3K7AK

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3k7aK00
2A69A 4Y52K 1HQMA 2A6HA 3PO2C 5C4XC 1TWHC 4A3LC 3H0GC 3HKZD 5C4JC 1TWAC 2E2HK 2WAQL 5C3EC 4AYBD 3S15K 2PA8L 4OIOA 2R93K 3HOXC 1SFOK 4A3DC 4MEYA 5TMFA 2R92C 3S16K 2JA8C 3S2HK 4Q4ZA 4Y7NC 1TWCK 2O5JA 1I6VA 1Y1WK 4XSXA 2CW0A 5IYDK 4A3FK 4A3MK 4A3BK 5IP9K 3CQZC 3HOWC 3HOVC 2B63K 4BY1C 4KN7A 3S2DK 4A3IC 4MQ9A 3GTLC 5M3FK 3HOUK 3H3VL 5C44C 4A3CK 2PMZD 3S14K 3RZDK 3FKIC 2VUMK 4MEXA 3M4OK 1K83C 4LJZA 1XPPA 2YU9C 4Y52C 4Q5SA 3S1QK 3I4MC 3GTGC 4A3KK 1BDFA 1YNNA 3M3YK 3HKZL 4A3JK 3GTQC 2NVXC 4KN4A 2JA6K 4XSZA 2R7ZC 5FJ8K 4OIRA 4QIWD 2JA5K 4A3EC 3S15C 3HOYC 1SFOC 3S1RK 2R93C 4XLPA 1YNJA 3GTOK 1TWGC 1Y1VK 4JK1A 3PO3K 3GTKK 3GTJK 1TWFK 1I50K 4YFNA 5IP7C 2NVTK 3GTMK 3S17C 3S1MC 1Y1WC 4BBSK 4X6AK 4BBRK 5IYCK 4A3MC 3S1NC 2NVYK 1R9TC 2NVQK 2PMZL 3HOZK 2Y0SD 4C3JK 4A3GK 4A93K 1I6HK 2JA7K 5FLMK 3RZOK 1I3QC 4YG2A 4C3HK 3I4NK 4XLNA 3PO2K 1WCMK 2E2JK 5C4XK 1TWHK 5M5XK 4OIQA 4A3LK 4A3KC 3H0GK 4YFKA 1TWAK 2WB1D 5C3EK 4G7HA 3DXJA 4LK0A 4QIWL 3HOXK 4AYBL 4A3DK 2R92K 2JA5C 2E2HC 4OINA 2JA8K 4NOIA 2E2IK 4QJVA 4Y7NK 3K7AK 3S16C 5M3MK 3S2HC 3GTKC 2A68A 1TWFC 5IYBK 3GTMC 1ZYRA 1TWCC 3HOWK 4GZYA 3HOVK 5IYCC 4BY1K 5M5WK 5IYDC 4A3FC 4G7ZA 2NVYC 3EQLA 5IP9C 3GTLK 3GTPK 4A3BC 5C44K 2B63C 4BXXK 2Y0SL 4LLGA 4YFXA 2O5IA 3FKIK 3HOUC 3S2DC 4A3CC 1K83K 4G7OA 4KMUA 4A3GC 4BY7K 3RZOC 3S14C 3RZDC 2VUMC 2YU9K 3M4OC 3I4NC 3I4MK 3GTGK 1WCMC 2E2JC 3GTQK 2NVXK 3S1QC 2WB1L 1SMYA 4ZH4A 2R7ZK 3M3YC 5C4JK 4A3JC 4A3EK 2JA6C 3HOYK 2WAQD 3WODA 2PA8D 2PPBA 1TWGK 3S1RC 2E2IC 3S1MK 5IP7K 3S17K 3K7AC 3GTOC 4C3IK 1Y1VC 4LK1A 4C2MK 5IYBC 3PO3C 3GTJC 1I50C 4QJVB 5D4DA 2NVTC 3S1NK 4X6AC 4BBSC 3CQZK 1IW7A 4BBRC 1R9TK 3GTPC 4BXXC 4A3IK 2A6EA 2NVQC 2BE5A 3H3VD 5TMCA 1I3QK 3HOZC 4BY7C 4A93C 1I6HC 4OIPA 2JA7C 5FLMC 5M5YK
chains in the Genus database with same CATH superfamily
4C3HC 2A6HA 5L46A 1O2BA 1ZXOA 2GAGC 3AD7C 1TWHC 4A3LC 1R9TA 4GTLA 2E2HK 4AYBD 2KWAA 5EGEA 3S16K 3S2HK 2RGRA 4Y7NC 3FKIA 3FOFA 5IYDK 4FZBA 3IPJA 3SZYA 3HOWC 4BY1C 4C45A 4MQ9A 4A3IC 3H3VL 2CFAA 3S14K 1VGXA 3FKIC 4MEXA 1XZQA 5IORA 1XPPA 4Q5SA 4KC6A 4A3KK 1O2FB 5HL8A 4KN4A 5FJ8K 2FQTA 3MMLB 1X31C 3GEIA 3GTJK 1TWFK 1I50K 5IP7C 1O25A 1WOOA 5IYCK 1J6XA 3LAJA 2NVYK 2NVQK 4J3NA 3VA7A 3G4AA 1F9NA 3HOZK 2Y0SD 4P5AA 4C3JK 1DD5A 4WJ3M 1WSVA 3PO2K 3JSTA 5C4XK 1TWFA 4A3KC 4G7HA 1B4BA 2NVYA 2R92K 1WOPA 4OINA 4NOIA 2E2IK 4QJVA 5M3MK 1TWFC 1TWCC 3HOVK 5IYCC 5M5WK 4A3FC 4A3BC 2NVYC 5IP9C 2B63C 2Y0SL 4A3CC 2R92A 4GT9A 2P5MA 2YU9K 2E2IA 1IBAA 4GTEA 2NVXK 1JOEA 3S1QC 1EFWA 2R7ZK 3M3YC 4KM9A 2E2IC 3S17K 4LK1A 3S1NK 4BBSC 3FOEA 2NVXA 4GTBA 2BE5A 2R7ZA 1I3QK 3BUEA 4OIPA 4BKWA 5FLMC 1F7UA 1HQMA 1BS2A 1TWAC 1EI6A 4PAAA 2JA8C 2XCRB 2O5JA 1J6VA 2CW0A 3T01A 3GTGA 3S2DK 3GTLC 1DCPA 3HOUK 1J6WA 1VRQC 2PMZD 3T00A 2VUMK 3TFJA 1K83C 1USMA 1WSRA 3I4MC 3GTGC 4P9SA 1DCHA 1YNNA 4A3JK 1IQ0A 4XSZA 3V4GA 4QIWD 2JA5K 4A3EC 3GSIA 1YNJA 3GTOK 4JK1A 3S1MC 2VUMA 1O26A 2NVTK 3GTMK 4C3IC 4BBRK 1R9TC 1ISEA 3ADAC 2PMZL 4FM9A 4A93K 4KMHA 4KB2A 2JA5A 1JVIA 2E2HA 2PHCB 2E2JK 5IOQA 2GSNA 5M5XK 3H0GK 3GTMA 2WB1D 5C3EK 4AH6A 3DXJA 4QIWL 3HOXK 4AYBL 4A3DK 2JA5C 2E2HC 4WJ4A 1O27A 3G4CA 3S16C 3S2HC 1WQFA 5IYBK 1INNA 3GTMC 1ZYRA 3BP8C 4LQYA 4O2DA 1J98A 3BP3A 5IYDC 4GTCA 5C44K 3H0GA 4LLGA 4YFXA 2GAHC 2O5IA 4G7OA 3S14C 1WIHA 1JQWA 3AQOA 4KDDA 2E2JC 3GTQK 2WB1L 3GTJA 4KMDA 1I50A 2GSOA 1O29A 3HOYK 3AD8C 2WAQD 3WODA 4BLAA 2PA8D 1TWGK 5CHPA 3L4JA 1ZQ1C 1O28A 4C2MK 5IYBC 1O24A 3GTJC 1I50C 5D4DA 1F93A 2V6TA 3CAGA 4DDQA 3GTQA 5IOTA 1IL2A 2NVQC 5TMCA 3HOZC 4C3JC 1B4AA 1TWGA 2A69A 3PO2C 5C4XC 1EH1A 2WAQL 3S15K 2PA8L 4OIOA 2R93K 1VJEA 2R92C 2RH6A 1XXBA 4C2MC 1I6VA 1Y1WK 4ILDA 3OREA 2XCOA 1USOA 1ZVUA 2YU9A 3NUHA 2ZUEA 1WQHA 3HOVC 5M3FK 3RZDK 3M4OK 2R93A 3N0CA 4RMFA 4LJZA 3ERED 2YU9C 5JVOA 1V5VA 4BLBA 1Y1WA 2NVXC 2JA6K 4KMAA 2R7ZC 4OIRA 3S15C 3T02A 2R93C 3S1RK 1Y1VK 3PO3K 3GTKK 3S17C 1I3QA 4X6AK 1Y1WC 3S1NC 1AB4A 1IS1A 4A3GK 2JA6A 1I6HK 2JA7K 3RZOK 1I3QC 4C3HK 5E68A 3I4NK 4XLNA 1VLOA 1WORA 1G51A 1Y1VA 3GTKA 1TWHK 4A3LK 4GTDA 4LK0A 3TTGA 1XXCA 1VH2A 1PJ6A 3LAPA 1O2AA 2P8TA 4Y7NK 3QX3A 3K7AK 3GTKC 2A68A 3TFIA 3HOWK 3OPFA 1HI9A 2V6UA 4BY1K 3A8KA 4G7ZA 3GTPK 2Y3PA 3S2DC 4A3GC 2XCQA 3FKIK 3HOUC 4KMUA 3RZOC 1UV7A 2VUMC 3I4NC 2JH3A 4GFQA 3GTOA 5C4JK 4A3JC 1EQRA 2D6FC 3GTPA 2PPBA 5IP7K 3K7AC 3GTOC 1DCOA 2V6SA 2NVTC 3GEEA 3CQZK 1IW7A 4BBRC 3GTPC 2A6EA 5TJ3A 4A93C 5M5YK 4Y52K 4KASA 2EBBA 3H0GC 3HKZD 5C4JC 3CQZA 5C3EC 1F7VA 3HOXC 1SFOK 1WOSA 3FHZA 4MEYA 5TMFA 4A3DC 1EK8A 4GTAA 4Q4ZA 4G0VA 1TWCK 4XSXA 4A3FK 4A3MK 1GE9A 4A3BK 5IP9K 3CQZC 2B63K 4KN7A 1XZPB 4LOWA 5C44C 3A8JA 4G0WA 4A3CK 1SFOA 1WQGA 4Y52C 3S1QK 3A8IA 1TWCA 3M3YK 1BDFA 3HKZL 3GTQC 3GEHA 1IE0A 5JFEA 1PJ7A 2B63A 3HOYC 1SFOC 4XLPA 1TWGC 4YFNA 3LPXA 4BBSK 4KB4A 4A3MC 4G0UA 3AH5A 4GTFA 3S0XA 4PABA 5FLMK 4YG2A 2CFAB 5EGHA 1WCMK 3HXAA 2FQOA 4OIQA 1XZQB 4YFKA 4LR2A 1TWAK 5IOSA 1PJ5A 2ZFZA 4M1XA 4KATA 3N0BA 2JA8K 4XCHA 4GZYA 5CJ9A 1WCMA 3EQLA 3GTLK 4BXXK 3GDZA 1TWAA 3TFHA 1YX2A 1K83K 1C0AA 3SZZA 4WILA 4BY7K 3RZDC 3M4OC 1YCLA 1KQ4A 3I4MK 3GTGK 1WCMC 3N3YA 1SMYA 1RU0A 4ZH4A 3OEPA 2GSUA 1XXAA 4A3EK 2JA6C 3GTLA 2ZUFA 1BGWA 2W7VA 3AD9C 3S1RC 3S1MK 3GIRA 1K83A 4P5BA 4C3IK 1Y1VC 1L0WA 3PO3C 2JA7A 1BJTA 4QJVB 4X6AC 1XZPA 1R9TK 3AQPA 4KARA 4BXXC 4A3IK 1TWHA 4KAWX 4KM8A 3Q3QA 3H3VD 4BY7C 1I6HC 1ZBSA 2JA7C 3L4KA
chains in the Genus database with same CATH topology
2A69A 4Y52K 1HQMA 2A6HA 3PO2C 5C4XC 1TWHC 4A3LC 3H0GC 3HKZD 5C4JC 1TWAC 2E2HK 2WAQL 5C3EC 4AYBD 3S15K 2PA8L 4OIOA 2R93K 3HOXC 1SFOK 4A3DC 4MEYA 5TMFA 2R92C 3S16K 2JA8C 3S2HK 4Q4ZA 4Y7NC 1TWCK 2O5JA 1I6VA 1Y1WK 4XSXA 2CW0A 5IYDK 4A3FK 4A3MK 4A3BK 5IP9K 3CQZC 3HOWC 3HOVC 2B63K 4BY1C 4KN7A 3S2DK 4A3IC 4MQ9A 3GTLC 5M3FK 3HOUK 3H3VL 5C44C 4A3CK 2PMZD 3S14K 3RZDK 3FKIC 2VUMK 4MEXA 3M4OK 1K83C 4LJZA 1XPPA 2YU9C 4Y52C 4Q5SA 3S1QK 3I4MC 3GTGC 4A3KK 1BDFA 1YNNA 3M3YK 3HKZL 4A3JK 3GTQC 2NVXC 4KN4A 2JA6K 4XSZA 2R7ZC 5FJ8K 4OIRA 4QIWD 2JA5K 4A3EC 3S15C 3HOYC 1SFOC 3S1RK 2R93C 4XLPA 1YNJA 3GTOK 1TWGC 1Y1VK 4JK1A 3PO3K 3GTKK 3GTJK 1TWFK 1I50K 4YFNA 5IP7C 2NVTK 3GTMK 3S17C 3S1MC 1Y1WC 4BBSK 4X6AK 4BBRK 5IYCK 4A3MC 3S1NC 2NVYK 1R9TC 2NVQK 2PMZL 3HOZK 2Y0SD 4C3JK 4A3GK 4A93K 1I6HK 2JA7K 5FLMK 3RZOK 1I3QC 4YG2A 4C3HK 3I4NK 4XLNA 3PO2K 1WCMK 2E2JK 5C4XK 1TWHK 5M5XK 4OIQA 4A3LK 4A3KC 3H0GK 4YFKA 1TWAK 2WB1D 5C3EK 4G7HA 3DXJA 4LK0A 4QIWL 3HOXK 4AYBL 4A3DK 2R92K 2JA5C 2E2HC 4OINA 2JA8K 4NOIA 2E2IK 4QJVA 4Y7NK 3K7AK 3S16C 5M3MK 3S2HC 3GTKC 2A68A 1TWFC 5IYBK 3GTMC 1ZYRA 1TWCC 3HOWK 4GZYA 3HOVK 5IYCC 4BY1K 5M5WK 5IYDC 4A3FC 4G7ZA 2NVYC 3EQLA 5IP9C 3GTLK 3GTPK 4A3BC 5C44K 2B63C 4BXXK 2Y0SL 4LLGA 4YFXA 2O5IA 3FKIK 3HOUC 3S2DC 4A3CC 1K83K 4G7OA 4KMUA 4A3GC 4BY7K 3RZOC 3S14C 3RZDC 2VUMC 2YU9K 3M4OC 3I4NC 3I4MK 3GTGK 1WCMC 2E2JC 3GTQK 2NVXK 3S1QC 2WB1L 1SMYA 4ZH4A 2R7ZK 3M3YC 5C4JK 4A3JC 4A3EK 2JA6C 3HOYK 2WAQD 3WODA 2PA8D 2PPBA 1TWGK 3S1RC 2E2IC 3S1MK 5IP7K 3S17K 3K7AC 3GTOC 4C3IK 1Y1VC 4LK1A 4C2MK 5IYBC 3PO3C 3GTJC 1I50C 4QJVB 5D4DA 2NVTC 3S1NK 4X6AC 4BBSC 3CQZK 1IW7A 4BBRC 1R9TK 3GTPC 4BXXC 4A3IK 2A6EA 2NVQC 2BE5A 3H3VD 5TMCA 1I3QK 3HOZC 4BY7C 4A93C 1I6HC 4OIPA 2JA7C 5FLMC 5M5YK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A69 A;  4Y52 K;  1HQM A;  2A6H A;  3PO2 C;  5C4X C;  1TWH C;  4A3L C;  3H0G C;  3HKZ D;  5C4J C;  1TWA C;  2E2H K;  2WAQ L;  5C3E C;  4AYB D;  3S15 K;  2PA8 L;  4OIO A;  2R93 K;  3HOX C;  1SFO K;  4A3D C;  4MEY A;  5TMF A;  2R92 C;  3S16 K;  2JA8 C;  3S2H K;  4Q4Z A;  4Y7N C;  1TWC K;  2O5J A;  1I6V A;  1Y1W K;  4XSX A;  2CW0 A;  5IYD K;  4A3F K;  4A3M K;  4A3B K;  5IP9 K;  3CQZ C;  3HOW C;  3HOV C;  2B63 K;  4BY1 C;  4KN7 A;  3S2D K;  4A3I C;  4MQ9 A;  3GTL C;  5M3F K;  3HOU K;  3H3V L;  5C44 C;  4A3C K;  2PMZ D;  3S14 K;  3RZD K;  3FKI C;  2VUM K;  4MEX A;  3M4O K;  1K83 C;  4LJZ A;  1XPP A;  2YU9 C;  4Y52 C;  4Q5S A;  3S1Q K;  3I4M C;  3GTG C;  4A3K K;  1BDF A;  1YNN A;  3M3Y K;  3HKZ L;  4A3J K;  3GTQ C;  2NVX C;  4KN4 A;  2JA6 K;  4XSZ A;  2R7Z C;  5FJ8 K;  4OIR A;  4QIW D;  2JA5 K;  4A3E C;  3S15 C;  3HOY C;  1SFO C;  3S1R K;  2R93 C;  4XLP A;  1YNJ A;  3GTO K;  1TWG C;  1Y1V K;  4JK1 A;  3PO3 K;  3GTK K;  3GTJ K;  1TWF K;  1I50 K;  4YFN A;  5IP7 C;  2NVT K;  3GTM K;  3S17 C;  3S1M C;  1Y1W C;  4BBS K;  4X6A K;  4BBR K;  5IYC K;  4A3M C;  3S1N C;  2NVY K;  1R9T C;  2NVQ K;  2PMZ L;  3HOZ K;  2Y0S D;  4C3J K;  4A3G K;  4A93 K;  1I6H K;  2JA7 K;  5FLM K;  3RZO K;  1I3Q C;  4YG2 A;  4C3H K;  3I4N K;  4XLN A;  3PO2 K;  1WCM K;  2E2J K;  5C4X K;  1TWH K;  5M5X K;  4OIQ A;  4A3L K;  4A3K C;  3H0G K;  4YFK A;  1TWA K;  2WB1 D;  5C3E K;  4G7H A;  3DXJ A;  4LK0 A;  4QIW L;  3HOX K;  4AYB L;  4A3D K;  2R92 K;  2JA5 C;  2E2H C;  4OIN A;  2JA8 K;  4NOI A;  2E2I K;  4QJV A;  4Y7N K;  3K7A K;  3S16 C;  5M3M K;  3S2H C;  3GTK C;  2A68 A;  1TWF C;  5IYB K;  3GTM C;  1ZYR A;  1TWC C;  3HOW K;  4GZY A;  3HOV K;  5IYC C;  4BY1 K;  5M5W K;  5IYD C;  4A3F C;  4G7Z A;  2NVY C;  3EQL A;  5IP9 C;  3GTL K;  3GTP K;  4A3B C;  5C44 K;  2B63 C;  4BXX K;  2Y0S L;  4LLG A;  4YFX A;  2O5I A;  3FKI K;  3HOU C;  3S2D C;  4A3C C;  1K83 K;  4G7O A;  4KMU A;  4A3G C;  4BY7 K;  3RZO C;  3S14 C;  3RZD C;  2VUM C;  2YU9 K;  3M4O C;  3I4N C;  3I4M K;  3GTG K;  1WCM C;  2E2J C;  3GTQ K;  2NVX K;  3S1Q C;  2WB1 L;  1SMY A;  4ZH4 A;  2R7Z K;  3M3Y C;  5C4J K;  4A3J C;  4A3E K;  2JA6 C;  3HOY K;  2WAQ D;  3WOD A;  2PA8 D;  2PPB A;  1TWG K;  3S1R C;  2E2I C;  3S1M K;  5IP7 K;  3S17 K;  3K7A C;  3GTO C;  4C3I K;  1Y1V C;  4LK1 A;  4C2M K;  5IYB C;  3PO3 C;  3GTJ C;  1I50 C;  4QJV B;  5D4D A;  2NVT C;  3S1N K;  4X6A C;  4BBS C;  3CQZ K;  1IW7 A;  4BBR C;  1R9T K;  3GTP C;  4BXX C;  4A3I K;  2A6E A;  2NVQ C;  2BE5 A;  3H3V D;  5TMC A;  1I3Q K;  3HOZ C;  4BY7 C;  4A93 C;  1I6H C;  4OIP A;  2JA7 C;  5FLM C;  5M5Y K; 
#chains in the Genus database with same CATH topology
 4C3H C;  2A6H A;  5L46 A;  1O2B A;  1ZXO A;  2GAG C;  3AD7 C;  1TWH C;  4A3L C;  1R9T A;  4GTL A;  2E2H K;  4AYB D;  2KWA A;  5EGE A;  3S16 K;  3S2H K;  2RGR A;  4Y7N C;  3FKI A;  3FOF A;  5IYD K;  4FZB A;  3IPJ A;  3SZY A;  3HOW C;  4BY1 C;  4C45 A;  4MQ9 A;  4A3I C;  3H3V L;  2CFA A;  3S14 K;  1VGX A;  3FKI C;  4MEX A;  1XZQ A;  5IOR A;  1XPP A;  4Q5S A;  4KC6 A;  4A3K K;  1O2F B;  5HL8 A;  4KN4 A;  5FJ8 K;  2FQT A;  3MML B;  1X31 C;  3GEI A;  3GTJ K;  1TWF K;  1I50 K;  5IP7 C;  1O25 A;  1WOO A;  5IYC K;  1J6X A;  3LAJ A;  2NVY K;  2NVQ K;  4J3N A;  3VA7 A;  3G4A A;  1F9N A;  3HOZ K;  2Y0S D;  4P5A A;  4C3J K;  1DD5 A;  4WJ3 M;  1WSV A;  3PO2 K;  3JST A;  5C4X K;  1TWF A;  4A3K C;  4G7H A;  1B4B A;  2NVY A;  2R92 K;  1WOP A;  4OIN A;  4NOI A;  2E2I K;  4QJV A;  5M3M K;  1TWF C;  1TWC C;  3HOV K;  5IYC C;  5M5W K;  4A3F C;  4A3B C;  2NVY C;  5IP9 C;  2B63 C;  2Y0S L;  4A3C C;  2R92 A;  4GT9 A;  2P5M A;  2YU9 K;  2E2I A;  1IBA A;  4GTE A;  2NVX K;  1JOE A;  3S1Q C;  1EFW A;  2R7Z K;  3M3Y C;  4KM9 A;  2E2I C;  3S17 K;  4LK1 A;  3S1N K;  4BBS C;  3FOE A;  2NVX A;  4GTB A;  2BE5 A;  2R7Z A;  1I3Q K;  3BUE A;  4OIP A;  4BKW A;  5FLM C;  1F7U A;  1HQM A;  1BS2 A;  1TWA C;  1EI6 A;  4PAA A;  2JA8 C;  2XCR B;  2O5J A;  1J6V A;  2CW0 A;  3T01 A;  3GTG A;  3S2D K;  3GTL C;  1DCP A;  3HOU K;  1J6W A;  1VRQ C;  2PMZ D;  3T00 A;  2VUM K;  3TFJ A;  1K83 C;  1USM A;  1WSR A;  3I4M C;  3GTG C;  4P9S A;  1DCH A;  1YNN A;  4A3J K;  1IQ0 A;  4XSZ A;  3V4G A;  4QIW D;  2JA5 K;  4A3E C;  3GSI A;  1YNJ A;  3GTO K;  4JK1 A;  3S1M C;  2VUM A;  1O26 A;  2NVT K;  3GTM K;  4C3I C;  4BBR K;  1R9T C;  1ISE A;  3ADA C;  2PMZ L;  4FM9 A;  4A93 K;  4KMH A;  4KB2 A;  2JA5 A;  1JVI A;  2E2H A;  2PHC B;  2E2J K;  5IOQ A;  2GSN A;  5M5X K;  3H0G K;  3GTM A;  2WB1 D;  5C3E K;  4AH6 A;  3DXJ A;  4QIW L;  3HOX K;  4AYB L;  4A3D K;  2JA5 C;  2E2H C;  4WJ4 A;  1O27 A;  3G4C A;  3S16 C;  3S2H C;  1WQF A;  5IYB K;  1INN A;  3GTM C;  1ZYR A;  3BP8 C;  4LQY A;  4O2D A;  1J98 A;  3BP3 A;  5IYD C;  4GTC A;  5C44 K;  3H0G A;  4LLG A;  4YFX A;  2GAH C;  2O5I A;  4G7O A;  3S14 C;  1WIH A;  1JQW A;  3AQO A;  4KDD A;  2E2J C;  3GTQ K;  2WB1 L;  3GTJ A;  4KMD A;  1I50 A;  2GSO A;  1O29 A;  3HOY K;  3AD8 C;  2WAQ D;  3WOD A;  4BLA A;  2PA8 D;  1TWG K;  5CHP A;  3L4J A;  1ZQ1 C;  1O28 A;  4C2M K;  5IYB C;  1O24 A;  3GTJ C;  1I50 C;  5D4D A;  1F93 A;  2V6T A;  3CAG A;  4DDQ A;  3GTQ A;  5IOT A;  1IL2 A;  2NVQ C;  5TMC A;  3HOZ C;  4C3J C;  1B4A A;  1TWG A;  2A69 A;  3PO2 C;  5C4X C;  1EH1 A;  2WAQ L;  3S15 K;  2PA8 L;  4OIO A;  2R93 K;  1VJE A;  2R92 C;  2RH6 A;  1XXB A;  4C2M C;  1I6V A;  1Y1W K;  4ILD A;  3ORE A;  2XCO A;  1USO A;  1ZVU A;  2YU9 A;  3NUH A;  2ZUE A;  1WQH A;  3HOV C;  5M3F K;  3RZD K;  3M4O K;  2R93 A;  3N0C A;  4RMF A;  4LJZ A;  3ERE D;  2YU9 C;  5JVO A;  1V5V A;  4BLB A;  1Y1W A;  2NVX C;  2JA6 K;  4KMA A;  2R7Z C;  4OIR A;  3S15 C;  3T02 A;  2R93 C;  3S1R K;  1Y1V K;  3PO3 K;  3GTK K;  3S17 C;  1I3Q A;  4X6A K;  1Y1W C;  3S1N C;  1AB4 A;  1IS1 A;  4A3G K;  2JA6 A;  1I6H K;  2JA7 K;  3RZO K;  1I3Q C;  4C3H K;  5E68 A;  3I4N K;  4XLN A;  1VLO A;  1WOR A;  1G51 A;  1Y1V A;  3GTK A;  1TWH K;  4A3L K;  4GTD A;  4LK0 A;  3TTG A;  1XXC A;  1VH2 A;  1PJ6 A;  3LAP A;  1O2A A;  2P8T A;  4Y7N K;  3QX3 A;  3K7A K;  3GTK C;  2A68 A;  3TFI A;  3HOW K;  3OPF A;  1HI9 A;  2V6U A;  4BY1 K;  3A8K A;  4G7Z A;  3GTP K;  2Y3P A;  3S2D C;  4A3G C;  2XCQ A;  3FKI K;  3HOU C;  4KMU A;  3RZO C;  1UV7 A;  2VUM C;  3I4N C;  2JH3 A;  4GFQ A;  3GTO A;  5C4J K;  4A3J C;  1EQR A;  2D6F C;  3GTP A;  2PPB A;  5IP7 K;  3K7A C;  3GTO C;  1DCO A;  2V6S A;  2NVT C;  3GEE A;  3CQZ K;  1IW7 A;  4BBR C;  3GTP C;  2A6E A;  5TJ3 A;  4A93 C;  5M5Y K;  4Y52 K;  4KAS A;  2EBB A;  3H0G C;  3HKZ D;  5C4J C;  3CQZ A;  5C3E C;  1F7V A;  3HOX C;  1SFO K;  1WOS A;  3FHZ A;  4MEY A;  5TMF A;  4A3D C;  1EK8 A;  4GTA A;  4Q4Z A;  4G0V A;  1TWC K;  4XSX A;  4A3F K;  4A3M K;  1GE9 A;  4A3B K;  5IP9 K;  3CQZ C;  2B63 K;  4KN7 A;  1XZP B;  4LOW A;  5C44 C;  3A8J A;  4G0W A;  4A3C K;  1SFO A;  1WQG A;  4Y52 C;  3S1Q K;  3A8I A;  1TWC A;  3M3Y K;  1BDF A;  3HKZ L;  3GTQ C;  3GEH A;  1IE0 A;  5JFE A;  1PJ7 A;  2B63 A;  3HOY C;  1SFO C;  4XLP A;  1TWG C;  4YFN A;  3LPX A;  4BBS K;  4KB4 A;  4A3M C;  4G0U A;  3AH5 A;  4GTF A;  3S0X A;  4PAB A;  5FLM K;  4YG2 A;  2CFA B;  5EGH A;  1WCM K;  3HXA A;  2FQO A;  4OIQ A;  1XZQ B;  4YFK A;  4LR2 A;  1TWA K;  5IOS A;  1PJ5 A;  2ZFZ A;  4M1X A;  4KAT A;  3N0B A;  2JA8 K;  4XCH A;  4GZY A;  5CJ9 A;  1WCM A;  3EQL A;  3GTL K;  4BXX K;  3GDZ A;  1TWA A;  3TFH A;  1YX2 A;  1K83 K;  1C0A A;  3SZZ A;  4WIL A;  4BY7 K;  3RZD C;  3M4O C;  1YCL A;  1KQ4 A;  3I4M K;  3GTG K;  1WCM C;  3N3Y A;  1SMY A;  1RU0 A;  4ZH4 A;  3OEP A;  2GSU A;  1XXA A;  4A3E K;  2JA6 C;  3GTL A;  2ZUF A;  1BGW A;  2W7V A;  3AD9 C;  3S1R C;  3S1M K;  3GIR A;  1K83 A;  4P5B A;  4C3I K;  1Y1V C;  1L0W A;  3PO3 C;  2JA7 A;  1BJT A;  4QJV B;  4X6A C;  1XZP A;  1R9T K;  3AQP A;  4KAR A;  4BXX C;  4A3I K;  1TWH A;  4KAW X;  4KM8 A;  3Q3Q A;  3H3V D;  4BY7 C;  1I6H C;  1ZBS A;  2JA7 C;  3L4K A; 
#chains in the Genus database with same CATH homology
 2A69 A;  4Y52 K;  1HQM A;  2A6H A;  3PO2 C;  5C4X C;  1TWH C;  4A3L C;  3H0G C;  3HKZ D;  5C4J C;  1TWA C;  2E2H K;  2WAQ L;  5C3E C;  4AYB D;  3S15 K;  2PA8 L;  4OIO A;  2R93 K;  3HOX C;  1SFO K;  4A3D C;  4MEY A;  5TMF A;  2R92 C;  3S16 K;  2JA8 C;  3S2H K;  4Q4Z A;  4Y7N C;  1TWC K;  2O5J A;  1I6V A;  1Y1W K;  4XSX A;  2CW0 A;  5IYD K;  4A3F K;  4A3M K;  4A3B K;  5IP9 K;  3CQZ C;  3HOW C;  3HOV C;  2B63 K;  4BY1 C;  4KN7 A;  3S2D K;  4A3I C;  4MQ9 A;  3GTL C;  5M3F K;  3HOU K;  3H3V L;  5C44 C;  4A3C K;  2PMZ D;  3S14 K;  3RZD K;  3FKI C;  2VUM K;  4MEX A;  3M4O K;  1K83 C;  4LJZ A;  1XPP A;  2YU9 C;  4Y52 C;  4Q5S A;  3S1Q K;  3I4M C;  3GTG C;  4A3K K;  1BDF A;  1YNN A;  3M3Y K;  3HKZ L;  4A3J K;  3GTQ C;  2NVX C;  4KN4 A;  2JA6 K;  4XSZ A;  2R7Z C;  5FJ8 K;  4OIR A;  4QIW D;  2JA5 K;  4A3E C;  3S15 C;  3HOY C;  1SFO C;  3S1R K;  2R93 C;  4XLP A;  1YNJ A;  3GTO K;  1TWG C;  1Y1V K;  4JK1 A;  3PO3 K;  3GTK K;  3GTJ K;  1TWF K;  1I50 K;  4YFN A;  5IP7 C;  2NVT K;  3GTM K;  3S17 C;  3S1M C;  1Y1W C;  4BBS K;  4X6A K;  4BBR K;  5IYC K;  4A3M C;  3S1N C;  2NVY K;  1R9T C;  2NVQ K;  2PMZ L;  3HOZ K;  2Y0S D;  4C3J K;  4A3G K;  4A93 K;  1I6H K;  2JA7 K;  5FLM K;  3RZO K;  1I3Q C;  4YG2 A;  4C3H K;  3I4N K;  4XLN A;  3PO2 K;  1WCM K;  2E2J K;  5C4X K;  1TWH K;  5M5X K;  4OIQ A;  4A3L K;  4A3K C;  3H0G K;  4YFK A;  1TWA K;  2WB1 D;  5C3E K;  4G7H A;  3DXJ A;  4LK0 A;  4QIW L;  3HOX K;  4AYB L;  4A3D K;  2R92 K;  2JA5 C;  2E2H C;  4OIN A;  2JA8 K;  4NOI A;  2E2I K;  4QJV A;  4Y7N K;  3K7A K;  3S16 C;  5M3M K;  3S2H C;  3GTK C;  2A68 A;  1TWF C;  5IYB K;  3GTM C;  1ZYR A;  1TWC C;  3HOW K;  4GZY A;  3HOV K;  5IYC C;  4BY1 K;  5M5W K;  5IYD C;  4A3F C;  4G7Z A;  2NVY C;  3EQL A;  5IP9 C;  3GTL K;  3GTP K;  4A3B C;  5C44 K;  2B63 C;  4BXX K;  2Y0S L;  4LLG A;  4YFX A;  2O5I A;  3FKI K;  3HOU C;  3S2D C;  4A3C C;  1K83 K;  4G7O A;  4KMU A;  4A3G C;  4BY7 K;  3RZO C;  3S14 C;  3RZD C;  2VUM C;  2YU9 K;  3M4O C;  3I4N C;  3I4M K;  3GTG K;  1WCM C;  2E2J C;  3GTQ K;  2NVX K;  3S1Q C;  2WB1 L;  1SMY A;  4ZH4 A;  2R7Z K;  3M3Y C;  5C4J K;  4A3J C;  4A3E K;  2JA6 C;  3HOY K;  2WAQ D;  3WOD A;  2PA8 D;  2PPB A;  1TWG K;  3S1R C;  2E2I C;  3S1M K;  5IP7 K;  3S17 K;  3K7A C;  3GTO C;  4C3I K;  1Y1V C;  4LK1 A;  4C2M K;  5IYB C;  3PO3 C;  3GTJ C;  1I50 C;  4QJV B;  5D4D A;  2NVT C;  3S1N K;  4X6A C;  4BBS C;  3CQZ K;  1IW7 A;  4BBR C;  1R9T K;  3GTP C;  4BXX C;  4A3I K;  2A6E A;  2NVQ C;  2BE5 A;  3H3V D;  5TMC A;  1I3Q K;  3HOZ C;  4BY7 C;  4A93 C;  1I6H C;  4OIP A;  2JA7 C;  5FLM C;  5M5Y K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...