3K7AK

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3k7aK00
4LK1A 3GTJK 3GTPK 5IYDK 4Y7NC 4KN4A 1TWFK 4XSZA 1SFOK 3S1RC 3GTQC 4A93K 4C3IK 5FLMK 3GTGK 4C3JK 3PO3C 3GTMK 4NOIA 2O5JA 2NVQC 4QJVA 4ZH4A 3H3VD 2VUMC 4MEYA 1TWAK 3PO2K 2JA6K 3S1NK 4A3LC 3HOYK 4A3GC 5C4XK 5FJ8K 5TMCA 3M4OK 2PA8L 5C44K 3S2DK 3H0GK 2R7ZK 5D4DA 4OIRA 2WAQD 3I4MC 4A3CC 4BBRC 4A3KC 2PPBA 3HOVK 3I4NK 2E2IK 3S14C 4BY7C 1IW7A 3S2HC 2Y0SL 4A3FK 1TWGC 3HKZL 5TMFA 1Y1WK 1Y1WC 2NVXC 2NVTK 3H3VL 4A3DK 3S14K 3GTOC 5C3EK 3GTKK 4GZYA 1R9TC 4A3CK 4YFXA 3S1QK 4A3MK 2A69A 2R7ZC 2JA8C 5IP9K 4A3JK 4G7ZA 2B63C 4XLPA 4YG2A 2O5IA 4OIQA 2JA6C 3RZOC 2VUMK 1K83K 5M3MK 4KMUA 4X6AK 3PO3K 4BY1C 5FLMC 5IP7C 4A3BK 4A93C 4BBSK 4KN7A 3GTQK 2JA8K 2JA5C 5C4JC 5IYDC 2YU9K 4OINA 2R92K 5C3EC 3HOXC 2NVTC 2JA5K 4A3EK 4MEXA 4XSXA 1TWHC 3S2HK 4A3BC 3S15K 4BY7K 4BY1K 2E2IC 2WB1D 4A3KK 3HOVC 4A3IC 3FKIC 3M3YK 3RZOK 2A68A 4QIWD 3S2DC 2R93K 2R93C 2B63K 3WODA 5IP9C 5IYBK 4A3JC 3HKZD 4A3MC 5M5XK 3FKIK 1TWAC 2A6EA 4Q4ZA 3M3YC 3S1QC 4BXXK 1BDFA 2NVQK 1R9TK 4C3HK 4A3DC 4Q5SA 3HOZC 4A3FC 2NVXK 3HOXK 1ZYRA 1I3QC 3GTPC 2R92C 3S17C 3K7AK 4YFKA 3I4MK 5C4JK 1TWCC 3GTLK 4BBSC 3EQLA 5C44C 2E2JK 4QIWL 2NVYC 2WB1L 5IP7K 3HOYC 5IYCC 2E2HC 4Y52C 4X6AC 3S16K 1K83C 4LLGA 2A6HA 4AYBL 3HOWK 5IYCK 2PMZD 1WCMC 4OIOA 2E2HK 4YFNA 2E2JC 1XPPA 1SFOC 4C2MK 5M3FK 4OIPA 2JA7C 1YNNA 3S17K 3HOUK 2PA8D 3GTKC 3RZDC 1I3QK 3GTOK 3HOZK 1TWGK 4A3GK 1SMYA 1HQMA 5M5WK 1I50C 4BBRK 3I4NC 3S1MC 4BXXC 4G7OA 1Y1VK 2BE5A 5IYBC 3H0GC 1I6HK 3CQZK 1YNJA 3M4OC 5C4XC 1WCMK 3CQZC 4LK0A 2CW0A 4QJVB 2WAQL 3HOWC 3PO2C 4A3LK 1Y1VC 3S1NC 1I6HC 4LJZA 2Y0SD 3S16C 3S1MK 4A3IK 4Y52K 1I50K 3GTMC 3GTGC 2NVYK 3S15C 1TWHK 4MQ9A 1TWCK 4AYBD 4G7HA 1TWFC 4A3EC 4JK1A 3S1RK 4Y7NK 3GTLC 3RZDK 5M5YK 3K7AC 3HOUC 4XLNA 3GTJC 2PMZL 3DXJA 2YU9C 1I6VA 2JA7K
chains in the Genus database with same CATH superfamily
4LK1A 2RH6A 1VH2A 3AH5A 4KN4A 1Y1WA 3GTQC 3GTGK 3GTMK 4NOIA 2NVQC 3CQZA 4QJVA 2VUMC 4MEYA 5TJ3A 3PO2K 3AD9C 3S1NK 2ZUFA 4G0UA 3H0GK 5D4DA 4OIRA 3GTJA 3S14C 4BY7C 1L0WA 3S2HC 1O2FB 3ADAC 3HKZL 2PHCB 1Y1WK 1Y1WC 2NVXC 3OPFA 1R9TA 3S14K 4KM8A 1O24A 1O29A 3VA7A 2VUMK 2W7VA 3GTQK 1WSVA 5C4JC 4M1XA 4J3NA 1VJEA 1IS1A 1EFWA 1USMA 5IOQA 1JQWA 1VGXA 2E2IC 4C3HC 4A3KK 3HOVC 3GEHA 1EQRA 3N0BA 3M3YK 1WQGA 4QIWD 5M5XK 3M3YC 3S1QC 1BDFA 1EH1A 3AQPA 4C3HK 2V6SA 3G4AA 2YU9A 3AQOA 5CJ9A 4Q5SA 4A3FC 2R92A 1I3QC 1J6VA 2NVXA 5C4JK 4GTFA 2GAGC 4QIWL 4WJ3M 2WB1L 3S0XA 5IORA 3HOYC 4P5BA 4KC6A 4AYBL 1ZBSA 4C3JC 1WCMA 1SFOC 1ZVUA 4FZBA 5M3FK 4OIPA 1O2AA 2JA7C 2RGRA 1PJ5A 2PA8D 3RZDC 2R7ZA 4RMFA 4KMDA 5M5WK 1I50C 3S1MC 4G7OA 1WIHA 3H0GC 3BP8C 4QJVB 2CW0A 3S1NC 3PO2C 1Y1VC 4A3IK 4KMAA 3GTMC 3GTGC 3S15C 3QX3A 3HOUC 3DXJA 1XPPA 3TFJA 3GTJK 2YU9C 1I50A 4G0VA 1TWCA 5HL8A 2NVYA 3H0GA 3TFIA 2O5JA 4GTBA 3PO3C 1KQ4A 2XCRB 4PAAA 3FKIA 4BLAA 5TMCA 3M4OK 3GTGA 4GFQA 3NUHA 1V5VA 1IQ0A 4BBRC 4A3KC 3HOVK 2E2IK 1WORA 5TMFA 1F7UA 4A3DK 2JA7A 3GTOC 2R7ZC 5IP9K 4XLPA 1ZQ1C 4YG2A 2JA6C 3RZOC 4X6AK 5FLMC 2FQTA 4A3BK 3FOFA 1XZQB 2JA5C 1F9NA 3GTMA 4KB4A 2FQOA 1AB4A 4O2DA 3GTQA 3GTKA 4A3EK 4MEXA 1TWHC 3S2HK 4BY7K 4BY1K 3FHZA 1X31C 2WB1D 4G0WA 1B4BA 1O2BA 2R93K 1O28A 2B63K 4A3JC 4A3MC 2A6EA 4GTLA 4GT9A 3Q3QA 1TWAA 4KMHA 1WOPA 1R9TK 2NVQK 2XCOA 3HOZC 3HOXK 1ZYRA 1TWFA 1O25A 3S17C 4C45A 3I4MK 1BJTA 5C44C 5IP7K 1INNA 3JSTA 5IYCC 2E2HC 4Y52C 4PABA 1BGWA 3LAJA 4KM9A 2A6HA 4KDDA 2P5MA 1WOSA 2E2JC 1O27A 4P9SA 1G51A 1YNNA 2V6TA 1TWGK 4A3GK 4GTDA 3I4NC 4BXXC 1ISEA 2BE5A 5IYBC 4LK0A 1O26A 4LJZA 1ZXOA 3S16C 2NVYK 4GTCA 4LOWA 5EGEA 1TWCK 2CFAB 1I3QA 3GTLC 4JK1A 4Y7NK 5M5YK 2PMZL 1YX2A 5CHPA 5IYDK 1TWFK 3SZZA 3S1RC 3MMLB 4A93K 4C3IK 1EI6A 1J6XA 1YCLA 1TWAK 4A3LC 5C4XK 1WQHA 5C44K 4GTAA 2D6FC 3I4MC 2Y3PA 1F7VA 4A3CC 4AH6A 2NVTK 1RU0A 3GTKK 5C3EK 1PJ7A 1R9TC 4A3CK 4A3MK 2JA8C 4A3JK 5EGHA 2B63C 1XXBA 2O5IA 4OIQA 1K83K 1XZQA 3G4CA 4KMUA 2EBBA 3IPJA 1BS2A 4BY1C 4A93C 4BBSK 4KN7A 3L4KA 5IYDC 3OEPA 4OINA 2R92K 4BLBA 2JA5K 3A8KA 4A3BC 1PJ6A 3FKIC 3RZOK 2A68A 3S2DC 5IP9C 5IYBK 3HKZD 3FKIK 4Q4ZA 3N0CA 4BXXK 3GDZA 4A3DC 5JVOA 3ERED 3GTPC 4ILDA 2R92C 5JFEA 3K7AK 5E68A 3L4JA 1WQFA 4BBSC 3EQLA 2E2JK 1F93A 3GEIA 1K83C 3T02A 2B63A 3HOWK 5IYCK 2E2HK 1DD5A 1WCMC 4OIOA 1SFOA 3SZYA 4C2MK 3S17K 3HOUK 3GTKC 4GTEA 3BP3A 1TWHA 3HOZK 3V4GA 4XCHA 1Y1VK 4C2MC 3OREA 1YNJA 1J98A 1IBAA 5C4XC 1WCMK 1Y1VA 4A3LK 3HOWC 3A8IA 1IL2A 3S1MK 1I50K 4LR2A 1DCPA 4C3IC 1TWHK 3S1RK 4G7HA 4A3EC 1TWFC 1XXCA 4KB2A 3RZDK 3K7AC 4KAWX 4XLNA 4FM9A 3T01A 2CFAA 2JA7K 3GTPK 4Y7NC 4XSZA 1SFOK 2E2HA 5FLMK 4C3JK 3LPXA 4DDQA 3TTGA 4ZH4A 3H3VD 2JA6K 3HOYK 5FJ8K 2PA8L 4P5AA 3S2DK 2ZFZA 1K83A 4KARA 2R7ZK 2WAQD 2PPBA 3I4NK 3TFHA 1UV7A 1IW7A 4A3GC 2Y0SL 4A3FK 1TWGC 1XXAA 1JVIA 3H3VL 3GTOA 4GZYA 4YFXA 1WSRA 3S1QK 1GE9A 1XZPA 2A69A 4G7ZA 3GIRA 2JA6A 5M3MK 3PO3K 2ZUEA 5IP7C 2XCQA 2JA8K 3CAGA 2YU9K 5C3EC 1DCHA 3HOXC 2NVTC 4XSXA 3AD7C 4WILA 5IOTA 3S15K 4A3IC 1EK8A 2P8TA 3AD8C 2KWAA 2E2IA 2GAHC 2R93C 3WODA 3BUEA 1TWAC 3GSIA 2NVXK 1TWGA 4YFKA 1VLOA 2V6UA 2VUMA 1TWCC 3GTLK 2NVYC 4LQYA 4X6AC 3T00A 3S16K 4LLGA 2PMZD 4YFNA 1HI9A 2JH3A 1IE0A 3GEEA 1JOEA 2GSUA 4KATA 4KASA 3GTOK 1I3QK 5L46A 4BKWA 1USOA 1SMYA 1HQMA 3N3YA 1J6WA 1WOOA 4BBRK 1VRQC 1B4AA 2GSNA 3A8JA 1I6HK 3CQZK 3FOEA 3HXAA 2GSOA 3M4OC 3CQZC 2WAQL 1I6HC 1C0AA 2Y0SD 1DCOA 4WJ4A 4Y52K 3LAPA 2R93A 5IOSA 4MQ9A 4AYBD 1XZPB 3GTPA 3GTLA 2JA5A 3GTJC 1I6VA
chains in the Genus database with same CATH topology
4LK1A 3GTJK 3GTPK 5IYDK 4Y7NC 4KN4A 1TWFK 4XSZA 1SFOK 3S1RC 3GTQC 4A93K 4C3IK 5FLMK 3GTGK 4C3JK 3PO3C 3GTMK 4NOIA 2O5JA 2NVQC 4QJVA 4ZH4A 3H3VD 2VUMC 4MEYA 1TWAK 3PO2K 2JA6K 3S1NK 4A3LC 3HOYK 4A3GC 5C4XK 5FJ8K 5TMCA 3M4OK 2PA8L 5C44K 3S2DK 3H0GK 2R7ZK 5D4DA 4OIRA 2WAQD 3I4MC 4A3CC 4BBRC 4A3KC 2PPBA 3HOVK 3I4NK 2E2IK 3S14C 4BY7C 1IW7A 3S2HC 2Y0SL 4A3FK 1TWGC 3HKZL 5TMFA 1Y1WK 1Y1WC 2NVXC 2NVTK 3H3VL 4A3DK 3S14K 3GTOC 5C3EK 3GTKK 4GZYA 1R9TC 4A3CK 4YFXA 3S1QK 4A3MK 2A69A 2R7ZC 2JA8C 5IP9K 4A3JK 4G7ZA 2B63C 4XLPA 4YG2A 2O5IA 4OIQA 2JA6C 3RZOC 2VUMK 1K83K 5M3MK 4KMUA 4X6AK 3PO3K 4BY1C 5FLMC 5IP7C 4A3BK 4A93C 4BBSK 4KN7A 3GTQK 2JA8K 2JA5C 5C4JC 5IYDC 2YU9K 4OINA 2R92K 5C3EC 3HOXC 2NVTC 2JA5K 4A3EK 4MEXA 4XSXA 1TWHC 3S2HK 4A3BC 3S15K 4BY7K 4BY1K 2E2IC 2WB1D 4A3KK 3HOVC 4A3IC 3FKIC 3M3YK 3RZOK 2A68A 4QIWD 3S2DC 2R93K 2R93C 2B63K 3WODA 5IP9C 5IYBK 4A3JC 3HKZD 4A3MC 5M5XK 3FKIK 1TWAC 2A6EA 4Q4ZA 3M3YC 3S1QC 4BXXK 1BDFA 2NVQK 1R9TK 4C3HK 4A3DC 4Q5SA 3HOZC 4A3FC 2NVXK 3HOXK 1ZYRA 1I3QC 3GTPC 2R92C 3S17C 3K7AK 4YFKA 3I4MK 5C4JK 1TWCC 3GTLK 4BBSC 3EQLA 5C44C 2E2JK 4QIWL 2NVYC 2WB1L 5IP7K 3HOYC 5IYCC 2E2HC 4Y52C 4X6AC 3S16K 1K83C 4LLGA 2A6HA 4AYBL 3HOWK 5IYCK 2PMZD 1WCMC 4OIOA 2E2HK 4YFNA 2E2JC 1XPPA 1SFOC 4C2MK 5M3FK 4OIPA 2JA7C 1YNNA 3S17K 3HOUK 2PA8D 3GTKC 3RZDC 1I3QK 3GTOK 3HOZK 1TWGK 4A3GK 1SMYA 1HQMA 5M5WK 1I50C 4BBRK 3I4NC 3S1MC 4BXXC 4G7OA 1Y1VK 2BE5A 5IYBC 3H0GC 1I6HK 3CQZK 1YNJA 3M4OC 5C4XC 1WCMK 3CQZC 4LK0A 2CW0A 4QJVB 2WAQL 3HOWC 3PO2C 4A3LK 1Y1VC 3S1NC 1I6HC 4LJZA 2Y0SD 3S16C 3S1MK 4A3IK 4Y52K 1I50K 3GTMC 3GTGC 2NVYK 3S15C 1TWHK 4MQ9A 1TWCK 4AYBD 4G7HA 1TWFC 4A3EC 4JK1A 3S1RK 4Y7NK 3GTLC 3RZDK 5M5YK 3K7AC 3HOUC 4XLNA 3GTJC 2PMZL 3DXJA 2YU9C 1I6VA 2JA7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 A;  3GTJ K;  3GTP K;  5IYD K;  4Y7N C;  4KN4 A;  1TWF K;  4XSZ A;  1SFO K;  3S1R C;  3GTQ C;  4A93 K;  4C3I K;  5FLM K;  3GTG K;  4C3J K;  3PO3 C;  3GTM K;  4NOI A;  2O5J A;  2NVQ C;  4QJV A;  4ZH4 A;  3H3V D;  2VUM C;  4MEY A;  1TWA K;  3PO2 K;  2JA6 K;  3S1N K;  4A3L C;  3HOY K;  4A3G C;  5C4X K;  5FJ8 K;  5TMC A;  3M4O K;  2PA8 L;  5C44 K;  3S2D K;  3H0G K;  2R7Z K;  5D4D A;  4OIR A;  2WAQ D;  3I4M C;  4A3C C;  4BBR C;  4A3K C;  2PPB A;  3HOV K;  3I4N K;  2E2I K;  3S14 C;  4BY7 C;  1IW7 A;  3S2H C;  2Y0S L;  4A3F K;  1TWG C;  3HKZ L;  5TMF A;  1Y1W K;  1Y1W C;  2NVX C;  2NVT K;  3H3V L;  4A3D K;  3S14 K;  3GTO C;  5C3E K;  3GTK K;  4GZY A;  1R9T C;  4A3C K;  4YFX A;  3S1Q K;  4A3M K;  2A69 A;  2R7Z C;  2JA8 C;  5IP9 K;  4A3J K;  4G7Z A;  2B63 C;  4XLP A;  4YG2 A;  2O5I A;  4OIQ A;  2JA6 C;  3RZO C;  2VUM K;  1K83 K;  5M3M K;  4KMU A;  4X6A K;  3PO3 K;  4BY1 C;  5FLM C;  5IP7 C;  4A3B K;  4A93 C;  4BBS K;  4KN7 A;  3GTQ K;  2JA8 K;  2JA5 C;  5C4J C;  5IYD C;  2YU9 K;  4OIN A;  2R92 K;  5C3E C;  3HOX C;  2NVT C;  2JA5 K;  4A3E K;  4MEX A;  4XSX A;  1TWH C;  3S2H K;  4A3B C;  3S15 K;  4BY7 K;  4BY1 K;  2E2I C;  2WB1 D;  4A3K K;  3HOV C;  4A3I C;  3FKI C;  3M3Y K;  3RZO K;  2A68 A;  4QIW D;  3S2D C;  2R93 K;  2R93 C;  2B63 K;  3WOD A;  5IP9 C;  5IYB K;  4A3J C;  3HKZ D;  4A3M C;  5M5X K;  3FKI K;  1TWA C;  2A6E A;  4Q4Z A;  3M3Y C;  3S1Q C;  4BXX K;  1BDF A;  2NVQ K;  1R9T K;  4C3H K;  4A3D C;  4Q5S A;  3HOZ C;  4A3F C;  2NVX K;  3HOX K;  1ZYR A;  1I3Q C;  3GTP C;  2R92 C;  3S17 C;  3K7A K;  4YFK A;  3I4M K;  5C4J K;  1TWC C;  3GTL K;  4BBS C;  3EQL A;  5C44 C;  2E2J K;  4QIW L;  2NVY C;  2WB1 L;  5IP7 K;  3HOY C;  5IYC C;  2E2H C;  4Y52 C;  4X6A C;  3S16 K;  1K83 C;  4LLG A;  2A6H A;  4AYB L;  3HOW K;  5IYC K;  2PMZ D;  1WCM C;  4OIO A;  2E2H K;  4YFN A;  2E2J C;  1XPP A;  1SFO C;  4C2M K;  5M3F K;  4OIP A;  2JA7 C;  1YNN A;  3S17 K;  3HOU K;  2PA8 D;  3GTK C;  3RZD C;  1I3Q K;  3GTO K;  3HOZ K;  1TWG K;  4A3G K;  1SMY A;  1HQM A;  5M5W K;  1I50 C;  4BBR K;  3I4N C;  3S1M C;  4BXX C;  4G7O A;  1Y1V K;  2BE5 A;  5IYB C;  3H0G C;  1I6H K;  3CQZ K;  1YNJ A;  3M4O C;  5C4X C;  1WCM K;  3CQZ C;  4LK0 A;  2CW0 A;  4QJV B;  2WAQ L;  3HOW C;  3PO2 C;  4A3L K;  1Y1V C;  3S1N C;  1I6H C;  4LJZ A;  2Y0S D;  3S16 C;  3S1M K;  4A3I K;  4Y52 K;  1I50 K;  3GTM C;  3GTG C;  2NVY K;  3S15 C;  1TWH K;  4MQ9 A;  1TWC K;  4AYB D;  4G7H A;  1TWF C;  4A3E C;  4JK1 A;  3S1R K;  4Y7N K;  3GTL C;  3RZD K;  5M5Y K;  3K7A C;  3HOU C;  4XLN A;  3GTJ C;  2PMZ L;  3DXJ A;  2YU9 C;  1I6V A;  2JA7 K; 
#chains in the Genus database with same CATH topology
 4LK1 A;  2RH6 A;  1VH2 A;  3AH5 A;  4KN4 A;  1Y1W A;  3GTQ C;  3GTG K;  3GTM K;  4NOI A;  2NVQ C;  3CQZ A;  4QJV A;  2VUM C;  4MEY A;  5TJ3 A;  3PO2 K;  3AD9 C;  3S1N K;  2ZUF A;  4G0U A;  3H0G K;  5D4D A;  4OIR A;  3GTJ A;  3S14 C;  4BY7 C;  1L0W A;  3S2H C;  1O2F B;  3ADA C;  3HKZ L;  2PHC B;  1Y1W K;  1Y1W C;  2NVX C;  3OPF A;  1R9T A;  3S14 K;  4KM8 A;  1O24 A;  1O29 A;  3VA7 A;  2VUM K;  2W7V A;  3GTQ K;  1WSV A;  5C4J C;  4M1X A;  4J3N A;  1VJE A;  1IS1 A;  1EFW A;  1USM A;  5IOQ A;  1JQW A;  1VGX A;  2E2I C;  4C3H C;  4A3K K;  3HOV C;  3GEH A;  1EQR A;  3N0B A;  3M3Y K;  1WQG A;  4QIW D;  5M5X K;  3M3Y C;  3S1Q C;  1BDF A;  1EH1 A;  3AQP A;  4C3H K;  2V6S A;  3G4A A;  2YU9 A;  3AQO A;  5CJ9 A;  4Q5S A;  4A3F C;  2R92 A;  1I3Q C;  1J6V A;  2NVX A;  5C4J K;  4GTF A;  2GAG C;  4QIW L;  4WJ3 M;  2WB1 L;  3S0X A;  5IOR A;  3HOY C;  4P5B A;  4KC6 A;  4AYB L;  1ZBS A;  4C3J C;  1WCM A;  1SFO C;  1ZVU A;  4FZB A;  5M3F K;  4OIP A;  1O2A A;  2JA7 C;  2RGR A;  1PJ5 A;  2PA8 D;  3RZD C;  2R7Z A;  4RMF A;  4KMD A;  5M5W K;  1I50 C;  3S1M C;  4G7O A;  1WIH A;  3H0G C;  3BP8 C;  4QJV B;  2CW0 A;  3S1N C;  3PO2 C;  1Y1V C;  4A3I K;  4KMA A;  3GTM C;  3GTG C;  3S15 C;  3QX3 A;  3HOU C;  3DXJ A;  1XPP A;  3TFJ A;  3GTJ K;  2YU9 C;  1I50 A;  4G0V A;  1TWC A;  5HL8 A;  2NVY A;  3H0G A;  3TFI A;  2O5J A;  4GTB A;  3PO3 C;  1KQ4 A;  2XCR B;  4PAA A;  3FKI A;  4BLA A;  5TMC A;  3M4O K;  3GTG A;  4GFQ A;  3NUH A;  1V5V A;  1IQ0 A;  4BBR C;  4A3K C;  3HOV K;  2E2I K;  1WOR A;  5TMF A;  1F7U A;  4A3D K;  2JA7 A;  3GTO C;  2R7Z C;  5IP9 K;  4XLP A;  1ZQ1 C;  4YG2 A;  2JA6 C;  3RZO C;  4X6A K;  5FLM C;  2FQT A;  4A3B K;  3FOF A;  1XZQ B;  2JA5 C;  1F9N A;  3GTM A;  4KB4 A;  2FQO A;  1AB4 A;  4O2D A;  3GTQ A;  3GTK A;  4A3E K;  4MEX A;  1TWH C;  3S2H K;  4BY7 K;  4BY1 K;  3FHZ A;  1X31 C;  2WB1 D;  4G0W A;  1B4B A;  1O2B A;  2R93 K;  1O28 A;  2B63 K;  4A3J C;  4A3M C;  2A6E A;  4GTL A;  4GT9 A;  3Q3Q A;  1TWA A;  4KMH A;  1WOP A;  1R9T K;  2NVQ K;  2XCO A;  3HOZ C;  3HOX K;  1ZYR A;  1TWF A;  1O25 A;  3S17 C;  4C45 A;  3I4M K;  1BJT A;  5C44 C;  5IP7 K;  1INN A;  3JST A;  5IYC C;  2E2H C;  4Y52 C;  4PAB A;  1BGW A;  3LAJ A;  4KM9 A;  2A6H A;  4KDD A;  2P5M A;  1WOS A;  2E2J C;  1O27 A;  4P9S A;  1G51 A;  1YNN A;  2V6T A;  1TWG K;  4A3G K;  4GTD A;  3I4N C;  4BXX C;  1ISE A;  2BE5 A;  5IYB C;  4LK0 A;  1O26 A;  4LJZ A;  1ZXO A;  3S16 C;  2NVY K;  4GTC A;  4LOW A;  5EGE A;  1TWC K;  2CFA B;  1I3Q A;  3GTL C;  4JK1 A;  4Y7N K;  5M5Y K;  2PMZ L;  1YX2 A;  5CHP A;  5IYD K;  1TWF K;  3SZZ A;  3S1R C;  3MML B;  4A93 K;  4C3I K;  1EI6 A;  1J6X A;  1YCL A;  1TWA K;  4A3L C;  5C4X K;  1WQH A;  5C44 K;  4GTA A;  2D6F C;  3I4M C;  2Y3P A;  1F7V A;  4A3C C;  4AH6 A;  2NVT K;  1RU0 A;  3GTK K;  5C3E K;  1PJ7 A;  1R9T C;  4A3C K;  4A3M K;  2JA8 C;  4A3J K;  5EGH A;  2B63 C;  1XXB A;  2O5I A;  4OIQ A;  1K83 K;  1XZQ A;  3G4C A;  4KMU A;  2EBB A;  3IPJ A;  1BS2 A;  4BY1 C;  4A93 C;  4BBS K;  4KN7 A;  3L4K A;  5IYD C;  3OEP A;  4OIN A;  2R92 K;  4BLB A;  2JA5 K;  3A8K A;  4A3B C;  1PJ6 A;  3FKI C;  3RZO K;  2A68 A;  3S2D C;  5IP9 C;  5IYB K;  3HKZ D;  3FKI K;  4Q4Z A;  3N0C A;  4BXX K;  3GDZ A;  4A3D C;  5JVO A;  3ERE D;  3GTP C;  4ILD A;  2R92 C;  5JFE A;  3K7A K;  5E68 A;  3L4J A;  1WQF A;  4BBS C;  3EQL A;  2E2J K;  1F93 A;  3GEI A;  1K83 C;  3T02 A;  2B63 A;  3HOW K;  5IYC K;  2E2H K;  1DD5 A;  1WCM C;  4OIO A;  1SFO A;  3SZY A;  4C2M K;  3S17 K;  3HOU K;  3GTK C;  4GTE A;  3BP3 A;  1TWH A;  3HOZ K;  3V4G A;  4XCH A;  1Y1V K;  4C2M C;  3ORE A;  1YNJ A;  1J98 A;  1IBA A;  5C4X C;  1WCM K;  1Y1V A;  4A3L K;  3HOW C;  3A8I A;  1IL2 A;  3S1M K;  1I50 K;  4LR2 A;  1DCP A;  4C3I C;  1TWH K;  3S1R K;  4G7H A;  4A3E C;  1TWF C;  1XXC A;  4KB2 A;  3RZD K;  3K7A C;  4KAW X;  4XLN A;  4FM9 A;  3T01 A;  2CFA A;  2JA7 K;  3GTP K;  4Y7N C;  4XSZ A;  1SFO K;  2E2H A;  5FLM K;  4C3J K;  3LPX A;  4DDQ A;  3TTG A;  4ZH4 A;  3H3V D;  2JA6 K;  3HOY K;  5FJ8 K;  2PA8 L;  4P5A A;  3S2D K;  2ZFZ A;  1K83 A;  4KAR A;  2R7Z K;  2WAQ D;  2PPB A;  3I4N K;  3TFH A;  1UV7 A;  1IW7 A;  4A3G C;  2Y0S L;  4A3F K;  1TWG C;  1XXA A;  1JVI A;  3H3V L;  3GTO A;  4GZY A;  4YFX A;  1WSR A;  3S1Q K;  1GE9 A;  1XZP A;  2A69 A;  4G7Z A;  3GIR A;  2JA6 A;  5M3M K;  3PO3 K;  2ZUE A;  5IP7 C;  2XCQ A;  2JA8 K;  3CAG A;  2YU9 K;  5C3E C;  1DCH A;  3HOX C;  2NVT C;  4XSX A;  3AD7 C;  4WIL A;  5IOT A;  3S15 K;  4A3I C;  1EK8 A;  2P8T A;  3AD8 C;  2KWA A;  2E2I A;  2GAH C;  2R93 C;  3WOD A;  3BUE A;  1TWA C;  3GSI A;  2NVX K;  1TWG A;  4YFK A;  1VLO A;  2V6U A;  2VUM A;  1TWC C;  3GTL K;  2NVY C;  4LQY A;  4X6A C;  3T00 A;  3S16 K;  4LLG A;  2PMZ D;  4YFN A;  1HI9 A;  2JH3 A;  1IE0 A;  3GEE A;  1JOE A;  2GSU A;  4KAT A;  4KAS A;  3GTO K;  1I3Q K;  5L46 A;  4BKW A;  1USO A;  1SMY A;  1HQM A;  3N3Y A;  1J6W A;  1WOO A;  4BBR K;  1VRQ C;  1B4A A;  2GSN A;  3A8J A;  1I6H K;  3CQZ K;  3FOE A;  3HXA A;  2GSO A;  3M4O C;  3CQZ C;  2WAQ L;  1I6H C;  1C0A A;  2Y0S D;  1DCO A;  4WJ4 A;  4Y52 K;  3LAP A;  2R93 A;  5IOS A;  4MQ9 A;  4AYB D;  1XZP B;  3GTP A;  3GTL A;  2JA5 A;  3GTJ C;  1I6V A; 
#chains in the Genus database with same CATH homology
 4LK1 A;  3GTJ K;  3GTP K;  5IYD K;  4Y7N C;  4KN4 A;  1TWF K;  4XSZ A;  1SFO K;  3S1R C;  3GTQ C;  4A93 K;  4C3I K;  5FLM K;  3GTG K;  4C3J K;  3PO3 C;  3GTM K;  4NOI A;  2O5J A;  2NVQ C;  4QJV A;  4ZH4 A;  3H3V D;  2VUM C;  4MEY A;  1TWA K;  3PO2 K;  2JA6 K;  3S1N K;  4A3L C;  3HOY K;  4A3G C;  5C4X K;  5FJ8 K;  5TMC A;  3M4O K;  2PA8 L;  5C44 K;  3S2D K;  3H0G K;  2R7Z K;  5D4D A;  4OIR A;  2WAQ D;  3I4M C;  4A3C C;  4BBR C;  4A3K C;  2PPB A;  3HOV K;  3I4N K;  2E2I K;  3S14 C;  4BY7 C;  1IW7 A;  3S2H C;  2Y0S L;  4A3F K;  1TWG C;  3HKZ L;  5TMF A;  1Y1W K;  1Y1W C;  2NVX C;  2NVT K;  3H3V L;  4A3D K;  3S14 K;  3GTO C;  5C3E K;  3GTK K;  4GZY A;  1R9T C;  4A3C K;  4YFX A;  3S1Q K;  4A3M K;  2A69 A;  2R7Z C;  2JA8 C;  5IP9 K;  4A3J K;  4G7Z A;  2B63 C;  4XLP A;  4YG2 A;  2O5I A;  4OIQ A;  2JA6 C;  3RZO C;  2VUM K;  1K83 K;  5M3M K;  4KMU A;  4X6A K;  3PO3 K;  4BY1 C;  5FLM C;  5IP7 C;  4A3B K;  4A93 C;  4BBS K;  4KN7 A;  3GTQ K;  2JA8 K;  2JA5 C;  5C4J C;  5IYD C;  2YU9 K;  4OIN A;  2R92 K;  5C3E C;  3HOX C;  2NVT C;  2JA5 K;  4A3E K;  4MEX A;  4XSX A;  1TWH C;  3S2H K;  4A3B C;  3S15 K;  4BY7 K;  4BY1 K;  2E2I C;  2WB1 D;  4A3K K;  3HOV C;  4A3I C;  3FKI C;  3M3Y K;  3RZO K;  2A68 A;  4QIW D;  3S2D C;  2R93 K;  2R93 C;  2B63 K;  3WOD A;  5IP9 C;  5IYB K;  4A3J C;  3HKZ D;  4A3M C;  5M5X K;  3FKI K;  1TWA C;  2A6E A;  4Q4Z A;  3M3Y C;  3S1Q C;  4BXX K;  1BDF A;  2NVQ K;  1R9T K;  4C3H K;  4A3D C;  4Q5S A;  3HOZ C;  4A3F C;  2NVX K;  3HOX K;  1ZYR A;  1I3Q C;  3GTP C;  2R92 C;  3S17 C;  3K7A K;  4YFK A;  3I4M K;  5C4J K;  1TWC C;  3GTL K;  4BBS C;  3EQL A;  5C44 C;  2E2J K;  4QIW L;  2NVY C;  2WB1 L;  5IP7 K;  3HOY C;  5IYC C;  2E2H C;  4Y52 C;  4X6A C;  3S16 K;  1K83 C;  4LLG A;  2A6H A;  4AYB L;  3HOW K;  5IYC K;  2PMZ D;  1WCM C;  4OIO A;  2E2H K;  4YFN A;  2E2J C;  1XPP A;  1SFO C;  4C2M K;  5M3F K;  4OIP A;  2JA7 C;  1YNN A;  3S17 K;  3HOU K;  2PA8 D;  3GTK C;  3RZD C;  1I3Q K;  3GTO K;  3HOZ K;  1TWG K;  4A3G K;  1SMY A;  1HQM A;  5M5W K;  1I50 C;  4BBR K;  3I4N C;  3S1M C;  4BXX C;  4G7O A;  1Y1V K;  2BE5 A;  5IYB C;  3H0G C;  1I6H K;  3CQZ K;  1YNJ A;  3M4O C;  5C4X C;  1WCM K;  3CQZ C;  4LK0 A;  2CW0 A;  4QJV B;  2WAQ L;  3HOW C;  3PO2 C;  4A3L K;  1Y1V C;  3S1N C;  1I6H C;  4LJZ A;  2Y0S D;  3S16 C;  3S1M K;  4A3I K;  4Y52 K;  1I50 K;  3GTM C;  3GTG C;  2NVY K;  3S15 C;  1TWH K;  4MQ9 A;  1TWC K;  4AYB D;  4G7H A;  1TWF C;  4A3E C;  4JK1 A;  3S1R K;  4Y7N K;  3GTL C;  3RZD K;  5M5Y K;  3K7A C;  3HOU C;  4XLN A;  3GTJ C;  2PMZ L;  3DXJ A;  2YU9 C;  1I6V A;  2JA7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...