOZ K;  3S1R C;  3S1N C;  2E2I K;  3GTJ C;  3GTK K;  1HQM A;  1I6V A;  4YFX A;  2JA8 K;  2JA6 C;  3HOU C;  3HOZ C;  4GZY A;  3CQZ C;  4MQ9 A;  3M3Y C;  4X6A K;  1XPP A;  2O5I A;  5C4J K;  3M4O K;  4A93 K;  4A3G C;  5M5Y K;  4OIQ A;  3K7A C;  2A68 A;  4LK1 A;  1TWC C;  2A6H A;  2Y0S L;  3S15 K;  2YU9 K;  3HOW K;  3S14 K;  4MEY A;  1IW7 A;  5M3F K;  5D4D A;  5M3M K;  1BDF A;  4A3E K;  3GTO K;  3PO3 K;  2PMZ D;  5IP9 K;  1I6H C;  4BY1 C;  4A3K K;  3GTM C;  4A3B K;  2R93 K;  4QIW D;  1Y1W K;  2PMZ L;  4YFK A;  3K7A K;  2JA5 C;  4Y52 K;  5C4X C;  2PA8 D;  4A3K C;  3GTM K;  5C4J C;  4BY1 K;  3M4O C;  4OIO A;  4A3B C;  4A3L C;  5IYB K;  2E2H K;  3FKI K;  2WAQ D;  4AYB D;  2R7Z C;  2VUM K;  2E2H C;  3S14 C;  2WB1 L;  3I4N C;  2NVT C;  3HOV C;  4KMU A;  1YNN A;  3HOX K;  2JA5 K;  1Y1V K;  4C3H K;  3I4N K;  3GTQ C;  3M3Y K;  5IP7 K;  4BXX K;  4AYB L;  5IYC C;  4G7Z A;  3S1M K;  4A3L K;  4A3M C;  4A3C C;  1TWC K;  2JA7 C;  3H3V L;  1I50 K;  3HOY K;  5FLM K;  1WCM C;  3RZD K;  3S1Q C;  1I50 C;  4X6A C;  2JA7 K;  3CQZ K;  4Q4Z A;  4A3E C;  3GTO C;  3S16 C;  3I4M C;  1R9T K;  4BBS C;  4A3D C;  4A3I C;  3S1R K;  3S1N K;  2Y0S D;  5IYC K;  4KN7 A;  4BBR C;  1TWG K;  4XLN A;  3RZO K;  2NVX K;  1ZYR A;  4LK0 A;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...